3RJOA

Crystal structure of erap1 peptide binding domain
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
419
structure length
408
Chain Sequence
GFPLITITVRGRNVHMKQEHYMYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERMHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoplasmic reticulum aminopeptidase 1
publication title Structural insights into the molecular ruler mechanism of the endoplasmic reticulum aminopeptidase ERAP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 153
structure length 408
sequence length 419
ec nomenclature ec 3.4.11.-:
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11838 ERAP1_C ERAP1-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 3rjoA02
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rjoA01
4KX9A 4FKHA 4PJ6A 4KXBA 2YD0A 1Z1WA 4FKEA 4OU3A 5J6SA 4NZ8A 4WZ9A 5AB2A 3MDJA 4FKKA 4FYQA 4E36A 5K1VA 4HOMA 4NAQA 4JBSA 4Z7IA 5C97A 4FYRA 5LHDA 5AB0A 4KXCA 4FYTA 4KX7A 3QNFA 3SE6A 5LDSA 3Q7JA 5LG6A 4KXAA 4F5CA 5J5EA 4KXDA 5CU5A 1Z5HA 4FYSA 4KX8A 3RJOA 4P8QA
chains in the Genus database with same CATH superfamily
4RH4A 3PP3K 2OXHA 1J0IA 3AVEA 4HYTB 4AQEB 1BBJA 4E2OA 1TKWA 1KYOJ 4MD5A 4XRCA 5C0FA 5IQ9B 5JIHA 4GIAA 1OGAB 2IV8A 4YS4A 1E50A 4GQ9H 1AZUA 1KLFA 4OW6A 4D8OA 2ZTBA 4ZUSA 1KY6A 1MFBH 3A22A 4JLRA 4KQ0A 4M43H 1AFVH 1T03H 4JFEB 1FI8C 4L23A 4WWKB 2VWEC 3Q6GL 2D3VA 4ZTEA 1R75A 4XVTL 2V17L 1K3IA 5CJBA 4E9YA 1T2XA 4NN5B 5TDPB 3QUXB 2FJSA 4HK0A 4EMZA 4PRNA 2FX7L 4S1DD 1IZJA 4QRTA 2D7TH 4TF4A 4LPYA 2YBRA 3QO0A 1TZHA 4EOWL 2DH3A 5E1AB 2A5UA 1OL0A 1A9BB 4N25A 4TUJA 3LKOA 2J2ZB 1PG7H 4KO9A 2F7PA 4FXGC 2Z0BA 3KWUA 1TU2A 4AVKA 2DWDA 2ED7A 4WFHD 2NXZB 3CDZA 3S9DB 1PPIA 3SO3C 1XO8A 1J1XL 1FVDA 3B6SB 4NKDB 4U05A 4OD3H 4I5BA 3II3A 4L4TE 8CGTA 3AY2A 3ISWA 1Z2KA 4XCEB 4DOHB 4AL8C 4P46D 4GQ9L 4XMXA 4F33B 4OZFH 4IYKA 1NDMB 5C0AD 5HHMB 4NI3A 4M43L 1AFVL 3ZL1A 4IRZA 1T03L 1N8ZA 3D85D 4OLVL 3D18B 2BNUB 4BFBD 4YBQC 1KG0B 3CLEH 3ZZSA 4IBLT 3KGUA 3L3HB 1HXYA 3FB7A 1X7QB 3OMNB 5F9JA 4NZJA 3FO9B 4HDIA 1W80A 1NFDA 2D7TL 3ZKXC 4UIKH 2BHYA 2ODIA 2NUPB 1T1XA 4JCWA 1PG7L 2WLNA 4M6OH 3BUDA 4XPBL 3ZDWA 4GPVA 1SXNA 3B9KC 1XSJA 1QYGH 1S2EA 2BVQB 4DP4X 2KI6A 3IGKA 4N86A 1TJGL 1UA3A 1R3KA 2NY3B 5GZNC 4X8GA 2X1PA 4OD3L 3VRIB 1PQZA 3P30H 3DPBA 4JZOA 5AENA 2BERA 4KZDL 1NCNA 3NJLA 3B2MA 3BPOC 4XVJH 4D9QD 2XY1A 3C12A 4FMVA 2D2OA 4FLOA 2QGDA 4WI0A 4Y19E 3GSQA 3FHAA 4ZPTA 3W5MA 3QJQB 5IQOA 3NIFB 4NWUL 2VW6A 3GBLA 3SKMB 4I2XE 3CLEL 5CEZL 3FJTA 1GCFA 3PE9A 5GJSH 5I17A 4L9LB 3JWNE 3MR9A 3NG5A 4MZ3A 2I24N 3LPFA 2FGWL 4GKZB 43CAA 2YGNA 4JM2A 4UIKL 3ILDA 4P23D 2JH2A 2VJXA 2OZ4H 4OIBA 2YGVA 5IQ7L 5J0BA 1E67A 4FI7A 1IIIA 3S34H 2VZOA 4PMEA 4ADIA 3Q43A 3KPSE 4N8CL 5DFTA 2QPDB 2GSMB 2B59A 1VIWA 1RY7B 3ARED 1QVOA 1QYGL 3O4LB 1DEDA 1YY9C 2ZNWA 2Z7YA 3FQTA 3N43B 4WWID 4LCUB 2GJRA 4W9JC 2X41A 4GKSA 3SYAA 2NYKA 3LRSA 3TBSB 2BMKA 4YC2C 4GH7B 3ZUNC 3MUGA 4ZQTA 2AQ3A 1MCDA 5HD8D 3GXMA 1TVHB 3MBWB 3PHOB 1ZOXA 3APDA 4OZGB 4UQ3A 4XVJL 2BXYA 4QNPF 4GO9A 2CMRH 3O9WC 4U3CA 3QDMB 5CNHA 1CGWA 2DEWX 4OUUA 2ETWA 5EWIH 3DRTB 5DVMA 4O2CB 4Z77A 1BJ1J 2D0GA 5CEYA 3FHQA 3IF1B 3FT1A 5FIEA 4DO5A 4FTVD 3RDJA 4JO3H 3LKNA 2Z7ZA 5GJSL 1A4JA 3FU3A 4XXCA 3V4PB 5HYQA 1WPCA 5BO0D 1KGJA 1SLWA 5K9KB 1AQDA 1F3JA 3GI9L 1LEIA 3SDYH 4RFEA 4PJBF 2H32H 3O3EB 4AC4A 2OZ4L 3E6FA 3HUJA 3JUZA 4QR7A 3S34L 5CINH 5ICXA 4YBLB 5DK0B 3DURB 1ZHLB 2V7NA 4XOBA 4PTUA 5FXCH 4HIQA 3QIWB 4OGAC 5BVJB 3V0WL 5CFHA 3PIQB 3UTSB 2R2BB 2Q20A 1MHEB 5F7HA 2WSDA 7PCYA 1KB9K 4KBPA 2J1KA 4JFZL 4FLSA 1Q9KB 1W0YT 1THAA 5D2NE 1HQRA 4JY5L 1I4FA 4XOEA 3V5HB 3PWLB 3AG1B 1HHKB 2GSGA 5IB1A 3QEUA 5DO2D 5F96L 2CMRL 4IEFA 3IMVA 1SQMA 2QMKA 4RGND 4ZX3A 2R1XA 3MJ6A 2IV9A 1QSED 1RUAL 3PGCA 4U33A 4JO3L 4E9XA 1R3JA 5IMKA 1FH2A 1JK9A 3NJFA 2C9UA 1X4XA 3BKJH 4NBZB 4ONFH 4P2CG 1ZLVK 4YHYB 5KBLA 3SDYL 2JXMA 4P59H 4Z7QB 2P8PA 4H8WL 1ZTMA 2WWMD 4FFWD 3GMQA 3BESR 1B0GA 3PRZA 3IDNB 5TDOA 3POHA 3NIGE 4JN2B 3RBGA 5FYLE 3TBBA 5IT2L 3SPIA 1LP9F 4S0SD 1OTSC 2D73A 4L2YA 2J55A 2XG5B 1ZDSA 1UZ6F 1BQHG 1UGNA 1CXLA 2H0PA 3AFLA 3OZ9H 2JQZA 2WTOA 5AWNL 1OZUA 2NSMA 3I6GB 3K80A 1XTMA 3IJHA 3L95B 3ELQA 4KITB 1JPTL 4BD4A 2IBZX 3RUGA 3BGMB 3UJTH 4I48A 1DUZB 3DNKA 3BQUC 1ZLWK 3AS2A 3DVFA 3W39B 5A3IC 1UEMA 2JI3A 3G5YB 4MMZA 3VFOB 3HMXA 1HYSC 1MCNA 1EAOA 4IRZH 3MRGB 1I1FA 4O51A 1KXVA 1DBAH 1E3FA 1PZ2A 1Q1JH 1UOLA 3BVNA 4MBRA 1G7JA 1ZVYA 4WU7B 4XODA 1KTBA 2R7EA 4G1EA 1E2VA 3D2UA 2DIAA 2YBGA 3BUTA 4NO3A 2Y7QB 4PJFE 3WY1A 1DDHA 3HG4A 4W9ZA 3FO2A 1A7NH 2J8UE 1IEHA 5EC1B 2YXMA 4ONFL 1PGRB 2R2CA 3TA3A 4P59L 5DZLA 3LN4B 3WTUA 2QZQA 3FTUA 4XT1C 4AM0B 3MRLA 5H35B 5JLZA 3V6BR 1DSWA 2AK4E 3NCFB 4N2IA 1XR8A 1S5HB 4JO1H 3VXRB 2P8LB 4KGLA 2VITA 2ZP8A 3WFBH 3WAJA 1Y6NR 3FB8B 5ISZB 1UD2A 4JREC 4WKZB 4M5TA 2L8AA 3L48A 4UANA 3ULUF 1BG1A 4F2MB 2OW7A 1FN4A 1YYCA 1IC7H 3UJTL 4JHUA 2ZX6A 1NDGB 3SDDA 3OX8B 3WYRA 2JJTA 2XWBA 3Q3GA 3ARVA 3BWAB 3SB3A 3MLTA 3WY3A 4U1GC 2C9AA 3RWIB 3G9VA 2R2HA 3KWWB 4YK4C 4XI5D 4GO6B 2DQUH 4MHHI 2EDWA 4MLSA 4LSSH 4WU5A 4JJHA 5LAPA 5AG8A 1XGRB 4PJDF 1IBBA 2XZAH 3S3DB 5CJ8A 1P7QB 3FQNA 4R0LA 4UT9A 2A9BA 2OL3H 5IVXE 3TN0D 2WKOF 2F8XC 3OAUH 3FN9A 4N9OB 1M53A 2DBLL 1QNIA 4KKPA 4JO1L 3TIEB 1JF1A 5JQ6L 3GBNH 3FONA 3RWJA 4N90E 5CZXC 4NUMA 3WFBL 1H3XA 1S7XB 3TBTB 4ODHL 1GHFL 1MAMH 3AU1A 3V0VA 4AZ8B 5K69A 2IPKB 3PQYE 1IC7L 4BFOA 4UV7H 2ZUYA 3IGAB 4XR8C 4YAQB 1HT6A 3GM0A 4TQPA 4AQ1B 4MQ7B 3BP4A 5JDSB 4DPRA 1ONQB 5IZ7A 1XIWD 3IAGC 1ES0B 1GZQA 5E6UB 3QFGA 1JDDA 4Z95L 4AKQA 2CA4A 3VXME 1PX4A 3EGSB 1OP3H 3MO1A 4G80A 4U1SA 1IBYA 4KI5D 4ANWA 3SZ6A 6PAZA 3HZVB 5D1QE 3DVNA 3DDGA 1LILA 3TH3T 2XZAL 4HJTA 4WUUA 1DLFH 2A6DA 3KS0J 3RY4A 4L4JA 3WY2A 1P6FA 2OL3L 5DUMH 5ETUA 1FHGA 3GHEH 1NPJA 1IIKA 2X1OA 3OAUL 2GYSA 5EMYA 43C9A 2DZEA 2FQGA 4AUUA 5I1LA 4FX5A 3ZTNL 5GS1B 1D5IL 3IPBA 1HOCB 1OARH 5F3BA 4UDTB 2OSYA 1YY8B 3SD2A 1M3IA 3QUYA 4TSBH 3VCLB 1U8CA 2NY0C 1Z66A 2AJUH 5GIRB 4UQIM 1KXTB 3CZFA 2XWTB 2XG4B 4KXBA 5ICYB 3NVQA 3N55A 3V9FA 5ILTH 2C1OA 2N01B 3N44F 2NDGA 4LPCA 1KJ2A 3L3JA 2GKIA 4ODWB 4R7DB 2LLNA 3AACA 4DEPB 3JV0A 1YN6A 1VA9A 4IS6B 3DX6B 5E9DE 3ZKMC 4P46B 1T1YB 1WA2X 4PJCB 2F58H 5FF6B 5CSZA 1BLNA 1MJ8H 4XN8A 5C0AB 4CVWA 3VH8G 4A6YB 2NLJA 1DFBL 2EDHA 5DUML 3D85B 1ZKAA 4ZFOB 4NP9A 1MW1A 2E0PA 2I5YH 4MJ5B 4Z7AA 2PPEA 4NUPA 2ZSVB 1XF4A 4NUJA 5BXFA 4J3VA 2CGZA 2HLFC 2UY6A 1CFTB 3BAYA 3KXFA 3LCYA 4W93A 5G2NA 2Z6FA 4TSBL 1ZHNA 3O6KL 3E3QC 3S5YA 5JYMA 3ULVE 3NUKA 2WANA 4MAYA 1MRCL 3HMXH 1FG9C 4GRWF 2KL6A 5ILTL 4X6DB 4HS3A 4NQDA 3KYNB 4JPIA 4AEFA 4B41A 3P2BA 2BRQA 1QQDA 2HT2C 4KY1L 5DMIH 2Q8AH 4ZUTA 4BGDA 2MPAH 1J05B 1IC0A 1BYPA 3ZZLA 4CKVX 1NGZB 4LESA 5C0RL 4XNYH 1DSFL 3FXIC 3V0AC 3RP1A 2VQ1B 2D7PA 3O11A 4FLQA 4N28A 4CBZA 5LKNA 4NQTA 1EQWA 4N2FA 4PR5B 1U0QA 2F53B 2VXTH 1MJ8L 4KVCH 3HIZA 4C8XA 4WEMB 2UWEE 4JMXA 4UNUA 3L16A 2W95A 4L8BB 1EO7A 3MV8E 4GMSL 3KLAA 5IUSA 2I5YL 2OX5B 5CLTA 1NMCB 1ACYL 3U2IA 1ORQB 3HKZA 4JM2C 4GFXA 2C3HA 3CN0A 1WFNA 1EDYA 5BRPA 2X42A 5E4EC 3MJ9A 1EUTA 4PGDA 4P23B 3I9GH 1XGYL 4Z78A 4D3CH 3VB9A 5I24A 4AM0Q 3BDBA 4L3AA 2YOAA 5D6CB 2P8MA 1BQ5A 3HMXL 1IAIH 3U0PA 3M8OH 4TQEL 1S7SB 1TSRA 1UWXH 3IRZA 1XB6A 3Q01A 4P57B 5DMIL 2W0FA 3NK3A 4WHTA 2Z7UA 2IGLA 1J87A 1HK6A 4PLJD 2BS71 3L6FB 4XNYL 5FO7B 2WBXA 2EICA 1VFBA 5A2CA 5B38B 1U3ZA 2X4SB 4I4WA 1O7DE 2IDUA 3PABB 4AJ0A 1SDDB 4FQJL 3R1GL 5DQDH 1P5UA 5L9DH 3NJMA 1Z9MA 4KVCL 4UT9H 2WWNA 4JL2A 2YS4A 2XYCA 4KJYB 2R39A 4FCHA 4ZW5A 1AGEB 5KYYA 3Q8BA 4PG9B 4XXCC 2BZCA 5F7FA 5T3ZH 3CLFL 2Q10A 3QWRA 4KMLB 4FTVB 4TTDD 1MWAB 3IJ7A 3LNFA 4OJDH 2F5BL 1SJMA 3IXTA 4DP8X 1DP0A 3BRDA 4QHLB 5BO1L 3TC9A 3CXHJ 3QDJE 4S1RH 1UXWB 2AERT 1VFAB 3HE6A 1U8KB 3M6DA 1B6UA 3QUZA 5F7DB 3A4AA 3SDXE 3MDJA 1NKOA 5B21A 3MLVH 4MA1C 1IAIL 2AC0A 3M8OL 3NIDB 3L3OA 3VSQA 3APCA 3IU4L 1J48A 1CUOA 2B1HH 3P4NB 5ACLA 2EDLA 2YAMA 1Z0NA 5I8CA 1D9KD 4WFEE 5DHYA 5DLML 5E23A 2OS7A 2YD2A 1OGTA 1SZNA 3DIDA 3ARGA 2VT0A 4JRXD 2F8VA 1PX3A 3BWZA 3KWTA 3QHFH 1UADC 1M6OA 1CDHA 5DQDL 2IADA 3MLYH 1CTMA 2HLAA 4UT9L 2DQTH 5EO9A 5KYUA 3KEDA 3AWFA 2ID5A 4ZW6A 2X40A 5FO8B 1U4FA 3HHSA 2M1KA 4RGNB 1QLFA 5E5RB 3ATBA 3ZU8A 1QSEB 2AVGA 3EH5B 2JTYA 1KPRB 4JGUA 5DMKB 4XN7A 2AJ3B 4IKKA 1HZLA 3IB4A 4HC1L 5FR3A 5B1AB 3BN3B 1OTUD 4TULH 1D6EA 1TTFA 1BAFH 1S9WA 2AXWA 4DVBA 5JZ7D 1CYGA 1TVBA 5ESAA 2MHAB 3OGCA 3MKGA 5IF0A 2XQBH 4N8UA 3X1EA 3OAZH 2JELL 4BELD 2HMID 1KJ2H 3R18A 2IH9A 3AS3A 1BIHA 4HIJB 4Y2LA 4YOKA 1KWKA 2B1HL 2X6CA 7TAAA 1HNFA 2VLME 3EOAB 2QHLA 4MMZC 2A9CA 4MYPA 5DJAB 2DQEL 4KKBD 3STLA 1AJ7L 2MMXA 4RQQB 4LIQH 2XN1A 3C08H 1KXVC 3MLYL 3PJNA 5EDSA 1DUYB 1XD1A 4WQOA 4XMPH 3ESNA 1IUZA 4EI6A 2FR4A 1JXKA 2W07B 1CDYA 3KPRD 2UZXA 1UCBH 5FW7A 4QHKJ 5CLXA 4YSSA 2O26U 1TLKA 4E41A 3LVEA 2VAAA 5A40E 5C92A 1TEGA 3TA3C 3DX3A 2WZAA 4TVUA 3MXWL 4JKPH 3LRGA 4Y8AA 4TULL 4D0BA 2VO8A 5TQ2H 4WW2F 4X5WA 3CFIC 4MLIA 4X4KA 2G4EA 1RUKL 1PD1A 5IJVB 3WFHA 2XQBL 4WJ5A 4X8CA 4HJJH 1U36A 4F2EA 4FJYA 1PAZA 4M4PA 2R9HC 4PRID 4G2AA 1YDPA 4NJ9L 1IC5L 1N8OE 2J6WA 3IJSA 4F8QA 5L4FA 5CGBA 3EJTA 5AYQA 3SDDC 2YXVA 4M56A 4E42A 4HETA 2JJTC 5F7EL 2O5YH 3OKKA 4LCWD 4NRXB 5IW6B 1NAKH 2WUBL 3IWUA 2BOBB 4NKOB 3C08L 3LPWA 2DQHL 5ABZA 4DGVL 4XZUA 4IKIA 4NS0A 1UCBL 4HU2A 2OZNA 3A3YB 3FB6A 3TIDB 4P2OA 2OMTA 3VXQA 2D31B 4OCYH 4R0LC 3ECWA 1PSKH 1V7MH 4NI6A 3MJ9H 5F88A 2X2JA 5LBVA 1FBIH 2BVPB 3QUMB 1DJIA 4KTEH 4P4KC 1WG3A 3G6AA 5TQ2L 3TN0B 2W88A 3MV7D 5JIDA 4NO2B 2XN9E 3DOSB 4QYOA 3MV11 1WGOA 1DE4B 2F1BA 3U9PL 2VXSH 5ANME 3ZYOA 2AANA 3PAVA 2NDFA 1JN6A 2YUZA 1HEZA 1YJDH 3U48A 3D05A 4KDVA 3OHMB 1KTDA 3DUUA 4HCIA 1N0XL 2LLLA 2OJ1A 3FFCE 1VEMA 2KQMA 3NDZE 4PJ6A 4W6XB 3B9AA 4QCIA 4XNDA 1NBQA 4TVPD 3H4HA 5I0DA 5SV4A 1XIWB 4F37F 1CG9A 3BZFB 5DMGC 1S5IH 5DVNA 5SWSA 2E7MA 3KJ6L 4IU2B 3O81A 3QJFA 3RTLA 1LD9A 2RQEA 3LYRA 1A2YB 1PSKL 1SFDA 1DYZA 1V7ML 2KZKA 3FQRA 3MJ9L 4KAQH 3UZVB 3FU6A 3W57A 1FBIL 3BD4A 4YHNB 2VDKH 3DMMA 5C0CE 1OTTD 1YVLA 4UMSA 3NRFA 2BFGA 1KPUA 4GAAA 3SE9H 4ZMAT 2UUDK 2YRPA 2MCPH 1OT2A 3MTXA 5HPMB 4CL7A 4NQVA 3QUYC 2I85A 4W4OA 4WI3A 5EPMB 1L5GB 3UPRA 3O3BA 1O5DT 4FGMA 1P5VB 3CSBA 3CX2A 4XBGB 4Z7VA 3MLRH 2F68X 4Y1AD 4F57H 5IHZB 3TNNA 4N2AA 5BW7A 3NIGF 1N70A 5GGSA 1ROCA 4ODUB 4PW9A 5D7IB 4Z76B 1UZ8A 2APTA 3OB0H 1H5BC 3MAWA 2K8QA 4TNVF 1JWMB 2BOCA 5GRWA 5GZND 1KJ3L 3EO0A 1T1ZB 3JYCA 1FO0A 2Q76B 4H8UA 3KL5A 3T2PA 4JY6A 1S5IL 2IQAB 3O6MH 1K9TA 3GBML 3IDYB 5IMLB 2FWLB 2WSKA 2O61B 1GC1L 4IOSD 2CPUA 2XWJB 4KV5E 1FFRA 1CLCA 2BO0A 1RKRA 4ZMTA 4KAQL 1GJWA 1U8LB 2WIIB 4N6RA 1NIEA 1VFOA 1XB3A 3T4YB 3HC0B 5D96B 5H4YA 2ADGB 2YKLL 1EV2E 2OW6A 3CU1A 2MCPL 4XAWH 4PJFF 4XN9A 2FEDC 3ABZA 5JOPD 4C83B 5FGCB 1IGYA 3TP4A 5IHWA 2J8UF 2YQ2A 1T22A 3D0LA 2JJVA 4MAYC 3SKNB 2W1NA 1AZNA 2MQCA 3MLRL 3P0VH 5AOZA 4F57L 4CJ1A 4XNUH 4UQEA 2FJFB 2MEJB 3HNTH 4NM8H 4RFNB 3ARPA 1R0AL 4FULA 3LHPH 4OKDA 1UQSA 2X4PA 2GAZB 1Q94B 5EA0L 4N2OA 1L0PA 2QDWA 3DX8B 1D5XB 2EINB 5HVGB 4WI7A 2I7OA 4W9KC 1G7IB 1VACB 4KC3B 5I82A 2DWYA 2J73A 3MREA 4NQED 5DVPA 1RMFL 4BHUI 1OAKH 1TOXA 1UC6A 1BWMA 3O3DB 3BD3A 4IW4C 4W70A 4GI8A 5CBEA 1OSPL 3VFVB 1RIVL 5JW5B 1INQB 2VDLB 4OV5B 1CIDA 4F8TA 5JPNB 3UXFA 3FT4A 4XN2A 5FKPB 4AV4A 4OSUL 1A3LH 1NM4A 5FHAH 3WD5H 4HD5A 4MZIA 4U6HA 4F7TA 3P0GB 1X5AA 4G9FA 2HTKC 4GINA 3WN5A 3UEZA 1BCIA 1NANH 2AFNA 4XTRD 3U0TA 3MC0A 3GIZH 4NSKA 3AB0C 2VDRB 3KBHE 3P0VL 5IVXF 1SXSA 5CILL 1LLAA 3G08A 3CN1A 3CK0H 4NM8L 2WCPA 2DPKA 4QEGA 1E9QA 4CSSA 3VX0A 2H0JA 2R2EA 2P48B 1JYWA 1YJDC 4LEOA 3LQAH 3B7SA 4ZO6A 2H6OA 4M61B 3DGGA 2GSIA 3ZT6A 3OL2A 1P5UC 4L4VA 4XB8A 2ZX9A 4ZOEA 5F1OB 4BDVB 1NINA 1OAKL 1IBDA 4JRYA 1FGVH 4MNQB 1AR2A 3LZPA 7FABH 4M1GL 3WIFB 4B3EA 3CFDB 4ZQKB 4D0DB 1LHZA 1RJZB 2BXZA 3JTBA 1GC1C 5E2UH 3QZPA 3WFDH 3TNMA 1FNSL 3GC3A 5BS0E 1A3LL 1PCXA 4FDWA 3S2AA 3IK2A 5DD6B 4LDCA 3DJ9A 4J7RA 4UT6A 3OZKA 3HE6C 1P1ZB 1QUNB 3QUZC 4JFXA 3B34A 1NDTA 5FK9B 5EOQL 4DP9X 1SDAB 4RIRB 3VD1A 5DD5L 3NBNA 1Q9OA 3QXVA 2DF3A 3L3OC 4JN1H 3T0WA 3CUPB 4Y9EA 3TO2B 1J86A 3EJSA 4TQHA 2YRLA 5AKRA 5AZUA 2BSCA 3SSGA 1GTFA 1FC2D 1IBFA 5TDNB 1DL7H 3LQAL 4LVNC 3TYFB 2AMUA 2DWEB 1UT9A 3ARGC 4HJUA 1CICA 3DJTA 1D9KB 5DF0A 1I1CA 3BQUD 1M1XB 2F1AA 5EUOE 1IEAB 4JRXB 3JZYA 4E5XB 2H47C 4TLUA 3RVUD 3VXTA 1HYSD 4FFVC 3ARFD 3VSUA 3C5ZD 1FL5A 1FGVL 4YSOA 4ZAKA 4B53A 3V6FA 1YMHA 3PY9A 4PP1C 3QPQC 4MRBA 3H2QA 5E70A 5HJDA 5I28A 1VGEH 3A0OA 5C8JA 3RL1B 1YAIA 4IMLB 3CZUB 2Z35A 3WFDL 3PCYA 1A7RL 4DW2H 2Y1AA 1ZLDA 3UAAA 1UJ3A 1A1OB 4XB7A 5DO8A 3ESPA 4AH2B 1LXMA 3N06B 2Y9RT 1WV7T 5KS9A 3ZIYA 5T5NG 4NJAH 5BNXD 2Y1VA 5FFOA 4KXCA 1KJMA 4HIEB 4M29A 3DV6A 2HRHA 4JN1L 4HPHA 4PGCB 4PJXE 4EZJA 3CVDA 1FO0H 5HDLA 1TTGA 2EYTA 3LJ3A 4M7JH 3AUVA 2K45A 4L18A 2FWOA 2PCYA 4WV1A 3VDBA 5BRZD 5AVRB 3ULVF 3SCMC 5CJ5A 3GLZA 5JYLA 2FO4A 1MHHB 3NA9H 4KQ4H 1RD6A 1OANA 4LKXA 2C5DC 1EAPB 2E6JA 2OYMA 3KPRB 1SYSB 1AY1H 1BHGA 3CSGA 5DD3L 2WVVB 4IQHA 4XNAA 5IFJB 5CU5A 3MGTA 4ZSOE 3PXHA 5TE7H 4FFZA 1UA6H 3GXPA 4XN5A 2FX8L 1MNUH 4B9IA 4TNVK 1ZT1B 5L2JA 1OD9A 2UWEF 4HWBL 4LASH 3EF7A 3CFBA 4LDEB 1NPUA 4AW4A 1LO3H 4EN3A 4Z7NE 2EUVA 1J8HA 3RNKB 3GYRA 4H1LA 5FCUL 3UO1H 3DI2B 4Z3FA 2D4DA 1XZ0B 3HC2A 1OO2A 5CZXD 4XC1H 4TRPH 5F1KC 1FO0L 1FNGB 4P5KB 4PRIB 3ZDYE 4M7JL 2PW2B 5F9OH 4P2QB 2Q8BH 1K2DB 2OMWB 2OYPA 3T65A 2WLJA 3KPLA 4OR1A 4WTXA 4DGYH 2ZX7A 3OJDA 3KWVA 2TSAA 4JFFA 4J3OD 4LCWB 3BZEB 1LO5A 3TZVA 3HAEB 3NA9L 5FLVA 3PP3H 5IK3A 2CKBL 4NNYA 3LQAC 3ME0A 3N1QC 1GW6A 4Z0BL 1JL8A 3CQFA 2Y1YA 3DV4B 2UYLA 5T1KA 3BW9B 4U0RC 1OQXA 3PPEA 2X2IA 4PG2A 2OULB 3K4ZA 4LVHC 1AY1L 4P2OC 4AJVA 1W6WA 3GGWB 1MJUH 1BXVA 5E9AA 3OJ2C 5GGRB 5JW3H 5D1ZA 2CAKA 3JT2A 3Q6FB 4NO0D 4OD2B 5TE7L 1VKXA 3C6SB 1LDSA 3GJFB 4LASL 4LGPB 2PYEA 2EDQA 3MV7B 3OB8A 3BI9X 1JOIA 4NZUH 3GSXB 4HWZB 5BCAA 2IWEA 2RMNA 3EZJB 3K2KA 4XC1L 4TRPL 2PTTA 1FZKB 2XX0A 1FLRH 3QNXA 4X6EB 2WBWB 5HP5A 2VMCA 1AE6H 4EIUA 2ZWYA 4OFIA 3T0XA 4XO4A 4DGYL 4PVBA 5FUZH 3BAIA 3WTXA 5CJOL 3Q8FA 2ARJB 3SDXF 3TXAA 4OCMC 1ERNA 2BWIA 2BWQA 2K7PA 3SO3B 3L13A 2BH0A 3I85A 3ROLA 4KUZH 3WUWA 4KJQD 3APFA 3E38A 2ZXCA 2XZQH 3ZKMD 5FOJA 3VNZA 1MJUL 4MSWA 2BW5A 1EUUA 4UT6H 4GW5B 2Y7MA 4R4BB 2FIKA 3DMMC 2QKIA 1HHJA 2G0KA 3ZTCC 2DMCA 5GRXG 4O9HH 1FIEA 2X88A 3BIKB 2E56A 4JCLA 3QFDB 1YC8A 2HRPH 1WUNT 2WO3B 3ARWA 2W94A 3NFPB 2BSTB 2YUWA 1LE9A 3LZRA 3TV8A 4X7SL 4BQCA 3C8HA 3QI9D 4W4OC 4KO7A 5HDQL 5J6HA 1FNFA 1K4DA 4KJPC 3RGHA 2R69H 1V55B 1FLRL 1PZ3A 3ZKXB 2VLJA 2ENSA 3HB3C 4BZYA 3MRHA 1NBYA 1AE6L 4ETQB 4MCNA 5BW7C 2KLRA 4Y1AB 5LNEA 5ERWA 1HZHH 2GBTA 2NNFA 2SODB 5FUZL 2VABA 4QRPA 1KIPB 4G7RB 4G6JH 4MJ6A 3LHAA 3QPXH 4WHDA 2E7CA 5IV2B 5KBNC 2DLTA 2HT2D 1HXMB 1MUJB 2EIZA 1MFEH 4EI0A 4KX7A 1TO5A 2EXSA 5EZOH 4IDJL 2JWYA 2XZQL 3EYVA 4AGLA 1CBVH 5CUSH 3BPOB 3H56A 3FH5A 1BP3B 4UT6L 1BZ7B 3GK8H 4BK8A 4ELMB 1JZIA 2PLTA 1YEGL 4O9HL 2D8KA 4N2MA 1S9YB 3D6GA 4AUYA 2LR4A 1L0XA 2K3HA 5JHLA 1RZGB 2VDMH 1U3JA 3CMOL 4X98B 5EF3A 3Q13A 4JM2D 2WBKA 3PNWA 1ZGLM 3CSPA 3HNSH 2R1YA 2KH2B 2R69L 5D7SL 2ZOLB 2FYYA 3UZQB 5HY9A 3TJHC 2X2HA 2O1AA 3RVXD 5EZIH 4AWJC 3BE1H 3WBDA 2PWDA 2VLKA 1QRNE 2Q7NA 5KUMA 1QFOA 2XZCH 4G6JL 3EO1A 3D4ZA 1AMXA 1IZKA 4M8QB 1MCPL 3EDJA 3E1ZA 4OGXH 5JNYB 1GL4B 1UT1A 2ORBL 5G4NA 1N9PA 3SKUD 2IDTA 4YC2B 5EZOL 1FNEA 3BP6B 3MBED 1LMIA 3CG8A 1QLRA 1CBVL 1QFUL 5CUSL 5D1XD 4NQEB 4FFZH 1TQUA 2E6PA 3FULA 2ZXBA 3GK8L 3GZKA 1KB3A 4L29A 5C0GA 1TJIH 1WCQA 1PZ5B 3HBPA 5LBSA 4H1LH 4B0MB 1AKJD 4NQCA 3W1ZA 2VDML 2WLMA 3D4CA 2N1KA 2XLLA 4X9BA 4AVIA 2PTUA 4B9YA 2WBJD 2V5MA 3B5TA 5MP6H 3HNSL 3FTXA 3WN5C 2BSDA 5I6KA 5KVFH 4G3YH 4X99B 1E7UA 5C07E 5FWQA 4J8RB 3ZMEA 4JPSA 1GYCA 1LQSR 3NH7H 4PBWD 5EZIL 4HOXA 1ZA3A 4X6FB 2BINA 1BLIA 3V0IA 2R23A 4ZMWA 1ZT4B 1AD9A 3B9EA 1N5AA 1G4RA 1PZAA 5FAAA 2GITA 3VFUA 2B0SH 2H0FA 3LN5B 2XZCL 4ONHB 1RLBA 3KWXA 1JVLA 2H1XA 4U1IA 4GUQA 4ZOBA 2NSXA 2CM5A 3BAKA 5EEWA 1NC2B 3JYBA 4X50A 1YEWA 3GB7B 3T2NL 5IGXH 4N8VB 2G75A 4HGWB 2VJ8A 5AB2A 3LZLA 2IXQA 4UIMA 3QVAA 4HUXA 2CO1A 1XSOA 4HMEA 1T7WA 1DBKL 5L88L 4YHIB 1TJIL 1UH4A 1D5RA 5AW5B 2AJYH 5F3FA 1JXFA 2VKWA 3V4VA 2I69A 4ZUVB 4XPAL 4GAYA 1IL1A 4P3DB 4C56E 5IB3A 4PJBA 4OZFB 1IARB 4PJGE 2BZ7A 3GSOB 1GH7A 4TVSa 1Z1WA 1LWHA 3AAZB 1ZLVH 4LOFA 2JJUA 1ASPA 1ACCA 2XSKA 3LEVH 4NAMA 4BH7A 3S3CB 3DUSA 4P04A 4IKLA 1YUHB 3CHSA 1C5DA 1PU0A 2IFFH 1ZLSH 2B0SL 1YYLH 1D5ZB 3ZKSD 4E9VA 1CI5A 5PCYA 2ITCA 3V79C 2B3RA 4OJFH 5A2IH 3BAEH 5IGXL 1CDUA 4NO5B 3BQUB 1OE2A 3T2OA 2A74A 4YO0A 1E6OL 1ZLWH 3BPCB 4PRPE 4DK6A 5D5MB 5DZOA 4ZAKC 4M4RB 2OP4H 3TBVA 4JRWA 3ARFB 3C5ZB 4U1NA 1IKNA 4A7UA 3UYRH 4ATTA 2A83A 3D2UD 4GAJL 1L9MA 2QHRH 2VAJA 4N2DA 2GIXA 5B1BB 4JDZA 1G9NH 3X3GL 1R24B 3WDHA 2AKRA 3HRZA 3ZTDC 1WWBX 4WTWA 3TA3D 1XT5A 3MRMA 1GVIA 3Q1EA 3NSFA 2GUOA 1PKOA 2P4AB 1JFQL 2ZP9A 4ANXA 4FADA 1BZOA 1T0MA 2XOTA 4F7EA 2P80D 3TPUB 1TNNA 1X9QA 4Y8DC 4I1PA 2ZAIA 3MRKB 5IOKA 2IFFL 2IAMC 1KLGB 1NICA 3ZL4H 4UWQB 1YYLL 2DIBA 2R9HD 5EU5B 4A7GF 1C16B 1GGCH 4HXBH 4KGJA 5DTFA 4DN4H 4JREB 4WV1C 3FTZA 1URLA 3RX8A 4BUQA 4OCSH 4DZ8A 5LUMA 2DLGA 4OJFL 5D93C 3OKMA 3GTTA 3W3BA 2CD0A 1GRWA 4AT6B 3CC5B 5BRZB 2WXKA 1GCYA 4HFWA 4J2XA 2RQ8A 3GXIA 5DRZA 4XCNA 2OP4L 3GHPA 1II4E 3C8KA 3GPEA 4NEHB 3BZDA 4TLSA 4QHKI 2R4SL 4DOHE 5AB1A 3ZQ9A 1C5CH 2VRQA 4U1GB 3V0JA 2VMEA 5CEZE 5KBPA 4MVBC 3ZQWA 5JHLH 1G7QA 3AC0A 3N9GH 1G9NL 1KCRL 2NQ3A 3PWPE 4DKTA 2COVD 3T6QC 1KCVL 1S3RA 2DN7A 1U41A 2GJ6E 3AG2B 5IM7B 4DCQA 3TCLA 3U9UB 5C70A 5J9PB 2WTRB 1I82A 2H4EA 1AZRA 1RUMH 1KYOK 2ZT9C 1G5AA 3LMJH 5AVZB 4EN3C 2MNUA 2CNYA 1XH1A 5A16B 3ZO9A 2Y36H 2PABA 5L4IA 4U7MA 5T3ZD 4JG1H 5CP3A 5IQMA 1UB5A 5JPMA 4X8XA 3R8BB 1HTYA 4ENEC 5SX5K 1JMZA 3ZL4L 2CO6B 2HA1A 5I76B 2AJXH 3G6JB 1GGCL 4HXBL 4NOFA 3L7EA 2NW3A 2KDGA 1ZV2A 3CGTA 1UB6B 2YD9A 2WO2B 2IPTH 3QARA 1NBZA 1RJYB 4NZDA 3DVGB 1JPFB 2OXHB 3TZVC 1QG3A 2XN0A 3OKDA 1MCLA 2EDRA 2LHAA 4PP2A 3WSQH 4RMTA 4MD5B 2X4UA 4PGBA 5A2AA 1QAWA 1G9MH 1C5CL 3BZ4A 4PG2C 5LBSH 5C0FB 4A2LA 3P9WB 5DMGD 4ZW8A 4M93C 4APQD 5IVNA 1SEBA 5D1ZC 3N9GL 3WMPA 1KFAL 4PJDA 1SLUA 5HI3C 1Y1UA 3D51A 1RJLA 1G0YR 1PIFA 4ZUSB 5PAZA 2E5EA 1EWHA 4JLRB 3MUJA 1JHLH 5IIEB 1RUML 3GMOA 2WKOA 4WJG3 4AYSA 1QFHA 5C0BA 4NO0B 4XWOC 4HV8A 2A4CA 2WXQA 2ZWSA 4O02B 3FOMB 5AD0B 1GYAA 4LOUD 3UC2A 2BNQA 1WCBB 3NCEB 4HK0B 5KTEL 5KVEH 1BYOA 4M6AA 4PRNB 3GKWH 2CIIA 4LHQB 1W16A 2MCAA 1KDJA 3QO0B 1HKLH 3QUYD 1TZHB 4TNEA 4N5EC 3JTSB 3NJJA 2AJXL 2UVEA 2OSWA 1MCCA 3QDHA 4OF6A 4TUJB 3LKOB 4F15C 3S5ZA 1Q9WA 2G9KA 1RERA 4XGZA 1LO4L 3VFWA 3T04D 2XWEA 2DWDB 2GG1A 3HG1A 5GRJH 4N26A 3BGFC 1K4CA 4LSVL 1FVDB 3HLKA 2NXYC 4I5BB 3V4VH 2MTAA 4JVUA 5LBSL 5JIPA 3GSRA 4H8QA 4OZGE 2VSCA 4GW4A 5E6RB 1HNGA 1I1YB 2FHCA 2ITDA 2P42B 2HJKA 1AZVA 1VF5C 3FN3A 3BLBA 1CFQA 2QKIC 5EUOF 3KBFA 3QJOA 4HQQH 4NERA 1E4WH 4WI4A 1I8UA 1DVFD 1Y18B 2R0WH 1LGVA 1N8ZB 1NUNB 1P9MA 1TTRA 2O6FA 2Y72A 4GIOA 3UZEA 1LWJA 2OK0H 2PP8A 3QFJA 1G9NC 1HXYB 3LZOA 3OM3B 3FB7B 3VRJA 1LNUA 1NWOA 5F9JB 3GKWL 4P2YA 4QHMB 1KV3A 4HDIB 1FYTE 3FUFA 3KXFD 1FPTH 3OXRA 3P73A 4LCCA 4DAGL 2UX6A 4LP4A 4JFSA 5F7AA 1NM9A 2W8CA 3NDYE 1JPST 4RGMB 4JHWH 3KL0A 1TEFA 4AYGA 4PJ9A 4I3RH 4NQDD 4Y5YA 2Q6WA 5EEVA 1OAYH 2Q2EB 5GRJL 3UTSE 3AXLA 5KAQF 2WQUA 5C2BH 4FHBD 1O6SA 5I74C 3U4EA 1S7WA 3ALPA 3ZR5A 2VL5A 4PJXF 1E4XH 2YD0A 4YVNA 1ICTA 1HX0A 3EYUH 4GQZA 4BV1A 4Z3HA 2HZHA 1KCBA 3FUDA 2VM9A 3OKOA 4F3FA 4PSPA 1HL5A 2HKFH 4WI0B 5F9AC 3GSQB 2OQJA 2H45A 1E4WL 1FH5H 2WXMA 3CN2A 2JK5B 2WWOA 4PV8A 2R0WL 5I1CL 2CPCA 5KVGE 5B3NA 3WKYA 1T66C 1TCRA 5F97E 2J44A 4WFGD 5DGQA 4GEIA 2HUHA 5FYJD 5I17B 3D39A 3MR9B 3R4DA 4Z7QE 43CAB 4KDWA 4JM2B 1ETB1 5E51A 3GO1L 3VRLE 4YGVB 1G1OA 5K1NA 4DETA 5E4EB 2HTKD 5I9QC 2R83A 3SE8H 5FDWA 4JHWL 2NX5E 3T0DA 2YN5A 3KYAA 3LIZA 4X6BB 25C8L 1F4XL 3PJSB 1DO5A 4Z7NF 3LOWA 1KYDA 1UXSB 1T6WA 5ESVA 1TETH 3FQTB 4LHUA 1A5FH 5F7LB 3ZJAA 1T4WA 4DHLA 1BA9A 4A67A 1E8XA 4GKSB 32C2A 3LRSB 2BMKB 5C1MB 5LXGH 3S8FB 3MUGB 2WXIA 4PV9A 3RQ3A 4FCAA 4D8PA 4M6NH 3ZDYF 1JTTA 1NEUA 3ZZ1A 3T0BA 4WSGA 1K6QH 1KIRA 4HKBA 5BV7B 3VE0A 2HKFL 4FNQA 4OF7A 5D7JC 1KBGH 5D1XB 2YGOA 1JZGA 2A6IA 5F7BA 4OUUB 1AXSA 1G9MC 4PHZA 4HUCA 4Z77B 4XXDA 5CEYB 1AQ8A 5C97A 4LFHD 3RDTA 3DIFA 4ETYA 3LKNB 4MDIA 2CO7A 1A4JB 1JK8B 1B4RA 3ULUH 2Z64C 4EDWH 1A14H 1F3JB 3PWJB 4OUOA 2WBJB 4RFEB 3U2JA 3VXSE 3E6FB 3HE6D 3TT1H 3VXRE 1BFOA 2FWUA 3SE8L 3WFCL 5DVKA 3UBXG 4MNHA 5ISZE 2V7NB 1F2QA 4PTUB 2ADFH 4BUGA 3Q2NA 5J56B 4OF5A 1Q0XH 1S3KH 4WO4D 1A5FL 4MA1B 5GGVL 4OZ4A 4HIHA 5AVXB 2XXCB 3JXAA 1PIGA 4ZTOH 5TE6H 3WNOA 4LMQI 4M03A 4M6NL 3J07A 3A6CH 4DPCX 1I4FB 4XPGL 4HOMA 2GSGB 5IB1B 3QEUB 3QCVH 4Z7UB 4FFVD 4IEFB 4N85A 4TS6A 1T6BX 3B2UD 3FYIB 2FQEA 2FJUB 4R26L 3WOVA 2R1XB 1HCVA 3SPVA 2PP7A 1MCWM 2YD3A 2PPFA 3MBXL 4PP1D 3PGCB 4WW1A 4XP1H 1YNTF 4PHXA 2IGFL 3CFJA 1R3JB 5IMKB 2ZICA 1DVUA 1JK9B 1F58H 2XX1A 5AUMB 4LLQA 1EIBA 4G7YH 2JXMB 3ESMA 3MGAA 3O2DA 4YXHL 1TZOA 4Q4IA 2XRAH 5E2JA 3TT1L 5IREA 1B0GB 1OK0A 5TDOB 2PWHA 2G9HA 1AD0A 2EIMB 5JW4R 3U0WH 2EDKA 2HT3C 3BPNC 1NH6A 1B9ZA 1JE6A 1S3KL 1UUNA 5GGRY 2FQFA 4OFPA 3IJHB 5IESH 3RUGB 1WAAE 5I5MA 5I0ZA 4I48B 1VAHA 3B2XA 4V11A 2RH0A 2A74C 5TE6L 4ZTOL 4IBWA 3OBAA 5G5DA 1XGZA 3A6CL 3U6RA 5MHSD 5JHMA 3EFDL 4ZI8A 4LSTL 1M7IB 5IJCC 3H7BA 3CHOA 1I1FB 1IKNC 1Q0YH 3QCVL 4XH2B 5CGTA 2DTSA 1BQSA 5INCA 4NN6C 4O51B 2IC2A 3MJ8A 3CZKA 5E8EB 1KJVB 3BVNB 1G7JB 1CFVL 2B1OA 4L4TA 2R7EB 4G1EB 1QI3A 3D2UB 1XL4A 3WJJA 2WC7A 2Z4QA 3FCUB 3HRZC 4NO3B 3ELAT 2OTWB 2VDNH 2J21A 3FO2B 1NGWA 4LXFA 2VR8A 1HAUA 4G7YL 4XVSH 1DVSA 1CQYA 3TA3B 4CA4A 5B7EA 3MRQA 2YRZA 1BZ9B 2X9WA 3EGXA 2GJZA 3MRLB 4WGWB 5JLZB 3PWNA 1CFSA 5KVMC 1RZKH 4JZNA 3U0WL 4FC3E 1TMQA 5EORH 2VITB 1ITCA 3T6WA 4J8QA 2MCG1 4K8RH 2EE0A 5IESL 1WVZA 3G04A 2VR9A 5J1SC 1FN4B 3EDKA 3VWJA 1J0KA 3NJGA 3FSZA 1JUFB 1HNYA 3ZHLA 4WFHE 4BXSV 2ICEA 1AIZA 2XWBB 3Q3GB 1JRHH 4M8UA 3BH9A 4CC1A 1L6XA 1Q0YL 1JZHA 2CRYA 2O72A 2C1PA 1Q90A 5H37A 4PJCE 4UAOC 2DLEA 4WU5B 3Q9PA 1WZAA 5ES4B 4P2OD 2EKJA 2VDNL 2DQJH 5C0AE 5JUEL 3WTTA 5I1JH 2F7OA 3RI5F 4Y19A 1J5HA 4KOBA 3TEYA 3G9AB 1YNKL 4R0LB 2AJZB 1KN4H 4WW2A 5EZJA 3UAJA 4OLYL 4F8OA 5FHBL 4GRWH 4I2XA 3REWA 3LIZH 3MRCA 2GTZA 3QSKB 4IIQB 5JPMC 1S7TB 1O5PA 1AVAA 1RZKL 1JF1B 5EORL 3ULUC 3VM7A 2IDQA 5I1HL 5EOTA 2KDYA 5EBLA 1BOGA 1SHXA 3FSVA 3FOLB 3WENA 4K8RL 1RK7A 2EDOA 3MHZA 2XXFA 1AZCA 3KG5A 1H0DA 2EDFA 3KPSA 3N40F 5L2KD 1B4JL 5MI0B 4I89A 1TG8A 1JRHL 2DD8H 3SZKC 5LGYA 1EXGA 1X5FA 2VXVH 3T5WA 4LBEA 3EBHA 5AL0A 5DK2A 4NRZB 2WP3T 4NENA 2H2PD 4G80B 4ZMYA 2K78A 4AQAA 4U1SB 4D9QE 4JBSA 4APQB 1MLBA 3P3SA 1OE3A 1L9SA 4LAQL 5E03A 3DVNB 5I1JL 5LGHL 1DHKA 3WLWD 3ABKB 2VH5H 2A6DB 4K7PX 1KN4L 3DMMD 4XPFH 3EYQC 1A7QH 2HN7A 5ETUB 2HTLC 3OVUB 4HF5H 3QCTL 5GS3A 5TF0A 4L8CA 3IRPX 5I1LB 1QBAA 3P2TA 5F3BB 2LU7A 2UUDH 5FYKH 3GINA 4OQ1A 4I3SH 4CN1A 3CQQA 3I75A 3ECVA 4FFYA 5JDJA 3QUYB 4K71B 4PJGF 1C7TA 1U8CB 2HPOA 3CZFB 5I73C 2YRBA 5KYXA 2JB6B 3D33A 1AAJA 4BUHA 2CUMA 4JDVA 2C1OB 3KDPB 5EFIB 1MY5A 1KJ2B 2OR9L 2QADC 3L3JB 3WJMA 2EDJA 3W9DB 3T08A 4ZFGL 4XCCH 1WC7B 1FFOA 2HJFA 3P4MB 4LRIA 3HPJB 4YFLI 3ZRCC 3CHQA 3SBPA 1F2XK 4IHOA 1B90A 4PRAA 1XB8A 3RKDD 1OPGH 5D2NA 4WTZG 5JA9A 3EBAA 4YPGB 5E8DL 3AM8A 3MCKB 5CSZB 1BLNB 3VWKA 2LTQB 2VH5L 3O2DH 3UZEC 5ACZA 1P9MC 3HCVA 4ANKA 2EECA 3AMKA 2A38A 2PW1A 1MPAH 2ENJA 3BWUC 2NLJB 4XPFL 1OALA 1DVFB 4A38A 5DMYA 3K6NA 2KS0A 4FQ1L 2GPZA 2WQWA 2ICWJ 4LCCC 1XF4B 4NUJB 3NN8A 1WISA 5BXFB 3RY5A 2UY6B 3KXFB 3VTAA 1QLEH 2ED9A 1ZHNB 1HH6B 4QF1B 4PJ9C 2DOCA 3SJVD 3DXAD 4Y5YC 1CR9L 1KT2A 1RZKC 3DBSA 3S3BB 3NIDE 5T33H 2QQNH 4TLKA 4HS3B 4NQDB 4Y16D 2UXVA 3QDGE 2ZIDA 4JPIB 2VDOL 5JTWA 2VIRA 4K8RC 2XY2A 4QLRA 5BVPH 4ZUTB 1ZXKA 5D71H 3KMDA 4J2QA 2EO1A 2YEZA 4LEXH 3EF4A 5IFHL 5GGTH 4HUVB 1HFUA 3O11B 1SMOA 2VZ1A 3ET9F 2Z8SA 4C4KT 1OPGL 1P2CA 3EFOA 5HYEA 4E9SA 1DDTA 1YEKH 3MUUA 3O2DL 3DETD 4RGNE 5IR1B 3U30C 12E8H 1X5IA 2H7WA 4ZOAA 4DVRL 5CD3A 1BVLA 1NIBA 3GJEA 2IBBA 2ZWNA 4QD2E 5T5NF 5CGYC 3KLAB 4PJFA 3H0TA 4PJHE 1EEZA 1VSCA 4PS4H 2R0ZH 2J8UA 4QRUA 1I7RB 5ENWA 1XAKA 3OPZH 4G9FD 1NBVL 1QLEL 2BSRA 4ZUUA 5LQBL 2V4LA 5HYJD 4OIIH 1P4IL 4W81A 4XMKH 1YEIL 5T33L 3AB0B 1JZ4A 5DHVA 3VJ6A 1N7ML 3U0PB 4G8GA 4GRMB 1BJMA 5HHNA 5I16A 4N0FA 3CXHK 1IAII 2ADIA 2W0FB 1JERA 2XWXA 4WHTB 1ETZA 4A7SA 3E7JA 2H8PA 2WWKO 3GBEA 3S48A 2V9TA 5E2VL 2KHAA 5GGTL 3WMSA 4PS8A 4L1HA 4MD4A 4MJHA 4L4VD 2WD0A 1IQDA 2EE9A 4EE2A 1U91B 4I4WB 1TZ8A 3V52H 3OD3A 3S5LA 4B9FA 2EE3A 5AW2B 1P5UB 1YEKL 1EZLA 4LGRB 1YEFH 12E8L 2QV2A 1KB9J 3V0HA 3RDTC 4AITA 3OKNB 3RIKA 1CMOA 3MA9L 5KYYB 4OLWH 1F3DH 3II1A 1MF2H 4MXVE 3UX9B 3EBGA 3JWNH 2APWA 2IWFA 3ZY7A 3IXTB 3ATEA 3OPZL 3ETBJ 2R29A 3D4YA 1RV6X 3SEPA 5IVXA 2A9ML 2VDKB 3HE6B 4BSVA 3ZBMA 2PO6A 3CFNA 4Z7WE 2WJ7A 3PUUA 2VSKB 2BRRL 2TRYA 3JV4A 3H53A 3ZZQA 3Q06A 5CMAA 5JOEA 3BGAA 4IOFC 2TSBA 1WS8A 4Y2DA 2M26A 3EYOB 4WO4B 3RI5K 3MJWA 1CICD 5I8CB 4RAVA 4XNQA 3PQYA 1TJHH 2W59A 3FZUD 4LLYB 1OGTB 2ZX8A 5F7KC 2AXGA 3V52L 4M62L 3ISYA 1R3IH 1M6OB 2IADB 4U3HA 3N43F 4ZAKD 3KD4A 1E27A 2X9YA 3MLPA 1YEFL 5KYUB 3MRRA 1I8MB 1BQLH 2KT6A 3HHSB 5I5RA 4POZD 2EZ0C 3VXMA 1YHPA 3UBGA 2QR0B 2WQSA 4FQXD 5D7LD 1MF2L 5F21B 4OZGF 2Q9OA 4CMHC 1R5IA 5IVZA 5T8IA 1N68A 2E9GA 2JKNA 2GY7B 1O7VA 1ITBB 3RVVC 1V27A 4FFYH 3BDYH 4M7ZC 2NOYA 2NR6C 5AAMA 1HHIA 1D6EB 1ASOA 5FC9A 4U3XA 1S9WB 4DVBB 1BGXH 1MCQA 2VB5A 3BJLA 3WTSA 5ESAB 3FSOA 3G5ZA 3OGCB 1T6VN 5IF0B 3EYSH 4M9OA 4KRPC 2X70A 1BVOA 2ED8A 1FIGL 5LCVA 2CR0A 2D03H 5I26A 4FZEH 4YSUA 2DJSA 1MQKL 1U8PA 3NZSA 5D72H 5LG6A 3IXAB 1CI3M 1AQHA 1V54B 3S4SG 4F24A 3LXUX 1TJHL 4FHKA 4PQXA 1E4JA 1JTPA 5DFVD 3VFRB 3X1FA 3FFOA 3STLB 4IK7A 3X13A 1J12A 1R3IL 1PFCA 4X4XA 1WFIA 4ZFFA 2B20A 3K4DA 3OWEA 3T8MA 5EEUA 3C09B 1JNLH 3B3BA 1WZKA 3WJJC 1BQLL 1CLZL 4B5ZA 3ARSA 5E9DA 1Q0EA 1PJ9A 2JTDA 3HE7C 2D4FA 4DWHA 3HTLX 2VAAB 1E8WA 2JB5L 3QIUA 3HKFA 1JWUA 1KIQA 2K6WA 3BDYL 4PJEE 2HLEB 5GSVB 4D0BB 4EN3D 3ZE2B 4QRSA 1DQQA 1J8HD 1EFXA 5FYLH 3T3PB 1R1CA 2CE6A 3RVTC 4M5ZH 5GJTL 4WJ5B 1GZHA 4CN6A 1BM7A 2GTQA 1CF1A 2D03L 3KLKA 2V3FA 2A4EA 3K3QA 4JPQA 4Z7QF 3ESVF 3VWJC 4X4ZA 2YPLE 4JUSA 3VRLF 1IQWH 2ICEC 4GKOA 5FM5M 1CF8H 5D7IE 2C4XA 4JFFD 5K1JA 3LIUA 3OKKB 1C9SA 2Y7OA 3TZVD 1P7BA 3DSNA 1U8HA 1QTYT 1LE5A 2AZUA 1URIA 2HT4C 2FQDA 4HBQA 4JO8A 3QYMA 4JAMA 1OHZA 3ZN6A 4ZNEE 3JWDH 4FNTA 4X0KB 1C08A 5IROA 2EJ1A 5D1ZD 3KPNA 1T20A 2FBOJ 2P3YA 3FB6B 4ISVA 4LVHB 2OMTB 3Q8CA 4P2OB 3UAJC 4C4BA 3LEXA 4WW2C 2G2NA 2B14A 4Z7OE 1NLBL 1DVXA 4U6XB 5F7UA 2UWEA 1T80A 1B2YA 4Q9QH 5FYLL 5FW8A 3JWNC 3SOBH 3ZXAC 3UBXI 3MV8A 3NZUA 5DHVH 4M5ZL 2M2DA 1N10A 3QORA 3BXNA 4RMBA 5FGCE 2NY6D 1JF5A 2F18A 5SWQA 1J9TA 1OP9A 4F7CB 4P3CH 4GNKB 3EUUA 1KTDB 3DUUB 1IQWL 5F7WC 3V5DA 4E36A 3VD2A 4HIXH 5L2KB 4O4YL 3WI9A 2A0LC 2YGPA 2Q5BA 3P4LA 4GLRI 5JORA 4LEBA 2BSED 2XVBA 3LQMA 5CCHE 1H8LA 1CG9B 3NOIA 5B7FA 4K7PH 1NKGA 4MA8H 1S9XA 4GXVH 2CCLA 4K5MA 2LAAA 5E4OA 1FAKT 5DWUL 2B39A 2PN5A 3BHBA 5SWZE 2R29H 4KUCF 1TYRA 1GJIA 1EO8L 1S7RB 3CDGA 3LKRA 5FB8A 1Z9NA 5KEZA 3UYOD 4MXQC 3DMMB 1OGSA 3BZ5A 1W72A 3DSFH 3JVGA 4XE5B 1NL0H 1WJ3A 1Z9LA 3WNIA 3I74A 4Q9QL 1YEDA 1N64L 1H3WM 3DRQB 4Q9BA 1KPUB 3SOBL 5DC0A 1UYWL 1RXLA 3BO8B 3O3BB 1SYVA 2VLJD 1FP5A 2AXFB 3NPZB 3TCTA 3QDJA 5GRUH 1CCZA 4Z7VB 1XBDA 2XETA 3OJVC 2F7RA 3VG0H 3QNZB 3TNNB 3VFSA 4QRPD 5H94B 1WFOA 2BS8A 4HIXL 3E8VA 4YHMH 1PTZA 4HH9A 1CXEA 5IBTH 1UZ8B 1WWCA 2V3EA 4LRIC 5I1GH 5KBMA 2BOCB 2ZUWA 3GMRA 2YUXA 3DX4A 1U8NA 4BFIA 3L9RA 1CGTA 4JY6B 4S0TD 1PD0A 2FSEB 3IM1A 4MA8L 5D2NC 1WAAF 3R4RA 2ISDA 4CAGA 4X7TA 4GXVL 4UTAL 2EVGA 3AM8C 1SDYA 3VWKC 4EDXA 4RA0C 3FU7B 5HI4C 2IBGA 4G59C 5DWUH 3I9PA 3O8XD 2R29L 3CFEA 1E0OB 4N6RB 4P5TC 1JNHA 3DSFL 1NIAA 3MOBL 1NL0L 2P5EE 1NCDH 1GSMA 4MB5A 1ZAGA 5LCVH 4PGEA 3SBQA 2BOLA 2JSFA 4BIKA 5B4MC 1IGYB 1A6ZA 1EX0A 2DQCL 2XFGB 1D5MA 1T22B 4XNXH 3D0LB 3QZOA 3QNFA 3ZHDA 4U4IA 3QXWA 5IQNA 5GRUL 2EYRB 3MLSH 5CAYB 2MPVA 3SJVB 1LEGA 3DXAB 2EABA 2VLKD 4HS8L 1MCBA 1RJCA 3BUPA 3ML9A 3UGXA 4YHML 4JFDE 2VR4A 3A4EA 5IBTL 1G9EA 1J0ZA 4Y16B 3IFPA 5I1GL 3O6LL 1UQSB 3E9UA 2X4PB 1WD8A 2XQ0A 4IM8A 1N18A 3INOA 3QJXA 1N59A 2FL5B 1EEYB 4RGOH 3VD9A 4WZ9A 3L3DA 4IU3B 4N87A 1FGNH 2NY7H 2XNAA 2B9BA 3QWOB 5JHDD 5GPRA 2Y2WA 1FDLH 2V2TA 5EF0A 5KSBB 1BIIA 1SJHB 1F4AA 3K91A 3BAWA 3PP4H 1OSYA 2MCMA 2JMRA 2RB8A 2P43B 3JWDC 1LK2A 1KPVA 2DQ6A 3FQ4A 4NQCD 1GTNA 1UACH 3L45A 1U8QA 3VGHA 1LQBC 3FT4B 4PJCF 3HR5A 2DRUA 2IEPA 3JWOH 5F9DC 3VNYA 1SJVA 2MKLC 3AUWB 3H9SA 3RA7H 2DQDH 4F7TB 3L1GA 3I9IA 1N0LA 3L1OL 4JPWH 4G7VH 4G9FB 1ND0A 2K6ZA 3WIIH 3WN5B 3ULVH 1JCVA 5HSFA 3U0TB 4B9JA 4NSKB 5HYJB 4MZ2A 3OF6A 3G08B 1OAZL 1TENA 1RH8A 1OCWH 2MOGA 1E9QB 4WFFD 5ICUA 4G1MB 2B16A 5I30H 1U3HA 4HZLB 3V7AG 1MDTA 1OP5K 4RGOL 1L3NA 1L9TA 1FGNL 2GSIB 2NY7L 5BZDA 4L4VB 5AW1B 3IMTA 3KPQA 2VJ0A 3WELA 5CCKH 5LGJA 4IIZA 2YWZA 4LVOB 3KPRE 2RALA 4G42A 4KPHH 1U8IA 3VA2C 2V2XA 5FV2A 4BQ6A 3L1EA 3UJIL 4GP4B 1E5BA 5IJKA 1J1PH 2OMXA 1Z5LA 3TNMB 3DROA 4AYMC 3QRLA 5BOPA 4EKJA 4J3OG 3RA7L 5J6SA 2ATKA 1YLBB 4JPWL 4G7VL 4HJ1A 5FOBA 4JFXB 1A3ZA 5E2TH 4YSEA 1FAIH 2ATPA 2V2WB 4RAHA 4NZ8A 1Q9OB 2IH8A 2XN9A 5MEOA 3L3IA 4WNSA 4ZZFA 5K9OB 2ZYSA 4YBHA 1G7HA 3PNRB 1N12A 4Y2DC 4PRIE 4ABWA 5ANMA 1EANA 4BGLA 5EUKA 1CLYH 5INDA 5I30L 4FNLL 5CIPB 4W9CC 1U6AH 1CICB 1D2OA 4RISL 1QR1B 2ZKYA 1AGDA 3S36L 4BHUA 3FFCA 1Z3RA 2ZZUT 1VLXA 5C2UB 1VADA 3F00A 4H13C 4XBEL 5DJDB 2J57A 3VXTB 4Y9CA 1X5YA 2AEWA 3COOA 3SDCA 1JYXA 4ZAKB 1W72H 3WTVA 2ZUVA 4E68A 3V6FB 1T83A 1YMHB 2FH8A 2SEBB 4ODSH 4KPHL 4NXKA 4GI9A 3MNWB 3SPHA 3WKPA 1QO3A 2D7OA 5C8JB 3S8GB 5IWLA 4OCWL 5D1QC 4FQXB 1J1PL 2Z35B 5D7LB 2AF2A 3HJ0A 4Q97A 4OBSA 2JI2A 4HHAA 5AAMC 1UJ3B 3AQDA 3ARBA 4NFBA 2XCMC 5C9JA 1SNRA 2BPBA 5C0CA 1ZXQA 1FAIL 4JM0A 3QIBD 3KVQA 2JLPA 1KJMB 1RZ7H 3DV6B 4NAJA 5C0EA 4A04A 4G11A 1SOKA 1CDBA 1MQ8A 1D6VL 1RHHA 1T1WA 1CLYL 4U0QB 1KELH 4FQIL 4EKXA 2NNRA 3WAKA 1FZJA 5E6IA 5JIQA 2ZCKH 5HGDA 1UZGA 2O5XL 3BUYA 3BYTA 4HAGA 1PDKA 5L4MA 4KK9D 3UYPA 1R46A 4TVPE 3TJEL 3H9HA 3NIDF 3RY6A 3W0WE 1GR7A 3CNKA 2CALA 5J4MA 4MASA 4UBDC 3HN3A 1E7VA 4JDTH 4YLCA 1T0NA 3QIUC 1CYWA 3T0ED 4C58B 1YYMH 3QQ4A 4H4NA 4K3GA 3E1F1 2IBZY 4QHPA 1KN2H 2LU3A 3THMH 5C0JA 4QO1A 4N0UA 4DQOH 2RJMA 5L2JB 4EN3B 2XIIA 2DM2A 3CFBB 4AJWA 6PCYA 3FUEA 3L17A 1J8HB 1GZHC 4H1LB 1UFGA 1R5VA 1U3NA 2CDEA 3JWOC 5DXWA 4A7GA 1RZ7L 2IH3A 3PGDB 3ULUD 2Z7WA 3IN0A 1MHCA 2HVKB 4PJHF 4TNWF 5HGAA 3TLRA 3VI3E 5K39A 5SX5H 1KELL 3ULVC 4J4PA 4MNGA 4KNUA 4BZ2A 1OSZA 2ZCKL 5AKVA 5HHPA 2AV7A 5C7ZA 3T65B 4RZKA 3KPLB 4X8JA 3OJDB 3VH8A 3EOTH 1XF5A 3PXJA 4JFFB 3GDCA 1LO5B 3TZVB 5K1VA 1J0HA 4NNYB 3ME0B 1MCHA 2HFEA 2IIJA 2KBGA 4IKJA 3EAKA 4ZD3H 5IROC 2OLDA 2PTVA 4PLNC 5JW4N 4NC0B 1S8DA 2G3NA 4FQCH 4K55A 4XP6H 4JDTL 4GKNB 2BP3A 4NZFA 4M93B 5D1ZB 2VZSA 1ZPLA 4YR6A 3ZHFA 5C0BD 1HZKA 2UXGA 3THML 2I25N 2Z1PA 5JIMA 4X5XA 3EYQD 3QISA 2VW4A 2QLVB 4DQOL 2BNQD 3HC4H 5GS0H 1UGKA 3MNZB 4JRFA 1UXLA 3QORC 4F8NA 2YEQA 4K15A 1AHWB 1U8MA 3O6FA 4NT6A 4F92B 4MXVF 5CD5D 2WN2A 5JOPE 4I7ZC 4H88H 2AQRA 2NY6B 1HE8A 3VMOA 1J9SA 3R06B 3QNXB 1G6RB 2BVOA 2AABH 3DHPA 1BMZA 2XHNA 4W6YB 1VCAA 3H2WA 5AW6B 4F15B 3QQ3A 4DF9A 3HG1D 4U6YB 3C5SA 3SKOA 3EOTL 4Z7WF 1U8OA 5J89A 5F70A 5E2WH 2QADD 2DYPA 4N2GA 4X7CC 2BIQA 4QY8A 1QOKA 4MB1A 1P84K 3EH4B 4KK5C 5LB1A 3GXFA 1FE8L 4OBRA 3WUWB 4CC0A 2X1QA 5ADOH 4FQCL 4NAQA 4F58H 4NQEE 1BJ8A 1O7DC 2XC8A 4MSWB 4L1TA 1K5WA 2X89A 4W68A 3W5NA 2FIKB 2QKIB 2X6BA 3JVGC 5HVHB 3HBGA 4YIQA 1YN7A 2UZYA 1WZLA 4WEBH 5GS0L 3L9YA 3SYQA 1LE9B 3IDGA 3IDXH 3BH4A 1VHPA 5D8JH 4JK0D 5HDBB 2F0CA 5DD0H 4C57C 4OU3A 4R4FH 4B9ZA 5BS0A 5C0ND 5J6HB 5LJYH 1KZYA 1ILSA 4JPVH 5AYUH 2VERA 4H5SB 2AABL 2VLJB 3MRHB 1NBYB 1F3RB 3KW7A 4UTBA 4C54A 5DUJA 4UZSA 2X09A 3KLDA 4XHJC 5EF1A 1J9RA 2YLHA 4QRPB 2AQSA 2I27N 2CIKB 5DZNA 4MJ6B 5L0QC 1U93A 1OB1A 2BCMA 4OB5H 5E2WL 2ZYIA 3CVHA 3NABH 4NQSA 3SY0A 3WFEH 3DTXA 2K8MA 3ZKND 1OSEA 3B43A 3D48R 3B5HA 4P9MH 5CJQH 1UWGH 3L5XH 4F58L 4XB3A 4A2MA 5KW9L 5EUOA 3H4FA 3EYVB 4BA0A 1F56A 1EZUA 3MRIA 2ZG2A 3CHRA 3DBXA 5I6PA 2BP5M 4K0OA 1PBYA 5EB9A 3MACH 4WEBL 2ICWI 1UWXK 1BAWA 3LNIA 4GUPB 1NGQH 1RZJH 3IDXL 1H3UA 2NY5H 3HG3A 4GRLA 2ZUSA 4R4FL 4HJ0C 3PNWB 4KY2A 2Z34A 3X14B 2R1YB 3MROA 1AGCB 5JXED 1YEHH 1DJSA 1JNNH 5HY9B 2VDQH 4PJEF 4HWNA 3QRGH 3MRFB 4XHQA 1FZMA 1RZ8A 2F74A 2J25A 5I9QB 5I19H 4PU2A 3QUGA 1XHHA 1M7DB 4Q58C 2VLKB 4LHUD 5E94A 2MTPA 5I0YA 3EO1B 4PJXA 3FCTA 2J5LC 4LF3B 4HIIA 5EZLB 3WFEL 2XBZA 1JGVL 1WITA 4IGBA 1J11A 4P9ML 5ECJE 5CJQL 1FNEB 1CU4H 1UWGL 1ZD6A 2F19H 4QXGH 2NYYD 5D5ME 3DX2A 5TQ0H 2BP8A 3OHXC 3HS0A 3EIFA 1F1GA 4K9EH 5D7IF 5JHDB 1E4KA 4BSJA 3DTDA 4HIPA 5I15H 1CFNA 2CGRL 2Q3ZA 4L29B 3H55A 2WY3B 4RETB 4HKXA 2A7BA 4R96B 3RDTD 2P5PA 3K72A 4PGJA 4YXKL 3FU0A 3PHAA 4QRQB 3DGCR 1SLVA 2BCKA 2H9GA 4NQCB 1RZJL 1O9ZA 3TV3H 1NC4A 3EGDA 4LL1A 3RHWF 4WI6A 3ML8A 2NY5L 3AITA 1MFCH 4ZSOA 4HUWA 3IGFA 4Z7OF 4BZ2H 4QJ4B 5GS0C 2VDQL 1ZA3B 2ENYA 1VB9A 3C9NA 2QBWA 1AD9B 2AV1A 1Q72L 3OV6A 4MDJA 5I19L 5IOPB 1LK3L 3VFUB 1UD3A 3OZLA 4Z3JA 1KTKE 4XP5L 1P7KA 1U3HC 5FYKD 4HMDA 3KHOA 5IKCB 5K93A 4U1IB 4Z8FL 1CVRA 2QVTA 4QRRE 3IFLH 1JZEA 1KXQE 1JAEA 3CDYA 1BQKA 4H0HB 2K3TA 4QXGL 4ERSH 2DH2A 2VE6A 3NQIA 4LARH 4UQCA 2IXQB 2UY7B 5TQ0L 4AIEA 7PAZA 2DV6A 2WXFA 1A4AA 2MOVA 2MSPA 4KXDA 2VMJA 4K9EL 4P48A 2ZKXA 3KVDD 1W15A 1AS7A 4F9PA 5AZ2H 2APVA 3E0GA 4U1MA 4BK5C 4TNWK 2KERA 3V4VB 4EZMA 1ZK9A 5IJKC 2X4TB 2HJLA 1UWFA 5HHQB 3ZL2A 2IOMA 4TQIA 1TF4A 3TV3L 5DT1L 1O6TA 5IB3B 2Y23A 1IO4C 3V7AE 3VGBA 1BD2D 4IBSA 3KLQA 1MFCL 5HHOE 1WHOA 3V7MA 4TUKH 1ZEAH 2FD6H 4OCRH 3AGVA 4ONGH 4PLOB 4BH7B 4AGOA 2EVIA 3FTVA 5CWSA 3DUSB 2F5AH 4YNYA 1CJYA 3UERA 2EXYC 4KRPD 3UL4A 1C5DB 4ABUA 2GTWA 2E8ZA 1JS4A 3X1GA 2BIMA 2BJMH 4S1SL 4HALA 1FFNB 3V95A 1S7UA 3VXUE 3KVPA 3FRPG 3IFLL 4UB0H 5IBUG 4NC2B 3VDCA 2E86A 3LDBB 3D0AA 3ECBB 3E9TA 2A74B 4GY4A 1AHKA 4LARL 4YO0B 5EIVA 2WLKA 4K2UH 3V6ZA 4ERSL 4RMSA 3SDCC 1MRFH 4KOCA 5ESQA 4AMWA 3TBVB 3S7GA 2ESVA 1BVKA 3INUL 3NAAH 3RZWA 4L4TD 1XF2A 4J6IA 4KK8C 2BW4A 1DJWA 1YNTA 2A83B 4NN6B 1B0IA 5FWRA 5IWLC 2V8MA 1RI8A 4JDZB 3PS6A 2ZX5A 2GBAA 3WLBA 4NQXA 5EC2A 3IFNH 1QX1A 2AKRB 3HRZB 3ARBC 4G71B 3U25A 3KJ4C 2Q1EA 2CG9X 4XMLL 4HBCH 1TDQA 2GUOB 2WINA 2PR4L 3KPPB 4PWHA 4EUPG 3VTMA 3GNML 1ZEAL 2CDGA 4PB9H 1UWEH 4UTBH 1T0MB 5E1HB 1RZJC 4MA3B 4O00A 2CLZA 1OF2A 3RVTD 2F5AL 2NY5C 3QIBB 5CLZA 3GMPA 2DI8A 3CVHH 1MJJA 1S9VA 3TTYA 2BJML 2D9CA 1XCTA 4CADA 3G7TA 3QULA 5E6IC 5DTFB 1EHLH 4HUMB 3VWJD 3TYGL 1H8OA 4DZ8B 4UB0L 3M1CA 1YNLH 3NZ8B 3VGAC 4KWUA 4LCIL 4LBAA 3RY6C 4R97B 1HWGB 1I85A 3P54A 15C8H 3MODL 3QCUL 4XCNB 1JWSA 4BM7A 1IEBA 3IJ8A 4G70B 2H3XC 5DD1H 4FEIA 4KVNL 5GZOA 4UU9A 1WAPA 4K3EL 1YA5A 5GISH 5ITBH 1G7QB 4UAOB 2E3VA 4DCQB 2NW2B 4Q8BA 3IFNL 1I7ZA 3TCLB 3IMSA 4K9EC 3T0EB 4FQHA 3UAJD 1NMAH 5GGSY 3DYPA 5IB2B 1JHTA 5C6TH 4HBCL 1VEPA 3S96B 1A6TA 4WIQA 4WI9A 1UASA 4BWWA 2AW2A 4UTBL 1GGBH 5E00A 4OF8A 5FYKU 1I1AA 1MH5A 1X7SA 4NNXA 4F7MA 1UB5B 2P7TA 3AG4B 5JPMB 3QEHA 2NY4D 4JPKH 1JDAA 2W9LA 3T8VA 1T3FB 3C87A 2X4QA 4J4PC 1C8QA 4I18B 3L7EB 5FV1L 2HVJA 3VU1A 3BT2H 2NY2C 2Y25A 2I07B 2NZ1A 3MRDB 1NBZB 1R17A 1YNLL 2C9SA 4G5ZH 2VR3A 2D0HA 4EBQL 3JBG7 2Y4SA 1A6UH 3OKDB 1QRNA 4XPTL 5JMOC 3BKMH 2A6JA 4PJ5D 2A0LD 2Y69B 3F7QA 1CD1B 4PP2B 2AJSH 1KB5L 4I0PA 3GSWA 1RQ5A 1ZPUA 3D1MC 4ZX5A 4YVUA 1MCEA 2Y06H 2DWSA 2ZXQA 5AVUB 3L9BA 1SEBB 4Z9KB 4PJDB 4H8HA 4YDLC 3MFFA 5MEQB 1AGFA 1DLHB 1T7ZA 2VR6A 4TUOA 2HKAA 3UABA 2LABA 3K71B 5AW7B 2QSCH 4M7LH 5C0BB 5C6TL 2WZPA 3P0YH 1TQVA 2FJHB 1MCJA 3Q9QA 5CM1A 2BNQB 4NBYB 1EJFA 4TUUA 1THCA 4PJ7B 2LAGB 2NRDA 3HI1B 4JPKL 4OGYH 1K8IB 2A1WH 2ROYA 4MKMA 2WYHA 3VW3H 1QBLL 2ZG3A 3OLIA 5C07A 3CPLA 3SODB 1Q9WB 4XGZB 1DQJA 2EDYA 2K4AA 2I9TB 5KBDA 3VFWB 1JP5A 3EJZD 5I73B 2ZPKH 3HG1B 4FQLL 4G8EA 2BP0A 1ZGLA 1WD9A 3BKML 5CKGA 4AZUA 1N4XH 3TGXA 2QADB 4KXAA 2AJSL 4KJWD 4W9FC 3A24A 2C8NA 4K3JL 3GSRB 2AEPH 3ILPA 1NEZB 1KBBA 3ZYIA 4EXPX 1CDIA 3R0NA 3HPLB 2HJKB 1HU8A 2HG5A 5D1XE 5HGBB 1CFQB 2L04A 3BCFA 3BEWB 4YDJA 4HS6B 3DYOA 3RTQD 1SUJA 3P0YL 4LRNL 2GJPA 3JVFC 3MRJA 1GS8A 3VG9B 3SDAD 3D52A 3EHBC 4ZMNA 2DQIL 1EHAA 2Z8RA 5E0FA 5SX4I 3KBPA 2AAVA 4KO5A 2WKLA 3VRJB 3V0GA 2K6YA 1Z6JT 4XAKE 4FFTA 5F7YC 5EIQA 3TOPA 4C56A 2WKGA 3OXRB 5IB5A 1JG9A 1UKQA 2MNWA 3GSNB 1XH0A 3QO1A 1XXDC 4LCCB 4M8RA 4PJGA 5B4MD 3SD5A 3BJ91 4B9CA 4PTTA 2WCGA 5A6IA 3VW3L 7CGTA 4OD1H 1F4HA 4F2FA 5I1DA 4AQ8A 1HXKA 2OCFD 1ZA6A 3LZFL 3AQZA 3OSVA 2ZPKL 2Q6WB 2N4IA 4LSUL 3AXLB 1OOWA 4BKTC 1AGBA 4JANA 1O6SB 3O0RH 3U4EB 4DPBX 1N4XL 3UIYA 3D0VA 1KNOA 3PDOA 2ZNXA 2BVUA 5DHMC 3MV9A 4J39A 4XCYA 3OKOB 4KKCC 1T0PB 1INEH 3IU3B 4Z7UE 1W8NA 2DMHA 3BKYL 1TT6A 4PRPA 3VQ2C 2OQJB 5IQ9A 3TX4A 3OLEA 4PV8B 4V1DD 1DQVA 4UTCA 3STBA 4D9LH 4DGIH 1BEYH 1TCRB 3KCPA 4XO8A 4GRLC 3TWCH 1WT5A 1KCUH 2HX7A 3TU6A 3LPOA 4X7EC 5AW4B 3SKJL 1HDMA 4R90H 3QQDA 2Y3NA 1LO0L 1W8EA 5TDPA 3IRCA 5ADPH 4CU7A 5FDWB 4UOZA 2P5WD 4G8GD 1N3NA 4PLKC 3UBHA 4F8LA 3RPIB 5ESVB 3RUGE 2CHXA 4LHUB 2I60H 3O0RL 1KIUA 3TM6A 1SHSA 3BRFA 1SBBA 32C2B 3HMWL 4OJEH 4Z18A 3VI3F 2XWDA 4PV9B 1I53A 4J12A 4D8PB 2LT9A 3WL9A 1TQBC 4I13B 3VO0A 1G7MB 1INEL 1J1OL 2F8OA 3V2AR 1RZIA 4HKBB 3VE0B 4NKDA 4UM9D 4QMEA 1L9NA 3QZWG 2A6IB 1F42A 4MB3A 4WTQA 4XNMA 2YD5A 4EEEA 4XCEA 4MJ4A 5FECA 2OXGA 3ARUA 3F5WB 3RPBA 2EXWD 1ZY9A 4D9LL 2J20A 3LD8C 1BEYL 4DGIL 3RDTB 4PVNA 3DIFB 5T3XD 4MDIB 2CO7B 1CO1A 1U92A 3PWPA 4E9WA 3EJUA 3TWCL 2GJ6A 1LDPH 3A4FA 3LV3A 4FA6A 1OD7A 4HFUH 2PO6D 3WS3A 1BFOB 5ADPL 3VXPA 1IT9H 2CBTA 2KZBA 3FO9A 4MNHB 3RZCA 1KZQA 3UTPD 4Y2DD 4WUKH 2NUPA 3IETB 1ZIBA 4OZ4B 4X9GA 1YCSA 1XZWA 1EJ6A 2VCOA 3PQYD 3EZ8A 1NCJA 2Q7YA 3D07A 3UPCA 1GW0A 3QK0A 2FRGP 2AGJH 1YPZE 4AMKH 4F9PC 3VRIA 2O30A 2YPVA 1E28B 3WS6A 3NJVA 1X9UA 1KBKA 1QW8A 1A6AA 4HJSA 4H44C 1DBBH 3VXMD 1MFVA 2Y6TE 3GXDA 3NMEA 1JZDC 2M83A 3CXDH 2X9XA 4WW1B 4ES9A 1HEJC 2J71A 4L3EE 1F6AB 3CFJB 3N1FC 4D7PA 1WFMA 1RIHH 1CGVA 2VXQL 3FQYA 1QEWA 2XPZA 2HXAA 3SKMA 1BD2B 1DQDH 4HLZH 4JE0A 4M7ZB 2FBJH 5I6LA 5IB4A 4HFUL 4G82A 3BVUA 3CFMA 4XXWA 4QOKA 4KRLB 3QG7H 3DK0A 1FFTB 4YXLH 2YGQA 4KRPB 3Q8EA 4OFVA 2CKNA 2GABA 5E7BA 5F1IA 3H3BC 4CUCA 2WLZA 4ODTL 4FQQA 5MEND 1FYHB 1QMUA 1OKEA 4RRPG 3NFNB 5G5DB 1V10A 3S98A 3U6RB 2A9AA 1NGPL 4IDLA 3PDDA 5BZWA 5INCB 3MJ8B 2V17H 4PCKA 4XVTH 5E9DD 1DBBL 2QPUA 4L4TB 5AW9B 1JNJA 3BPLC 1TVHA 4MJID 1IMHC 3P40A 3T1FA 3ETBF 3QIUD 3QE5A 1RIHL 1NGWB 3FQ2A 3IMWA 3BVVA 3K8KA 3V9CA 4O2CA 2H32A 3MRQB 3IF1A 1X5MA 3EGXB 4V2BA 2GJZB 2FBJL 4XO9A 2WSPA 2HSIA 4FERA 3OWRA 3PWNB 3Q48A 1CFSB 5CR8A 4Y5XA 4YPJA 3SGJA 4JZNB 5C09D 4KFZC 3QG7L 2OYLA 4G6AD 1J1XH 4I9WD 1NAML 1A6WH 4YXLL 3O3EA 1FYTA 3FT3A 3RPKA 3SPJA 4WKXA 1V3KA 4PB0L 3SN6N 2E9BA 3B1TA 3ULVD 3I2CL 3V4LA 5DK0A 3VWJB 3QEGH 1I85C 1E90A 3A6BH 3QIWA 4OGQC 2BSBA 2X12A 5BVJA 2ICEB 2X4RB 3BUIA 3PIQA 4ZDHA 3UTSA 2NY1D 1MHEA 2R0LH 3BH9B 5HJ3A 3MA7A 8PAZA 2G30A 4OLVH 2GBUA 5GZOC 4QWWC 1JRHI 3WFZA 3CX5K 2C1PB 1Q9KA 4BFRA 2C9RA 3VFNA 5IROD 5A7EA 3V5HA 5ELIA 3IKCA 3GJFK 2YQ3A 1HHKA 1IKFL 1CLVA 1S78C 4HLJA 1F5WA 5D5MF 4WW2B 1SMDA 5DEZA 5JO5B 3IVKB 1OAJA 3J7HA 1IAMA 1MVUA 1I1AC 2WIMA 4XPBH 3MRCB 3REWB 4PJAA 2GTZB 1V5JA 2F2HA 3KLHC 2OI9C 1UUSA 2NSQA 1TJGH 2HVBA 4BINA 1A6WL 4JFPB 2NY4B 4FYSA 2ZF9A 4R2GD 1BOGB 3NGBC 4ZMLA 1U8JA 3D9AL 4RMVA 3T77B 1W0WA 1PX8A 4KZDH 1YC7A 2DTML 2PPAA 4N6QA 4AK2A 4NQDE 3QEGL 4Y4KC 2NX5A 3A6BL 1X5JA 3CV5A 5HGHB 4EN2A 4A2HA 1AXTH 1QFWL 2R0LL 1XV8A 2V37A 3F64A 4I0PC 4NWUH 3BGMA 1FV1B 2Z8WC 4PJ5B 1WA0X 3W39A 5CEZH 2RR3A 5DK2B 4N2BA 4NENB 4AQAB 3B1UA 4M8VA 2FGWH 5F0PB 4G7SB 1HESA 4JL1A 1MFUA 2B5IC 4WU7A 5ALCL 3X17A 5IQ7H 5IFAL 2HN7B 4N8CH 4OI9A 2ENQA 1D7DA 3LS5L 1XF3B 4WFGE 4RCAA 1U2CA 5FYJE 5GHWL 1SRDA 4GAFB 3OLGA 1KEMH 1RUQH 2XPGA 5KG9B 3WY4A 1F11B 3UDWA 5I6XB 4G72B 4CSPA 3FMGL 1FNLA 3VXSA 1HEHC 1F18A 2F53D 4GBXD 1AYOA 3FQWA 3EOBA 4WY7H 4HX1A 1QZ1A 1XEUA 2G3ZA 2YPVH 3AQYA 1AXTL 3CZSA 3WJMB 4DH2A 1FFOB 4WFED 1BQRA 1HN1A 4IHOB 5EEZA 4ORZC 5BJTB 1UURA 4MS8D 3X12B 5D2NB 3GI9H 4ZMVA 3E2HB 3QJTB 4J3OF 3UMTA 5ACZB 3HCVB 3RTQB 2PW1B 2OL3A 1D5BA 4P2AA 4AIZA 4UM8A 2ZXWB 3E6HB 5SV3A 3SDAB 5H4ZA 4MAZA 1BSIA 4RAUA 1S9KC 3V0WH 1X4ZA 4IHBA 1KEML 1RUQL 3H6AA 3DHMA 1ZVSA 2GK0A 4JFZH 1KGXA 4AQ8C 4LU5L 1YMMD 4ZS6C 1NIDA 4GP5B 4JY5H 3TIEA 4PS3A 3NIGB 1MIEH 2HFGL 1KT2B 1F4YH 4OJAA 3S37X 4FXLA 4WY7L 1QTPA 1MW3A 2WW8A 3ZE1B 5F96H 1F6LL 2YPVL 4OFDA 3CFKB 1EERB 4AZ8A 2VIRB 4JFHD 2WLIA 2K70A 3UAFA 1F41A 1RUAH 5IEHA 3BOVA 1WAAA 2YEZB 1S7QA 3VI4E 5LLIC 1JHKH 1AO7D 4YAQA 5FLUA 4I0CC 4MQ7A 3QXDA 3EFOB 1ONQA 4LSPL 3P02A 5DFAA 1W91A 3GBDA 4H8WH 3V6OE 1I7UB 4Z6AT 4UAHA 5L4JA 3EGSA 5CD3B 2OKMA 5IT2H 1BVLB 1KCSH 1NTDA 4V1DB 1JGDA 1D7BA 2HCZX 2VUOA 1H6FA 3IMRA 1WT5C 4L8SA 1L7IL 3TVMD 3H0TB 3BKCH 1FHNA 4WWKC 4KX8A 3RWEA 5AWNH 3H9SD 2X38A 2J8UB 2VLRD 3NRPA 1B0RB 1JPTH 5ENWB 2EUZA 1NGYA 2C3GA 2OMYA 3HLAA 4NN5C 3QUXC 4ZUUB 4DP1X 4LEEA 3CN4A 2WO4A 1ZLEA 4M5YL 3OF6D 5L7XH 5BOZG 5GS1A 3OQRA 1MIEL 1F4YL 2DM7A 3JZ7A 5DHVB 1HIMH 4PY7B 4Y4FD 3VJ6B 2P5WB 4G8GB 1XCQB 5HHNB 4N0FB 3IDJA 4R5XA 2ADIB 1JGUL 5GIRA 1F00I 4NZTH 3WO4B 2XG4A 1UG9A 4O2FA 2X10A 1IRAY 1USZA 3VA6A 2NXZC 1JHKL 1F4WH 1O7SA 4AV0A 4EIBA 4QTHA 4MD4B 5MHSE 1IQDB 1OP5H 2ZYHA 1PL3A 4R7DA 1JMXA 3UH8A 4AC2A 4L37A 4KK6C 3DX6A 4UM9B 4NKQB 4I8DA 5KVGH 1M71A 1DN2A 1KCSL 3PG2A 2W9DH 3V4PL 4PJCA 1SOXA 4G8AC