3RJMA

Caspase2 in complex with chdi ligand 33c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
b'LQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-2
publication title Exploiting differences in caspase-2 and -3 S(2) subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rjmA00
2H5IA 2HBRA 2XZTA 2QLJA 3V3KA 3GJSA 4ZVSA 2XYGA 4ZVUA 3V6MA 4I1PA 1SC1A 1NMQA 2XYHA 5H0IA 4NBLA 4QUJA 3R7NA 3PD1A 1RHQA 4NOKA 3KJNA 5LU8A 1RHRA 2QL5A 4ZVRA 1GQFA 2CNOA 2H4YA 1F1JA 1F9EA 3GJRA 3H11A 3NS7A 4QU9A 3BIJA 3RJMA 3V6LA 2J33A 2C1EA 4EHHA 4NOJA 2J32A 3D6FA 3IBFA 3V4OA 5JFTA 5I9TA 4NOMA 5IAKA 4IYRA 4QUEA 1NW9B 2C2KA 4IEFB 4N6NA 2H48A 2AR9A 5IASA 2H5JA 3R5JA 4N7JA 2QL9A 1RHUA 1NMSA 3EDQA 4I1RA 4EHNA 3GJQA 5IC4A 3OD5A 2QLBA 3D6MA 1IBCA 2HBZA 3GJTA 1ICEA 2J31A 3EDRA 3PCXA 3R6GA 2FQQA 1GFWA 4QUHA 3H13A 4JR1A 2CNLA 4JR0A 4PS0A 4FDLA 1RWMA 1QDUA 2H65A 4EHFA 4QUIA 2HBQA 3H0EA 5IANA 4D3XA 3E4CA 5LUBA 2DKOA 5IAEA 4AWAA 3DEJA 4AW9A 4N7MA 3DEHA 3S70A 3DEKA 3NKFA 3V55A 4QTYA 5LU9A 5IAGA 2Y1LA 4AWBA 4DCOA 1CP3A 4EHAA 1CVRA 3P45A 4JJEA 4JQZA 4QTXA 2CJYA 4QULA 1BMQA 2H54A 3R7SA 4D3ZA 3R5KA 3R6LA 3ITNA 3V4LA 4QUAA 3UOAB 5IBCA 3R7BA 3KJQA 2CDRA 3NR2A 1NMEA 1RWKA 3IBCA 5IBPA 3DEIA 4QUGA 3KJFA 1RHJA 4PRYA 1RHMA 4ZVPA 2C2OA 3P4UA 5IAJA 1JXQA 4QUDA 3SIPA 1RWNA 5K20A 4DCPA 3D6HA 2P2CA 1K88A 1I4EB 2WDPA 4JJ7A 2HBYA 1SHJA 4JJ8A 2H51A 1I3OA 4JB8A 4FGUA 4EHKA 3PD0A 4LSZA 2XZDA 4PS1A 3UO8B 5LUAA 2CJXA 4N5DA 1RWOA 4ZVTA 2XYPA 4NBKA 3S8EA 1I4OA 3H1PA 1K86A 4HQRA 4EJFA 4JR2A 4QU8A 4FXOA 2QLFA 1PYOA 5IABA 4HQ0A 4NOLA 1RWPA 2FUNB 4EHDA 1RHKA 4QU0A 4NBNA 2H4WA 4ZVOA 5I9BA 5IARA 3QNWA 4N6GA 1M72A 3SIRA 4PRZA 4HVAA 4JQYA 1SC3A 4QU5A 4DCJA 1RE1A 2NN3C 5IBRA 1RWWA 2CNNA 1PAUA 2QL7A 2CNKA 2C2MA 3K7EA 4D3YA 4N6OA 1QTNA 1KMCA 1RWVA 2J30A 3H11B 1QX3A 4FEAA 4ZVQA 2Y0BA 4EHLA 5IC6A 1RWXA 2K7ZA 1SHLA 1I51A 2C2ZA 4QUBA 4M9RA 1SC4A 2FP3A
chains in the Genus database with same CATH superfamily
5CG1A 4ERXA 1WF6A 4F2HA 2HEIA 1I7SB 1W5SA 3HXTA 4XUCA 3SBOA 3SJ7A 1PJ4A 3VYRB 1PW7A 1A9OA 3MQFA 1ML3A 3NOVA 4EEXA 1JIIA 4H1TA 1TUBA 1IE3A 3A4LA 1W85B 1F2UB 3FETA 5AK6A 3ZE7A 4IGAA 1EVQA 1BFKA 4XWOA 3V8QA 5MGBA 1QAMA 1YACA 1VRWA 3KOZA 2Q5LA 4X00A 3AVUA 1F48A 4HCJA 4IJQA 1YQEA 4JLAA 2JFWA 5C35A 3M7IA 1EG2A 4EA8A 5JXWA 1RBYA 3ZOKA 2R2AA 4ENSA 2GCGA 3RUPA 2F62A 3LUBA 3TQCA 4IFTA 5KX5B 3L7YA 3ND7A 4L0QA 1P7CA 3BC1A 3ILSA 1ZA2A 3KNZA 2QR3A 1CS0B 2IODA 1XP8A 2VOJA 3BJIC 5FPYA 2R6R1 4PLYA 2HDWA 4NECA 1G9SA 5F2EA 1EX1A 5JSHA 5AM3A 4EY4A 5JZOA 5FAXA 2G5CA 1TYBE 3FLBA 4CR6A 2IZ6A 5BR1A 1H3NA 1WMDA 3EQZA 1F8GA 1V47A 2C00A 2OSVA 2NSDA 3HSKA 3TI7A 5HKKD 2FFAA 5TSDA 5DHFA 5KYYA 4CTNA 3THYB 4GS5A 1L5HA 4U9UA 1VXOA 2OBMA 3ISVA 1ODKA 3RBXA 3OOJA 3ICCA 4EEKA 2V45A 1BYUA 1QOQB 3QU9A 2ZYAA 4HUTA 1HE3A 3CM0A 3IDSA 3JAWB 5KNCD 2NU9A 3M49A 4JQCA 3WQQA 5BMVB 5DJ5A 4F93B 5DBEX 5KI6A 2VJYA 4HDMB 1Z9BA 2GSDA 1JVSA 3CO5A 2AWNA 4FZVA 3ZQUA 1W48A 2GZHA 2YV1A 1UMBA 4M9CA 1RD4A 4U63A 3T94A 3V4SA 3WLLA 1Q20A 4EJ2A 2H29A 4AKGA 5A4IS 5JCXA 1N8SA 2XWQA 2QN6A 4D5GA 3TWOA 3IQGX 2H3EA 1J9EA 2FEPA 1NBIA 1DNPA 3CJRA 1V5WA 1HZZA 3LT0A 4R2JA 7REQA 1ZA1A 2FZCA 2J3EA 3VVLA 4UJ5A 1ZRSA 3D7KA 2HRZA 4BQOA 5HUQA 1EX6A 3EA4A 4MUIA 4OGWA 4W1RA 5EHXA 3HB0A 1HDEA 2FW1A 5HF8A 1DX4A 1ENOA 2QLFA 4IGEA 4AS3A 2AOUA 3COYA 4Q3LA 2R5WA 3ZQJA 3RKRA 1OI3A 5A5FA 1H6DA 4M60A 1Z28A 4L4SA 3U9SA 3WDKA 1O97C 3L5KA 4UTOA 3RT7A 1RKVA 5ECGC 4DA8A 2R5FA 3C39A 2QE6A 5TQJA 4OAQA 3L1HA 4MV6A 2TECE 3WJAA 4M9SA 3H8SA 4RGVA 1R18A 4N8DA 2BCGY 2VG8A 5CX4A 1WVMA 3WGHA 1RWVA 3M82A 5M7EA 1MFZA 1XVTA 1Z0ZA 2K6GA 3Q9SA 4B6OA 4I9NA 4R51A 2VPWA 3E35A 3GT3A 4HWOA 4ZIRB 5K0TA 4PR3A 3FTFA 2GBGA 1GZ6A 4RLFA 4B7XA 1POWA 4Q3OA 3S2UA 1BN6A 1AKRA 3WGZA 1I5EA 2MSDB 1UJMA 2NNLD 2VRWA 4EKEA 3OPNA 1YXMA 1QYDA 5K1ZA 4KOEC 4LY9A 2X15A 1NQOA 2Y9PB 2VYND 3BK2A 2QX7A 4PTYA 3FUCA 3T34A 1RBZA 3HFSA 1TM5E 2H31A 1AN9A 4TXJA 1DC8A 1PR1A 4CQMD 4AY2A 2QI9C 4IJ6A 4I6GA 1ZWLA 3COJA 3G1WA 4YY3B 1Z08A 1NXWA 2X7HA 2H0AA 1I36A 5CU7A 2PVPA 1A1SA 3KR1A 1KJYA 3SEQA 3SE0A 2FSSA 3RUIA 3UKJA 3CIOA 2FRXA 1CXZA 4I08A 4FKMA 4PLCA 1JLLB 4OX9Y 1EFRD 3P96A 2HNAA 4Q9IA 5KMGA 2C0QA 3OSZA 1DWQA 2HJWA 4NCJA 4WFQA 2QN2A 3VV2A 3ETLA 3FPSA 2WVGA 5EXEA 2AL7A 2G83A 4RFSB 4XQ9A 3ZXIA 3LBYA 4CEJB 4OQFA 3HB1A 4UDNA 2R8ZA 1QRDA 1DU4A 1WUIS 1R88A 2RH4A 4WERA 2GKGA 3IAS6 3R2JA 2BGTA 4UMDA 1HZJA 4YXWA 3A2KA 2PSJA 3BS4A 1RXCA 1IPEA 2MOKA 3H05A 1WO8A 4CLRB 4BTEA 4LOIA 4EJMA 1H8HD 1TC1A 5IW8A 2BFCA 4CLOB 2OVBA 2ID9A 4KPFC 2WSMA 3DAOA 3ZR4B 2C4VA 3ZWKA 2YZNA 4EFDA 1WUYA 3D0KA 1RLUA 2VSQA 4IJUA 3QPBA 2QIPA 1KJIA 1NQAO 1PK8A 2IC5A 3KYCA 4RIEA 5G3YA 2LUOA 3ANSA 2YV2A 3BTSA 1GT6A 3M9LA 4O4HF 1P4SA 5JXJA 6ABPA 4QFDA 1GZUA 1RBQA 4DZTA 4I1OA 2G67A 3GELA 4CHGA 2HJVA 4NPHA 3TAXA 2IPMA 2C07A 1Q6YA 5KKCA 3VU8A 4GP7A 1W44A 4PF1A 4LE2A 1RM4A 4GOLD 1PZHA 1QH1A 3C4JA 4XB2A 2C8VA 2PRSA 3VUEA 4E0BA 4ZFNA 4K9SA 4EG0A 4D9GA 3K9NA 3GEGA 1LBTA 4RO0A 2BC9A 4A2WA 5ICGA 2ZI5A 3E2MA 4BMOB 3OMLA 3F74A 3PPYA 4RWEA 2IUTA 2EQBA 1QYXA 1PWZA 3AHCA 3I6ZA 2WFZA 1O2DA 3RTCA 4Q4LA 3O92A 4I4TF 4LISA 5KTRA 1KY3A 5KYUB 3TIFA 1W34A 1G19A 5KSOA 2JI9A 2QTNA 3UA4A 1RLMA 4YJ3B 4BAGA 2UZIR 3L6CA 3DLBA 3B3AA 5LP6C 3WC4A 2DG2A 2PLNA 1RQ2A 1BFUA 3L1UA 3I12A 2IEZA 3C5HA 4BXOA 4EYEA 4LC9A 3PFWO 4INJA 2KJQA 4DMCA 4EW2A 3GJYA 2WP0A 1FX0A 4MYSA 2HSGA 3EVDA 1U1EA 4U00A 2EHJA 1VHTA 2JDIA 4QOSA 2NO1A 4FC6A 4AP5A 5DHSA 1K8ZB 3PLNA 2Q5OA 1ZK4A 1U8YA 4F5ZA 3E0XA 1N2OA 2IYEA 1U2RA 3THWB 3UK0A 1L7VC 2FEKA 4PN7A 1UKBA 5I7HA 3E8XA 1N3IA 3HO8A 3V1NA 1JU9A 2H0QA 3BB3A 4ZPJA 4BWGA 3VYSB 4AO8A 5H9WA 2ZRNA 2GYWA 1ORVA 2OO7A 2GJ8A 5LB4A 2ORED 3AVVA 3W34A 3ON5A 1KZ9A 1BHO1 5EQFA 4MCAA 3C3PA 2Q4TA 3ES9A 5F64A 1QQTA 2IVZA 3H9BA 4CCYB 3AR4A 1H3EA 1R10A 5EXSA 5CITA 5KQLA 1H2AS 1KERA 2ODAA 3AR2A 2I29A 4L4ZA 5G0TA 4ZEMA 3LQYA 2AMJA 1M2NA 2E9SA 2CHQA 3O1LA 1MAVA 2YHSA 3QNMA 5LFAA 1JLHA 1OXSC 4CF7A 2W22A 3LXUX 3I9LA 1EFKA 1YR7A 3NKVA 5KYWA 1B23P 1J8FA 3BIWA 3IDFA 2AVDA 1R4MB 2GN9A 1FTWA 4KYVA 4OIFA 5FKJA 3MF4A 3FYDA 3VA7A 3GI1A 4C43A 4ILKA 4C05A 4EKDA 2R4TA 4YCLA 2PSHA 3UHPA 2FW9A 3CJTA 4JMLA 4DNOA 4QOJA 4OMFG 5IJWA 1IBCA 1T5DX 5DHTA 4QUHA 4L78A 4UFNA 3JQ8B 2AOTB 3TX6A 3PFKA 4GEKA 5B1SA 4NCKA 4KXVA 1VL8A 4JCOA 4JROA 4NU8X 2DULA 2C9ZA 2DPHA 3B6KA 3MMXA 2R8RA 3ZDCA 3IUPA 5GVRA 1V9LA 1IJBA 2EDAA 1ZW6A 3ODGA 4PPNA 1T9ZA 2XECA 1THMA 3HUTA 4PGGA 2FXVA 3V9AA 1H2ZA 4PBRA 1TD9A 3ROZA 1J7KA 3D3KA 3E5RA 4ZQCB 5AXAA 3NBQA 4ENUA 3ORHA 3W7AA 3GRKA 4B8YA 1JE1A 2P35A 1DBSA 5D3MB 2QP3A 3ZJUA 3TUJC 3MXOA 5DRTA 3ZY2A 4F2PA 5B6IA 1OTYA 4ID3A 3CWZA 5JV5A 2HPHA 4EM6A 5DTJA 1A77A 1VGRA 2RIPA 4QPCA 1ZU4A 3HM2A 4MS3B 4YAUA 2F8LA 4JLMA 4R4JA 4RTLA 4M83A 1HLDA 4ON9A 1NXTA 1U0TA 1UC8A 2ZVJA 4A1OA 1QCDA 3RU2A 2VHWA 3KC2A 1MMFB 1F2TB 4IUDS 4ZI2A 4XCXA 2JD0A 1DQRA 1JIUA 4PSKA 2YOGA 4MYTA 1ABBA 2D06A 1ISRA 1QH8B 2FEAA 3L79A 4LS3A 4PS1A 1NT4A 1SHTX 3NGXA 3OQ1A 2UYCA 1TUIA 2WG2A 1F4LA 1RE0A 3UGJA 4ARZB 3BULA 4X20A 4QJ5A 1Y81A 3G59A 2SHKA 3SBXA 3UH1A 4C87A 4F4FA 4IVQA 4LV6A 4FOSA 1N7GA 3GEMA 1WV0A 1NG9A 3NG1A 1EM8A 2OZLA 1R3UA 4KN6A 3BMQA 3MCVA 1SUWA 1E7SA 2FX3A 4A0RA 2JCVA 1Z16A 3GUUA 4GG1A 3EA5A 2IJGX 5TS2A 2E48A 4WHMA 2MTBA 4Q7JB 3TDNA 1U1FA 3EAGA 1YB5A 4LYEA 2CNKA 1IRIA 3PUHA 5E7JA 1YR6A 5L3RA 3VJRA 1E2PA 1NVKA 4J49A 1SUDA 4UD2A 4S0XA 3M6AA 4BQIA 1CDOA 1TU0A 1KS2A 2REBA 3QEMA 2O2YA 4ZV4A 2Z2JA 5K6TA 2Y0BA 3N86A 3LPCA 5KTTA 3NOXA 2CEKA 2FOIA 1PVOA 3FBWA 2EU8A 3UV6A 1TKCA 3PLRA 3RSSA 2WWRA 2R87A 1KS9A 1K8YB 3ZQ6A 4Z99A 1EUQA 3Q9NA 3HHEA 4IQ0A 3O4JA 4MVJA 5AKYA 4REOA 5A3JA 1JDVA 3CYFA 1NRXA 1OLUB 1QORA 1UBFA 2A0UA 5LA6A 1JV2B 2WA1A 5E4YA 3AI7A 4AD8A 4V0NA 2KB0A 3D7SA 3TIIA 2P0AA 1HA3A 4MWZA 3ZHBA 4DBLC 1Q0PA 2RGEA 2F43B 3BD9A 3OFJA 4GL4A 1UXKA 1YJ8A 4UCFA 1NQXA 3H9GA 4HQNA 5DYGA 1FDIA 4LX8A 4UPVA 3PTAA 1RADA 2AXQA 2PKRA 2BFOA 4QU9A 3T9CA 1E98A 3N87A 3UV3A 4DQUA 1XMOB 3AILA 4XGKA 4WQMA 5JFTA 2C2BA 1SOMA 3C48A 3CWQA 2PRIA 3FFWA 4M1SA 4MI9A 1BJRE 1XZ8A 4WFIA 2ORIA 3DM9B 2MR6A 1JJVA 1LQTA 1CLUA 4JLUA 2HPZA 5IASA 5AVYA 4JT9A 4ND8A 4YC7A 4RGYA 2I2FA 2IE8A 3IUBA 4Y6OA 1FXWA 4GWLA 2W4MA 5K0EA 1UOQA 3KKQA 4MWGA 4LX0A 5BNZA 3RSFA 1WPRA 3LTNC 4KQGA 3MT7A 1E2GA 1W85A 3FKSD 1DELA 3VYVA 3GGDA 4GGOA 3W9SA 4G9EA 3WYBA 5MN6A 4K6KA 4YJGB 4V1CB 2F3SA 2EQAA 4MW9A 3VC2A 2BRUA 2W2MA 1P33A 4PCLA 4D8VA 1JQJC 4W9NA 3QIVA 2OKCA 1P1HA 2RHRA 1M0SA 5AUQA 3CUSA 2HUPA 4H4EA 3WQRA 4PAGA 1NVVQ 2M6RA 1MIOA 1U7TA 4YO7A 1XL1A 2B7BA 2YS7A 2Q1YA 3PNYA 4MQBA 5ALSA 2LE0A 2OCBA 2VJQA 3F6YA 4FBLA 3T7IA 2OQVA 5CAEA 4BFTA 4IIYA 1ORDA 2P9TA 3I04M 1CS0A 2D5BA 2I4TA 1O97D 3PWZA 4IZIA 2UYYA 4J0HA 4QC2A 4V38A 4A6DA 1ZUNA 3JQBA 1EIWA 1CC1S 3KUCA 1M3SA 1Z5UA 3E9CA 2OCDA 4TLMB 3I2YX 1O6ZA 4RPIA 1NNEA 1ML4A 1JXQA 2V7BA 3FLEA 2ZE7A 3L8FA 4MGEA 4FDVA 2IV2X 4P7GA 4Q82A 3BT7A 5L6MB 1LPNA 4UREA 4IW3B 4ABYA 2WDPA 3FPBA 1GAJA 3B20A 3KHUA 5G53C 5A3QA 1NJ6A 5AI5A 1VSBA 4OJKA 2IHBA 4L2IA 5K8UA 1HGXA 1GEGA 3FDZA 3THYA 1IHDA 2JFPA 4I9GA 4PTZA 3BX1A 4C6TB 2Q7OE 4Y2PA 4ZQGA 3W1WA 4IDEA 3PCRB 3RCBA 1SBIA 1J0AA 1NDHA 3JAWA 2G1PA 3P7MA 4INOA 5BMVA 4TWAA 2L17A 5FBHA 2X6RA 4HFNA 2BP7B 1P0FA 2JAWA 3FOBA 4KLZA 5KZMB 1VTKA 3TW8B 4IXDA 4NDNE 3VFDA 4B6JA 4CMIB 1UODA 1HK7A 3LAWA 1X7ZB 1Z0SA 2F3UA 4B85A 1A5AB 5KIAA 3QSYA 2Q1UA 2WJIA 4Z3DA 2D0OB 3C4VA 3DYIA 4JDPA 3G0DA 4ND1A 2IVFA 3GGOA 2EFDB 1PBNA 3JQ7A 5BNFA 1LTKA 1TZMA 4GI7A 5D5HA 4KRXA 3G5UA 3OQJA 3U3JA 1ZIDA 1HTBA 1OV4A 1WZNA 1QIFA 5E0OA 3T1YB 3LLMA 3CKYA 2VQ3A 5GAJA 4C4AA 3RS2A 3N53A 1II9A 4G9BA 4L5IA 2WHQA 4ZVUA 2A5JA 3UNXA 1IWOA 2KLHA 5BV7A 2JHCA 1YRWA 2VJNA 3DW1X 1RWBA 4WK4B 4WUVA 2MCFA 4MS1A 3RVRA 1XWFA 3W0LB 1DC5A 2EKPA 2KLBA 3UUWA 1F8UA 3WMRA 4DLPA 5HJEA 4V0SA 3OPVA 4BKRA 1NYLA 1RYDA 3ED5A 2W2OA 4QBTA 4NYJQ 5KVCA 2JVKA 4O0MA 4ZIRA 1U9IC 1ZXBA 2MWMA 2VKQA 4M8IA 4MITA 3ZK8A 1CJVC 1W2GA 5AJUA 1TFUA 4BX2A 2HIHA 1PRYA 3AP2A 4LVCA 4IIJB 5LYJA 3E61A 4IAOA 2PX3A 1UC5B 5INTA 2OFFA 2NOAA 3FX2A 3K2QA 5G40A 4ARAA 1LK0A 3U4IA 3UMSA 1WXQA 4QAJA 2XXJA 1RVDA 1EWRA 4EVQA 1ZPDA 4LOHA 7GPBA 3RROA 3PPIA 3EXHB 1K9VF 1S4QA 4Q34A 1MG0A 4NDZA 1FXSA 4ZT5A 3SE7A 4KBFA 4MR9B 2GK6A 3CA8A 2PIAA 1RTTA 2PWPA 3DEKA 4LGVA 1I01A 3BD6A 3ORRA 4E07A 2I33A 3KM0A 4JS0A 2WAXA 3NIBA 1YRLA 2BCJQ 1Q1BA 3G3EA 4Q1AA 2IEYA 3PGLA 2PZJA 3HKBA 4M9QA 5C0OE 2QSZA 5F73A 4D4GA 5DNCA 4FZJA 2NYVA 4OK5A 4JI1B 4BFZA 1BHSA 1CY7A 3MJCA 3WO1A 1N2HA 1JG4A 3HBNA 1V8OA 3RSZA 4CEJA 3GT0A 4MKXA 4BB0A 1O6BA 5BR7A 4GYKA 4J1TC 4WKCA 3E2PA 3WNDA 3DMGA 1JG7A 1XEWY 5EE9A 2RK6A 3UIEA 1F60A 5MHTA 3P20A 1KVSA 5IAJA 3V2HA 3OC0A 3C8HA 1N2BA 1IOVA 2QN3A 2X0IA 4LPKA 3CPHA 2BPOA 4CLRA 4RUKA 3DTVD 1O03A 3FCUB 2IWHA 4I66A 4I4CA 3GFRA 4OQQA 2GESA 4ECAA 3VKFA 3VISA 3WB9A 1NURA 3IV7A 5B30A 4MPJA 4S2UA 4BFXA 4QSHA 4KO2S 3DVQX 1DE0A 1COWA 2H85A 2HZ7A 2WTEA 4O2AF 3BJZA 4GO1A 3CUVA 4MVJP 2X2OA 3RG2A 1DZIA 4ZXPA 3PJEA 1N6NA 3UXHA 2OV3A 1GQSA 2N75A 4PNEA 2RGRA 3HKDA 5JVDF 1B7GO 1BHJA 2Y6VA 3VDRA 3VDMA 2WT4A 3FZNA 3R8XA 3UAVA 2Q2OA 2VSXA 3KVOA 1TTTA 4FT4A 1P3JA 1XD9A 3UW3A 3HJTA 2VZLA 5ICFA 3N9IA 1NP6A 4K81B 4J1NA 1SEPA 5CA1B 1OT5A 3C5EA 1JR4A 2WILA 4MB0A 3JAMA 2VCHA 1JA0A 4I6JA 3TLEA 2WZBA 1KHTA 5T7BA 1BYIA 2FR1A 1QTNA 1ZD2P 2HHCA 1X7XB 3H11B 1T4MA 2PGIA 3IVRA 2R48A 2HQOA 3DHVA 2P9FA 3K16A 3ORQA 4KYTA 2ZPAA 1R2QA 2I6GA 1FIUA 2XQIA 5KYUA 3EULA 4Q4JB 3SHQA 4DXHA 1DP4A 2CNDA 4Q7EA 2OT3B 2W83A 5ELXA 2OSBA 1D7AA 1VJRA 2ZRLA 4YJ3A 2YIJA 2C7OA 1VDZA 1VKHA 1E1MA 1GPMA 1XLTC 2C2XA 4XM0A 2HNBA 4Y30A 3T9DA 3UFXA 3QOYA 2I80A 4JUCA 2PKEA 4F86A 2LKDA 2OV4A 2GMWA 1M6NA 3AJDA 3MRTA 4GPAA 4DV6B 4TMWA 2YHUA 1UMKA 3FWKA 2B1IA 3IKVA 4AQ7A 3THWA 2VHXA 1SFRA 1IPHA 1NXOA 5COAA 3C87A 1F9EA 1IY2A 2IX9A 3AL2A 1EB9A 5B7PA 2VXBA 3KZKA 1QKJA 5BXQC 1ZMTA 1IN8A 4TVKA 1YU9A 4FN5A 1AZSC 2GDZA 3CURA 4IQGA 3ETCA 1A88A 1PLJA 3LP5A 3Q5GA 4R71A 1L4FA 2G07A 4I1RA 4UBNA 5FUQA 1KJJA 2ZJ2A 1N6OA 2IOFK 1AMNA 4PX5A 1DIOB 4LHEA 3I4CA 3PXUA 4C4XA 3FSGA 4W8GA 2ZOSA 5HDBB 4Z1MA 3M5WA 1PF7E 3H17A 3H1EA 4G0NA 1Q0HA 4JR1A 1Q7TA 3T5GA 4CCYA 2ZIEA 1VA5A 2JIMA 4AS1A 4S1OA 2GEDA 3DULA 3RU3A 1CK4A 4D3XA 4M0DA 2GGSA 3HCRA 1HPLA 3NI2A 3PK0A 2A7XA 4B6PA 4JWTA 1CY0A 3DZDA 3RS4A 1T9BA 3FPGA 3K92A 3TM5A 1IUNA 4MLCA 4ZTZB 5JARA 4XQEA 2PT6A 1GU7A 1C8VB 1E5XA 5HBGA 2FG6C 4RM2A 3PX7A 2PX0A 3CSUA 3I4FA 4HUQB 1R4MA 4X0EA 2W0MA 5AJWA 4D8YA 1TIBA 2DERA 5I6DA 4WLOA 3ZGXA 2GPTA 4Q7MB 4L5JA 5ITWA 2FG7C 3FI0A 1EWVA 4B43A 3OEHD 4BBJA 3E81A 1L8LA 1RW4A 4H1VA 3IV6A 1ZD4A 4B6GA 1MZVA 3JQ8A 1PZNA 2AOTA 3BL5A 3VZBA 1YHYA 4PSDA 3EY9A 3O5AA 4M3NA 3UT0A 2PL3A 2COKA 3JQ9C 2JLBA 1JR3E 3V1MA 3TN7A 1P6UA 3WFJA 2XB6A 4G85A 1R12A 3GEEA 4RS4A 1EWKA 1GVNB 1X2EA 4Y6QA 2REQA 4H6VA 3KSBC 2VZ9A 5LZ9A 1VJGA 1JAIA 1Z37A 2JIPA 2B7CA 2NZ2A 3EVCA 4UAUA 1EINA 3VZDA 1QFJA 2V6GA 1BGXT 3JWJA 2PIDA 2FN4A 4KQJA 4LVUA 4TX1A 4C6SA 4UDXX 3FMFA 2B20A 3FAZA 4WLFA 5JIBA 4ZMBA 3HV0A 1RP7A 1XVUA 5KNBA 4DMHA 4Q3EA 3D5EA 1LI5A 3CLHA 1I13A 1QVWA 1V43A 3PGJA 2NO5A 2JW5A 5AICA 1KWGA 2HA2A 4MLZA 3S2GA 2NQ8A 1U2SA 2FQWA 4H60A 4MVXA 4EY3A 1ZUHA 1U1IA 1LK5A 3Q2KA 4CBVA 3LKBA 3QKRB 1ZRHA 3WLAA 1NZJA 1DO8A 1QH8A 4ZPXA 3UAYA 1TQ6A 1ZN8A 1DXQA 4MYRA 5JC1A 4ROSA 2HX1A 4RA6A 4XEHA 1QV7A 2WHXA 3LM8A 3ZWDA 2P69A 1VLQA 3NX4A 1O1YA 3GNLA 4JLBA 2VP9A 4YAFA 4UAGA 2R66A 4X93A 3SVZA 1G5FA 2R11A 2G28A 3VSEA 1A7KA 2HXYA 2VHTA 4MW7A 4EAAA 4KR7A 1VMEA 4E5UA 2AWOA 2XVYA 2J8ZA 3B8HA 4X1OA 1R0XA 1XEAA 1O8CA 2F9LA 3KB1A 3QPWA 1PSZA 2C95A 2BKLA 2GPBA 5AM2A 4X6UA 2H9AA 2CHGA 2W9XA 4EUNA 2X5KO 4OQNA 4DWWA 2BMDA 1KPHA 2OAGA 3HRHA 3L0DA 4BS9A 2QMOA 3NCHA 2L18A 1E9AA 3DO5A 3UICA 2QS9A 3DBIA 1QO9A 1OXUA 3I1JA 1UJ4A 3AEQA 3P9CA 4GYWA 2M2IA 2XCLA 2PJUA 4XSVA 4TYNA 1XK6A 3WLIA 3U3RA 4ZU6X 1BCRA 4KB5A 1FTYA 2OEPA 1NJFA 1JSCA 4LHSA 4WGGA 3X43A 1M7BA 4FHFA 1YASA 2G1UA 1J6UA 1A76A 2J6CA 3LVQE 5HDQA 4WPGA 3W9UA 4ID9A 3HVUA 1KP3A 1OLUA 1XZCA 5IJAA 2QLBA 4JEIA 1X1SA 4EO7A 4ZMSA 4QOGA 5LD2C 5JTTA 4WA8A 1LX6A 1WXFA 2VA8A 4KYIB 1N1EA 4QQRA 5JJBA 4KV9A 2Q0SA 5U4QA 4S05A 1TA4A 4PLVA 5BSHA 4HX2A 3BH6A 4WNCA 2JGMA 5BVHB 2WTNA 1XSEA 3KSUA 2YNMA 4ZEXA 1Z5ZA 4RADA 3OTQA 4PHFA 5BSVA 1PL6A 1FU7A 1NMZA 3QUQA 1OBVA 1NE7A 4H9GA 1J90A 2ZB4A 3LX8A 5IX8A 2BGRA 1BXGB 3H5AA 1KYQA 4XD7D 5BN3B 5K4GA 1ZX1A 2ZBVA 4DM7A 3AHEA 4HKTA 4X9XA 1MKYA 3M81A 4TSFD 1VFPA 1UBSB 3BA6A 2GAFA 2I2BA 3FWYA 1XMSA 4AYWA 1XIVA 2Q8NA 1GCOA 1S01A 2E55A 4XQCA 4YHBA 2NAPA 2NP6A 2PLAA 1A9RA 4DSUA 1J1UA 4YJGA 1MQ8B 4V1CA 3CPJB 4R5MA 4YJDA 5NULA 2F3RA 4HTFB 3Q6MA 4H18A 5ADVA 1ZSYA 3HBFA 1JDBC 4R0NA 4LSGA 4C1BA 1WW2A 1DFIA 4B45A 4ISCA 5CXUA 4FGUA 4IDNA 1FS4A 3B9RA 2VR1A 2B8WA 1TM3E 4K86A 4KTVE 4M7OA 2OCYC 1ZGZA 2YN0A 3SDBA 4CDGA 4ZCTA 4ZICA 1KQFA 2DT8A 2L42A 3T35A 1KZ7B 2CHFA 1KOLA 4DEXA 1RM5A 2C03A 1KK0A 5EIBC 1D0SA 5IYZF 4AG6A 4PW0A 3X2SA 3F6SA 4U2BA 1PYOA 4GZ3A 4EKGA 1Z5NA 2GB4A 5JH7B 2OECA 3TQFA 4DLSA 1YDMA 3SR3A 3WIVA 1ZH0A 3SY8A 1C9NA 3VO2A 4UHJA 2W71A 5I7AA 1PAUA 4K6HA 4FBMA 2CN1A 3ZHXA 4H1WA 1WDKA 3L9WA 4EPTA 5I7WA 4QXPA 1G7TA 2C61A 2XA9A 4IMIB 1XWWA 4BNFA 5GJWC 3SZ3A 2LD4A 4R2LA 2AN5A 3PQ4A 3MTIA 2REOA 2JASA 1RPAA 1BE8A 1BU5A 1M76A 2QW0X 4LJLA 5YASA 5FEUA 1ZN9A 2IXEA 2BEUB 2FN3A 1ZNQO 1C1DB 1WQ3A 3FPCA 3HN7A 3QX9A 4V24A 5DISB 4DKJA 2GJSA 2ZDGA 2QJTA 4B80A 3WWYA 2YY5A 4P0QB 1FNCA 4EKNB 1SH7A 5IWCA 3NLLA 3QKSB 3ZWQA 5BSMA 2AYZA 2O0LA 3C41J 3M34A 3L18A 4GDMA 4CMBA 2GNAA 3DB2A 3T3EA 2IUYA 2AHOA 3W1VA 4JWKA 1G6HA 1ZCFA 2EP5A 3H04A 4XPZA 3EPKA 1QG4A 5ITSA 1Q14A 4BLOA 2OGSA 1RVV1 2XHEA 1KAEA 3G0CA 2IW1A 3Q1LA 2PSSA 4TYQA 4DANA 4WK2B 4FD2A 3RQSA 5A02A 1JQEA 3CTMA 3PC6A 2HOQA 4FNGA 4NZZA 4LCEA 1QIIA 2GK3A 2HMAA 4OAPA 5DYTA 3VPDA 4EARA 1KZ6A 4INZA 4QM7A 1DHRA 1MJ5A 1E69A 1J8QA 4ENTA 2NPOA 5ALZA 5JLJA 3WO0A 5I4CA 1J2JA 3Q7EA 4A2CA 4EI7A 4L7QA 3QVVA 2G71A 5ANRB 3B5IA 8MHTA 3K0AB 3IHWA 4M1ZA 5AKJA 1WNTA 3NGLA 4JI5B 2A1TR 3MFYA 4QPDA 1EGVB 1T36B 1O5TA 3LUCA 1UEXC 3HMKA 1B8UA 5HA5A 1SQ0A 1VKOA 4C4OA 3CBQA 5ALUA 1MO3A 2ZPUA 1DO0A 1R0YA 2A7QA 5T64A 2RGUA 3HYSA 4YRQA 4D8WA 1IM5A 4H31A 1S2MA 4IIJA 3GMSA 4GM4A 2R8OA 3JS5A 1G8KA 1K0FA 4HFMA 1PNOA 1VG1A 2X9VA 3KCQA 5A4FS 1Q15A 4PAMA 4B6RA 1ZRMA 3VJLA 1L9XA 2ZRCA 4PVCA 1ZL2A 5EWJB 2PSFA 5AVSA 2E1RA 5AIAA 1QOPB 3A9TA 1WB5A 5B3JC 5BPHA 2VNIA 1CYDA 4ZVPA 4X97A 1QWOA 3NTVA 5C80A 1NQTA 1LTHR 1FLNA 4MVJH 1QJ4A 2J7PA 2VH2A 2HCJB 3BGDA 3IIJA 3PUZA 4MR9A 4E70A 3AW9A 5IG2A 4I46A 2ZTSA 5JROA 3R3JA 4INPA 2UVPB 4RGBA 4X8LA 4BRUA 2DECA 2WMOB 3HB5X 1R6XA 1YDFA 2F48A 3VNAA 4CIDA 4D6XA 1W5AA 1YQTA 2QD4A 3CT6A 3MPUA 3GFFA 3OZDA 1H2FA 2JH9A 3AF3A 1Y82A 4V0ME 5L4LA 2VPPA 1LZKA 4Z2AA 1I4OA 1YTUA 2VK4A 3EXEB 3GMIA 1D1QA 1QBKC 3H1GA 4JB3A 2PUVA 4NMHA 4EQ6A 2VJBA 3FTEA 4XGQA 4UNRA 1R3DA 4MUKA 1L4BA 3BQMB 4YRCA 4E7PA 2CD9A 2IV3A 5IVHA 1QV6A 2AC4A 4J7XA 3P9SA 1OQAA 2B92A 2AXPA 1W75A 2UVDA 3IOCA 3KELA 5DNAA 4BKPA 1XZQA 2PD6A 4C5CA 1SOAA 5AUNB 3MINB 3R3VA 2GM3A 1L5VA 1QH0A 1E96A 2ZJ7A 5REQA 3MMSA 3VU0A 4EHLA 3A11A 3UPTA 4BIIA 4BFYA 1CG6A 2PMKA 3NAGA 4G65A 2WMYA 2Z2IA 5MN5A 1J24A 4CN9A 1X6VA 4OBBA 5DGXA 1T2DA 1CRLA 1SKYB 2WU3A 2YW9A 3O03A 5BSEA 5HGXA 2I9PA 1PLKA 3OPMA 3AIMA 5JPDA 4LXUA 3LLUA 5LOVA 4XVHA 4ZAGA 3V7FA 3OQIA 1SC1A 1FP2A 1GPJA 1Y1KE 4R0MA 1I0LA 4C5AA 5IM4F 3K2EA 4TZTA 3QBJA 1KVRA 5EY5B 1ENPA 1M2JA 1VJDA 2QTCA 3IJ5A 3NNNA 1J33A 4LRXA 3VKUA 1EI9A 4NARA 2GJ4A 4P08A 4AJOA 4UTRA 4WBNF 1CUEA 1E3WA 3LYLA 3ZV5A 3I9NA 3H11A 1QGYA 1D09A 4H7EA 3HY4A 3V7UA 3SYMA 3EVBA 1GARA 4OX9B 4B40A 3T7KA 2QRZA 2R4QA 4X6XA 1R8YA 4Q4JA 4YQFA 1YRBA 2KWIA 3OHPA 4R1TA 3CEJA 2IPXA 4U7DA 3E53A 4K8RB 4C4SA 3FGOA 4NBSA 4FIDA 2QYTA 2M1XA 4OFZA 4RM3A 3ZDEA 1WL8A 3RTAA 4EHNA 5JJIA 4CM9D 2OMEA 3Q6IA 2A5DA 1KO1A 3PYMA 1IEVA 3DZKA 3KR9A 3OCJA 3IOMA 2FV8A 4KN8A 2A33A 4D43A 5IS2A 3G6KA 5E2AA 3A1SA 4MLPA 5E8JA 3EF3A 1G21E 1P1FA 2W4IA 3CU5A 4Y9TA 4F38A 2GXQA 2DWQA 2LCIA 5JAPA 3FF1A 4NXMB 1RMTA 1CQJA 2EIHA 2P2LA 3TRIA 4YRPA 1CEXA 3JYHA 1CP3A 3IUMA 2AHRA 1E0JA 3P8ZA 3DMTA 4J0JA 3ZTYA 3IOBA 2J3LA 3TS1A 1X3LA 1Y9ZA 1Z38A 3DQZA 3F8TA 2XVMA 3I0MA 3LIPA 4D74A 2IH2A 4EUEA 1BXRA 3EC7A 4JSYA 4UAJA 5AP9A 1C2TA 2CDRA 2WE8A 3S40A 2R6CA 1WPGA 4Q05A 1B43A 4UZSA 3UPDA 3ZX4A 3F9RA 3ISTA 4GM0A 4RY9A 1U0HC 4IXWA 4EG1A 1AUOA 2EJVA 1MB3A 2BYTA 2Q3DA 1UJ5A 3LBHA 1J1IA 2QZ9A 3MSXA 4MRAA 4Y2HA 1T0JB 2XTNA 3BXGA 1IZ9A 3E22B 4FX5A 1KO4A 3ZDYB 2NP7A 2CXSA 1B14A 3T5MA 1VC2A 3AF1A 4DT1A 3GJZA 1XCOA 1XDDA 3DXXA 1XDGA 2CLMB 3QX7A 4IJ5A 3LF2A 4L0DA 2HQSA 3T3OA 2V65A 2J5QA 3EPPA 3UV7A 5DBHX 1IUKA 2I34A 1GN8A 1MQSA 3G8CA 3I04A 1AMUA 3RKUA 5HOEA 3VR3A 2SKCA 3OPXA 4N9QA 4YRAA 3PQ2A 3T4EA 4MRMB 1QHSA 3QP9A 4ZVOA 5HF9A 4U7JA 1I5RA 3EFOB 5T8KA 3W90A 1N6IA 4BVFA 1AA9A 4U5QA 1ODTC 3QVOA 2ONYA 3DOCA 4WXYB 3W2HA 1XDUA 1CJCA 3KE9A 3NHRA 2CUNA 1UP6A 1U2ZA 4YBZA 2TMDA 4U7WA 4HGZA 3AKDA 1XL0A 2GOYA 2X4DA 3X1KA 4IUCS 4E46A 4ZJPA 2W8ZA 3KKMA 5DP1A 2BEJA 2OXRA 2Q3JA 1LW7A 2YWBA 3E7WA 4FQ5A 1E6UA 3GWZA 3RFUA 3VTKA 4YCNA 1DB3A 4KUEA 4I55F 2PMFA 5HTKA 1CQIB 4CF6A 2GYUA 3C5CA 3KVVA 5L3SA 3U56A 1I3KA 2HSJA 4FHCA 4GOMD 1F4PA 1MC4A 1ABEA 1Y5MA 4A8TA 1BS1A 3ORSA 5CUQA 2OV6A 1ESCA 2WYIA 2CE7A 3GPLA 3L2OB 2B0CA 2PE5A 3ZHSA 4QASA 1VZ2A 1AKMA 2HPAA 4IZ6A 4YAWA 3UQYS 3TGLA 3DVAA 221PA 2E2WA 3GYBA 4MAMA 1W25A 4XYBA 4OLJA 3DKRA 1E61A 4XM2A 3A9WA 2IY7A 5BSUA 5EUBA 3IQFA 1NLFA 4KE7A 4IDQA 5TB5A 2JAXA 2GEKA 1NF2A 4XIGS 1TF7A 5DW0A 1KJZA 4OH7A 2LW7A 4CMEA 1IM2A 4DIFA 2QA5A 1WDWB 3PNSA 3TOCA 3PNOA 1ZJ4A 1NJ8A 1R6DA 2XUOA 1UPCA 5BW6B 4F8JA 2QD2A 2GA9A 2ZG6A 3HBAA 5AW8A 4ZOQI 4TZKA 4BU0A 3UMVA 1SNYA 1ZIPA 1B0AA 4LRYA 2QVLA 2KI5A 1J00A 1JNXX 3SBEA 2DMRA 1GPAA 4AIRA 4GPEA 3O47A 1I2ZA 3FB4A 5HILA 2PNFA 4W5WA 3F98A 5KQSA 1AO0A 1ABFA 1G7RA 2JFOA 3OJLA 2BJHA 3HR4A 1D0VA 1MRSA 1CRWG 3E1SA 3MS4A 4I8IA 2WJWA 1KAQA 2ZAIA 1UCFA 4TXMA 2ID8A 5J2UF 1KI8A 2DR2A 3BBPA 4Q1VA 4WINA 3LUJA 2QRGA 4QYTA 1UOOA 3ZWMA 1J25A 5EIBD 2J3JA 4LYFA 3KT3A 2R8BA 3G85A 3OAAD 3KB6A 1UWKA 3P9QA 5CXQA 1OLOA 1YJ5A 3TVDA 1WB9A 1P2SA 3TW6A 1QVRA 5ULLA 5JSFA 2F90A 5A2QA 1PEYA 3JQDA 1FW6A 2QE7A 3DHNA 1H0HA 1ANKA 4PCAA 4P5EA 2QTGA 3ZW9A 2JJ1A 4QUDA 4MW0A 3NNDA 4C2BA 4IOLA 4K9PA 3PHCA 3PNKA 3VHXA 3ZZ1A 3GLGA 3ZVLA 4J16C 4JOCA 1M75A 4FX2A 5AI9A 1MB4A 2FP4B 2SKDA 4JOQA 1WZ2A 2WTUA 1QIDA 3UJDA 3PQEA 1DHTA 1BXGA 4DC1A 1J39A 1HOTA 3PS9A 3SPXA 1TTQB 2PLWA 1KAGA 3M3PA 5BN3A 4P8RA 5A7GA 3BERA 1XMJA 4NQZA 1LVHA 1XTZA 3NHFA 3VNVA 4MCHA 4UDYX 5ERXA 4LZNA 3AUXA 1H93A 3GRUA 4G41A 3ESAA 3DA8A 4FMDF 3E7PA 4QVGA 1F8XA 2POCA 2QDXA 3NP7A 2RGAA 3MWGA 4J7CA 4IOKA 5F3DA 5FADA 1GIAA 2VF7A 1V0JA 1DCMA 4B3TB 2PUFA 1OB2A 3FCCA 1NY5A 2GUGA 1DMRA 3VH2A 1CZKA 3VOSA 4FJ1A 4EVSA 3AR7A 2FEOA 1R00A 1ONSA 4QXMA 5HJ2A 1P0CA 1G7SA 2AJDA 3GXBA 2Z8XA 3BICA 1JFLA 3IC5A 1C3XA 3TI9A 1LTQA 5IXJA 3DM5A 1FX1A 1V3TA 3C8DA 1OILA 2JAPA 3V32A 1FNBA 4L3VA 2W6QA 2BJVA 3V6MA 1FQWA 1M2GA 2GNOA 3EEFA 4LYDA 4XI9A 2WABA 2XTAA 3HABA 4UTXA 1DKNA 3WYFA 3S2YA 1GPYA 1RAHA 4PHGA 4Z4IA 1ZEMA 1OGYA 1DJOA 4J1QA 2BBTA 3WLKX 3ZTWA 2AE1A 2GJAA 4Q4HA 3ONFA 2G5PA 2QM7A 1RZVA 3BRWA 3I1IA 5F1PA 4L8VA 3UF0A 2W6NA 3W2GA 2G76A 3ZU6A 3A4NA 2XWJI 2DR0A 3CGWA 3ABOB 4KXYA 3HU2A 1E9VA 3ZH2A 1C8LA 2CZCA 2NQTA 1RQNA 4KAFA 4IYRA 2H4FA 1WMSA 5KNDA 4A82A 2XUPA 3EGDB 3JW8A 3LQRA 3I1FA 1JR3A 4UXIA 1WBDA 1SU8A 2MIIA 3W77A 1C1DA 4PPFA 2A8YA 2V6JA 1E9CA 1T13A 3KQPA 3GARA 3KU1A 3PX2A 2JHGA 3VJMA 1V6CA 1GZDA 4E3WA 3MGKA 2D62A 1EJ0A 2PBFA 3FB1A 1IJEA 3ZJYA 4RENA 2Q3BA 3DL0A 3QKSA 4KI0A 1T5BA 2O9JA 3KJXA 2BFFB 4FDLA 4L4YA 4P5PA 4ZGWA 2XRZA 1JR6A 4QBGB 3KSAC 1CX9B 2FFHA 3F2IA 3FD8A 1E6KA 3I8XA 4DMLA 3H5IA 1OA1A 1SZPA 2WWXA 5KNBH 1OLXB 1Z13A 3UH0A 4AW9A 2YHAA 1M2KA 1Y8ZA 1E2QA 4FDTA 4UUBA 3EIQA 4HAWA 3VR4A 2IXDA 1SD2A 3PR1A 3LV8A 5AI6A 2Z4RA 4D3SA 2EJTA 2LNDA 3DTNA 2H92A 1P7PA 3OP1A 1SPXA 4UTPA 2Y67A 1BKSB 2R1TA 3GUZA 3H99A 4D3ZA 4EZIA 3X1YA 1Y1PA 2XA1A 3ROKA 621PA 5K99A 2DPYA 3NC4A 4HEA6 1TQ2A 2FPGB 2NZJA 2JLXA 1NPDA 1RWKA 3P9YA 2HSEA 2IHJA 2IEGA 1TQHA 5WRFA 2PS0A 2ENUA 2P6MA 4WT7A 4BQFA 5KU1A 1NAHA 5K3DA 3RREA 2B4RO 4M0PA 3RGWS 1KEUA 1RRGA 3ZLTA 3EZ2A 1QONA 3IAUA 4LHVA 1ISSA 4UHEA 4D96A 4YT5A 1LS1A 2V9ZA 3F67A 2I3ZA 1ZKDA 3UMYA 3THXA 4Q1EA 2CVHA 4B34A 2V0GA 5AM1A 3WYNA 3ZU2A 3ITDA 4G36A 2PUEA 1I2MA 1C8KA 2H51A 3C3YA 4HB0A 5D86A 5LQAA 2J9FA 1Y9AA 1XYYA 2IW3A 2WUVA 3PPXA 4L4UA 3FXAA 2EATA 2VH1A 3ICWA 3QJYA 1G4AE 2FMFA 4K6CA 1QG0A 4Z0NA 3T1TA 2O5CA 2JGEA 1CEEA 1AGRA 1Y9EA 1WD5A 3L3BA 4QHYA 5EWJA 3UVEA 4YECA 5CT9A 2H4ZA 2RH8A 5AI0A 2VYVD 3IP6A 5I7FA 1W581 4EB6A 3R3WA 4HXFB 3BHNA 4FVTA 3TQOA 1CCWA 1Y3BE 2QB5A 2ZJ5A 2VXCA 3G7UA 4IO1A 1V45E 4CKYA 1TB4A 3AF4A 2RK4A 4B74A 1P45A 1NYQA 1YGPA 2XD9A 3HZOA 4JN6B 3DG9A 4TT3D 1HEUA 1SKMA 4PN3A 2AEEA 2SCUB 1IQ0A 2EAUA 3DL2A 4ZQHA 1PZGA 3ZY5A 3P9RA 1R8XA 2UVPA 1O0CA 1U94A 2VLBA 2VPXA 1U8FO 3L1VA 2H52A 3AUSA 4ZQFA 3V8NA 3EC2A 4ZCQA 4YYZA 4OO3A 4L8WB 1IMJA 1N2GA 1S7CA 5FO1A 2ZM6B 5FV7A 2FCAA 3LQ2A 2ZVDA 5A6SB 4UULA 2DY1A 3KSDO 5FPQA 2IYUA 3EXEA 2WSBA 3G2HA 2Z2KA 5E1DA 4UFPA 1FSPA 1RC0A 3X44A 1OVMA 3HM9A 5CNMA 2WIDA 3U4HA 1A9XA 1P17A 4N5HX 1QTRA 3LW7A 4R05A 3A14A 4UMVA 4EBBA 2HT1A 2ZUEA 3R5TA 3OD1A 1LQUA 4NBVA 1Y1TA 1B0ZA 2IHTA 1GN9A 4K87A 5CNIA 3ZHVA 2Y27A 1IAQA 3LRXA 5J63A 2PVSA 4XJXA 2DEUA 3AEXA 3KJIA 3JTEA 4KQ1A 3MINA 1O94A 4UUAA 1GSHA 3D02A 3TG2A 3B1XA 4G37A 3IPRA 5HF5A 2EP8A 4CUJA 3OJCA 3SWWA 1NA5A 2Q1SA 3FPFA 1QPBA 3QENA 1Y6ZA 3QOFA 1ZGBA 3P0EA 4Y6SA 4YASA 2HW8A 1D6JA 3UUGA 2QAJA 2EL7A 3DVLA 3RS0A 2FFQA 4IG4A 4V3BA 2W2PA 3B60A 3IAS1 4QOFA 1UDBA 4B81A 1GYPA 2NM0A 2X8JB 2YY6A 1QE0A 3MWEA 4G5SA 3HEAA 2YRFA 4EYOA 2JZCA 1MUUA 1T1EA 1WSWA 2AW3A 2IYRA 1YUNA 2WMDA 4P38A 4EG4A 1SU6A 4PWYA 1CIPA 2EYUA 3GDFA 2XNKA 5IANA 1Q84A 3V55A 1ZISA 3EZXA 2AD5A 2C59A 4KMOA 4GXNA 4XVRA 1VHDA 4DMUB 3I4LA 2DFTA 1MNQA 4CNQA 1QHXA 5EHNA 2Y92A 3TNFA 3B1FA 3ZHYA 2GCIA 3DE3X 1KRWA 2VYQA 3IH5A 1L3BA 1OROA 2FPPB 4OY3A 4UM7A 4G2NA 4IXMA 3A31A 2GBPA 2LP4Y 5HW0A 5K09A 2FEXA 2ISSD 2Q9CA 3A3OA 3D8UA 3E18A 4BCCA 3SICE 3PQ3A 4FFSA 1RYMA 5EZYB 2JGFA 2ZB2A 3OQHA 1BGWA 3GCGA 1GRRA 1SB9A 4A03A 2PUJA 4PLZA 5BSKA 3C85A 1EA7A 4WZAE 2HC9A 3RYTC 3ONVA 2CLLB 3R5FA 1HX7A 1TO2E 2F1OA 3AY3A 1HRKA 3NDRA 4HH3C 2VUSA 4REQB 4TV8A 3ZU5A 1AQLA 3ZZNA 3ITEA 4BIMA 3FGPA 2NWQA 2VF2A 3DPSA 5G1OA 2E6UX 2YV5A 3IBYA 4AIIA 2X8WA 4EHKA 3OU2A 4MQEA 5A0VA 1JXAA 5GPBA 4MUAA 3FDXA 2BELA 2ZR8A 2V7UA 3OEED 2C3UA 3C43A 3TZLA 4OFWA 2XW6A 2D1YA 3LE8A 4BNTA 1KZYC 1PNQA 5TIIA 3NVKI 1YVRA 1DOAA 5BV1A 3IEXA 2LGJA 3LLCA 4QNRA 2JAUA 4R98A 4X7MA 5KKNB 3PZRA 5TV2A 3AHJA 7MHTA 1J2RA 5BVGB 3X1ZA 4Z4CA 1ND6A 2A59A 1RP1A 1XDZA 4H6WA 3JD2A 5GONB 3RH0A 4DPMA 4LZLA 1AUQA 4RF3A 2WTMA 3W4KA 1HFJA 3S5UA 1TYDE 1J8MF 1RJEA 5FTMA 4CF3A 2VXYA 3MCUA 2OHOA 3WL4A 1UBMS 2FR8C 3MOSA 1LBEA 2GX6A 4II3A 3VAAA 1R0WA 3CX7A 2R1ZA 2WFAA 1W36C 1QGUA 1X9HA 1U7XA 2X4LA 3PITA 1PD1A 4B9AA 3BBLA 1U3FA 4JLJA 3PUKA 5BR4A 2IH5A 1JG1A 2DFVA 2BEVA 2C5AA 4YGYA 2CK3D 4MRMA 2CF5A 1A7UA 4MV9A 1AF7A 4R7TA 4I3FA 3EFOA 1ES9A 2VRCD 3L05A 3RHZA 1B93A 1PFVA 3CXRA 4NMXB 4S2EA 1R6UA 1IYZA 5TVGA 3C3WA 1RI4A 2FZVA 4WA7A 1CZOA 4C2TA 2NXJA 2P65A 4Z6KA 2JHPA 1VBFA 2R60A 1QS0B 3HJCA 2ZU6A 5F35A 3RSCA 2IYPA 4DCGA 3GAMA 4JQOA 2NTYC 1RXUA 2X0NA 3OIWA 2X9QA 5JDIA 9ABPA 1C0IA 1YI8A 5H3CA 1CQIA 2R8PA 1OAOC 3KYDB 3M70A 3NOOA 4RKFA 1FEZA 4RVOA 1JEQB 2WHPB 4E94A 5BSGA 2WICA 5J4VA 2R6ZA 4G4JA 4OM8A 2M6KA 3ST7A 1YZNA 3TLKA 4TVOA 4V0MA 2DWUA 1S2GA 4HWGA 3T3GA 5K9ZA 1MOQA 4NAHA 1UT6A 1CUYA 2J08A 2QKYA 2ECPA 2BE9A 5J40A 1UBLS 2IXAA 1MVNA 1XEXA 5T41A 2JB9A 4DMKA 4GQAA 2C2WA 3CBGA 4QTYA 4BNXA 2F4VB 5IM5A 3M6IA 3AYZB 4DMMA 1L7NA 3NTQA 1WR8A 3FHCB 4O02B 3SYNA 2GAIA 2FN9A 3IEVA 1BMQA 3R7SA 2IHVA 3BWYA 5H3LA 4ZJYA 1JLSA 1L4MA 4FILA 4LV8B 2OC4A 2F9MA 3HR7A 5MFZA 2Q46A 2V6BA 3B1VA 5HKOA 1OTXA 1K92A 3BHMA 4LC0A 4L3OA 4MVCA 3WZ2A 3UT5A 3P97A 1RHJA 4QFCA 5TX7A 3S0JA 1DRVA 2HT6A 3VNQA 3ZE8A 1BW9B 4XVCA 2QZ4A 2AMVA 3A3YA 4O2LA 2C9CA 4HZIA 3F5FA 4GRAA 1AJEA 2CVPA 3MJTA 4R1MA 4C3OB 1CQWA 4DA4A 1ZJJA 4H3VA 5AWFC 2DH6A 4LWOA 4N3BA 2BTEA 1Z0UA 2QD1A 1SD5A 3BMXA 5A03A 3SX0A 2WNSA 1PHPA 2WWGA 3SS8A 4EF6A 2GAJA 5AOAA 3EHEA 1ZNXA 1UKAA 1JLMA 6NULA 1M1NB 1U8ZA 1MC1A 2B69A 4EHAA 2BKAA 1D2AA 3ZWBA 1RQ7A 2HMVA 1UZAA 1FU4A 4IHJB 3ADPA 5KINB 4BMDA 4JENA 2Q27A 3DE0X 1OZGA 4I5FA 5TF4A 1YQXA 4CMAA 1RQXA 3KHKA 4MMZB 4UBLA 3WKCA 4EHDA 2Z6UA 2BDTA 2XNDA 5C1DA 2KM1A 3A2LA 3AKYA 3KJZA 4Q37A 1N6PA 2E4XA 4BVKA 1AGNA 3U7JA 3WLQA 2ZSHA 1P7ZA 2GPJA 3L0IB 4IM7A 5CRIA 4DUPA 2ZAGA 4BVGA 4WJLA 1M7HA 2FZGA 4MTCA 2PWYA 4G26A 4ZI3A 5IC6A 3BF8A 5A0TA 3K5IA 4BMCA 3DV9A 1NSTA 2ZRGA 5JAZA 1AKWA 1G21A 2GBLC 2QMEA 4YAIA 1TRHA 4RNDB 1KMQA 3OZFA 2WJPA 2O3TA 2EGGA 5JR3A 1GTG1 2UZ0A 3ADCA 3RWMB 2AQHA 3H1AA 4GPTA 1XQVA 5AVRA 1SKBA 1Q2XA 5ALEA 2CV2A 4BTLA 3BXPA 2IY8A 2YMMA 2H4HA 2FPSA 3QJGA 1XMPA 2EZ9A 3CC8A 1HNNA 2G8NA 1SRRA 2CFSA 2I71A 2VOEA 3FCXA 4OKIA 2JFFA 4OYLA 3GCDA 3LA6A 5IEBA 4RV9A 5JYDA 4KUGA 1SCNE 5J3JA 3GR6A 2DCUA 2VDNB 2QXTA 1F7VA 2WHRA 3FOFC 2V5UA 3MGBA 1DDIA 2J32A 1EQAA 4HK4A 4KGXA 5DNEA 2GZAA 1TYEB 4FYIA 5CLHA 5B37A 1G6Q1 3EEQA 1UWLA 2EVWX 1VOTA 4P7JA 4XWTA 3RS9A 4DQKA 1WBBA 5DCYA 5IVIA 2MMGA 5BOSB 1DQPA 1X86B 3N2EA 4GECA 3DSRA 4KQMA 2D59A 4ZAVA 5K3OA 2IH4A 3O8OB 2JI6A 2Z98A 3JWHA 3VTFA 3IP9A 4IZHA 3OCCA 1I3MA 1LLUA 2JANA 3GZNB 3I8SA 4FCWA 4L72A 2VBIA 3IEIA 3UGKA 4PXYA 1QO7A 3NIGB 1GL9B 1U2GA 4KDEA 3U7EB 1DBRA 3O38A 4E21A 5AVTA 4YMTA 1CUFA 3ORFA 3D64A 1Z6GA 2XNHA 3PCTA 4KLCA 3PUXA 4MV4A 3D0QA 3SLKA 4MR7B 4NFYA 1WQ1R 4QEKA 3Q3GE 4UC0A 4WKBA 4IG9A 4RHFA 4EQZA 4GKJB 3EVNA 3WDMA 1N5LA 1G1AA 2ZRMA 1EM6A 1MPTA 3GHHA 1PN3A 4XA8A 3H1FA 4H6PA 2PZKA 1Z5GA 3WLMA 2BGUA 2QN8A 4WASA 5C8DA 3EGDA 3KL2A 2OXFA 4KE6A 2Z8YA 1EK5A 2XE8A 4G6ZA 3RC1A 3WQSB 1UJ2A 2PUBA 1BRTA 1M1ZA 1NJ1A 4AAYA 1NMEA 2AC7A 1D4ZA 1IDN1 1T3SA 2A5GA 1Q7BA 3FHOA 3Q5EA 5JS2A 2P75A 1EJ2A 3Q7QA 2R6AA 3HGQA 1WTCA 2BFFA 2H63A 3F9CA 4K3UA 4IFBA 4DRXB 2Y1FA 4ZO9A 3AJAA 4M8NE 1F17A 1OLXA 1MJHA 3N05A 4EPRA 1PQPA 2C82A 4LGMA 2G08A 1Z4KA 3AK4A 3G9XA 4JJ7A 4PZYA 5EHIA 3S1AB 1Y6FA 2RH5A 4OFBA 3ZVKA 1LLCA 4JB0A 3AB3A 1EX7A 1SJ9A 4UFOA 3PGVA 3UCXA 1Q3HA 3CNBA 4MQMA 5FBQB 2AVNA 2ZRJA 2W48A 1OHHD 3M6UA 5IP5A 2HK8A 2RI1A 4AG3A 1RBMA 4HRVA 1IC6A 3AETB 4KQ2A 2LVBA 5KSPA 3HH8A 2RBGA 4EUFA 3HEBA 4KTTE 4O3MA 4BE4A 2P9JA 3G1TA 3I83A 4FYWA 4BLVA 3U6KA 2AJTA 1YDHA 1ZI8A 5CB4B 1OY1A 1S4MA 1U0SY 1JP7A 1W0KD 1Z74A 1XOIA 4IHKA 4E13A 4NCXA 3BDIA 1Z8FA 3ME5A 4ZRNA 5D01A 5IMBA 4O6VA 1NBMA 2PX8A 3LDUA 6YASA 2QRPA 3G7SA 2FHPA 2OV1A 1UK8A 2IF0A 2VHJA 3GBPA 4NPAA 5F21A 2WY2D 4CQMB 3BFVA 1E4VA 3WB2A 5H3HA 1P9NA 3L02A 4R16A 5DHRA 4TTPA 1K2WA 3HO1A 3DOJA 4QJ4A 3S27A 2WYVA 4DLAA 4KR6A 4JKYA 2VDRB 3QBEA 2D00A 5AM4A 3Q3HA 2XUFA 4MULA 3TGPA 2ZIZA 1BX3A 2O7VA 3DBOB 3IILA 4K6GA 3RW9A 2O2DA 3H18A 1LBSA 4G81A 4KFSA 1C0LA 2PO5A 4UW9A 4UOQA 2DLDA 1E1KA 3VR6A 4PGMA 3N2ZB 1YR3A 2HLDA 1ZKMA 3CINA 5I9MA 1CS4C 2XGJA 3Q7PA 2W2LD 4ZAXA 1M9NA 4HFRA 1EFLA 5FBZA 2H7YA 1U2DC 3FTNA 3L0SA 4AECA 2IHYA 1EBFA 4QPPA 4AZTA 3UHFA 2C4MA 4QYWA 4YTEA 1JFFB 2G3YA 2QGNA 1KRXA 3H19A 4FNAA 5BNIA 1B41A 3O8QB 4LNUB 3L9XA 3S8YA 4W5JA 2QRLA 4W7SA 2BTOA 1KR5A 1US8B 2V7PA 2ZS7A 2GJKA 3BFXA 2ZAYA 3IRVA 3FIJA 2ZSJA 2P4QA 3A1DA 1U0RA 4D81A 1UADA 1Z0FA 4IH9A 4LJ5A 5F2OA 1Z2OX 3ZXUB 4EG7A 5HVNA 5EZSA 2CNLA 4X8MA 1UBHS 1YZFA 3NAQA 3TO5A 4E33A 4JC4A 5L51A 2QLLA 2OG2A 4EW1A 4RWZA 2BFPA 1EXNA 3QOXA 1RZ3A 1ZIYA 3ZWPA 4BLUA 3QMVA 3ZHQA 3KOWA 4MAFA 1S2LA 1W35A 1D3AA 1IZZA 4B7AA 5ALIA 3JARA 3SX4A 3QLUA 1YZUA 1XEFA 3ABZA 5KQGA 5JZMA 3QTBA 3CVYA 4QULA 4GDFA 1YZLA 3F5QA 4CKZA 4LJ8A 2GK7A 1EK6A 3FWHA 1PEKE 4UUNA 3GBSA 1PJ8A 1E0KA 3JALA 1HF3A 1NKVA 1VJTA 2HFKA 2YYYA 1Q3TA 1FTNA 5CH5A 3OI7A 3HSSA 4IWYA 4YI5A 4LXQA 1BE0A 3EZFA 5CFZA 3IT3A 4H1UA 2W6JD 1QIEA 1XGKA 1RPJA 3WSTA 4Q3NA 1A7AA 4RVGA 3ESRA 4OP3A 5AXBA 3NJRA 1S3IA 1V7ZA 4RIIA 3N07A 1B42A 1DAFA 1ZC4A 3O7WA 4WEQA 1YZQA 1UINA 2B9EA 1QCZA 5LZ7A 5EIAA 1NV9A 2P2NA 4C4TA 1YOVA 4GVPA 4LF9B 3UWDA 2QQEA 4DB2A 1W36D 2FPPA 5KTPA 3VBEA 1KPGA 1X15A 2P2YA 5HMLA 3L84A 3USCS 3STTA 5DI3A 5IDYA 2IU6A 4G1EB 2QLTA 4E7OA 1EFPB 2JZNA 3UJ3X 3V4PB 5EZYA 1A98A 2VQ6A 1J2TA 4B09A 2I8LA 2Q6IA 5MF6A 2APJA 2RHDA 2E49A 3WL3A 5KNDH 3FPJA 3IIKA 4E1VA 3DPUA 3ETHA 2JD2A 1UANA 1VMKA 2PKQO 2FYTA 8LDHA 3HYNA 5GZ3A 1LJLA 2HWWA 1OFUX 1JIVA 4DSOA 1P80A 1DAEA 2QN7A 3HRIA 4G67A 1PJLA 1T9DA 1KVTA 1TOAA 1TF5A 1WPXA 3NJ8A 3EJ6A 3QF7A 4PBTA 3T7DA 3V2GA 3LUFA 1QQBA 2QUKA 3R9XA 1M1YB 3OZRA 1KZGB 3HY6A 2PV7A 5EYPA 4DCMA 1QP4A 1UP4A 1WPQA 1YMVA 4HNGA 4MKRA 2Y05A 2O8CB 5FYQA 3G5LA 1MC5A 3AQ4A 1F14A 5L7WA 5LYJF 2JEZA 3S44A 3A27A 2ZATA 3UKDA 1RKQA 3VR4H 1F6WA 3ZG6A 2DUUA 2J9RA 5EE5B 3R3UA 2OGZA 4ODIA 1TQ8A 3V3KA 1STOA 2NO0A 1ZMBA 2WSSA 5TXGA 2JJ2A 4UARA 1YVUA 3UW1A 4ARUA 2VQEB 3FOWA 2A9KA 2FR0A 3LRPA 1PT7A 3L4BA 3UY4A 1C7JA 4Y6GB 4MRRA 5B58T 4O8ZA 3SXJA 5BVGA 2O14A 1GTSA 3EZ9A 1G64A 2ZTHA 3OM0A 4XB6B 4A8PA 2BMVA 2HRDA 2PRJA 1JQDA 4DG5A 3JQ6A 4MP6A 1DPGA 1P5JA 3NAZA 4HGOA 5BXYA 3WRXC 1D4AA 1N5JA 2XITA 4RTPA 1BVHA 4UHBA 1M7GA 5CM9C 1E4EB 5FULA 3QVTA 1P91A 2Y77A 3GN2A 3JAKB 4BFVA 2WKSA 2SBTA 4MV7A 4R84A 4DCNA 2NV0A 4FR5A 3IMEA 2OWEA 1L1EA 1RHUA 4UE6A 5DEIA 4H08A 1YIOA 2IU3A 1Z75A 2GK4A 3HA3A 4M98A 4FQ7A 2XOEA 2A9FA 1OFVA 4KMSA 1C7IA 1ZMRA 4KVZA 3KCNA 1GG5A 1N5IA 3MC1A 3P9KA 1RNLA 4ZEOA 3VOTA 3UMRA 1IN5A 1WNFA 3C5VA 1DKMA 2R8EA 2VP3A 3DE4X 4OG2A 5KAMA 2IBSA 1CR1A 2AJBA 5JHHB 4LG1A 3HVJA 3G9TA 1F6DA 2Q1TA 2Z1MA 3AJ9A 5DHQA 2W37A 1NR1A 2J0QA 1H0SA 1QS0A 2BN4A 2VHVA 3DLCA 4LOKA 4F6LA 1A71A 2AMLA 3C3DA 2VCEA 5J4YA 2F00A 1POXA 3P2JA 2BM1A 4FKBA 4N0DA 4KPYA 2ZZNA 1VL2A 1DI0A 2VTKA 3LWDA 5J5AA 5AW6A 3KYDA 1OH7A 3NP9A 1N2ZA 2VJCA 1BJTA 2WHPA 3EXHC 3VI3B 4G1FA 1Y33E 3EXAA 1BH2A 3GFQA 4LY0A 4Q6BA 4Z9FA 4TMVA 3VU9B 4A0FA 4YUWA 1AHHA 3DT9A 3EJWA 3L8MA 4QXQA 2JLRA 2VRNA 2XOKD 5ESXA 4DDVA 4EB0A 4ZCIA 2HWXA 2M9MA 4U6NA 3F73A 3C6KA 1PR9A 2C1XA 1SIBE 4WADA 1M6VB 1U4NA 1XRPA 2XJ9A 1L5ZA 2YRWA 4GP9A 1E2KA 2V7EA 3TKAA 5K20A 3TTYA 3G5MA 1IBKB 3ZXYA 4C7OB 4KGVA 3DP9A 4EL0A 4ZCRA 4ICIA 4A2PA 1ZG3A 2EOAA 3HE3A 4Y6RA 3BIOA 1AS2A 3IFSA 2BM9A 3G9ZA 1T6YA 4URFA 2GN2A 3QY0A 1HO3A 1LJUA 1DIBA 5B6JA 4G0UA 4QZVA 1EDOA 1HLFA 3ZS8A 3MCAA 5BYAA 5KCMA 4L5YA 1TO6A 3LUPA 4YFYA 5FD8A 3O4RA 2C29D 2WI8A 2GASA 5EJ7A 2ABWA 4GLJA 1ADCA 1SOWA 2XBUA 4UNPA 5AESA 5LD2B 1YJBA 3V1KA 3ETJA 4HQ0A 3BCRA 4R8KA 4D3DA 1TKBA 2W6IA 1GDDA 3MJSA 4LJ4A 3ZBTA 4M37A 4PLHA 3SIRA 4TMZA 4PYLA 5FFNA 2VK2A 3ADOA 2B7LA 3L7LA 4YEDA 2CLIB 2G77B 5ENVA 4XYEA 1B8PA 1X13A 2PMEA 5ALLA 3TEJA 2AG5A 2VNHA 4FW8A 3NC1C 1D1PA 4Q7LA 2DLNA 5JECA 2GAAA 2VDVE 3H2JA 2VHQA 4G1UC 1YKFA 1U2EA 1VLHA 1X1AA 3MTJA 3QHAA 3QY9A 4G97A 3HCPA 3TLCA 3CONA 2IPLA 2WIBA 1GKKA 1H5UA 4NVRA 1NJSA 3H9UA 5D7BA 3N70A 4ZVSA 2HIGA 1UFRA 3LP6A 3WS7A 2R68A 3DF7A 5TEVA 4CF5A 3TIXB 2XA2A 5JU6A 3OE5A 3BE4A 3BGIA 4LY3A 3LHKA 2CFTA 3TLJA 2WNIA 1GQQA 4Y2RA 4J75A 3RVSA 3WJ1A 2ECOA 2G09A 4AZ3B 4IMJB 2IZOA 2ACEA 2QV7A 2YZGA 3O83A 3O95A 4U2FA 4XDGA 3IVAA 5AI4A 2NUTA 1VJ1A 4WZAA 3WRVA 3DMDA 2XT9A 3RM3A 4OQYA 1JALA 4D82A 4LRUA 5KJ6A 4CTMA 4NV0A 3KKEA 1DEXA 3CZ5A 4P4SB 5FUBA 3S6JA 4KR2A 1K66A 4IJMA 5IH7A 2PWAA 4MKIA 3QWAA 3UGQA 3ZGVA 4G5GA 2NXWA 1RLIA 2HCTA 2I4RA 1AB5A 1K6XA 1U1GA 2DQSA 1QRAA 1FFCA 2BZ1A 2QAIA 4JP2A 5F5LA 1G8HA 5EGNA 4C76A 1Y3CE 2YW2A 1ZJ6A 3D3WB 3NBZC 5FL3A 4MXDA 4BNVA 5A04A 2G9UA 1KP9A 4NEQA 5K7SA 4O4JF 2PFKA 4PS0A 5K0NA 5AKHA 3H5VA 3PHGA 4CLHA 2CMKA 1Q57A 1YQ9A 3HDGA 1DJQA 2D1RA 2G1KA 3HYLA 4JSTA 2LPMA 1UJNA 3C3XA 1XN1A 1OI2A 4NP6A 1MEEA 5LZ2A 4FYPA 4KNWA 3EBPA 4Y2GA 3S70A 2WPNA 2I03A 2YXEA 1ICIA 1FFEA 2PZMA 2I6FA 2YX1A 4FNOA 2R97A 2CXXA 5CJPA 5ALRA 2FY8A 5I5GA 3UKOA 2P9YA 3C3CA 1W5BA 3KPJA 3MG9A 4J6FA 5BOSA 1U5CA 3LFHA 3WTBA 3OU7A 4DYHA 5HKKA 3MZ0A 4F45A 4OOEA 2HDNB 4IWXA 1QG6A 4IIHA 4YT4A 1KETA 3JVDA 2OCLA 4FZRA 1TI7A 4PZCA 4GX5A 3W78A 4L7VA 1JTEA 2BBOA 3L0BA 5KNCA 4RK0A 1BEZA 2GTHA 4TM7A 2UUBB 5BUSA 4MYDA 4KR0A 1JILA 3BPSA 2I62A 3WBKA 1K88A 1IG3A 4LGCA 4DQVA 4W9MC 4JT2A 5L4SA 1JQ3A 1IUOA 2QTZA 2UAGA 4MQ6A 1EBBA 1ZD5A 3CX8A 5DWQA 3L0YA 1JAYA 4JYBA 3Q3IA 4OI1A 1A8UA 2CJWB 3LL4A 5JWRA 2OPHA 1PG2A 5LBTA 1SRQA 4D25A 1OC2A 4XTCS 3KJGA 1ISJA 4FCCA 3VUFA 1PJRA 4C21A 4MUXA 4PYJA 5A1TA 2QRQA 1DC3A 3IR5A 5EUCA 3RSHA 1FTSA 2B4YA 3GWGA 3PP8A 1YCHA 2DVMA 3FPLA 4P92A 1JQAA 3IP8A 2V98A 5DGHA 1VSVA 3QKUA 4DB4A 2PXHA 4GW3A 2ZRBA 4CLXA 2HJRA 2X5OA 4DRXA 3NASA 4C2AA 3FPKA 4PRZA 3T4PA 4YXFA 1EWQA 1LSSA 4KQ9A 2A78A 4AX4A 3IQXA 1SCUA 3RANA 2W2KB 4G4IA 2JLWA 1WMEA 3H8WA 1YULA 2XQKA 4PQRA 1GLVA 5HK8A 1PR3A 4UDOA 2RFLA 4OHFA 4C0BA 1T91A 1ZVQA 2MYNA 3AUYA 2ZIAA 3DFUA 2C5HA 1XMVA 2X0RA 2ZBQA 3GJ6A 1JYSA 1FE8A 1T4CA 4RKYA 4RJJA 3UJAA 1J49A 3C0KA 3C6MA 1H0KA 3FYUB 4LDRA 4J4HA 4YIKA 1QU2A 1XTSA 2OFWA 1USUA 5ADHA 2XUQA 3JX9A 3AFNA 3WIOA 3AETA 4MUHA 4IILA 1MRZA 1TT5B 1XZDA 9ATCA 2CNWA 1UOPA 4M1TA 1Z8DA 3OPQA 3BAZA 2GCEA 5CB4A 4G0QA 4RK5A 2VYNA 1E6WA 1IHXA 3VR1A 4LIPD 3KZNA 5SZHB 4U2DA 1TIKA 2OCGA 1F51E 4RD2A 3KB2A 3WDSA 2XYQA 4QDJA 1ZD8A 4CQMA 1F12A 3U4QA 4N9WA 1O0SA 3LSTA 3E9MA 3L7IA 4N0PA 4NOMA 5A9SA 1ZGCA 1YZ3A 5DO9A 3AKEA 1KNQA 3CCCA 4EPXA 3SZMA 2BHTA 3DB1A 3I5XA 3QUTA 1SPBS 4GMGA 1ULHA 1VG9B 1XDBA 2V4ZA 3PUYA 2JHAA 4FEGA 4HNHA 3GP3A 5E4FA 2HL6A 5HQ3A 2DM6A 4PCUA 3V9PA 1J5XA 4DBLE 1H4QA 5K6RA 1V2HE 1EFRA 4C29A 3TOXA 1V9CA 3K09C 2J4FA 2FQQA 2YZ2A 4GLLA 4FB5A 5C5EA 3ZVNA 1X8LA 5LP6B 1U9ZA 4TQGA 2VPQA 5JT1A 1OIVA 5IJ0B 1JR2A 1XDWA 1U7UA 3H0EA 3JWIA 2C04A 2ONZA 3KVRA 1SCJA 3W5AA 4G0WA 1Z17A 2FETA 3LC2O 5D5PA 4C78A 2GH1A 2WWIA 1ODFA 3DZBA 4AWBA 4CM3A 3DDWA 1B6GA 4RPGA 3LHIA 4WOPA 3TVYA 5LN1A 3VKGA 4A8JB 1VE7A 3IOEA 3ZDZB 4Z4HA 5ICMA 1F2VA 4N12A 2M6SA 4LNUA 2RJOA 3KQMA 1PK7A 1R6TA 5K8TA 1H8HA 4CW7A 3LJKA 4CV0A 3LTEA 3ZLJA 3AZPA 2RAPA 4WDQA 1TJ5A 4YJFB 3L1IA 3PXEA 3SNHA 4D57A 3DMYA 3DEIA 4O2BB 4F12A 2XUKA 4CE6A 5CFLA 1ZK2A 3NGMA 3KHSA 2YWRA 2VP6A 2JCYA 3FG9A 5I8ZA 5B58C 3BL6A 4JYPA 2QMQA 1ONOA 4KNVA 4MSUA 2KHZA 2QQGA 3U61B 4CEIA 1OWOA 2LXNA 3HHPA 2XDQA 5E6UB 2E89A 3OIYA 1EP9A 2BAGA 3LD9A 5E6RA 3RFVA 1U7OA 5FI1B 5DCWA 1H2BA 1WB6A 3FOEC 1OIWA 1ZQ1A 4NLLA 1T43A 5CTAA 4YUYA 1AY0A 4PQYA 1JUDA 5CGZA 1GA4A 4U02A 1L5WA 4Q00A 5K2MA 3QXXA 4XDZA 3MIZA 2O1SA 3WAKA 1BMFD 2FLWA 1CZLA 1FTQA 5EEGA 3EE6A 4ENQA 3Q8LA 2QF7A 4RGQA 2VYCA 4GKAA 4K6OA 5HTOA 3HEMA 2O59A 4U4AA 3TLMA 1PFKA 3CO0S 2YOFA 5A62A 1S0UA 4IH1A 2YV3A 1L3IA 2A0YA 3STXA 2R9VA 3WYAA 1GP2A 3HKCA 2FFJA 3K9GA 4RZ3A 3W2FA 4AJIA 3BXXA 3AM1A 2EWMA 2P9CA 3QVGB 2X8BA 2E5FA 3SJZA 2GHIA 5CW2A 3ZNPA 4N39A 4XD2A 1EE1A 2A1UA 3ZJ5A 3OM1A 3EPRA 4J07A 2X3FA 4BO9A 1VIAA 4ZKEA 4DLZA 1EFPA 3NHUA 5FOTA 5F4ZA 3Q15C 1K97A 4DTIA 1X94A 3W2TA 5FQNA 2IS2A 3A1UA 1VBMA 3JQCA 1JHRA 3JQFC 4G0ZA 4R1SA 1RXYA 4G0PA 2ZKLA 4D9JA 4DUZB 2X8AA 1U8CB 3GAFA 3H4MA 2YXDA 1T3TA 1YBAA 4MKHA 2X4GA 2HCRA 3KTOA 4WZBE 5DXAA 5EP1A 4COKA 1TGYA 5FTLA 2Q3MA 4RU1A 4HDQB 4D46A 2D0DA 4DJDC 5CVEA 5F3WB 5J5VA 1Y6JA 2H2HA 4HZUB 3AHDA 4DABA 4XASA 2V9PA 3IE0A 3T41A 3BQNB 3TZKA 2ATEA 3B5EA 1BD4A 5A3VA 4BEBA 5C8XA 1PR0A 1M6WA 3R1IA 4W5HA 2PX5A 1YNOA 1DAOA 3EVAA 3I6YA 1JX6A 4HDCA 1QHNA 1N4AA 4ZRDA 4S1PA 3R0IA 1AV6A 2H59A 4XIFA 5K4AA 4LCJA 3OLYA 1NPYA 3H13A 4X6YA 3T1QA 4PG8A 4JR0A 3PXGA 2DY0A 3I37X 3IAM6 3WGIA 4TTRA 5H4GA 1T2FA 1TW3A 2JL1A 5K3FB 1P19A 5CURA 2B9VA 4YV2A 2XBLA 3WLNA 3GIWA 4R1LA 5TF0A 4BNNA 4UEJA 1G17A 2KBEA 3GFTA 1YS1X 3LUDA 2XB9A 1J0EA 2FJ0A 3P45A 1E4EA 1B3BA 4XRGA 1WCXA 3B38A 3IRUA 3JAKA 4EGCB 3PPVA 2A14A 2QP9X 5EJ4A 2XWSA 2OFXA 3MUNA 5TMEA 1PWYE 3M6FA 4I9UA 3S7TA 2A58A 3DKPA 3CWCA 3T5CA 3WBFA 4AVYA 2CLCX 3L7KA 1TM4E 4NCNA 1CR6A 3AWIA 1OSNA 4GVLA 2Q41A 4OGKA 5IZCA 3PL5A 1KTVA 1PBTA 3H2ZA 3I2KA 2H17A 1KPIA 1RI1A 2X40A 3GRYA 4UZFA 4Z9BA 4AF7A 4LQLA 3R3ZA 4CT4B 3RVKA 4HWTA 3WZLA 1Z34A 4DQXA 1QCYA 1ZVJA 5F7XA 4DV7B 1RRKA 1SXJD 2C9YA 3G8YA 3HU1A 2BD0A 5DX0A 1UWCA 5KB3A 1U9CA 5TQ2B 3O91A 4YV1A 1P9OA 3V1UA 1WOYA 1RFGE 1U4OA 4U39A 3VR6H 4F71A 5LQNA 3RAEC 1RQRA 4JV5B 2FMTA 1XTJA 3K0CC 4HWPA 4KN5A 3RVPA 4CYMA 3OFKA 2G40A 5KTSA 1G38A 5J59A 5TT1A 3UAOA 2R96A 2QG6A 2O2SA 3O6VA 4LFBB 1DIGA 4G4GA 4IV5A 5LOVF 4ND4A 2FW0A 1SUBA 1Z8HA 4A6XA 1CLEA 4PLPA 1OH8A 3ZD7A 2AIRA 3PC2A 2QJOA 2FK8A 3NBXX 1LKZA 4KSCA 4ZHQF 3N59A 1G9XA 1SC3A 3DAHA 1PWHA 4E5VA 5BQPA 1I0ZA 2JFHA 4C7OA 5AO9A 1XKLA 1TXGA 1M1UA 5EHGA 2AR7A 2MHCA 3KG2A 3M6LA 4DA0A 1WMFA 4F06A 3HBMA 2IBTA 5J23A 2Z5GA 3KFVA 1P0MA 3ECAA 1LRJA 4JLNA 2AN9A 5U9CA 4F3TA 4EAQA 4FONA 3FWNA 5FBKA 5FL7D 1JECA 2E85A 4A73A 2Q45A 3AHHA 3GDOA 3RHSA 4GWGA 3EXIB 4OUKX 3SD7A 2P4HX 1A9QA 1D03A 2PRKA 2Q5EA 1P1RA 2DTDA 5CDFE 4AUMA 1D07A 1IL0A 2RG1A 4NIMA 2AFVA 1TKAA 4BNKA 2V7VA 2IWRA 2OK7A 4JX8A 1N7JA 2JJ8A 1IQUA 1R0RE 2CVFA 5FPSA 3RJMA 3SHOA 3VPSA 1V1MB 4HJRA 2ZUUA 5LMUB 4FEEA 3RS5A 3TE6A 5FT9A 1RM3A 2X42A 1IVNA 3DMFA 3F6EX 5AKLA 1YCFA 2PFGA 1IOZA 1HXHA 2OQRA 2Z2ZA 3G7NA 2GBFA 3HNPA 3AOGA 3N8IA 3UAZA 3FNFA 3VJKA 4BGDA 2DUNA 3AFIA 3QVLA 4TMTA 2AF4C 3ZLVA 1Y8RA 2ZPTX 1VP9A 1CFJA 1XJWA 3AP1A 4OLBA 4FMCF 3UWSA 2EBFX 2QX4A 3OIGA 2MYPA 1GUDA 3ZS9A 4KXMA 4CCSA 5LUBA 5BUCA 3QXGA 4AZ3A 3Q3CA 3BWDD 3QXHA 3FKSA 1WDTA 5BRNA 1JG2A 1DKLA 1ZN2A 3FHTA 3ZDRA 5CVTA 3KT8A 2O2GA 2FEWB 1ZD3A 2XGGA 4WZBB 4EVIA 3DAPA 2IUSA 2I4IA 2X1LA 1PGQA 1QF7A 2FSPA 4TRJA 1N8TA 9GPBA 4DUGD 3NZEA 4LJ7A 1IJFA 1H2HA 1XJ5A 3K9BA 1WXEA 1W4AA 3RRBA 4RVSA 3UHAA 1KYYA 3U7FB 3I0ZA 3TLZA 2Z3ZA 3EQ2A 4E6PA 5IH3A 2YMPA 3Q3EA 1FC0A 3G02A 2EKDA 1BXZA 3FZYA 4ATNA 1JIQA 2P5UA 1S2NA 4DCPA 1XI2A 3DHWC 3N2LA 5AOCA 1CY8A 4ZDKA 1YBFA 2GILA 2HU7A 4UUMA 2WJJA 3K32A 2YWGA 1XZEA 2G06A 4PYMA 3BSYA 3F0TA 2G7ZA 4H1HA 4LRQA 4XIIA 5DMHA 4ETWA 3H1PA 4HGQA 2IUEA 2II6A 4KWCA 1YS2X 3GGJA 5HIMA 1VPTA 3KUDA 5DKFA 3ZY6A 4GL2A 1K8XB 1V11A 4B9EA 2Z1NA 4ZT6A 1SVWA 4CM6A 3D0RA 1RRPA 2P4SA 3INTA 4O3FA 1UC9A 3OA2A 5CHYA 1XAGA 2WWTA 2WM8A 2H2DA 3QYPA 4FYJA 4MHSA 1JPUA 2H1CA 2HA5A 3II6X 4O1IA 3OTOB 5KO2A 1K27A 3FVQA 1C1YA 2FSFA 3FW1A 3AC0A 4L9RA 3AUFA 5AXCA 4RZXA 3U9TA 3SHTA 2HGZA 2WB2A 5JS1A 1FRZA 1SVUA 1U99A 2B6HA 3E5HA 3EGEA 3WYCA 2Q2WA 2CJWA 1B76A 4S1NA 1KGDA 3DJFA 4TYMA 1WEHA 2QN1A 3AU8A 3P4YA 4FOPA 1RZRD 1PNRA 5BW5A 2VAXA 1VE5A 4EG8A 3JCZA 4B2IA 3E9NA 3D6TB 1V7CA 4OOFA 1Y6GA 3NYQA 4NV3A 4P7KA 2AEMA 3H3JA 2MT9A 3M4NA 5IT9A 2QVCA 4YBRA 2W93A 1ZGGA 1Q0UA 3N76A 1D2CA 1W8DA 3QBVA 4JBXA 2EX4A 2XKKA 3V2IA 1L7QA 1XFDA 1YCDA 2IFTA 1IEXA 3FDIA 3QW2A 4LVNA 1IN7A 4XJSA 5GJCA 2ZYWX 4RK4A 2EF0A 2A2ZA 3QE0A 4FINA 4HDSA 2X1HA 4Z0HO 3WV5A 4DHWA 3UJHA 1XMXA 3LDGA 1ZUIA 4IL5A 5K45A 2W2KA 1F1JA 3BEDA 2YZKA 4TKUB 1U1DA 4YP1A 4RTSA 4XB1A 3VYUB 1P9RA 4A0SA 3D6FA 4G0VA 3LX5A 5JNRA 4V2UA 3R5SA 1MHTA 4NJMB 3TBFA 2AZXA 2Y2VA 1BROA 3ZDFA 1Y7LA 2ZGVA 5C18A 2ADMA