3RJOA

Crystal structure of erap1 peptide binding domain
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
419
structure length
408
Chain Sequence
b'GFPLITITVRGRNVHMKQEHYMYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERMHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoplasmic reticulum aminopeptidase 1
publication title Structural insights into the molecular ruler mechanism of the endoplasmic reticulum aminopeptidase ERAP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 153
structure length 408
sequence length 419
ec nomenclature ec 3.4.11.-:
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11838 ERAP1_C ERAP1-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 3rjoA02
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3rjoA01
4FKKA 3MDJA 4KX8A 5K1VA 4E36A 5LDSA 4NAQA 3RJOA 4FYRA 5J6SA 4KXCA 5CU5A 4NZ8A 3Q7JA 3SE6A 4KXAA 4KXDA 5LHDA 4JBSA 4FYQA 4WZ9A 5C97A 4HOMA 4FKHA 4F5CA 1Z1WA 4P8QA 4FYTA 4Z7IA 1Z5HA 5AB2A 4KXBA 4KX7A 4PJ6A 4KX9A 5AB0A 4FKEA 5J5EA 4FYSA 4OU3A 5LG6A 3QNFA 2YD0A
chains in the Genus database with same CATH superfamily
4RDQF 2BOCA 1X5YA 3Q6FB 4X9GA 2VXTL 4JR9H 3GC3A 3HC0B 3HBZA 3QJQB 3KPPA 3U2SA 3MKKA 4ALAH 4C83A 1DBAH 1GGBH 1NL0L 3TU6A 4Z7WF 1KCRH 1L9NA 4PWHA 3DDFA 3RWFB 2BSCA 4ABUA 1A21A 4JN1L 1A9BA 4PP2B 5JW4N 3WFDH 7PAZA 4YHKH 5BNXD 1F56A 1JGUL 2Y2TA 4H44C 2EXYD 3D3VD 4APQD 3F5WA 1HNYA 1ZTXL 2LR4A 2Y1ZA 2WPGA 3GQFA 1SJVA 1H3PL 1P5VA 3MV7B 1MPAL 3OZLA 3EJCA 3HI1B 1IKOP 4M7LH 4N1HB 2DQCH 2E6QA 5D7IA 1YEWA 3MRGB 4BSVB 4MCYB 1A47A 4Y5VB 1EO7A 3LZFH 2DLTA 1KG0A 3VYOA 1J0HA 3T0DA 1OTUD 1J8KA 4KK8C 2JK5A 4DQOH 1SEQH 1OB1A 3F7LA 3H2QA 2YBRA 4Z7IA 5TFSL 1FDLL 3SDAA 4KJWC 8FABA 2VDOL 1BFVH 3IGLA 4G6JL 3VD2A 5EFIB 2HXAA 1BVNT 3L45A 4QXWA 3RQ3A 1A7OL 1ODUA 5GPRA 3W11C 5J8OA 1Q1JL 4LBEB 4WI8A 5D1QB 3I6KA 3RB7A 4DEUA 5AL8A 3DIFA 1F2XK 1FFPA 1NIBA 5FO8B 4PV9B 4WO4A 5I1GH 1FFNA 1ONQB 2AK4A 3WUZA 2VLKA 1D7BA 2FD6L 3BH8A 2ENYA 3SCMB 2WLKA 1LTXA 5C0GB 2VLRA 1A6ZB 5F89B 3ARTA 3HFMH 3OKNB 1I1FB 3U1SL 4U6HA 1N8OE 1XGPB 1P1ZA 4DP7X 5B3JE 1UA6L 3L4CA 2PCXA 1AD9B 2X1XR 4PJCA 4XCFL 4Y4KC 4WTZA 5KZCD 4M48H 4C4UA 1BIHA 3IBEA 2DI7A 3B9KC 2IIJA 1ZY9A 2VO8A 3FQ4A 3PL6D 3RVUC 2G3MA 2EUWA 1V5JA 2P5WD 3BDBA 4Z7OE 3VFMA 2DQIL 4AYSA 2BS8A 4KJYA 4YDKH 4ACPA 4NGHH 4DCQB 2Q7NA 5FHBH 3KDPB 4HWNA 3DUSB 4JANB 1DQIA 4BWUA 4PWEA 5FGSA 1J5HA 3VFUB 4PJDE 2N59A 3S35L 5HDBE 1BQHA 2DEWX 2DWEA 4JQXA 3SKJL 4ODHL 2BNQD 1BA9A 4YHLL 3IE4A 1D3CA 4R4ND 3TT1H 2B14A 4X0NA 2KL6A 2JLLA 4QYOA 4PV8B 3N42F 1NMAL 3DX6A 1A14H 1PG7H 3ARWA 1GZQB 3JTSA 3L3IB 2XA8L 4MCNA 4ADIA 1YUHA 1IGYA 3BKYH 1HIMH 1JV5B 4IW4C 4LOVA 3WO4B 3N43F 5B1BB 3OC5A 4YDJA 5IR1B 1IBBA 2FZ3B 4K94H 1FH5L 4JGJA 4GO6B 2KI6A 1SEBB 4D9LL 2Y7QB 2GJZA 3MCLL 5E94A 2YPKB 1G5GA 1ODAA 2XWEA 3O41A 4HD9A 3BP6B 1A1OB 1RUMH 3ETBJ 4YDIH 4U0QB 2NNAA 5ABAA 4XMXA 4MNQB 1IC7L 4TVSa 1TITA 3KBHE 3U25A 2F9BT 3GI9H 2EDDA 5JPMA 1GSKA 2LU7A 4KJWD 1GW6A 2JKSA 1CE1L 2HWZH 4OF0A 4K15A 3MVSA 2E8YA 2J8UA 4Y4FC 2NYZA 4M62H 4JO4L 3W11D 2P49B 4RZKA 1G1KA 5L7XH 1X7SA 3CSFA 3U2JA 2XWRA 1L7IL 3KPPB 4FG4A 4C83B 4JKLA 3GMLA 1S7SB 1BBDL 2VL4A 3MNZA 1EANA 3DUUA 4HBQA 3ZYIA 2R8SL 2PW1A 3U7WH 1CIDA 4CILA 1A9BB 4LCWE 2P3YA 2YQBA 3FUEA 2CO4A 2IF7A 1S7XA 1LO3H 2NQCA 3QQ3A 3BP5A 4CW1A 1U8OB 1YNKH 4QRPA 1NCJA 4TSCL 2VW6A 3NSCA 1P5VB 4TLTA 4WUUA 3B9KD 4YDLC 4Z0BH 4XPGH 5DJ8A 1TLMA 4QRRA 4YSAA 4L8CB 5FO9B 2V5YA 2PABA 4P9HH 4ONOA 1LLAA 2DWSA 1EUTA 3P0YL 3VD4A 5C0RL 2FNWA 5E4EB 1CTOA 5F9WC 1RV6X 2VDLB 2JIXD 1I9IL 5GRVK 2CJUH 3CDFA 5C0BB 2ZZUT 3B8YA 4N26A 4MZRA 3BKCL 5JR1L 1OB1B 4J39A 1Z5YD 1ZE3C 2IBBA 3PP3K 1AZRA 3SDAB 1PGRB 3D85B 3MUY1 3QARA 4I89A 5F7UA 1VSCA 2AAVA 1CF8L 2AAAA 3NZHL 3RWHB 4Z7UA 4NRYA 4NKDA 1R3IL 1GH7A 4HJ1A 4L4TD 3RWIA 1T04B 1UFUA 1WPCA 1I3UA 4ESKA 3DIFB 2OCCB 4WO4B 4XH2A 1DJXA 1FFNB 2B1AL 4HKZA 5FYLL 3MBEB 1NOFA 3MZTA 1A6WH 3OMNB 5GGVL 5D2LE 1T7ZA 5DC4B 4U6HB 3C2AL 4S1QH 4BCXA 2CQVA 4DP4X 4RMBA 4CSSA 1VFAA 4DPRA 3GM0A 3GNMH 1D5IH 1NAML 4DWHA 5J6GA 4K71C 5CM1A 1X5GA 3C5ZD 3B2VL 5HI3C 3EUUA 1FG9C 4PW9A 1TFPA 5EU7C 4P5KA 1A6TB 3ZL4L 2CD0A 2KQNA 1S46A 1S7RA 2E9WA 4QRSA 4YQXH 4Y4FD 3CFCL 2FT8A 1MY7A 5IQOA 1ZA6B 1EMTH 1YC7A 3GBMH 1CR9L 2EXTA 2FJFA 5DEJA 5BZXA 3BHBB 5BXFB 1KBPA 1SDDB 1I8MB 2VRQA 5J0BA 2NY3D 1O7VA 2PYEA 5DZOA 5FWQA 2BRRH 4YSDA 5EO1A 1WZKA 1R3JB 3EJSA 4JRYD 4Z3GA 1T0PB 4KRLB 2IADB 1WV7T 2VDNL 3NIDB 3ROOB 4QYOB 3U46B 4WQOA 3DX6B 2FSEA 4QOKA 2CKBL 1UWGL 2F53A 3JTSB 2J20A 1MFDH 2CLZA 1J1XH 3FU9A 3VI3E 3L4YA 1K8DA 3FO0L 4K5PA 2DYPD 4R83A 1JK9B 4YDJB 1M57B 4OB5H 3GINA 3T0AA 3UZVB 3M86A 1SLVA 5B8CC 1SVBA 1JSYA 2Q20A 3SBRA 3FB8A 4R84A 2FR4A 4U0RB 3SQBB 5A2BA 5E94B 3MLXH 1MHPH 3S8GB 3D33A 4M1CC 3HLAA 2QQQA 3DI2B 3V95A 3P3TA 4TUUA 3SJVA 5JYMA 1BGXH 2L8AA 2WLMA 2ZUUA 5INCA 1JGVL 4YPGA 2KKQA 3NCBB 2VC2L 4M02A 2AJXL 4ZD3L 5HJBA 5GS1B 1CBVH 3IM1A 4A7VA 2BXYA 2VE6A 4GKZA 1CL7H 4WFGD 1F4HA 5DEZA 1KBGH 3C6LB 1AGEA 2IWFA 3AY2A 2J6WA 3CSBA 4FXTA 1BDYA 4OGAD 4JM0A 3GMLB 3P30H 2DQTH 1MFCH 4YNYB 3DUUB 4TUKL 4PIBA 4JQVC 4PS7A 4L37A 2OJEA 4HWEH 1KPVB 1F4XH 3P73B 4M5YL 3I85A 3R0MA 1G94A 1UH4A 1ZHLA 4PGDB 3H2WA 1BIIA 2IGFL 1JHTB 1GW0A 4HWZB 2L4OA 4BFIA 5I6XB 1HXKA 3UTSA 2ZPKL 3G5XB 4LHUD 2KYIA 3UBXA 2MSPA 4DT2A 4OKVB 4PJ9B 4KKQA 4PG2A 5D1ZD 2VLJE 3KBFA 5HI3D 5DJ8B 4JRXD 3UYPA 1C5CL 4Y1AE 4EF3A 4QRRB 3EG9B 1NCWH 2H0PA 5T5NG 2OL3B 3U2IA 1MFAH 1BZQK 3SO5A 2DLEA 4WNQB 4KVNL 4LOFA 3JZYA 4FQPA 4ICWA 1VGKB 5E9NA 5CSZB 2YBGA 2Z3FA 3PP3H 3U4EA 1MJUH 1DVSA 1QRNA 2IDSA 2L04A 3L1EA 3SY6A 3T04D 5CP7A 4H25A 1QD0A 2Z0UA 3FT3A 4M6MH 4QHKJ 4NRYB 1S7WA 1S9XB 4OLUL 4PBVC 2VLLA 4R7VA 1RUKL 1EH9A 1GGUA 1OW0A 2ICWA 2IH3B 3WBDA 4XH2B 3KHOA 1YEIL 1MI5A 4B0MB 5FGBC 4YXKL 1LE5B 2XWBA 3CLEH 3P77A 5EUKB 4W9KC 5FYKH 3R8BB 5AYUL 3BAYA 5C08A 3CDGA 3QDGB 5F7HA 1NBYA 3IMVA 1M6UA 4P3CH 2OL3H 5KVDE 2Z92B 4G6MH 4XBPB 4LEOA 5D2NA 2WKGA 3S48A 4D9QD 3OG6B 1NBZA 2E6PA 3V10A 4P5KB 4DN4H 3WNKA 3V0JA 4WW2C 3GJFA 3J27A 3DJ9A 4QRSB 1HJCA 5CR8A 4Z77A 1MRFH 1BEXA 3EHBB 3RTLA 1MAML 2QFPA 3QAQA 1MFBH 3HPLB 2FJFB 3FUJA 3MGOA 1KJVA 4D2NA 2D0FA 3BVNA 3KH3A 4X7DC 2C5DC 4GP4B 3TN0A 4FTVE 4TXVB 1MLCA 3NCJH 4LVEA 1TQBC 1DJZA 1LQBC 2PYEB 3NQKA 3VWKC 1VCAA 4N2BA 5BOJA 5EO1B 5B4MC 3S3PA 4FHBD 5CJ5A 5GJTH 2X9XA 4MXVE 2FSEB 3LS5H 3PWVA 4QOKB 2VR5A 1NBCA 4XWOC 5GS0L 3TCTA 4OIIH 4GAJL 4ODSL 4GQ9L 4FJ6A 1RMFH 3WHE1 2DI8A 2ZCZA 4WFFE 4G5ZH 1K8DB 4WTQA 2GUOA 4K8RH 3NFPA 5CZXC 4B0MM 4CDHA 3ARSA 3U0PB 3V4LA 1S9VA 3QH3A 5DURB 3UC0H 3PV6A 2ZCKH 1KTRL 4FHJA 3WKPA 1EDHA 1G6RB 3JWOL 3QJTB 3GKWL 2A9BA 5HGGS 1E6JH 1U21A 5INCB 3TFBA 3ELQA 1IAOB 4QDGA 3EGSA 5AW9B 4OGQC 2EUXA 3D25A 1QW8A 4Q4EA 3OKLB 2RHEA 3F7QA 1Y6NR 3KGUA 2XXMB 4OZFG 1CMOA 1KV7A 1IC5H 2VE6B 3MCYA 3AREB 4GKZB 4MCMA 1AGEB 4F7EB 1MWAA 5SWZD 4YHIA 1I1AA 3GTNA 4H1LA 3S3JA 2F1EA 3BI9X 3KH4A 1RULH 3BCFA 1ZA3B 2O5YH 2DQJL 2F0CA 1NGYA 4L5FE 1NM4A 4LU5H 4Y2LA 1MCLA 3KXFA 1UFGA 2RCSH 4DP8X 3R4RA 4L37B 2OJEB 3II1A 4M4PA 3P4NA 2EXWC 4RRPA 4OZIB 4W9HC 3H6AA 3VXQA 1KJ2H 4GUCA 3GMMA 1ZHLB 3T4AC 3KL0A 3WKMH 4LVNC 1RZJC 4MVBC 1MNUH 5TDNA 4XCEA 5A6LA 2EH8L 3AUWB 3MOAH 1BP3B 5I6LA 2H2PC 2NY0C 5ENWA 2GEQA 4X5RA 4YBLB 3UBXB 4ELKA 2QEJA 4OCRL 3D6GA 2VZUA 1QBAA 4BKLA 1EAQA 2EZ0C 3KWWB 3CXHK 5IV2A 3Q8AA 1BZOA 3TP4A 3GSVA 3Q6GL 1IM3B 3ALXA 2I60H 4YGVA 4EDWH 2APWA 4LCVA 4WV1B 1X9LA 4XBGA 2D73A 1T1XA 1SHWA 3RAJH 2JJTA 4DKDC 1QRNB 3E8UL 3R06A 3T77B 5CP7B 3NEOA 4IBYA 4PWIA 3FT3B 4QO1B 1QUNA 3L3OB 2OMZB 2A74C 2R69H 4JHVA 5AYTA 2DMKA 3D39E 1B6UA 2ESVD 1J18A 4R2GB 3VRLF 3CFJA 2R0KH 3BWUF 2BJML 1KCUH 5I71C 3A6CL 4O5LL 2D7TL 4XWOD 1KTCA 2N0MA 3CNKA 1MCPH 3NH7L 4X9YA 3AS2A 3S3BB 1SF5A 1THCA 1T0MA 4R3SB 4FYRA 1MEXL 1FGVH 5T3ZD 4NXSA 1FNEA 4XP1L 4HXBH 5FB8A 2FGWH 4F37K 2G2RB 1ULVA 3G04B 1B4RA 1E9OA 3QUMA 4TVPL 4NUGL 5D5MF 3VFRA 3CVHH 1ZLEA 2IQ9L 2VM3A 2PP9A 1KTBA 1P5UB 4JFXA 1KB5A 5CINH 5AALA 2CO6B 2X6CA 2ROYA 3FDWA 2WVVA 4MD4B 4TV3A 1MW3A 1JXJA 1SFDA 1U8KA 2CK0L 3AWFA 3V0WH 1A3LL 4NQCD 4B9JA 3S3CB 3ENEA 2D4DA 3CVIH 3FYEB 4YUEH 2NR6C 1WH0A 3GRWH 5G55A 4GUOA 5FUCE 2QKSA 1EO8H 4PJEE 3QXAB 4M3KB 3GSQA 1KJVB 4LCIL 5INDB 3P54A 2HX8A 5DZNA 2ZOWA 1SMDA 3LEXA 2K9UA 1ERNA 1SBSH 1A1MA 2M2DA 3X2QB 2JELH 1P2CB 1WT5A 3MREB 1JPSL 4F2ME 3VQ2C 2EXWD 1DSWA 1W80A 1TKWA 4MVBD 4TSBL 3FCTA 4W9CC 3WFCH 5HDRA 4I85A 3TNMA 2NY0D 4DKTA 1VFBA 5KG9B 3NFPB 4A63A 5I9QB 3AS0A 4ANKA 3V4VB 1BF2A 2DRUA 5KSVB 4BH8A 4U1MB 3Q3GB 4QHNA 4WK4B 3ZE0E 1NSNH 4L4VD 2AABH 1TT6A 4LSTL 3ULUL 1BYOA 3EGSB 4G6KL 2OAAA 3IWUA 3OAUH 4PJAA 3D51A 1SF3A 1V7MH 1HYSC 4A7GF 3HVDA 3K2UH 5EIQA 3FFDA 3MTXA 4PSPA 1AHWC 1KBKA 2GSGB 3TYGL 4HHWA 3PHAA 3OHXC 4JHUA 1QLEL 3KWXA 4YHIB 5EZPA 3T9WA 4CU7A 1IBYA 4TSAL 4H1LB 5F0MB 5IP4A 1G7PB 3QAZB 5CEYB 5IOPA 2XWZA 4P2QB 5CSBA 1C16A 4QNPF 1X5MA 5FS5A 4QAWA 5DD6A 3HG1A 1I8IB 2VQTA 5KYXB 2ZG2A 3MZGB 3ZTCC 4NFDA 5B7MA 1MF2L 1PSKL 3GMMB 4JKKA 3S37H 1IARB 1YC8A 4DK6A 3VFSA 2F8XC 1U6AH 4HP5A 4LLYA 3T08A 1Z66A 3L7FB 5ENWB 3F58H 3PFUA 3A0OA 3VFPA 2F74A 2YXMA 3FTXA 4M8QB 1CXHA 1SYSA 3EZJB 1ACXA 1CD8A 2BVQA 4W6YB 1FZMB 4ZS7H 4NUJB 3WLBB 1KCWA 1WE5A 4YE4H 1XF2B 4FA8A 1NUGA 4FFYH 5DRNA 2YUVA 3BT2H 2NR6D 2ZX8A 2RB8A 5I1EH 4PB9H 1KYOJ 4XBGB 1YN6B 1CG9A 1DVZA 4MX7A 5L6YL 1XF5A 3R06B 3GIVB 3I2CH 4O9HH 4R96B 2I24N 3V4PA 4YWGH 3GZQA 1OAUL 4MQXC 4F7TA 2H6OA 1WWBX 3NABH 1FIGL 2A9NH 3H85A 5HHME 4PRID 1XWVA 2BWIA 5ISZA 3FKUS 5C71A 1QVOA 4RISH 3LRKA 1R5WA 3ZLQC 2AJSL 3DGGA 3PHQA 4OGYL 2K3HA 5I75C 1W0YT 2CUIA 4PJIB 4HCRA 1CN4A 1FNEB 4AQEA 5FB8B 3C6EA 4FFZA 1NLDL 1W8EA 4FZEH 1H8LA 5GIRA 5F0PB 4RRPM 2YXVA 4OFVA 1G9NL 3VFGH 4NNPL 1SPDA 1K6QH 4WI3A 2F08A 2XTSA 3HZ3A 4OZIF 1HXMB 4JFXB 3WU1A 1KB5B 2E6JA 2W65A 5IK3B 4IKLA 3VFWA 3O6LL 3U0WL 1GMIA 5ESVA 3C6SA 2P9RA 1KV3A 3LKRA 3PABA 4BBWA 2X2IA 2YR3A 1HYSD 1VFUA 4OAWA 3BH4A 4S2SB 2F19L 1JXDA 4RESB 3BSZL 4QIRA 4TL4A 4IRSC 1KIUA 3NFSL 1EJ6A 2OMTB 2VXQL 2G9KA 5FGCB 3OPZL 3IMUA 4C54A 2F68X 3B1UA 3H42L 1LO2L 3IS0X 1A1MB 2A9ML 3HZKB 4FNUA 1F6AA 2G3XA 1BVZA 2HVBA 1VPOL 3C87A 2WW8A 5D1ZI 5C8JA 3HN8A 3PAZA 3VGBA 5DMKB 4PRHD 2JB5H 4OVUA 1OCWH 4U2ZA 4HIEA 4GXVL 2YN5A 1EHLL 4TNWK 2P48B 4Z7QB 2VR6A 4ZMOA 1JWUA 3TNMB 1DQDL 3L4TA 5CD3A 1QFUL 2FX7H 4AKPA 5LGYA 3N2JA 2P7TA 1JGDA 1SZNA 1WITA 5KVGH 1AYOA 4YHYC 3SPVA 4BH8B 1BQSA 2A6DA 4QHNB 5D93B 5CCHE 1P7KA 5E1HB 1IT9L 4N85A 5DT1H 1TO4A 1TVDA 4RBPH 3SDXF 5FLUA 5IMKA 4XN9A 2CBQA 3LV3A 4PJ5B 4X83A 1XIWA 3IJHB 5I30H 1VGEL 4MXQC 4MQXD 3ZKNC 2O5ZL 1AI1H 4ZUSA 3S5LG 4A1RA 4M7KL 4OUUA 1FBIL 3WFHA 3VI4F 1T2XA 2H26B 4UAOB 3OD3A 4BKTC 1ACCA 1XEDA 1N2RA 1IAII 2WXMA 1N5AA 5C6TL 1ZGLA 4UINL 3OKKA 4OFIA 4IS6A 1YSOA 1C16B 1CXLA 1TETL 5DD6B 3HG1B 1MW0A 2AQPA 2FECI 4RGOL 1JPGA 4LLQA 4X7CC 5CZRA 3SDDD 3TBSB 4Q9QL 1X9RA 3GSUB 1MAKA 3MUZ1 2QVIA 4PHXA 1YQ2A 2BHFA 1QFWH 4EI5A 1AFVL 1PY4A 4PS8A 2XVBA 1I31A 3HRZB 3ZR6A 1HZKA 4NM4L 3NCYP 4JHAH 5D72H 3SBPA 4L48A 3WJJA 1KEGH 4NOFA 4PJGE 3SZ6A 4G6AC 4FFTA 5E8EA 2WUBH 3VFPB 2F74B 3KBPA 4ZBJA 1EAOA 3FS9A 3JV4B 2BVQB 4Y19B 3T0WA 3PY9A 3DSNB 1KCLA 3VFVB 5DRNB 1FNSH 5FUZL 3ZE1B 3CHSA 2P28B 4HG4K 4K3DH 1XF5B 3PYCA 4LCCC 4UM9D 3NCYS 1N18A 3QG6B 1MCOH 3OV6A 4W9JC 4F7TB 1IVLA 1G7LA 2KZWA 3ARFC 2UUDK 1PIGA 3K8MA 2WIIA 1AQHA 2DTMH 2B16A 3SKNB 1A5FH 1QVOB 3GD1C 5I1KH 2ERJB 2ICEB 5KUKA 4OR1A 3PHQB 3VTMA 4XNZC 3WAKA 2E9GA 2W9DL 3FQRA 4H8WL 4WDIA 3QIUB 1T5WA 4L1LA 3ZKMC 4W93A 2CBOA 3P3RA 4QHLA 5C07D 3S36L 4AIXA 3IJYB 2OXHA 5DK2B 1T20A 5E5MA 2NTSP 3ESNA 4M03A 5GIRB 4HBCL 1ADQH 1E9PA 2VDMB 1J11A 3FMGL 4OF8A 4NQSB 4M1DH 1V3JA 3IJSA 3QPXH 4RLDA 1T6VN 4XMPL 1SDAB 2I7OA 1DQKA 2MIZA 4GSDL 2W65B 4ZUWB 4U1SA 4K5OA 1KTKE 2F2HA 3VFWB 3QFGA 4N8VB 3VXUD 4Z78B 1FWXA 1RIHH 4UIMA 5D4HA 4I1NB 1DR9A 3U48A 2NXYC 4GXFA 5DVLA 4MXQD 1AKPA 3ZKND 1ADWA 4LNRB 4OAWB 5EF2A 1BMZA 4PJXA 3FH7A 1RSYA 3IFLL 3QW9A 2FIRT 1KIUB 1ORQA 5IMMA 2W9EL 5I1LB 1ZVYA 5ALBL 2WBJA 4EKXA 4X6EB 1QQDA 1I85A 2TSBA 3OC8A 3UC2A 1F6AB 2QDVA 5KYUA 1HCZA 1OAYH 3V9CA 5IMOB 3DVNA 1JPFA 1CYWA 2M8XA 1TENA 4A2MA 3ZYOA 1TFHA 1FL3A 2ZKXA 3FT4A 3QS3A 4FN0A 2AEOA 3DMMB 5T3XH 1YEGL 4DUWA 1LEIA 3CIQA 1HZHL 3OHMB 2MMXA 1JZ6A 4QHPA 2IFFH 1R0AH 3F84A 1UOKA 3DHJA 4G6AD 5G5DA 1OAKH 5BZWA 2P7TB 4UT6L 2GSMB 2ATPB 2P47B 3H55A 3WNNA 1RLBA 3TF7C 4D7BA 2VMCA 3L7EA 4DGYH 2GIXA 4EN3A 4YVNA 4XN8A 1BQHG 3SQOL 2V2XA 5IM7A 3DJRA 4P5TC 5DLLA 4BFNA 3CC5A 1KGWA 1EGJH 1HHKA 5LXGH 3LV3B 2WXJA 3KDMB 3QULA 3SGKA 5DZVA 4NN7C 4WFHE 2YS4A 2OMUB 1JWMA 1N6UA 1X5LA 3AGVA 4ODWA 4QGTA 4I18A 1OPGH 3ARFD 2D31A 1HHJA 3L54A 4L3CA 2IALB 1NGWB 4UZSA 1AR1D 1CQKA 2J5LC 4P4KB 3G08B 2V5MA 1KXQE 3HI5L 3WY2A 1EWHA 3A23A 4Y2OA 3PWUA 5HYJE 3OKKB 4G8FA 3WN6A 3NACL 4B9IA 2B3IA 2W07A 4QRTA 3ZKMD 4ZW7A 3IDNA 2ATKA 5A2AA 4AYDC 4XNXH 4XC1H 2BSBA 1UH3A 3APCA 4HKXB 4PRDA 5BQ7A 3HE6D 1KN2L 3PPEA 5ANME 4EZKA 2KLTA 4MMZA 3LNIA 4HQQH 3DOSB 1P7BA 3ARBA 5IHUL 1HHIA 3H3PL 2W0FA 3QWRA 1KGYE 1ETZB 3AG1B 1TTGA 1N3NB 3HG3A 1KIQA 1UQSA 2HTKC 3BWAA 1U92A 3MOBL 4Y5VC 3VXSE 2XVKA 1NZRA 3OWRA 4Z23A 1GPOH 4MNGE 4OBRA 2ZYIA 3B2PA 3BEVA 2YMXH 2WGXA 3S2AA 2X70B 1LO5A 1TZHB 5H4ZA 1G7LB 2EYRA 2MHAB 1KYAA 4MDJB 4C56B 2YPLB 3W56A 2WIIB 4BFEA 3GK8H 4WVRA 1LQSR 1J0IA 2IPKB 3G6JA 1L0YA 3V0AC 3BVVA 4A6YB 4BFKA 3VXTA 1ETA1 3IN2A 3EFFB 4U7SA 4YFEA 5LGJA 2WZPD 3WUWB 5IW6A 5HHXL 1ZGLM 2JTDA 1EHNA 4Q58C 4QHLB 2WXKA 1ZRUA 1A7PL 2VN3A 1DQJA 4NO0D 2OXHB 3TJEL 1T20B 5E5MB 2FO8A 3SE4C 1OHZA 4AUJA 4H26A 3EOBA 1N8ZA 3MUJA 3IJSB 4M6OL 1HINH 1T4WA 1W16A 2AJUH 3QCUL 5EOTA 5HD8D 3PWNB 2R2CA 3QUYB 2WK2A 4K5MA 4XN2A 3Q8EA 1CU4H 4RMRA 4UIMB 2MQ3A 3DX2A 3WMQA 5AEAA 1L4IA 2C4FT 3MNWA 1B4JH 4NQED 4PUBL 2FECL 4GMSH 1EDYA 3Q9QA 1J05A 4E41A 2FJHA 5DHVB 5C09E 3F00A 1MELA 2XQYK 3GXDA 4HGWA 2EXSA 3DNKA 5DVMA 4Z76A 1HJBC 5IMMB 3ULAB 3R7RA 1ACZA 1GYCA 3CDYA 2UWEF 2KDYA 5AKVA 2WBJB 4G7YL 3ESUF 1DBKH 1PZ3A 1QQDB 5KSBF 5DRXA 2DICA 4IOIA 3L17A 2J1KA 3BAKA 3G5ZA 1E4KA 2XQBH 2VM9A 3CDCA 3DVNB 1JPFB 4HLZG 1F6FB 1MFNA 4U6TA 5L9DH 4P9ML 1IGTA 2VITA 4MJHA 3TGXA 3LQZA 2M83A 4WCYL 4M6AA 1OT4A 4MASA 2KQMA 1ACYL 3EADA 4WEEA 5E23A 3ZHLA 3UABA 3TTYA 3WO4C 1Y6MR 2VDPB 3JSSA 1Q9WA 3CHXA 3MV7D 3KW7A 3V0EA 2WTRA 3MC0A 5AKTA 1G7JB 5FYJL 4AW4A 1B4LA 1CZ8L 2QKIA 5FYJE 4EN3B 3BKJH 1FL5B 1OCOB 2OR9H 3IDXH 5FA4A 2DJUA 4XNDA 4WEMB 5E8NB 4KTEH 1UJTA 4TNWF 4BE6A 4JY6B 2HT4C 3N0PB 3PNWA 2FIKB 2ZKWA 4C55A 1A9VA 1A4JA 4H8VA 4BFRA 3IRZA 3W38A 5IWLC 1JV2B 2VISA 5I0YA 3BMWA 1JWMB 3GUTB 1NDTA 1KC5L 4AYBA 1GGIH 3HG0A 1EBAA 2VO5A 1FH2A 4UTBL 2D31B 5DK0B 2DQDH 4L8DB 2FLBT 1TUPA 1EUUA 4KITB 4XNYH 2WAQA 3BZEA 5C7ZA 3QT2A 2CO1A 3MPCA 1I75A 5D1QD 4N2CA 5LBSL 3FSAA 4LLDB 2ZICA 2C9SA 2JCCF 2V9QA 4QRTB 1INDH 5DVKA 1RZIA 5DR5L 3IDNB 2YD7A 3A21A 2F8OA 1UB5A 3LYRA 5SV3A 3PWPE 5E08L 4FZ8L 3KJ4C 4OCSL 4PRDB 3VXOB 1PY9A 3C09B 5EG6C 1ZXQA 4YC2B 3U36B 4MMZB 2CR0A 2P52A 3MRNB 3I9AA 5EBWB 1HHIB 2IDUA 3ABMB 4OM0H 1YEKH 3IMRA 3QFDB 4P5MA 2WKOF 3KD4A 3KYMA 1LDPL 1XZ0A 3V5KB 4BZ2A 1KIQB 4WUKL 1UQSB 5E6YA 4KI5E 3BWAB 1WP6A 1U92B 1CDBA 3ZKQD 3ASNB 1IUZA 4PP1C 5BJTA 1TJXA 3OR6A 3D87B 1BOYA 3FTWA 4FI8A 7PCYA 4I8DA 1YLBB 5AVQB 3BEVB 3SOBL 1BWWA 4FNLH 2FTAA 3O6FB 2OW6A 5F97E 4QY8A 3SDAC 1R33A 2EYRB 3MRMB 2JKLA 2GY5A 4G7VL 4MDIB 2VQ1A 3NJKA 1CGTA 5I8KH 3WTUA 3UBXG 1HVXA 1T7YA 2O6CA 1FO0A 4Y16B 3G6JB 4LDEB 1UM4H 2GI7A 4JG9A 1DZBA 4RFNB 4TQEH 3C9NB 3D9AL 5PAZA 3PFQA 2KZKA 2IPTH 4WO4C 2WB7A 5CBAB 4ANWA 5C0AA 3PQYE 2L7EA 2GTWA 2GKIA 1FFQA 3DOIA 3CZNA 3IMTA 5E6IB 1DQJB 4FP8H 3PHSA 5CGMA 5D1XA 2X2UA 3DXAA 4KPHH 5T3ZL 1QBML 2ZSVA 4DVRH 4A38A 1FVCA 2ZUWA 4W9EC 1NLBH 1WA1X 3RIFF 5FPIA 5C0EB 3FHAA 5TE7H 2E5EA 4HT1L 4JO5A 2ZXGA 2UX6A 1P9MA 4G8EA 3M46A 3Q2LA 4AGLA 1WICA 3IEAA 4MNQD 4KAQL 3QG7H 3S88L 5JXEA 1L5GA 3LS4H 3AWEA 4I13B 2IH9A 3UEQA 4I4WA 5IEHA 4EQ3A 2BOLA 3QXUA 4E41B 1ECYA 5E8OA 3NSDA 2XPZA 1JZDC 4N8CH 1ZCRA 1FZKA 1AQDA 1UA7A 4HGWB 5J5EA 4AYMC 1SJXA 3DURA 3KYOB 4CC4A 4P5RA 3FULA 4RGMC 4PRPE 3Q5YA 3DX7B 1FYTA 4FKKA 2XWCA 1UXSA 3BVDB 4I5BA 1U36A 4JQXC 5D4JA 8CGTA 3G5ZB 4QRQB 3GBNL 2HCZX 5HVHC 5ITFA 3T3ME 3EYSL 3BCDA 1N64H 3GHEL 3MRPA 2X40A 2FDBP 4GSUA 2EDYA 5AW5B 4CMMB 5C0DA 5CILH 1UCTA 3T1FA 4PLJC 3RJDA 1KY7A 1PNCA 1QMUA 4G9FA 4A2GA 4ETQA 1IZJA 4AQ1A 1Q9WB 1KDJA 1GGCL 2QKIB 3U9PH 4U0RC 3VFTA 4PR5A 4EZMA 4KX8A 4GG6F 3ATFA 1Q0XH 4OLVL 1PKOA 3BLKA 2B59A 2PCFA 4PP1D 3QSKB 4OT1H 4PI2A 3QS2A 3TO2A 3X3GH 3P40A 5HVFB 5C0BD 2NZIA 4MAZA 4PTTB 4NM8L 3WHE0 1RUPL 2VISB 4DZ8A 3SDAD 4P2YA 5LB1A 3D85D 1IQDB 2KLRA 3MLPA 3RWGB 5GS1C 2YN3A 4YOKA 4N0UA 4GFTB 5BRZA 4ETYA 5EU6E 4TNVK 3T1WA 3FCSA 3GPSA 3MV9E 4JO3L 1EA9C 1Z9SA 4HLJA 3WS3A 5B3SB 3CXFA 1YMMA 5HHPB 5IT2L 2QPFA 4PTUA 4WO4D 3AVEA 4OI7A 4EUPB 3S4SA 1RZIB 3MBED 1NUDA 2VLRD 2PXYA 2GFBB 3IGFA 1YJDL 1IAMA 5KVFE 2Y5QA 1JFHA 6CGTA 4ZNCD 2MCPH 5JDSB 4DEWA 2CNZA 5EEYA 3LKOA 4UQ3A 5GGQL 2K45A 1REIA 1T2QL 5I6XC 3TBVB 1BAFH 1QYGH 3WIAA 4QXGL 3O6ML 3CH1B 2X4NA 4H1LG 1QACA 3SGJC 4RMUA 3QJOA 4XP4H 1FCGA 2ICES 3UTPE 1T89C 3CSYA 3D18B 1K4CB 1QFPA 4F5CE 3S35X 3OR6B 4N2AA 3WNLA 1CDCA 4RRPG 2P45B 3HR6A 1VLXA 4PJ7F 1QSEA 2GI0A 3NJLA 2WIMA 4XVOA 3PCYA 2XVGA 1WISA 2VQ1B 2X9ZA 2XZQL 3RU8H 4LQFL 5E2TL 1FRGL 4OZGE 4TQ8A 2ODHA 3ILPA 1M7DA 2MRYA 4PLKC 2XX0A 4X4XA 2L0DA 1KYDA 4JFWA 1MIEH 5AD0A 3K71B 4Z9KB 2BLFA 2HG5B 4UQ9A 2XJKA 5DVNA 3VD5A 2GCYA 5ETUA 3QR1A 1A6VH 4PCYA 1OP5H 3AT0A 3DXAB 4AYFA 5B1KA 1CCZA 1KWGA 3E2HB 5EZOH 5IW3A 1FVCB 1X5HA 1CE6A 1KENL 2QGDA 2CMRL 2BVEA 4LSPH 3VGDA 4F2EA 1GIGH 1DBJL 4HC1H 1CFQA 1MJ7L 2R2HB 3OF6A 5I0WA 3RWJA 3WEMA 1EXUA 1ZT4A 1AS8A 4NEHB 1XMEB 1JNJA 2Y4SA 4UMSA 5LGHH 2VB5A 2OP4L 4Z7VA 3FRUB 2E27H 4AH2B 1T5XA 1FZKB 1AQDB 4XHQA 1YEEH 3EHBC 2IBZX 4XNMA 3ATEA 4DGIH 3Q2WA 1JZFA 2D03L 3C6LD 3HNVH 3K6OA 2VDOB 3L6FA 2PTVA 2ZWSA 2GITB 1YECH 1I7TB 3X1EA 1RZKC 1UWFA 1TPXB 4FMKA 1YHPA 2BDNH 1JVOA 4M43L 1IQWL 1U3JA 3P9MA 1A6AA 4JHBA 1GC1C 4NQTA 5D7SH 2BNRA 2YRLA 1RJZA 5T1DL 4AEHL 1IU1A 2YA0A 3CQPA 3SYAA 4F15C 4MB3A 5HHQA 3O2VH 3QDHA 5KOMC 4AQ1B 2JH2A 4PJ9D 2OCFD 4MAYA 4GXUM 4QRRD 4KXBA 2ZWZA 1GJWA 1VA9A 3OXRA 4OLEA 4Q8BA 4YPJA 3ZX1A 4K9EC 2B59B 2PCFB 3MO1B 4JPQA 4BSWB 5I0DA 2R0LL 2FL5A 3V0VA 4UQEA 5C0FA 4L23A 3V6OC 1EEZA 4DVBA 4ZUVA 1S2EA 4XZ4A 3NYKA 4OCXH 2P8LA 3FSOA 1Y1DA 4GIPD 3U30B 1T03H 3A4DA 3JWNE 3FCSB 3X14A 4HUUB 1XDTT 1NPUA 1NMBL 3WXVH 4QKXB 1TNNA 3MCKA 4PTUB 2LU3A 2AQ1A 2V2WB 3DV4A 2QGBA 3H3KA 4D3CH 5DS2A 2HUHA 1NUNB 4HMEA 2R0WL 4R0LA 3D0VB 1BQKA 3OGCA 2CHXA 2IWKA 3RNKB 4NWTL 3N50A 3KYKH 5DJ0A 1QBLL 3RVTC 5IJKC 4BFOA 2CKBA 4NJAH 4HDIA 3ZDXE 3N85L 3T2NH 43CAB 3QDGD 5L4JA 3LKOB 3CC1A 4UILH 3BUPA 5I2IA 3MLWH 2XRAL 3NA9H 1OP4A 3PV7A 4IM8A 4YBLC 4PG2C 4L2LA 2AGJL 3LHAA 3OR7A 4MLIA 5F7KC 2WINA 2ZYSA 3U7YL 3L3KA 2WWKT 4P48A 4TOYL 4DPCX 4YK4B 2GSIA 4DKFH 3I84A 2G3ZA 3EHBD 4NSKB 2I26N 5FO2A 1ZV5A 3KE0A 3QISA 4RWYH 1GY2A 2YGQA 3FL7A 4JHWL 4PJHF 2B4CL 3ARYA 3R4DA 4L2YA 1A9EB 1CJYA 3HZVB 1ZPUA 1LO0L 3QIBB 5CEZE 3UJJL 3REWA 2PYED 1M7DB 2MH4A 1UZ6E 5KW9H 4X4XB 2VDQH 3LN9A 4HXAL 2YRZA 4HWBH 1CGUA 1BVKA 1I9RH 1OW0C 1HSAA 4QOKD 4WTWA 5ALCH 5AD0B 4PGCA 1IO4C 4OZ4A 3HN5A 1U8NA 1I8LA 2ORBH 3D1MC 2GCYB 4PEEA 3UBFA 5CFAA 2Y7OA 1PKQE 4LCWB 1RCYA 4AYFB 3L95A 5J4MA 3MMEA 3TPUA 5AG9A 3L5HA 5TQ2L 5DURD 4GT0A 4ZG1A 1ZV9A 2LW3A 3EAKA 5CJQH 1UKQA 5GHWH 5BQDA 1P5UC 1XF3B 1FJ1A 1V3KA 4J3OD 3VJ6A 1IKNA 3E8VA 1NKGA 4PG9A 5D2NC 1MCWM 5HTSA 4EPSA 4JFUA 4A7QA 5CZKA 4NP9A 1OF2A 3QDAA 3QNZB 3V7AG 5L2JA 2CWRA 3ARED 3IKKA 4NZUH 5H37H 2DM2A 4YH6A 1HQRA 1U93B 3L6FB 5ECJE 3KMDA 1MREH 3TN0C 2FBJL 3T0EA 1IBZA 4GRLA 4CKVX 3UTQA 2OFQA 2X7LA 1UWEL 2GABA 1MVYA 1BZ9A 4J12A 4R26H 3B83A 4P2RA 3LH2H 3RVTD 1RJZB 2DBJA 1NCOA 2CSPA 5CUSL 5E7BA 5GZNA 2CIIA 3CUPA 4QXTA 1OM9A 3F7VA 4HPYL 4NCDA 5D2LB 5FYJU 1KGCE 3DGDA 4KKRA 1Q94B 1UGNA 1KPRA 4MAYB 3H4FA 4GSRA 5ES4B 4HZ1A 3B43A 3A67L 4HS8L 1NAMB 2D7OA 1MCWW 2OMNA 3HN3A 3O3BB 4LIQE 4PN6A 4GI8A 4QLRA 5B3NA 1IM3D 1OGAE 3MLUL 3F7PC 1UCBL 3P0VH 5AVWB 1F00I 4JKPL 5C0FB 1WFJA 3CCHB 1EEZB 1QRND 1WA0X 2JKJA 1KFAH 4P0DA 3DA0A 3O3DA 4RZCB 3MYJA 1ZLSH 5IVXE 4OFPA 1F4YL 3KYNA 4ES8A 3GXNA 5IESH 3H9SA 1PLGH 2OZNA 1W9XA 4NQVA 3MCKB 3QAZC 4TPRL 2AK1H 4EDXB 4JPKH 4PY8J 3DV4B 2D9QB 4YX2L 3D09A 4CC0A 5SWSE 4R0LB 2A3TA 2VDNB 2DOCA 3IJEA 2DI9A 3JTBA 1DO6A 2CKBB 5FW7A 5LWYL 4HDIB 5MHSE 4XAWL 5D7IF 3VI3B 3LDBB 4XPTH 3HAEB 1EJ8A 2MOGA 4UQ2A 3VE0B 5TDPA 3GXIA 2QADB 5HSFA 5T1MB 1KT2A 5FO7B 4OF5A 2XG4B 2DJSA 5DD5H 1GAFL 4K3JL 2WINB 1P7QA 5IIEB 3IDIB 4ZMVA 3ABLB 2EACA 3LPWA 2C3WA 4R4FH 4FQIH 4OLZL 3RVXC 1CYXA 2BX5A 2K8MA 1XCQA 3IFNL 5JIDA 1WS8A 5CCGE 1X7TA 4UWQB 2JJTC 2FCBA 1J1PL 2VC2B 3AU0A 4PB0H 2AP2A 3TN0D 4L8BA 4KZCA 1ZDSA 3TVMA 2DTSA 3AW5A 3TV8A 5L2KE 1HN1A 3GMNA 1MIML 3OMAB 4TQIA 4WWOA 1DE4A 1YRKA 5EN2B 1XGTA 3L5IA 4Z7OF 3BD5A 2J3SA 5CBEA 1HSAB 2D3NA 4OV5A 5AUMB 1AGFA 5FXCH 5E9DE 3KPNA 2DYRB 4NYLA 1NCCH 4PJCF 4ALAL 1DBAL 1GGBL 4PJDF 5J3HC 1C5BH 3Q2CA 2OJZH 5HDBF 5TK4A 4IJ3B 3EFDH 4Z3FA 1A4AA 4CVWA 1GZPB 3MMEB 3TPUB 5I8CB 3CSGA 4FNRA 1ZLVK 1IGJA 4FFWC 3WFDL 4U3SA 4YHKL 4JO2L 5HPOA 5J6HA 3BAJA 3HMXH 4C47A 3IKCA 3ASWA 1P4IH 3WDIA 5DFTA 3VJ6B 3MLSH 3A4EA 2B1OA 3IK2A 3NCXA 3EGDA 1BQRA 1D2OA 2BVPB 3KPMB 4M7LL 3BYYA 2DQCL 3L3HB 5F7WC 3WKQA 1KF9B 1CF1A 3WN5A 1OF2B 4OJDH 3WG7B 1JZ5A 1NGQH 3V55A 2EH7L 4X4MA 5E8PA 3LZFL 2QHRL 1ZK5A 1CXFA 4YSCA 5DJ6A 1P4BH 1Q9LA 4S1DC 1TTBA 1HQRB 1U0QA 4XXWA 3RLSA 1SEQL 2WC7A 1UD5A 4K9EH 4U1HA 4DQOL 1ZT7A 3T0EB 1COBA 4DPAX 4P23A 1GOHA 3UTQB 3QDME 4P2QD 4FL4B 5DUPH 3W39B 4J3UA 2RR3A 1HE7A 1BFVL 1UOVA 3WSQL 4EO5A 1JNNL 4KFZC 4P2RB 5KTEH 1A2YA 4JJ5B 4HSCX 1EFXB 5EV7A 4UV4L 3HKFA 3VNZA 3QHFL 4AITA 4P46B 5CIPA 2EYTA 3ZBMA 3CXDH 3F7VB 3QZPA 1NCHA 1RD6A 1D5MA 5FW8A 1PEZA 3MR9B 1U58A 3WEXA 4PJ8A 5AB9A 4MKMA 3VXMA 4EBQH 4F33B 5EBMA 2RQEA 4DN3H 5D93C 5DRWA 3RVXD 1Q90A 1A6PA 2PW2A 4BFGA 1HI6B 2JTYA 3O2DL 5FA3A 4M48L 2APBA 2Y3NA 2Y5TA 1VCBC 2EAEA 5F6HJ 2MNJB 2YD1A 5DDHB 4NQDA 3NK4A 3X3FH 4HIIA 5DRZB 2YGVA 1JF6A 4DEPB 2BW5A 3E9UA 3CFDA 3TL5A 1MLBA 4JM2F 4K7PX 4YDKL 4NGHL 4NQVB 4YL9A 4FTVB 3DVFA 4FXKB 1DLHA 5FHBL 3MV01 3K4DA 4NX0A 3VXPA 1CIUA 5IFAH 4LPXA 1MCCA 4MA7H 1NIFA 5DMIH 4BSJA 3IJEB 1DVUA 1QEXA 3LPFA 4NO5B 2NNXA 3KLAB 4RX4D 1ZS8A 3EF4A 1LMIA 1OWWA 2NY4B 1PG7L 1EZUA 5TDOA 2EC9U 2NUPA 3WTVA 1HIML 5KN5B 2Q0ZX 3RIAF 2EDOA 4LHJB 4JLRA 3TOPA 1XSKA 1P7QB 1CVSC 4K94L 5EF0A 3SSGA 2H3KA 2X1OA 3VGHA 3T3PE 4NENA 1XCQB 4PGBA 1O0VA 1RP9A 2FEDD 2NYYC 2CGYA 3LZLA 4MA3A 4Z7UF 1NDMB 1I4FB 2K4WA 4DZBA 1RUML 2NNFA 4UDTA 4HFWA 5I1DA 3D2TA 5IMLA 2HJLA 1OTTD 1A6UH 4RA3A 2FO1A 4FG0A 1JAEA 4X2UA 3GMNB 2HWZL 2MQ0A 5DEGA 3QVAA 4N2KA 2CPUA 1NC2A 1XGTB 5EZIH 1JFQH 1NFDA 3FO2A 4M62L 3VYPA 3CVCA 1X44A 5BS0A 2X12A 2ZP9A 3GJFH 3K8LA 5L7XL 4HJEA 3K91A 1AGFB 2AJ3A 1HHGA 4NYLB 5CHNB 4YDVB 5F7NC 2J44A 4QD2E 1OCZB 4XMWA 2G2NA 3OWEA 3FNKA 1ZLVH 4P99A 4HWUA 4JDVA 2J56A 1VZHA 1IGJB 1O75A 4MD0A 5J6HB 1E42A 4EIGB 4HUCA 1QWUA 3IKCB 1IJNA 4X6CA 2X89D 3U1PA 2FX8H 3VGAC 1LO3L 1FPTL 1QFOA 3K2MC 2AEIT 2DPKA 3D3VA 1DYZA 4JG1H 4APQA 4MJ6A 1YNKL 4U2YA 4PJ5D 4G80A 1WCBB 5CP3A 2VJ0A 4J2QA 4P57B 4Z0BL 4XPGL 3IMWA 3IU4H 4MCZA 5DJCB 3W2DH 2EDEA 4P9HL 4WKZB 3QIWB 1HNGA 4JDEA 1CUOA 3K74B 1GKEA 1DCEA 2CJUL 1E3FA 3WL9A 3FB5A 4U1HB 4N68A 1QSZA 4XBEH 1I8AA 4P23B 2WNKA 4UQBA 3RFZA 4ODTL 2WXIA 2YMOA 3EW3B 4L5FH 2HVJA 4ZAKA 2YAPA 3HG1D 3ETSA 1RJYB 1A2YB 5I6PA 2R1XA 3X1NA 2OMVA 2YD0A 1S78C 2AXFA 4P05A 5FUOH 4ICXA 1R75A 1QTSA 3LAFA 2EYTB 2CXGA 3VA6A 4J3VA 1BZDA 3VVWA 2NLJA 2HN7A 4AV5A 1U58B 4PJ8B 1A6WL 1M6OA 2C9PA 3F6JA 3VXMB 4Y19D 5EBMB 3EO1A 2HRPH 2EIZB 3MJGX 4HH9A 4S1QL 3B7UX 2F7PA 1MFUA 2H2SC 4E0RB 1K8IB 5C0NC 1IE4A 1D5IL 5IHHA 2NYYD 2QGEA 2QDWA 1Z0MA 2WQXA 4YXHH 2Y5TB 3MV8A 1J0JA 2FJSA 3LX9A 2X5PA 2NY5H 3V7MA 5I66A 2KPWA 1YMHB 4IU2A 1XIWC 1P0SE 2CUAA 4WJG3 1EAPA 3PL6A 4HIIB 4RFOL 3CFIC 1UT2A 3PIQA 3FQUA 4P59L 3CFDB 4AZUA 1U8HB 4PJEB 1FG2B 1MLBB 4YQXL 3BSZA 1D7FA 3LZOA 4P4KC 3NUKA 3UZQB 2VXQA 1EMTL 2QPUA 5DUMH 3JVGA 1DLHB 1M7IA 1CLVA 2CJSA 4GUPB 5GJSL 1QATA 3O11A 4O58L 4Q9BA 5IFJA 5DTFB 4JY5L 2HG0A 4F2MB 3QIUD 3X11A 3P1VA 3BP7B 2AZUA 3ISWA 3M1CA 3LN5A 5DXWA 5A2CA 3MRDA 2BRRL 3L1FA 3DVGA 4ZOCA 1JZJA 4EI5C 1E5UI 1DQLL 1U8IA 2P5WE 3CX2A 1D5BA 3O8XB 2HX7A 4XP6H 4AEEA 3JYCA 3WJJC 4R7DB 5TDOB 2DN7A 2NUPB 3G5VA 3WE6A 5E1AA 3NP3A 2ADFH 3GSNB 1UM6L 4OB5L 4C58B 3IFPA 1H8OA 5A40E 4ODVL 3ZE0B 4RH4A 4EUPG 4NENB 2ZUYA 1V3MA 1ZANH 3MLXL 4HEMA 4MA3B 5CD5D 4G11A 3QUMH 4C8XA 2RGSA 5E5RB 4L3FA 4YHOH 4HFWB 1XHHA 4NRXB 5I1DB 1ZIAA 2ISDA 3ZO0A 2HJLB 5EMYA 4ZUUA 3SDCA 2OXGB 3ZIYA 2CHWA 5A2IH 4N5UA 3ZXAC 3GO1L 4A2DA 2PPFA 1NC2B 3F7RA 1UXLA 4NO2A 1NFDB 3I9IA 1QLEB 2V2TA 4AIZB 1CL7L 1WIPA 2E3VA 1KBGL 1X9UA 3DMMD 2AJ3B 5AFAA 1E65A 4LQ1A 1JK8B 4ZSOE 1AGCA 3KVPA 3ARZA 2E7HA 2ICCA 1HOEA 4JPIA 3AFLA 4JDVB 3BC9A 5GS3A 3GSNH 1F4XL 5J13C 4RMWA 1M05B 4CSPA 3VSVA 2I9TB 3FB7A 5C0ND 4L1DA 1ET5A 5JQHC 5J11B 1JCVA 4WFED 4K07A 3N41B 5GGTH 3SGEH 3NSXA 1NC4B 2AJVL 1H15A 1G7IA 1SRDA 2I32A 4MCZB 4GG8A 4ZUTA 3VRLE 5F88B 1M7UA 3K0WA 5GRVL 4DTGH 2HX9A 3NGBB 3OX8A 4P4KD 1I8UA 4ENED 4GRWB 4KQ4L 4MSWA 5LDUA 3FB5B 4K55A 4KWUA 1MHCA 1MJUL 2WBJC 3HB3B 2O5XH 3RFZB 1I85C 3KPRE 5HHMB 3ZU8A 1ZLUH 1DFXA 4PAZA 2IANA 3PGCA 3GJEA 3LEYH 2ZKHL 3HW7A 2R4SH 4M6ML 3LKNB 1G7HA 4MWFA 2P8MA 2BY3A 1KLUB 3ZT5A 4MA8H 2WUCH 1AKJB 5CJ8A 1EHKB 4L4TA 3HUJA 2WXNA 5ACZA 2AW2A 3U4KA 4Y5YA 2DQHH 5E6UB 4ZMXA 2NLJB 2GJRA 3IGAB 3F83A 1M6OB 4XP5L 3K5RA 4EN3C 1BOGB 2WWKO 2Z35A 1UT9A 1H9DA 2YD5A 5FYKL 1DJIA 4Q6IB 4YGAB 5IEKA 5FYKE 5CMAA 3BZFA 4KRMB 1FIEA 4KDVA 5BUAA 1KCVL 3AXHA 4P3CL 2OL3L 3HCVA 1X5IA 2NY6B 5F1SA 4IU2B 2IPUG 2J1XA 2MQGA 3GS4A 3C5ZA 2BIPA 1EAPB 1U42A 4ZQKB 3DX8B 3FQUB 1YEFH 4C56D 1KB9J 2XWTA 2YPLD 3ESMA 5HHOE 1SLXA 1MRFL 2R1YA 1VADB 4GJTB 1ZWIB 4JRFA 5HYQA 4Y4FA 2VRKA 1G84A 1Q8MA 2NX5E 4N9GA 3O11B 3Q05A 3S36X 5BVJB 4W4OA 5IFJB 3CVDA 5DA4A 5I73C 4L05A 4OVVA 3NCJL 3MA7A 4FQLH 3V4PH 1CICB 1J8SA 1H3XA 1A7NH 5GJTL 3BDXA 4F91B 5BRQA 3UIYA 3C09C 1U8IB 3QUXB 4JGMA 4NZDA 5E1IA 1O7SA 1CT8A 4X5XB 4MMZC 4ENZA 3STZA 3WE6B 3GDBA 1O6VA 1RMFL 4JO8A 4L3EA 4RA0C 3ARBC 5HJ3B 4G5ZL 4UT6A 4Q9RH 3M17A 1WGOA 4LVOB 3RBSA 3BJLA 3LVTA 4K8RL 1IGMH 5DI8A 2QFRA 4JFHD 1TNMA 2FJUB 4BK5A 4HCRH 3ESVF 1WTLA 2BP5M 3II3A 3L9BA 3N44F 3QQ4A 4J8QA 4V1DA 4WK0B 2OSWA 1URLA 2Y2WA 4FFZH 3S4SG 2ITCA 3D34A 2ZCKL 3UC0L 1QTPA 4JRYE 5IW1B 4WWKB 5C6PB 1BFTA 4G9DB 1JZ3A 4GBXB 1J9TA 2WVTA 2AV1A 2WBJD 4MMYA 4PWFA 3SBQA 3SDCB 5IBLD 2OTWA 1ITBB 3CFEA 2E9IA 4RAVB 1IC5L 2OA9A 1JDAA 1I8KA 4LOEA 1J8HA 4U05A 1LXMA 2C9QA 1TJIH 4YBQC 4I3SH 2YHGA 1L3WA 3PU7A 4U7KA 3UPAA 4N1EA 3UX9B 1RJLA 3ECUA 5ICZB 3APNA 3EJUA 2QZQA 4KH9A 1N4XH 4NB7A 4LPVA 3UROR 1HC1A 3HS8A 2O5YL 4DK3A 5E6IC 3QEGH 4LU5L 2J4WH 2RCSL 4HFUH 5JIKA 2I27N 1IM9B 2KUTA 4IKIA 4EN3D 3QYMA 1KJ2L 2OQJA 3WNPA 5M95B 4ORZC 4PJGB 1YYMH 4I0KA 5L4IA 3FB7B 1MNUL 1R6VA 1TZGH 2FQFA 3B5GA 3MOAL 3FTVA 4ZQTA 1VERA 1G6RL 1ZSHA 3IPBA 1WBXB 4L9LA 4NNYA 4LHUA 4U4IA 2Q6WA 3F7KA 2A83B 2B08A 4RNRA 4JFDE 5GRJH 1G7IB 1JTTA 5D1ZA 2DKSA 2RFXB 4ZUTB 5KBMA 2CO7B 2ODIA 3FK3A 2G5RA 2J25A 1GOFA 2I60L 3JQOB 4UIKH 3DO7A 2F8VA 4IYKA 4WW1B 4BRJA 4AWJC 4EDWL 1MHCB 1CLYL 2OK0H 1DJWA 3K1KC 4TNFA 3DIVA 3ES6B 1I3RA 5DZAA 1E4KC 1RKRA 4HJ0C 1IL1A 1XCTA 2E7DA 1R3HB 3FFCA 3TURA 3M88A 4JRXE 3TNNB 5EEUA 4NKQB 4N0CC 2R0KL 2Q7YA 5EU7E 2GVYA 4JAMB 1KCUL 1BECA 5KBNC 3HUJB 4FAAB 1QSFE 5ACZB 1AHMA 4XTRD 4F24A 1ZSDA 4Y5YB 3VGEA 4LPUA 1MCPL 3R1GH 2BVOA 1UM5H 3ARBD 1UWYA 4UT7L 1FGVL 3QWRD 4HXBL 1IEAA 1NGPH 2FGWL 2QKIC 3GZPA 1TJGL 2IOOA 4PJAF 4AVKA 3BZFB 3V4UH 4LLVA 2GJ6A 3CVHL 3LHPH 4JFEE 5K69A 1UYWH 4X0KA 2UV3A 3HCVB 1XB3A 4E36A 1UG9A 1KBBA 1QTYT 2ZWKA 5CINL 3VH8B 4JQIL 5EC2A 1FN4A 2X6BA 2EEAA 4G7QB 3BW9B 2OKMA 3V0WL 2VNCA 1BWMA 2XWTB 1O9VA 2R23A 4YUEL 1N5YH 2BY2A 4IHBA 5F1NB 2R1YB 3N41F 1CPUA 4UNIA 5IVZB 4YBQD 1A3ZA 1EO8L 4LPYA 2W8CA 1MJ8H 5T5FA 3TLRA 4P49A 3QUGA 2DQUH 2XY2A 5ADPH 3L9RA 2OTPA 1MCKA 5I82A 4PVNA 4UCFA 1SBSL 3MA7B 3QEHA 1HWGB 2BZCA 5E6ID 3CFMA 5DJAB 2JELL 1OGTB 4ONGL 4XVUC 4LLWB 3KVQA 4D9QE 4UTAH 4OF6A 3S3SA 4KKLC 2JI2A 2NSMA 1CT8B 3JUYA 3ML8A 3ULVC 3STZB 3WFCL 2QSCL 1QHPA 2BSSB 3C5SA 4L3EB 3SDXE 1PNDA 2Q10A 2P5EA 4OLXH 4GSQA 4ZTOH 4ZFGH 5KVEL 2CM5A 3HNTH 4PRBA 3D0LA 3DX9B 4B50A 3Q06A 3O3AB 3B3IA 4HMDA 4IIQB 3TIDA 3QQ4B 4ZFFA 4PJFA 5JW3H 4E41D 1E8XA 1J0KA 1H3UA 2BMKA 1FAIH 2ITCB 4X7FC 5IVNA 2XV0A 3LQAH 3VI4E 3NOIA 1S7TA 1VIWA 1ZEAL 2HKFH 4JZJB 4ZDHB 5F7BA 3RPIA 2AV1B 3E7JA 3NAAH 4LSSH 4MMYB 3DDGA 2OTWB 1J5DA 4LK4A 2VSMB 4PCKA 3TS8A 4YIQB 4Q52A 3HAEG 3MRKA 4Q2ZA 2APTA 3DTXB 5A16B 4UTBA 1V7ML 3GLZA 4HJ0D 3PJSB 3K2UL 5KAQF 1JUFA 4MJIE 1N0XH 3FSZA 1UD6A 4X6DF 2IEPA 1J8HB 5D8JH 3EJYC 1IB5A 1SQ2N 1N0LA 4YXLH 4N0CD 4JM4H 1LD9A 2XACC 5LBSA 5HYJB 2I5YH 3FT2A 1RJLB 3MRIA 1L0PA 4JVPA 3UGUA 2AJYH 4FCHA 4O00A 1XBDA 2J88H 4YSRA 4JZOA 1X5JA 2FT7A 2NT1A 5KSAB 1EZSA 4LASL 4B7LA 4Y7OC 2W94A 2WZ6A 1KJ3H 3E2HC 1MQKH 3MLZH 4Z3IA 5HY9B 2OQJB 2W0PA 1UD4A 1LP9E 3GTTA 3QXVA 3GSXA 1KDIA 5F7YC 3VDCA 4FQXA 3V4VL 3FQTA 4KXDA 1FHGA 2B39A 1U6AL 1Z9OA 2BY0A 3MJ8A 5EU3A 3F58L 2EDXA 5SWZE 3MRFA 1LEKA 3TF4A 4U1JA 2ZUTA 4R90H 3SE9H 2UVEA 1QLRB 4I87A 5I74C 4CGTA 4NHUA 5TE6H 4ZS7L 2BSED 2WOYA 5ILTH 4I1PA 4KOBA 1M71A 3AMKA 4YE4L 4JMNA 4FFYL 4HJJH 5K1VA 3BT2L 2WBWB 5I1EL 4PB9L 4WW2A 2IDCA 4CU6A 4B60A 3DI3B 4NKIL 5CGTA 3LZNA 3MUHL 1DEEA 1UUNA 3BEWA 1I3RB 2NYKA 2XXGA 4NKMB 2WQRA 4YWGL 5DS8B 2UY6A 5B1JA 1IL1B 1YPZE 5ITBL 3SKOA 1JZIA 1XCTB 1TPXC 2A9NL 1RZGA 2GHZA 1ZVSA 3FFCB 3P11H 4OFKA 3W0WE 4U1LB 1KY6A 4AK2A 3K6IA 4JFQA 4XVUD 1VEPA 2ESVA 2YD8A 5FV2A 5EUOA 4RISL 1ICTA 3ULVD 1PX4A 1HTYA 2APXA 3GWJA 3CK0H 4AQ1C 4W9IC 5EPMB 4OZHE 2EDHA 4FZEL 2DLHA 5C97A 4LLVB 3VFGL 2GJ6B 5DD1H 3KVDD 3NJJA 5I1HH 1K6QL 2CUMA 3US9A 2R51A 3NJNA 2LLGA 4XB3A 2EKSB 3P2TA 3ZE2F 1N12A 3OMZA 5EC2B 5LG1A 5I5MA 3JVFC 3MGAA 3TESA 5C09B 3DETC 3EH2A 4MJ2A 4X8GA 4Z5RB 3U30C 2MEJB 4NQCA 2V7HB 1AD0A 1U2CA 3EJYD 1VEOA 1CDGA 2AXGA 3TEYA 4FQHB 2OS7A 5D6CA 5AWNL 1BJ1H 2CUHA 5E99H 3U83A 2ZCHL 3L9RB 4K5LA 2WCGA 4P8QA 3II2A 4O2EA 1FGNH 2PXYC 3W81A 1E5AA 3DXAD 1T6WA 2ARJA 4PRNB 5F1KC 4CGUB 4IRJB 1OCWL 2J6EH 2JB6B 3IPEA 3IB4A 4QRBA 4WU5A 3OQRA 5AVZB 4CN4A 2J1YA 1QZNA 4F8OA 1KCSH 2P5EB 4E2OA 2CLRB 3GGWA 4PRBB 2HT2D 2FX7L 3U6RA 1HHHA 3TTSA 3S9DB 1OEZW 4XO5A 2R4RH 2ZXQA 3G7TA 2QHLA 1YN7A 2A6KA 1JHKH 3DHMA 4OCLC 4DP6X 4ZFFB 5KVGL 4G1MA 1LM8V 4NPJA 4PJFB 4M5SA 3MQIA 3IF1A 4YK4C 4XVSH 1UURA 2WXPA 4HCIA 1S7TB 5JW5A 3G3LA 1QOKA 4WEBH 1JRHH 3UTTE 4BDVA 2BWQA 3FRPB 2YAEA 5BO0D 2J7LA 4NIYE 2WLHA 4NQXA 4I77L 1KTDB 4XMLH 1O6SB 4PGEA 2DL9A 1AI1L 1JUFB 3BZEB 5EU6A 2AKRB 2YFOA 2CDGA 1ND0A 1F41A 2R56L 1N0LB 4LO9A 4OCNC 4HYTB 1AANA 5GRUH 5H35B 5CLTA 2D2OA 3QJVB 4L4VE 1TYEB 3CU7A 2Y7MA 2X53A 1R5VB 4JZOB 3QHZH 4DJMA 2Y36H 4XNBA 2HJFA 4H2AA 4CADB 3PWPB 5M7QA 4Y9CA 2AV7A 2YOAA 1INQA 5GGSA 2EVFA 2ZJSH 3FO9B 1MHEB 3GSXB 4F9PC 3BKMH 1QFWL 2IG2H 4M3HA 1PZAA 5IHBA 1F97A 1CD0A 3ZL1A 4JHAL 4NFBA 3NEXA 4PJXF 3HC2A 3MJ8B 1W8OA 4ZXBA 2D4FA 1K5NA 1LEKB 3LZRA 3U0TA 4AK1A 4DKEH 1DP0A 5M94B 1AZCA 5I8EB 1JCKA 4NHUB 5AZUA 3DETD 4LBAA 4EE2A 4FABH 1TQTA 4XN7A 4NO3A 2IDQA 1FNSL 1SXZA 5DHMC 3IE9A 1BJMA 1I3GL 1QKZH 4MMXA 4A2LA 2NR6A 2BM3A 4JL1A 1X7QB 4JFOA 4K3DL 4XPBH 5ID1A 1DEEB 1XGRB 3QRGH 4FQ2H 4LXFA 4BQBA 5JYLA 1A8JH 1S7UA 4W6WB 4U1IA 1MCOL 1R24B 2UY6B 5IROA 2X88A 4N0YL 3SKOB 1ZVSB 4NWUH 5EU5A 4WKXA 2DV6A 5KJ7E 3AS1A 1BEYH 2DTML 4RVBA 4PRIA 1XSIA 1A5FL 5EUOB 5I1KL 4WZ9A 3PQYB 1QHQA 5F7EH 1JPTL 4L0ZA 3GIZH 3B2UC 2BNUB 1NCAH 4PWGA 5AOIA 4CKQA 4MAYC 5JTWA 5FYKU 3WY4A 1XEUA 1HH6A 5B7FA 1K3IA 4N20A 2GBVA 3NIGE 1WAAE 1RHHA 3E38A 4M1DL 5CJXA 4YR6A 3QPXL 4N2DA 4AX3A 3ZUNC 1PEWA 4QGYA 4M6NH 2UWEE 4ZPVB 4XCCH 4FA6A 5KSBE 3WDHA 5AW2B 1EDQA 2ZOUA 2BHYA 4U6VH 1IMHC 4C4BA 1E40A 3IDYC 3R19A 3F12B 15C8H 1FI8C 2QVMA 4BZ2H 4DQAA 5HI4D 4HIJA 1L9QA 2G9HB 4PRPB 3QR0A 5F7AA 3TIEB 2AXGB 4K23H 2XX1A 5IB1A 2PCPA 3OHXA 4XPAH 3WYRA 3POCA 1AAJA 4G8AC 5DD0H 3EGXA 2D7PA 2ZCLH 5CJOH 4APXB 3VMPA 4LSUL 3PXHA 4O2EB 3WTSA 3FOMB 4R0LC 1OAYL 1WF5A 1YY9C 2APFA 1KTLB 3QQNA 4LCWD 3TBBA 3QZBA 3RTQA 2DIJA 1JZ4A 1KIRB 1NJ9A 4GT7A 4NC1C 4PRHA 4QWWC 3RPBA 1MDAA 3ZQ9A 3LDBC 5T3XL 4POYA 1FO0H 2O5NA 3PGDB 2EIBA 5T3XE 5C7XH 3RYMA 3UL4A 4M4RA 2WY3B 2IFFL 2QADC 3GGWB 5ICUA 1Q0YH 1T4KA 2WXOA 3U6RB 1HHHB 1OAKL 2VXTH 4QT5A 1YVLA 3BPLB 3CN0A 1ZGLP 5TGBA 1CDUA 1A22B 4IKNA 3WNJA 1E9QB 5G4NA 2ADJA 2IAAC 3IF1B 3ROLA 4GAGH 4HEPA 3RUGE 1OKEA 1TQWA 4YJZL 4PRAA 1XR8A 5K59F 5HGAA 4TNGA 3BXNA 3FONB 4GW1A 1EGJL 2QZ5A 3MGTA 5EZLA 4BDVB 5LXGL 1WQVT 3RWDA 2JCCE 4PQXA 1H3PH 3NQIA 1XXDC 5EZJA 4BQ8A 2EE3A 5EU6B 1OPGL 4PJBE 3IFOA 2QLYA 2CDGB 4KRPB 3U82B 5IB3A 4MNHB 4LGPB 3VNYA 3QQDA 5J1SC 1IKFH 4KTDH 2GB2A 5GRWA 5FYLD 3V6BR 3NFNA 4HS3A 4X9FA 5CU5A 3QCTH 2KT6A 3B2UD 4Z7NE 4W9GC 1FDLH 3FQWB 1D5ZA 5IJVB 4IJ3C 1LK2A 1INQB 4G6JH 4MAYD 4AKQA 2OMXA 4HKBB 4XC1L 2XG5B 4XNXL 5LO7A 3SDDA 3CDZB 5MERA 1Y0LA 3B7SA 4JDZA 3WHXA 2DLFH 3RZWA 3LMJH 4ZXBB 1K5NB 1KLGA 3U0TB 4BD4A 3OJ2C 4EAEA 4ODBD 3LH9A 3NJHA 1U8JB 4R4BB 4U3HA 2BOBB 3OKEB 2X4QA 4X4KA 5EOQH 1O9ZA 1G6VK 1LYQA 3CZEA 3I6SA 4J3SA 4KXAA 2PR4H 4LSRH 2BVYA 5JHBA 4JFOB 3DV6A 5IJCC 1GPOL 2XTJE 4XCFH 1OSPH 3PDOB 2YMXL 3HS0A 4Z7WA 4JFPA 3T0EC 4BHUI 4GRLC 3PWJB 2Y6SC 4FL4C 4OZGB 5F0JB 4UUJA 3AAZA 4XWGH 2CHZA 1IJ9A 5EU5B 1OF0A 1YY9D 3GK8L 1UA3A 2WANA 3JWDH 4AGMA 1H0DB 2LOEA 3O3UN 4AM0A 4E9VA 3RDTB 3LH8A 4QWWD 5B22A 1P1VA 3W3BA 5GZNC 3CBKB 3L3DA 3OM3B 4GW4B 2QADD 2H3XC 1OLZA 1XMWA 3M6DA 2X4UA 4JPVH 4OZFA 5I76B 3MUGA 5KSUA 2YUZA 5SWQA 3SKJH 4E9RA 1R3LB 4ODHH 3OLDA 4QHMA 1HH6B 3FTGB 3CSTA 2AZAA 3E6FA 1RHHB 1A4BA 1CDJA 4YSPA 2WYZA 2AJUL 3AM8C 1F3DH 1YY8A 4XMTA 2DWDA 2XBZA 4ONHA 4R6UA 1OWRM 5ABDE 1XB8A 2QTVA 1WFUA 3FT9A 4FEMA 3VXUA 5F71A 1Z9NA 4E9XA 2OJ1A 4N3UA 1B4JL 1CGXA 2B9AA 4GMSL 4DEPC 5I23A 3I50H 4G8IB 5C07E 5E4AA 1I1RA 1GVIA 4D9LH 1QRKA 3VQ1C 2Z7YA 1N10A 3MRLB 2AVFA 3D52A 3DYPA 2DKUA 3NPZB 5IB1B 5I5IA 2L7JA 4ZFZB 1V7NH 3EGXB 1DBKL 1S8DA 3LKSA 4A6YL 3OZKA 4OU3A 1SHSA 4UZGA 4PY7A 4NJ9H 1H5BA 1ED3B 3ABZA 3RTQB 5L9DL 1CE1H 4NUMA 4LPTA 3ATDA 3GF8A 4GG6E 1DLFH 5GS0C 2IC2A 4R5VA 2NW2A 3L2NA 3NIFF 3ASOB 3IU3A 4AVJA 1GZHA 2NY4C 1VZGA 3GSRA 3KPLA 4BWWA 4ZO8A 1T4KB 3WIFB 4D7PA 1A3QA 2F7RA 5F3HB 2LLNA 1L7IH 4NPYB 3MOQA 2K9FB 5TGBB 3VFOA 2ADJB 2NZ9C 2R8SH 3BKJL 3QGVA 4KVCL 3H9YA 3JWOC 3FB6B 2OR9L 3IDXL 3NRQA 1E4WL 5HVGB 2NW3A 1Z9MA 1AVAA 3QRLA 3T0XA 2Y1AA 3UG5A 4NZRH 2MKLC 3FO1B 3S98A 3RWDB 5IQ7H 3T0ED 4GRLD 5EZJB 5JHDA 2NRDA 4AMKH 1GGIL 1FFOA 5C0CA 1UATA 2SEBA 2DQDL 4XNYL 5H94B 4P2RD 1CXIA 1HOCA 1EFXD 1KB9K 3LY6A 1AO7E 3CFBB 3MLTA 2E86A 4KKZA 3MLRH 1JDDA 1F90H 3O9WA 3NFNB 1WYJA 2XI9A 4IRZH 4LAJH 4QRUA 5T1LA 3BKCH 3WMSA 2ZD0A 3KM1A 4PREB 1FNFA 1INDL 3W57A 1ILSA 3UH8A 1LK2B 4KZDH 1DHKA 1Q38A 2EDQA 2OMXB 3T3MF 3KLQA 1R3IH 4DW2H 5FKAA 5MERB 4ORGA 4U1KB 4HALA 3WOVA 4F2FA 3HE6A 1HDMB 1BXVA 5EF1A 3ZUCA 5AQ0A 1AGBA 4GEIA 1KLGB 4ZJ9A 4OM0L 2K8QA 1YG9A 4QR7A 1PBYA 1YEKL 4QPEA 1DVQA 3QUHA 4LOUC 1PLCA 4AXWB 5GGVH 4GMTL 1Z5LB 1AZVA 4KZEL 4KRNA 4YO0A 5IVOA 5HDLA 4GKNA 4IMLA 2ITEA 4XXWC 3WD5H 4QHUB 2UYLA 1SXBA 1RP8A 4OD1H 4JFPB 1NGXB 4P23C 2CM6A 2IJ0C 3BN9C 1WEJL 4Z7AA 3B2VH 3AAZB 1FCCA 5AW8B 1FZJA 4LMQE 1HILA 2Y07H 1MJJB 4GRMB 5I8KL 2MCMA 5JW4R 5EU4A 5GQBA 1NBVH 3D69B 3OXSA 3WJLA 3DHPA 3S2CA 1UM4L 5GS0D 3B6SA 1KYFA 2QGCA 1M56B 5KWYC 4TQEL 2IMMA 2NY4D 3QFJA 2H1LM 5HHNA 3B8SA 2CLVA 1PKQB 3M7OA 2UY7A 4FHKA 3FF7A 1MNNA 2X4UB 3QORB 4KROB 3AU1B 4PJ8C 4FP8L 3RZCB 1P7QD 3QCVL 4GH7B 3CXHJ 3BO8A 4WJKB 3TH4T 4NO0A 4ELMA 2NZ9D 4Y2DA 3L8QA 5TTRA 1ZJBA 1NLBL 5AVTB 1XT5A 1KEMH 3LNEA 1R46A 5TE7L 3ZO9A 4DAGH 1YY8B 4JK0D 4RWHA 2DWDB 1WBYA 3QG7L 1G9MH 4I2XA 3LS4L 3U6XS 4PLNC 5CEZH 3GSWB 5DUJA 3CZUB 2AF2A 4K2UH 5DUBA 5HGDB 2NUTA 4N8CL 2WTOA 1JZHA 3S7GA 3V6ZA 4UQAA 1U3ZA 5I1LA 3KAAA 3QNXA 2B0SH 3Q7JA 3HR5A 2OX5A 3IJ7A 3LKSB 2IDFA 3O6KH 4UOQA 3CU1A 3NMEA 4FX5A 1GCFA 1JGVH 3Q6FA 4AL8H 3HC0A 3M07A 1H5BB 2PCYA 2AHIA 3IETA 3VXRE 1BX2B 2EE6A 4WK2B 2DZEA 3UO8B 1N64L 3TYFB 4NQEE 2NW2B 3CJJA 2V33A 3FAWA 4RQQB 3SZKC 1TVHA 3GSRB 4M29A 1BPLB 2B1HH 5CILL 1R4XA 5D7LE 1ASQA 2M1KA 3LXAA 2CA3A 1V54B 1CFTB 2HFGL 1BZEA 4X8JB 2H6PA 4TUKH 1RFDL 1W6LA 2AANA 2BS9A 5I6OA 2P46B 2C9AA 1OGAB 3QJUB 2OZ4L 3BWSA 4JFZL 4CJ1A 4PPTA 3VGFA 1Q0XL 2PLTA 2FUTA 3O2DA 3MRGA 3QIWD 4BSVA 4ZPTA 3ULUC 3EBGA 4MCYA 5EIIB 4PCSA 4HF5H 4OT1L 3X3GL 4AQZA 4S1SH 4G42B 2GK0B 2ZONA 2RH0A 4ZW5A 1F86A 3MJ6A 4OLWH 3SPCA 4P23D 4PD4K 5JHDB 1OZTG 4M93B 5HPMB 3QWNA 5C0CB 1C5CH 2SEBB 4P3WA 1XAKA 3FTYA 3MBXL 3WFZA 1GA2A 3MV7E 4WI0B 2C3VB 5EFIA 3HIZA 3G5YB 2JF1A 1ZT1B 5JHAA 2EDBA 4KVNH 5GS2H 3QWOB 3O9WB 3N43B 4ILDA 4LBEA 4QRUB 1VF5C 5D1QA 5SWSB 2ZAIA 4DIXA 4Y4HB 2VL5B 1C5DB 5FO8A 4NDMB 4S11A 4PV9A 5L0QB 1MFMA 4PJ8D 3SCMA 2EC8A 1MG3C 3GS0A 5C0GA 3VXMD 4CBPA 2VZ1A 2NY7H 4BFJA 1ETB1 5F89A 4JCWA 5HYEA 4ORGB 3U7AA 2VMDA 2MCPL 4LIQH 1XGPA 2R2BB 4Z7VF 3TA3A 5BV7H 4FTDA 4APQC 1BFSA 4PJHE 3UOAB 5FK9B 1BAFL 1QYGL 4KUCD 2VERA 4BWTA 4QLWA 5KBKA 1TQCB 1IC4H 4XP4L 2Q3ZA 2R7EB 1XO8A 5ESQB 1W72B 1BQ5A 5AYUH 1FAKT 4ZODA 3NGBC 2X2HA 4YO0B 2V9RA 5KOVC 3V9FA 3M1OA 5LBGA 2R9HC 2PPEA 2UYLB 2X0UA 4XPFH 4K5NA 2B77A 3HB3C 3RFZC 4DCQA 1S9WB 2OR8A 1EBPA 3HBQA 4JANA 3DUSA 3GSOA 4ZAKC 2HFFA 3RU8L 2ZG1A 3LCYA 4JGUA 2EC9T 5E03A 1MRCH 5EULV 4LHUG 5FFLA 1YEJH 3OXSB 5KS9E 1XL6A 1PYWB 3SD5A 1R9FA 5AG8A 5E9DB 4XOBA 5E2JA 3DBXB 1MIEL 1KXVA 1MAMH 2XBTA 3QFJB 5HHNB 2Y72A 4FKHA 3FQXA 2FEJA 4FMVA 3L3IA 3V0GA 1A6VL 1JV5A 1J88A 1K5WA 3KBEA 5F8RC 4Y2DB 2FZ3A 5IR1A 5I28A 1G9NC 2XN9E 4LL4A 1F1GA 3T8VA 2WOBA 2VN5A 3PJNA 5LJYH 5B1CA 5F96H 4LSPL 3ZDXF 1QNIA 2YPKA 3ULUD 1N6QH 2O72A 4GAJH 4ODSH 5CEXA 2HLFC 1A1OA 3UZEC 3ZDYF 1GIGL 4HC1L 4L29A 2NPLX 1A0QH 2XPYA 4MNQA 5HHVH 1QR1B 3PL6C 3K7UA 3HHSB 5IWLA 1HKLH 2A4ZA 2OMWB 3QJHA 4CNIA 2WJ7A 2E27L 2IMNA 1SN2A 4ODXB 1NC2D 1A3RL 2BZDA 5BS0D 1FL6A 1M2OA 4DNLA 3J07A 3CV5A 5HVWA 4DGIL 4D8OA 4XNUL 3JVGC 5E00A 3HNVL 4N4YB 4Q56A 3QNXB 5DK3A 2BIQA 3UO1L 1ECZA 5A43C 3PHOB 2QVFB 2FGZA 4I9XA 3VG0L 4OFDA 1H3WM 2H3NB 4LF3B 3IETB 1YECL 4LKCA 2WQVA 3N1QC 1S7SA 1R34A 3DX0A 3N1MC 2BDNL 3Q5TA 4R4NC 3QUXC 1U95A 5D7SL 1TVHB 1UZ6F 1JGLH 2DD8H 2ZUVA 1IFHH 4A37A 4LVOC 5FR3A 3O2VL 1OAQH 5FOBA 5JLZB 1U8OA 4LGSB 5EDSA 2DL2A 2H6PB 2VN7A 2DM3A 5JMOC 3CN1A 3NN8B 4BZ1A 3IPFA 3NJGA 2CJ3A 4L8CA 5FO9A 3KPSA 4ZPTB 3MNMA 4BA8A 2LHAA 3I75B 2B3RA 3JV5A 3M45A 1F11B 2DF3A 2NCEA 2R9HD 3SDCC 2QQKH 3HB3D 2I85A 5C0BA 5D71L 5HHMD 4GUQA 3DC0A 4ZOEA 4OCRH 4OCXL 5C3LD 1G5AA 4LKXB 1XX9C 2CA4A 2K3TA 3D85A 4ZAKD 4NBZB 1JYWA 1B2YA 1AG6A 1SBBA 1T03L 4B9GA 3RWHA 5JO5B 1AKJD 1SOQA 4WIQA 5D7IE 3Q6GH 4RMTA 4NQQA 5BRPA 1T04A 1N19A 2QPSA 5E6SB 5K9QI 2ZX9A 4D3CL 2G75B 3CZFA 2XWDA 3MBEA 5E5LA 3TBWB 4AV4A 3FRPG 4MA1B 3OJDA 3KYKL 3WI9A 3AMLA 1ET8A 1JGIA 4AQOA 4NJAL 3GKZA 2CR6A 3OKDB 3TA3B 4XO9A 1QA9B 2BJMH 2X6UA 3ZN6A 1URIA 4FERA 2EDTA 4UILL 4XCNB 4F1ZA 3MLWL 4XAKE 3MV8D 2F61A 5D7HA 5F3BA 2G5BB 2NY6D 2YMTA 2HLFD 2OCJA 4MJ5B 4A7TA 5CIPH 1TTUA 5CXPA 1KFGA 4E5XA 3AADB 1RSFA 3IRPX 1B0IA 1I7ZB 2AK4E 2G4GA 2VLKE 3FSVA 4Y88A 3UJIL 2Z31A 4U6YA 2VLRE 4LLUB 4DKFL 1A6TA 5E8DL 4TVPH 5C2UB 4WU7B 4NUGH 1P53A 2VCOA 1HWHB 4RWYL 3OLGA 1ZA6A 1S7VB 1XAUA 2R27A 5SV4A 2O6DA 3V52H 1BZ7A 4PJCE 1LEGB 3GSOB 3LXCA 3OAYH 3BHBA 5BXFA 1SDDA 2HFFB 1I8MA 2CK0H 3ORJA 1A3LH 1LE9B 1MZYA 3A6BL 3VU2A 4ZO6A 5KW9L 2IAMB 3AG3B 2VDQL 5IVXF 4XOCA 1R3JA 3QUXD 4HWBL 1J12A 2IADA 1D9KA 4PH8A 3ROOA 1QHOA 4Y5YC 3U46A 1MDTA 1UD3A 5LDSA 4H8WC 5GZOC 3FQXB 3Q8FA 1F2QA 2ORBL 3NG5A 2RIKA 2Y23A 5J1AB 4XE5B 3T6ZA 3ZKSD 2NDFA 1QR4A 2OPCA 4GFXA 3N40F 1QP1A 4YVUA 5TF1H 1JK9A 1SMAA 6PAZA 1JPSH 3UZVA 4D0CB 4HG4J 1GXEA 3BVWA 1CGSH 1MCBA 3SQBA 2XWJB 5CJQL 4JJHA 4OM1L 5GHWL 1HT6A 1U8QA 5CEXB 2FJGB 3WE1A 4L29B 1OE1A 5KVMC 4F92B 2TSAA 3C5ZC 3SDCD 4MRCA 5JNYB 2WTPA 2HMID 3ZPDA 1SY6H 4CNIB 3QJHB 4NAQA 3DYOA 4FFVC 2GY7B 4HAGA 3JV6B 4F8NA 2EEBA 4HIXH 4OD2B 5EOCH 5GS1A 1FL6B 1SM3H 2QL1A 3WGVB 4CU8A 1VDGA 4NZUL 4N0FA 2IH8A 5E00B 2MWCA 1Z3RA 2FB4H 4KU1A 4W4OC 3C6LA 5EEVA 3L4XA 1MREL 4GW5A 4ZW8A 1M53A 5C9JB 1HZLA 1BFOB 3E0GA 4OUOA 1NCGA 4LKCB 2NY3C 3NCMA 5J56B 1IM9D 4R26L 4YNYA 2VUYA 5D5MA 1U95B 3LH2L 5G4OA 2UZYB 1KPVA 1YYLH 2G30A 4JPWH 3TYGH 3P73A 2J8UE 5KBLA 4PGDA 4XGZA 1TCRB 1JHTA 3B4NA 3WJMA 1HWWA 4HWZA 5FOBB 1IEHA 5AVVB 1B88A 4QRAA 3G5XA 1PG7W 4IIQC 4BK5C 2VR8A 1U3YA 4HIQA 4N6QA 3O3EA 4OKVA 4PJ9A 4JY4A 1YAZA 5FDWA 3SGJA 3EG9A 3KPSB 4OBSA 4WI5A 4LVHC 2OL3A 1T89A 1JZEA 4Y1TA 2Y1YA 1VZIA 3P0VL 4WNQA 2A7BA 1PIFA 1VGKA 2EICA 1F8TL 5CSZA 4KKCC 5MEQA 2LU4A 1KFAL 2IAND 4QRPE 5GSVB 1T7XA 1E4XH 4WUUE 1ZLSL 1WZMA 4HX1B 1D6VH 4IOFD 4PS4H 4NN6B 1P6AB 4H8UA 3RVWC 2IV8A 1PLGL 4QRRE 1CLZH 2YWYA 1S9XA 1SMOA 1F02I 1K4DB 1MCJA 4NC2B 4QJ4B 2AK1L 5GZOD 1E6OH 5BUGA 2IH3A 1GJUA 4OGAC 4AIEA 3VRIB 3C60A 3CZFB 2BSRB 4AYEC 5FFGA 1FIGH 2P5WB 5GSRB 3OJDB 2Z34A 4XN5A 1IZKA 1LE5A 4LLAA 4J23A 1IIKA 5EUKA 4Z7UE 4XPTL 1PQZB 1JGEB 3QDGA 1WUZA 4FQQA 5JUEH 2A0LD 4X6FA 5F3BB 2CIKB 3RWCB 4L9LC 2Z92A 4XBPA 2QV2A 4E5XB 1FLRH 4K3EL 5ICXB 3SHSA 1JYNA 2EO1A 3Q2NA 1CQYA 5D1ZC 5B1AB 1A7RL 1ZPLA 4R4FL 2Z31B 4WEUD 4U6YB 5AB0A 3OGOE 4FFVD 4FQIL 1X5XA 1HSBB 1EAJA 2TRHA 4WI7A 4HJGA 1G9NH 5E1QA 4K0OA 3CTTA 4KBPA 2G4EA 2X4RB 3HPLA