The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
157
|
structure length |
157
|
Chain Sequence |
SLSPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVYGGEKGAYLFLVSGKNRLDLGKATRLVGGPLLEADKWAVAALTGFDAGGVPPVGHNTPLPAYLDEDLLGYPEVWAAGGTPRALFRATPKELLALTGAQVADLKEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
De novo protein
|
| molecule keywords |
SC_2cx5
|
| publication title |
Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
pubmed doi rcsb |
| source organism |
Thermus thermophilus
|
| total genus |
38
|
| structure length |
157
|
| sequence length |
157
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2011-04-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04073 | tRNA_edit | Aminoacyl-tRNA editing domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | YbaK protein | YbaK/aminoacyl-tRNA synthetase-associated domain |
#chains in the Genus database with same CATH superfamily 2Z0K A; 1WDV A; 1VJF A; 3RI0 A; 2J3M A; 3OP6 A; 2DXA A; 2Z0X A; 3RIJ A; 2J3L A; 1DBX A; 1DBU A; 3MEM A; 1VKI A; 2CX5 A; #chains in the Genus database with same CATH topology 2Z0K A; 1WDV A; 1VJF A; 3RI0 A; 2J3M A; 3OP6 A; 2DXA A; 2Z0X A; 3RIJ A; 2J3L A; 1DBX A; 1DBU A; 3MEM A; 1VKI A; 2CX5 A; #chains in the Genus database with same CATH homology 2Z0K A; 1WDV A; 1VJF A; 3RI0 A; 2J3M A; 3OP6 A; 2DXA A; 2Z0X A; 3RIJ A; 2J3L A; 1DBX A; 1DBU A; 3MEM A; 1VKI A; 2CX5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
