3RK3B

Truncated snare complex with complexin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
62
structure length
62
Chain Sequence
b'GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vamp2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 29
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk3B00
2NPSC 1KILB 3HD7B 3VOPA 2WZ7A 2YMYA 1GL2B 4WY4D 2NPSD 5KJ7C 5CCGC 2M8RA 3M0DC 5CCHD 1GL2C 1KILA 3HD7A 5KJ7D 5CCGD 4W7YA 1GL2D 3PP5A 4WY4B 2NPSB 4W80A 4WY4C 1T3JA 1SFCB 1JTHA 4JF7A 5CCHC 2NPSA 1SFCC 1HVVA 2HG5D 3HTKB 5KJ7A 3P8CE 5CCGA 1SFCD 1L4AB 1XTGB 1GL2A 3RK2C 1N7SB 1L4AC 3RK3C 3B5NB 2N1TC 3RK2D 1N7SC 1L4AD 3RK3D 3B5NC 4WY4A 4OH8B 2N1TD 1N7SD 3RL0B 2XDJA 5CCHA 3B5ND 1URQC 1SFCA 3RK2B 3RL0C 3RK3B 1URQD 3TSIA 2N1TB 2PP6A 3RL0D 2KOGA 1L4AA 1KILC 3HD7C 1URQB 2N1TA 3KYQA 1N7SA 1KILD 2H8PD 3B5NA 2HFED 3HD7D 1JTHB 4N78E 4W7ZA 4LGDE 1URQA 1NHLA
chains in the Genus database with same CATH superfamily
2IBZG 2LXBA 3JCUE 2AXCA 2IPPA 4HJGH 3AE8C 2IFNA 2H89C 2A06G 4IFFA 3VP9A 3HUSC 2R3SA 5CCGD 2E74B 1NTZJ 1CSBA 3HE4A 1R5SA 4PJ0E 1LGHB 1YTZT 3VMAA 1T3JA 1SFCB 2PAJA 3CMAP 1RF1C 3NMDA 5DJUB 1P84E 3CLQA 2O3JA 5KJ7A 3PLNA 2IX7C 4OWFA 3V5BA 2Y0CA 3W67A 3L35A 2WSFH 1T8ZA 3MHVA 2Q1KA 1NAYA 1JY2P 3GHGA 4IOIH 4PD4I 2GA1A 2PFXA 2FKWB 1URQC 4K3AA 3Q5RA 1L0LE 1SFCA 2IFMA 2ZXXA 1BE3D 4OGQD 2WSEH 1PGOA 3TSIA 1JMMA 2E76C 2PGDA 1EDLA 3TGUE 1EZVE 2P1JA 3AE1C 2OQQA 5TISH 1HUCA 1S4XA 1MFZA 3KYQA 2I1KA 4ZMDA 1IFNA 1JM0A 2Q5UA 2NPSC 2JWAA 3EWKA 2I8DA 3MUDC 3EFFK 2JDIH 1D7MA 3E1RA 4H44C 1M90Q 1BCCD 3RK3E 1EDJA 5AVTB 3BRVB 5KLVD 2Z5HA 1KFMA 5CMZA 4GOEA 4W80A 2VRSA 3TGUJ 5H2FH 1SQXG 1TU3F 4I1LA 1HF9A 3GF3A 3M0DA 1KYOI 1IFDA 2FYUG 2M5AA 1LWUC 3D6YA 4IFDK 1AVOA 4BWNA 1FZAA 1L0NG 1YHQP 2LR2A 2QJPC 4IL6X 4K35A 1Y47A 4IL6H 2ZT9B 1HBWA 1USEA 4D6TG 4KT0J 2NZ2A 4M3LA 5KKZC 2C9LY 4C7RA 1Z56A 2PRRA 1UIXA 4U3FD 1NTKK 2MJZA 2QM7A 1KILC 4DOJA 3AE7C 1DD4A 1SQQD 2Y9YA 1M1JB 2N1TA 1DX7A 3C9IA 4I2LC 1HH0A 1M7LA 5TISE 3TK1A 1KB9H 3V4WA 4N78E 2H43A 4JYCA 2E43A 3HD7B 2RKLA 1ZRTE 2QG4A 3FGAD 2O1JA 2P58A 2WSFJ 1FDOA 3OJAB 1NGMB 3FXEA 1W2EA 3M9QA 1T2KC 1FZEA 1RE4A 3V2QA 1SLQA 1LTIC 2AEMA 2WPRA 2BCCE 2WSEJ 2Q9IA 3GW6A 1EXJA 1KV4A 1RF0C 3EFGA 1HJ0A 1BE3G 2W6AA 1NTMK 1PGJA 1ZMEC 3NFQA 1PP9E 3KQGA 2OARA 1FJPA 5M1BA 1RF1B 1NAFA 3AE6C 1PFIA 2QA4P 4H13D 1N73C 1VQNP 3B5NC 3V2RA 1N7SD 4I6MC 5APQA 5BU5A 4N3YB 3L73J 3BCCG 1Q90D 2QM8A 3VTPC 2E5TA 1YQ4C 1NYHA 4IL6E 1P84D 5AW2B 2BCCJ 1K04A 3WUUA 1BCCG 1URQB 3VMYA 2JKVA 1CZQA 2H8PD 5KLVG 2FFDB 1PP9J 4LGDE 3SFEC 3ITKA 1VQLP 2Q3EA 1X0TA 2GM4A 1J1EB 2OYOA 1KB9E 2AEJA 3D6ZA 3Q3DA 1L0LD 3A0HH 1M57D 5KJ7C 5AVVB 3VP8A 1VL2A 1VQOP 5C39A 3CXHH 5L8RJ 3TGUD 3MTUE 1EZVD 1JB0J 4QMAA 1SP4A 2NPSB 2E74C 3GMAA 3GHGC 2FFDA 3A5TA 3S4RA 3W68A 1SFCC 1FZCB 1GTWA 3JSVC 1K9MQ 1SVFA 4U7JA 5B66H 2FXPA 4U3FG 2HR3A 2ITAA 1BGYG 1YBKA 1VQKP 1SQQG 3RK3D 3PHLA 3K5BA 3TNUB 1ZN5A 3H1KG 5APTA 4UB6E 3O6QA 2A45G 3V4QA 2B87A 1FZCA 1NTZG 1LJ2A 2QJPB 2WPVB 2KIKA 1OVVA 1QX8A 1M56D 3H32B 1NVOA 4JYBA 5AW0B 5KAFH 1H88A 5KKZB 2OYIA 1BSNA 1PIXA 1QGKB 5BVZA 3TNUA 1KILB 3FXDA 2WZ7A 1LTGC 4BXLA 3RBZA 2ZVNB 4R4LA 4PD4H 1WT6A 2M8RA 3M0DC 1FU1A 3A0HE 2C9NY 3BASA 3L4FA 3A7OA 1NTKE 1IFJA 1NJIQ 2N9BA 3CXHE 5GTHE 1R8EA 3H32A 5CJ4A 3RBXA 4N78D 1LTSC 2OGUA 1HVVA 1IZNB 1ZR2A 2W8ZA 3FX0A 3CCUP 2W83C 2ZYAA 1L4AB 3AE2C 4C7NB 1M1KQ 4LC1A 3TF5A 1ZRTD 4HH2A 4GIFA 2N1TC 5B66E 1OMIA 2ZAEB 3B8EB 4YXDC 1JCCA 1RHZB 2R5DA 2BCCD 1NTKJ 1GD2E 1SQBE 2ZT9C 2IZ1A 1N73B 2C0XA 1R5LA 4R4MA 1L4AA 1PP9D 5APSA 2Y0EA 4NPFX 4PV1C 1NH4A 3TGUG 1E79H 1EZVG 1HWTC 3FWNA 1RE4C 3AE4C 1T3UA 2E75D 3HE5B 1KYOH 1VF5D 3M9BA 1JY3N 1AVYA 2JWDA 3CX5I 4EI2A 2WTYA 5KAFE 2OTLP 3HE4B 2FYNB 1EQ7A 1VQPP 2BEQD 4PD4E 1SQBJ 4NPDA 1S1CX 1YYCA 3BVHA 3CWBG 3L71E 2K1AA 1MV8A 3HE5A 5AW1B 2IDBA 3H1HE 3P8CE 2FXOA 1KB9D 2KSEA 3F89A 3GHGB 4KHXA 3CCEP 1KILE 1LTTC 1PPJE 3O8ZA 2ZVOB 4EDFA 4WWIA 1SQXK 2KLUA 1GDTA 1QL1A 1BSHA 2ZJSE 4ZKUA 4RJTA 1BDCA 2FYUK 2IYOA 2SPZA 3H25A 3TYYA 2A45I 1RQUA 1L0NK 3G6EP 3L71J 1JNMA 1VQ6P 3HD7D 5CJ0A 3H1HJ 3G9RA 4H0LB 1IK9A 4RKUJ 1CW5A 2FFDC 2OYHB 3KPEA 3LIEA 2BASA 2MKVA 1GL2B 2CPBA 3IR9A 1KYOE 1J1EC 1MUUA 3N7NA 4WBAA 5AW6B 4L76A 2FYZA 3BRTB 2W27A 4HKZH 1NU1E 4WB4A 3PTZA 3CCLP 3L73G 2WT7B 4A7PA 4CPGA 3ABVC 3WU2E 2M5AB 3AECC 2OYHA 3M0AA 2XU6A 2JP3A 4WVZA 1FAVA 3OA7A 2BCCG 1YIJP 3VMZA 1KORA 1FZCC 1L0LJ 1GL2A 1OW8A 1PP9G 4BRYB 1QVFO 2LKMA 2O01H 3PH0A 2FXMA 1NTKD 3RL0B 3MD0A 1AV1A 2OYIC 2K37A 1DEEG 3CXHD 2HPCA 2HLOA 2IBZE 2V7QJ 3L72E 2WT7A 1NU1J 1VQMP 1URQD 1EDKA 1LTJB 2N1TB 5AVXB 1DD3A 4DZOA 5AW3B 2A06E 2QIWA 3SWFA 1JY3P 2E76D 3OW2O 2WSCJ 1HJBA 3SWKA 2HFED 1Q81Q 4BRYA 1QLED 4RO0A 2QJYB 1S9KE 3IFMA 3AEEC 4PV1B 1KTMA 3AE9C 1IFPA 3CC4P 2NPSD 3C8VA 1SQBD 3U59A 2YXQB 1XTCC 5KLVK 1LTJA 2FY8A 1FE6A 4H44D 3L72J 1AQ5A 4GT1A 2RN0A 3N4XA 2XNXA 2K3RA 3LW5H 3CMEP 2D2CC 2IBZI 1KMIZ 1Q7YQ 2KI7B 3UIAA 3L70E 5AVZB 1Q2NA 2HG5D 3HTKB 5CCGA 3A3YB 3L37A 1L4AC 1M8OB 4PD4D 5H2FE 2JR8A 5B5EH 4OVNF 1OWAA 3L71D 2YO3A 1SQQK 2UWJE 3HTKA 3H1HD 3P8CD 4AYCA 3USSA 3LIDA 1KILD 3L70J 1PPJD 1FOSF 2YIUC 1NTZK 1DIPA 2J58A 3S9OA 1LTAC 2YMYA 3H1LE 2FYUE 2ZXEB 4AQRD 1PV3A 2FYNC 2O01J 3S1KA 3Q2YA 1L0NE 1K73Q 1T2KD 1KQFB 1FZFA 1KZUB 1PGQA 4JF7A 1QVGO 3G4SP 4YTPC 2NRGA 1Y8AA 1KYOD 3AEGC 1OZHA 3SWYA 3CX5H 1LP1B 3L36A 3O6QB 3H1LJ 1NU1D 4EIJA 3A0BH 5APYA 2CPSA 3GG2A 2B87B 5CCHA 3B5ND 2CK3H 3G71P 1NO4A 1S2EA 1SQVK 1FOSE 5AW7B 2YKOA 5B5EE 1SQBG 2WWWA 4MN4C 2OYIB 5DJTB 1VQ7P 1H89A 2Q3IA 3WUVA 2QE7H 1LP1A 5APVA 1WRGA 1LT9B 3CCSP 1RY3A 3P7KA 5APUA 4ZNCA 4H0LC 3Q5PA 3VN0A 2P7JA 2QJKC 2OYHC 2P67A 4Z1MH 3CC2P 2IBZD 5AVUB 3L72D 3D70A 2JO1A 5KLIC 1GL2C 5KJ7D 2A06D 5E79H 3I55P 1N2DC 3CD6P 1PGPA 5TJHA 3AEDC 4WY4B 2A45H 3F5HA 3MIWA 3D71A 2E74D 3HRNA 2H88C 3H1JE 1LT9A 1SQPK 2B88A 3ZDMA 3BCCE 1G2CB 1S9KD 4XE5B 1SFCD 3L71G 1XTGB 1VQ5P 3RK2C 2W6BA 1N7SB 3H1HG 2D2CB 4L74A 4WY4A 1PPJG 4OH8B 4TLFA 1DH3A 1NWQA 4DT0A 3CX5E 5KAIH 2HYNA 3IAOA 1S5LX 3RL0C 1IFMA 3JCUH 3M9HA 3A0BE 1S5LH 2WPSA 2HODA 2RMZA 1G2CA 4H0LD 4JQ0D 3L70D 1LTJC 3H1JJ 1VQ8P 1N7SA 1FDIA 1GMJA 3GLMA 1X79B 1JEKA 1YTZI 2Z5IA 4DCKA 1GU4A 1L0LG 3R2PA 3BATA 2QJYC 2E42A 1GW3A 1NTME 2B89A 5CCGC 5GTIH 1IC2A 1IFIA 1AJYA 2YIUB 1BGYE 5AVRB 1OXZA 2L5GB 5AVQB 1W5CE 1GW4A 3SFDC 1KQGB 1E5WA 1A02F 5E79E 1NU1G 1HGZA 3H1KE 1JY3O 2GUSA 3L75E 1OFCX 2E5YA 3KZIH 2M3BA 1NTZE 5KTBA 2K9JB 1K05A 1CI6B 3H1LD 1JUNA 4Y99C 1PZQA 2FYUD 1H0TB 2N9YB 1NTMJ 2N1TD 3L74E 1BDDA 4XA4A 3B4SA 2GUVA 2IZ0A 3CCMP 1BGYJ 1FS0E 4I7ZB 5KAIE 2Q7CA 3L72G 2ZT9D 3H1KJ 1S5LE 2K9JA 3L75J 1CI6A 1JOCA 2JEEA 5CBNA 2Q6QA 3KXDA 1H0TA 4PV1D 4DJGA 1L2PA 3Q5SA 1OW6A 5K5GB 2KP8A 3Q1MA 3CI9A 1ZV8A 1MFTA 3L74J 5AW5B 4TT3H 1SQVE 1RQVA 5GTIE 2QJKB 2R5BA 5KLIB 5CCHC 3MP7B 2YKQA 1ZW0A 2L91A 1ZOYC 3AEFC 2JJLA 2Z4EA 2P10A 3L70G 3KZIE 3H1IE 2HPCB 1A02J 1RE3A 5APWA 1SQVJ 3RK2B 1YITP 1K8AQ 3H1JD 3I5CA 3GF7A 2PP6A 3BCCD 1SQPE 1P84I 2KXPB 1LT1A 3CCRP 2E75B 4GODA 1FC2C 1YJ9P 1LNQA 2V4HA 2XZRA 1VF5B 2YNYA 1VQ4P 4GKGA 3U1AA 2QSIA 1HGVA 1JO5A 3CWBE 3G3ZA 1LT9C 3CX5D 3H1IJ 2QEXP 2ZYDA 1IO4A 1N8RQ 2YXRB 3AEAC 3JC22 5CCHD 3SSUA 3MZWB 3U1CA 4JPZB 3H1LG 1EZVI 3NXSA 1U7JA 3EQ2A 1SQPJ 2KS1B 2YKPA 4WY4C 3E7KA 2Y0DA 3V6IA 3CCQP 1AQTA 2FBWC 1AA0A 3B71A 4RESB 2XV5A 3IN6A 3CL3D 4ZKPA 1KC8Q 2O1KA 3CWBJ 1NTMD 4H13C 2KZIA 1SS1A 1BGYD 1N7SC 1KD1Q 3T97B 1N7LA 3M91A 3R4YA 2KS1A 2M0BA 4Y99B 3H1KD 1J1DC 3L75D 1VDFA 2R3CA 1NTZD 1RH5B 2OTKE 3I56P 1GK4A 2P2UA 4OGQB 2ZYGA 4UB8H 1DEBA 2YO2A 1JTHB 2IYPA 3L73E 3T97A 2KSJA 1M1JA 4JBZA 5EFWB 2B9BA 1NHLA 1H8AA 3L74D 1SQBK 2Y9ZA 2POHA 1NOHA 3CC7P 4WY4D 2R32A 3HUSB 3PJSK 2M3EA 1G1JA 3E1IA 2KLVA 3HD7A 4W7YA 3KHUA 1KQLA 5CBOA 1N86A 1SQXE 5AVWB 4B86A 4HB1A 2KNCB 2WITA 1JTHA 4UB6H 2QVAA 2XKMA 1W2BO 2D2CD 1LTBC 5AW8B 1VQ9P 3H1JG 1FBMA 1HTLC 3VYIA 5APXA 3HUSA 1YQ3C 5CHXA 3IF4A 1AFOA 3II6A 3RK3C 1SQVD 2LXCB 1NTKG 1L4AD 4D6TE 1RF1A 1IJDB 4N6JA 1FZBA 5AVYB 2KNCA 2E76B 1X22A 1PL5A 4L73A 2AEFA 1SQXJ 1MZ9A 4I7ZC 1VPCA 2ZFCA 2R44A 2J5UA 3TDKA 2FYUJ 4EOTA 5GTHH 4XFJA 2C0WA 2DW3A 4KJMA 3H1ID 4YPCA 1GZLA 2K9YA 1YJWP 2W90A 1MKMA 4UB8E 1L0NJ 1URQA 1EXIA 1S72P 2AXTH 2YMKA 1KQSO 1YI2P 4H44B 4D6TJ 3H6PA 3LW5J 3KDPB 1SQPD 1ZLLA 3RL0g 3A2AA 3V2PA 1NTMG 5AW9B 1X8YA 1L0LK 1RE3C 1OVRA 1BE3E 2NPSA 1OVUA 3FWLA 3MUDA 3CWBD 1U57A 1YJNP 3MGNA 1LWUB 1KB9I 3L75G 1X9VA 3M06A 4L75A 1JMBA 3WUTA 3QH9A 1NU1K 4EYYQ 3AE5C 4IFMA 3CPWO 4GDOA 3CCVP 2HODB 1UIIA 3OAKA 1GK6A 2I1JA 4H13B 3L74G 1FJKA 2J59M 4Y28J 4ASVA 1JY2N 1BCCE 3VMXA 3NTNA 1ZXGA 1LWUA 1BE3J 3CCJP 5KLVE 1USDA 1EC5A 1JY2O 1ZP0C 2E75C 2WMMA 2H7HA 2WQYC 4AUWA 1VF5C 1J1DB 3PRJA 2BEZF 1JCDA 1S3JA 2WSSH 2RH0A 1EDIA 4C46A 1NKZB 3VOPA 2QRXA 3AEBC 4ASWA 2AXTE 4PJ0H 4GOFA 2O01N 3BCCJ 1KILA 1FDMA 1Y9BA 1GL2D 3PP5A 1GU5A 2OTJP 2KK7A 5AVSB 1SQVG 1T6AA 4YXWH 1BCCJ 4O9BA 1P84H 1OIPA 5KLVJ 1IK7A 3V2NA 1KN7A 3L73D 2G8YA 1QEXA 4U3FE 3P8MC 2WPQA 2K88A 1SQQE 1ZR4A 2W6JH 2WVRA 3P32A 2G3AA 3B5NB 3RK2D 1KFNA 4C7NA 1WMKA 3QWOC 3H1IG 2XNDH 2XDJA 3CXHI 1M1JC 1SQXD 1RF0A 3RK3B 1Q86Q 3RL0D 1OX3A 1J2JB 2KOGA 2KYVA 3AE3C 2V7QH 5BU8B 3HD7C 1SQPG 1FZGA 1L0ND 1N73A 4U3FJ 1Q82Q 1G1IA 2KUBA 3B5NA 4NPEA 4OGQC 4LLHA 1U7MA 3C1LA 4HYTB 3RGUA 1QL2A 1NKNA 1OW7A 2KB7P 3WMM0 1SQQJ 4W7ZA 2WSCH 3WU2H 4D6TD 5AW4B 2KZJA
chains in the Genus database with same CATH topology
1LT9C 1KILB 2J58A 2WZ7A 1LTGC 1IO4A 1LTAC 2YMYA 2IPPA 1WT6A 2IFNA 2M8RA 3M0DC 5CCHD 2ZXEB 4IFFA 3VP9A 4AQRD 3HUSC 3U1CA 5CCGD 1FU1A 2C9NY 3BASA 3NXSA 3L4FA 1CSBA 3HE4A 3A7OA 1IFJA 1LGHB 2N9BA 3EQ2A 1YTZT 2YKPA 3H32A 5CJ4A 1T2KD 4WY4C 1T3JA 1SFCB 1FZFA 2PAJA 1KZUB 1RF1C 3NMDA 4JF7A 4N78D 1LTSC 1HVVA 4RESB 3CLQA 1ZR2A 5KJ7A 2IX7C 2XV5A 3V5BA 1L4AB 3CL3D 4ZKPA 2O1KA 4C7NB 4LC1A 4HH2A 4GIFA 3SWYA 3L35A 2WSFH 1T8ZA 2N1TC 3L36A 1N7SC 1JY2P 3GHGA 4EIJA 3B8EB 5APYA 1JCCA 2FKWB 2CPSA 1N7LA 3M91A 5CCHA 3B5ND 1URQC 2R5DA 1SFCA 2IFMA 1NO4A 4Y99B 2WSEH 1GD2E 1J1DC 1SQVK 1FOSE 5AW7B 3TSIA 1JMMA 1VDFA 2YKOA 1N73B 2C0XA 2R3CA 2P1JA 2WWWA 1L4AA 1HUCA 2OYIB 5APSA 1GK4A 2P2UA 1NH4A 1MFZA 3KYQA 1HWTC 1H89A 2I1KA 2Q3IA 1DEBA 1RE4C 1T3UA 2YO2A 5APVA 1WRGA 1JTHB 1LT9B 3T97A 2KSJA 1RY3A 3P7KA 1IFNA 3HE5B 5APUA 1M1JA 3M9BA 1JY3N 2Q5UA 3VN0A 1NHLA 1H8AA 2WTYA 2NPSC 2P7JA 1SQBK 2OYHC 2P67A 2POHA 1NOHA 5AVUB 3HE4B 4WY4D 2R32A 3HUSB 1G1JA 1GL2C 3E1IA 2KLVA 3HD7A 1EQ7A 5KJ7D 4W7YA 1N2DC 3BRVB 5AVTB 1KQLA 2Z5HA 4WY4B 1KFMA 5CMZA 4W80A 2VRSA 2A45H 1N86A 5AVWB 3MIWA 4B86A 1YYCA 3HRNA 3BVHA 2WITA 1JTHA 1LT9A 1SQPK 1MV8A 3HE5A 2XKMA 5AW1B 1G2CB 4I1LA 1LTBC 5AW8B 1S9KD 4XE5B 3P8CE 1SFCD 1FBMA 1HTLC 3M0DA 1XTGB 1IFDA 3GHGB 5APXA 3VYIA 3HUSA 1LWUC 4KHXA 5CHXA 3RK2C 1AFOA 2W6BA 3II6A 1N7SB 4IFDK 1LTTC 3RK3C 3O8ZA 1FZAA 1L4AD 1SQXK 4WY4A 1GDTA 4OH8B 1QL1A 1RF1A 1DH3A 1NWQA 1IJDB 4ZKUA 2HYNA 4N6JA 1FZBA 5AVYB 2FYUK 1HBWA 3RL0C 1IFMA 3M9HA 2WPSA 4M3LA 2HODA 3TYYA 2A45I 2C9LY 4C7RA 1Z56A 1G2CA 1NTKK 2MJZA 1L0NK 2QM7A 1LTJC 1MZ9A 1VPCA 2ZFCA 1KILC 4DOJA 1M1JB 2N1TA 1DX7A 3C9IA 1JNMA 1N7SA 4I2LC 1HH0A 1X79B 4EOTA 3HD7D 2C0WA 1M7LA 5CJ0A 1GZLA 1YTZI 3TK1A 1IK9A 3V4WA 4N78E 2H43A 1CW5A 2Z5IA 2FFDC 1URQA 2OYHB 4JYCA 3KPEA 3LIEA 1GU4A 2E43A 3HD7B 3R2PA 2BASA 3BATA 2E42A 1GL2B 2CPBA 3IR9A 1GW3A 1J1EC 1MUUA 3N7NA 4WBAA 5CCGC 5AW6B 2O1JA 1IC2A 1IFIA 2FYZA 3H6PA 3OJAB 3KDPB 1ZLLA 3BRTB 2W27A 3A2AA 3V2PA 5AVRB 1OXZA 2L5GB 5AVQB 1W2EA 3M9QA 1T2KC 1FZEA 4WB4A 1RE4A 5AW9B 1GW4A 1X8YA 1L0LK 3V2QA 1SLQA 1E5WA 1LTIC 1RE3C 1A02F 1HGZA 2WPRA 2WT7B 2Q9IA 1JY3O 2GUSA 2NPSA 3MUDA 1RF0C 2OYHA 3M0AA 2XU6A 3EFGA 1FAVA 3OA7A 2W6AA 3MGNA 1LWUB 1NTMK 2M3BA 3VMZA 1X9VA 3M06A 5KTBA 3NFQA 1FZCC 1GL2A 3KQGA 1CI6B 2OARA 1JUNA 1FJPA 4Y99C 1RF1B 1NU1K 1NAFA 1PFIA 4IFMA 1N73C 2LKMA 2O01H 3B5NC 2FXMA 2N1TD 3V2RA 2HODB 1N7SD 3MD0A 4XA4A 3RL0B 2OYIC 3OAKA 4I6MC 2HPCA 2GUVA 5APQA 5BU5A 2HLOA 1GK6A 2I1JA 4N3YB 2WT7A 1FJKA 1URQD 2J59M 2QM8A 1LTJB 2N1TB 5AVXB 3VTPC 1JY2N 2Q7CA 3VMXA 4DZOA 5AW3B 3NTNA 3SWFA 1LWUA 5AW2B 1JY3P 1JY2O 1HJBA 1CI6A 1JOCA 1URQB 2JEEA 3VMYA 1CZQA 2H8PD 2H7HA 2HFED 4AUWA 2FFDB 1J1DB 1JCDA 4LGDE 1S9KE 2GM4A 1J1EB 4C46A 1NKZB 3VOPA 3IFMA 2KP8A 3CI9A 1ZV8A 2NPSD 5KJ7C 5AVVB 3U59A 3VP8A 1XTCC 5KLVK 1LTJA 5AW5B 1KILA 1FDMA 3MTUE 1GL2D 3PP5A 1AQ5A 1GU5A 1SP4A 4GT1A 2NPSB 5AVSB 3N4XA 2R5BA 3GHGC 2XNXA 4O9BA 3LW5H 2FFDA 3A5TA 3V2NA 5CCHC 2YKQA 1SFCC 1FZCB 3P8MC 3UIAA 1GTWA 5AVZB 2HG5D 2WPQA 3HTKB 5CCGA 3A3YB 1SVFA 1ZR4A 2JJLA 2Z4EA 3P32A 3L37A 1L4AC 3B5NB 2HPCB 3RK2D 1A02J 1KFNA 3RK3D 4C7NA 1RE3A 3TNUB 2XDJA 5APWA 1M1JC 1ZN5A 5APTA 1RF0A 3RK2B 2A45G 3RK3B 1OWAA 3V4QA 3I5CA 1FZCA 2PP6A 3RL0D 2YO3A 1SQQK 1J2JB 2KOGA 2KYVA 3HTKA 3P8CD 4AYCA 5BU8B 2XZRA 3HD7C 1FZGA 2YNYA 4GKGA 3LIDA 1N73A 1KILD 3H32B 1G1IA 3B5NA 3U1AA 4LLHA 4JYBA 5AW0B 4HYTB 1H88A 1QL2A 1HGVA 2OYIA 1NKNA 1FOSF 3WMM0 2KB7P 1JO5A 4W7ZA 2WSCH 1NTZK 3G3ZA 5AW4B 5BVZA 3TNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS C;  1KIL B;  3HD7 B;  3VOP A;  2WZ7 A;  2YMY A;  1GL2 B;  4WY4 D;  2NPS D;  5KJ7 C;  5CCG C;  2M8R A;  3M0D C;  5CCH D;  1GL2 C;  1KIL A;  3HD7 A;  5KJ7 D;  5CCG D;  4W7Y A;  1GL2 D;  3PP5 A;  4WY4 B;  2NPS B;  4W80 A;  4WY4 C;  1T3J A;  1SFC B;  1JTH A;  4JF7 A;  5CCH C;  2NPS A;  1SFC C;  1HVV A;  2HG5 D;  3HTK B;  5KJ7 A;  3P8C E;  5CCG A;  1SFC D;  1L4A B;  1XTG B;  1GL2 A;  3RK2 C;  1N7S B;  1L4A C;  3RK3 C;  3B5N B;  2N1T C;  3RK2 D;  1N7S C;  1L4A D;  3RK3 D;  3B5N C;  4WY4 A;  4OH8 B;  2N1T D;  1N7S D;  3RL0 B;  2XDJ A;  5CCH A;  3B5N D;  1URQ C;  1SFC A;  3RK2 B;  3RL0 C;  3RK3 B;  1URQ D;  3TSI A;  2N1T B;  2PP6 A;  3RL0 D;  2KOG A;  1L4A A;  1KIL C;  3HD7 C;  1URQ B;  2N1T A;  3KYQ A;  1N7S A;  1KIL D;  2H8P D;  3B5N A;  2HFE D;  3HD7 D;  1JTH B;  4N78 E;  4W7Z A;  4LGD E;  1URQ A;  1NHL A; 
#chains in the Genus database with same CATH topology
 2IBZ G;  2LXB A;  3JCU E;  2AXC A;  2IPP A;  4HJG H;  3AE8 C;  2IFN A;  2H89 C;  2A06 G;  4IFF A;  3VP9 A;  3HUS C;  2R3S A;  5CCG D;  2E74 B;  1NTZ J;  1CSB A;  3HE4 A;  1R5S A;  4PJ0 E;  1LGH B;  1YTZ T;  3VMA A;  1T3J A;  1SFC B;  2PAJ A;  3CMA P;  1RF1 C;  3NMD A;  5DJU B;  1P84 E;  3CLQ A;  2O3J A;  5KJ7 A;  3PLN A;  2IX7 C;  4OWF A;  3V5B A;  2Y0C A;  3W67 A;  3L35 A;  2WSF H;  1T8Z A;  3MHV A;  2Q1K A;  1NAY A;  1JY2 P;  3GHG A;  4IOI H;  4PD4 I;  2GA1 A;  2PFX A;  2FKW B;  1URQ C;  4K3A A;  3Q5R A;  1L0L E;  1SFC A;  2IFM A;  2ZXX A;  1BE3 D;  4OGQ D;  2WSE H;  1PGO A;  3TSI A;  1JMM A;  2E76 C;  2PGD A;  1EDL A;  3TGU E;  1EZV E;  2P1J A;  3AE1 C;  2OQQ A;  5TIS H;  1HUC A;  1S4X A;  1MFZ A;  3KYQ A;  2I1K A;  4ZMD A;  1IFN A;  1JM0 A;  2Q5U A;  2NPS C;  2JWA A;  3EWK A;  2I8D A;  3MUD C;  3EFF K;  2JDI H;  1D7M A;  3E1R A;  4H44 C;  1M90 Q;  1BCC D;  3RK3 E;  1EDJ A;  5AVT B;  3BRV B;  5KLV D;  2Z5H A;  1KFM A;  5CMZ A;  4GOE A;  4W80 A;  2VRS A;  3TGU J;  5H2F H;  1SQX G;  1TU3 F;  4I1L A;  1HF9 A;  3GF3 A;  3M0D A;  1KYO I;  1IFD A;  2FYU G;  2M5A A;  1LWU C;  3D6Y A;  4IFD K;  1AVO A;  4BWN A;  1FZA A;  1L0N G;  1YHQ P;  2LR2 A;  2QJP C;  4IL6 X;  4K35 A;  1Y47 A;  4IL6 H;  2ZT9 B;  1HBW A;  1USE A;  4D6T G;  4KT0 J;  2NZ2 A;  4M3L A;  5KKZ C;  2C9L Y;  4C7R A;  1Z56 A;  2PRR A;  1UIX A;  4U3F D;  1NTK K;  2MJZ A;  2QM7 A;  1KIL C;  4DOJ A;  3AE7 C;  1DD4 A;  1SQQ D;  2Y9Y A;  1M1J B;  2N1T A;  1DX7 A;  3C9I A;  4I2L C;  1HH0 A;  1M7L A;  5TIS E;  3TK1 A;  1KB9 H;  3V4W A;  4N78 E;  2H43 A;  4JYC A;  2E43 A;  3HD7 B;  2RKL A;  1ZRT E;  2QG4 A;  3FGA D;  2O1J A;  2P58 A;  2WSF J;  1FDO A;  3OJA B;  1NGM B;  3FXE A;  1W2E A;  3M9Q A;  1T2K C;  1FZE A;  1RE4 A;  3V2Q A;  1SLQ A;  1LTI C;  2AEM A;  2WPR A;  2BCC E;  2WSE J;  2Q9I A;  3GW6 A;  1EXJ A;  1KV4 A;  1RF0 C;  3EFG A;  1HJ0 A;  1BE3 G;  2W6A A;  1NTM K;  1PGJ A;  1ZME C;  3NFQ A;  1PP9 E;  3KQG A;  2OAR A;  1FJP A;  5M1B A;  1RF1 B;  1NAF A;  3AE6 C;  1PFI A;  2QA4 P;  4H13 D;  1N73 C;  1VQN P;  3B5N C;  3V2R A;  1N7S D;  4I6M C;  5APQ A;  5BU5 A;  4N3Y B;  3L73 J;  3BCC G;  1Q90 D;  2QM8 A;  3VTP C;  2E5T A;  1YQ4 C;  1NYH A;  4IL6 E;  1P84 D;  5AW2 B;  2BCC J;  1K04 A;  3WUU A;  1BCC G;  1URQ B;  3VMY A;  2JKV A;  1CZQ A;  2H8P D;  5KLV G;  2FFD B;  1PP9 J;  4LGD E;  3SFE C;  3ITK A;  1VQL P;  2Q3E A;  1X0T A;  2GM4 A;  1J1E B;  2OYO A;  1KB9 E;  2AEJ A;  3D6Z A;  3Q3D A;  1L0L D;  3A0H H;  1M57 D;  5KJ7 C;  5AVV B;  3VP8 A;  1VL2 A;  1VQO P;  5C39 A;  3CXH H;  5L8R J;  3TGU D;  3MTU E;  1EZV D;  1JB0 J;  4QMA A;  1SP4 A;  2NPS B;  2E74 C;  3GMA A;  3GHG C;  2FFD A;  3A5T A;  3S4R A;  3W68 A;  1SFC C;  1FZC B;  1GTW A;  3JSV C;  1K9M Q;  1SVF A;  4U7J A;  5B66 H;  2FXP A;  4U3F G;  2HR3 A;  2ITA A;  1BGY G;  1YBK A;  1VQK P;  1SQQ G;  3RK3 D;  3PHL A;  3K5B A;  3TNU B;  1ZN5 A;  3H1K G;  5APT A;  4UB6 E;  3O6Q A;  2A45 G;  3V4Q A;  2B87 A;  1FZC A;  1NTZ G;  1LJ2 A;  2QJP B;  2WPV B;  2KIK A;  1OVV A;  1QX8 A;  1M56 D;  3H32 B;  1NVO A;  4JYB A;  5AW0 B;  5KAF H;  1H88 A;  5KKZ B;  2OYI A;  1BSN A;  1PIX A;  1QGK B;  5BVZ A;  3TNU A;  1KIL B;  3FXD A;  2WZ7 A;  1LTG C;  4BXL A;  3RBZ A;  2ZVN B;  4R4L A;  4PD4 H;  1WT6 A;  2M8R A;  3M0D C;  1FU1 A;  3A0H E;  2C9N Y;  3BAS A;  3L4F A;  3A7O A;  1NTK E;  1IFJ A;  1NJI Q;  2N9B A;  3CXH E;  5GTH E;  1R8E A;  3H32 A;  5CJ4 A;  3RBX A;  4N78 D;  1LTS C;  2OGU A;  1HVV A;  1IZN B;  1ZR2 A;  2W8Z A;  3FX0 A;  3CCU P;  2W83 C;  2ZYA A;  1L4A B;  3AE2 C;  4C7N B;  1M1K Q;  4LC1 A;  3TF5 A;  1ZRT D;  4HH2 A;  4GIF A;  2N1T C;  5B66 E;  1OMI A;  2ZAE B;  3B8E B;  4YXD C;  1JCC A;  1RHZ B;  2R5D A;  2BCC D;  1NTK J;  1GD2 E;  1SQB E;  2ZT9 C;  2IZ1 A;  1N73 B;  2C0X A;  1R5L A;  4R4M A;  1L4A A;  1PP9 D;  5APS A;  2Y0E A;  4NPF X;  4PV1 C;  1NH4 A;  3TGU G;  1E79 H;  1EZV G;  1HWT C;  3FWN A;  1RE4 C;  3AE4 C;  1T3U A;  2E75 D;  3HE5 B;  1KYO H;  1VF5 D;  3M9B A;  1JY3 N;  1AVY A;  2JWD A;  3CX5 I;  4EI2 A;  2WTY A;  5KAF E;  2OTL P;  3HE4 B;  2FYN B;  1EQ7 A;  1VQP P;  2BEQ D;  4PD4 E;  1SQB J;  4NPD A;  1S1C X;  1YYC A;  3BVH A;  3CWB G;  3L71 E;  2K1A A;  1MV8 A;  3HE5 A;  5AW1 B;  2IDB A;  3H1H E;  3P8C E;  2FXO A;  1KB9 D;  2KSE A;  3F89 A;  3GHG B;  4KHX A;  3CCE P;  1KIL E;  1LTT C;  1PPJ E;  3O8Z A;  2ZVO B;  4EDF A;  4WWI A;  1SQX K;  2KLU A;  1GDT A;  1QL1 A;  1BSH A;  2ZJS E;  4ZKU A;  4RJT A;  1BDC A;  2FYU K;  2IYO A;  2SPZ A;  3H25 A;  3TYY A;  2A45 I;  1RQU A;  1L0N K;  3G6E P;  3L71 J;  1JNM A;  1VQ6 P;  3HD7 D;  5CJ0 A;  3H1H J;  3G9R A;  4H0L B;  1IK9 A;  4RKU J;  1CW5 A;  2FFD C;  2OYH B;  3KPE A;  3LIE A;  2BAS A;  2MKV A;  1GL2 B;  2CPB A;  3IR9 A;  1KYO E;  1J1E C;  1MUU A;  3N7N A;  4WBA A;  5AW6 B;  4L76 A;  2FYZ A;  3BRT B;  2W27 A;  4HKZ H;  1NU1 E;  4WB4 A;  3PTZ A;  3CCL P;  3L73 G;  2WT7 B;  4A7P A;  4CPG A;  3ABV C;  3WU2 E;  2M5A B;  3AEC C;  2OYH A;  3M0A A;  2XU6 A;  2JP3 A;  4WVZ A;  1FAV A;  3OA7 A;  2BCC G;  1YIJ P;  3VMZ A;  1KOR A;  1FZC C;  1L0L J;  1GL2 A;  1OW8 A;  1PP9 G;  4BRY B;  1QVF O;  2LKM A;  2O01 H;  3PH0 A;  2FXM A;  1NTK D;  3RL0 B;  3MD0 A;  1AV1 A;  2OYI C;  2K37 A;  1DEE G;  3CXH D;  2HPC A;  2HLO A;  2IBZ E;  2V7Q J;  3L72 E;  2WT7 A;  1NU1 J;  1VQM P;  1URQ D;  1EDK A;  1LTJ B;  2N1T B;  5AVX B;  1DD3 A;  4DZO A;  5AW3 B;  2A06 E;  2QIW A;  3SWF A;  1JY3 P;  2E76 D;  3OW2 O;  2WSC J;  1HJB A;  3SWK A;  2HFE D;  1Q81 Q;  4BRY A;  1QLE D;  4RO0 A;  2QJY B;  1S9K E;  3IFM A;  3AEE C;  4PV1 B;  1KTM A;  3AE9 C;  1IFP A;  3CC4 P;  2NPS D;  3C8V A;  1SQB D;  3U59 A;  2YXQ B;  1XTC C;  5KLV K;  1LTJ A;  2FY8 A;  1FE6 A;  4H44 D;  3L72 J;  1AQ5 A;  4GT1 A;  2RN0 A;  3N4X A;  2XNX A;  2K3R A;  3LW5 H;  3CME P;  2D2C C;  2IBZ I;  1KMI Z;  1Q7Y Q;  2KI7 B;  3UIA A;  3L70 E;  5AVZ B;  1Q2N A;  2HG5 D;  3HTK B;  5CCG A;  3A3Y B;  3L37 A;  1L4A C;  1M8O B;  4PD4 D;  5H2F E;  2JR8 A;  5B5E H;  4OVN F;  1OWA A;  3L71 D;  2YO3 A;  1SQQ K;  2UWJ E;  3HTK A;  3H1H D;  3P8C D;  4AYC A;  3USS A;  3LID A;  1KIL D;  3L70 J;  1PPJ D;  1FOS F;  2YIU C;  1NTZ K;  1DIP A;  2J58 A;  3S9O A;  1LTA C;  2YMY A;  3H1L E;  2FYU E;  2ZXE B;  4AQR D;  1PV3 A;  2FYN C;  2O01 J;  3S1K A;  3Q2Y A;  1L0N E;  1K73 Q;  1T2K D;  1KQF B;  1FZF A;  1KZU B;  1PGQ A;  4JF7 A;  1QVG O;  3G4S P;  4YTP C;  2NRG A;  1Y8A A;  1KYO D;  3AEG C;  1OZH A;  3SWY A;  3CX5 H;  1LP1 B;  3L36 A;  3O6Q B;  3H1L J;  1NU1 D;  4EIJ A;  3A0B H;  5APY A;  2CPS A;  3GG2 A;  2B87 B;  5CCH A;  3B5N D;  2CK3 H;  3G71 P;  1NO4 A;  1S2E A;  1SQV K;  1FOS E;  5AW7 B;  2YKO A;  5B5E E;  1SQB G;  2WWW A;  4MN4 C;  2OYI B;  5DJT B;  1VQ7 P;  1H89 A;  2Q3I A;  3WUV A;  2QE7 H;  1LP1 A;  5APV A;  1WRG A;  1LT9 B;  3CCS P;  1RY3 A;  3P7K A;  5APU A;  4ZNC A;  4H0L C;  3Q5P A;  3VN0 A;  2P7J A;  2QJK C;  2OYH C;  2P67 A;  4Z1M H;  3CC2 P;  2IBZ D;  5AVU B;  3L72 D;  3D70 A;  2JO1 A;  5KLI C;  1GL2 C;  5KJ7 D;  2A06 D;  5E79 H;  3I55 P;  1N2D C;  3CD6 P;  1PGP A;  5TJH A;  3AED C;  4WY4 B;  2A45 H;  3F5H A;  3MIW A;  3D71 A;  2E74 D;  3HRN A;  2H88 C;  3H1J E;  1LT9 A;  1SQP K;  2B88 A;  3ZDM A;  3BCC E;  1G2C B;  1S9K D;  4XE5 B;  1SFC D;  3L71 G;  1XTG B;  1VQ5 P;  3RK2 C;  2W6B A;  1N7S B;  3H1H G;  2D2C B;  4L74 A;  4WY4 A;  1PPJ G;  4OH8 B;  4TLF A;  1DH3 A;  1NWQ A;  4DT0 A;  3CX5 E;  5KAI H;  2HYN A;  3IAO A;  1S5L X;  3RL0 C;  1IFM A;  3JCU H;  3M9H A;  3A0B E;  1S5L H;  2WPS A;  2HOD A;  2RMZ A;  1G2C A;  4H0L D;  4JQ0 D;  3L70 D;  1LTJ C;  3H1J J;  1VQ8 P;  1N7S A;  1FDI A;  1GMJ A;  3GLM A;  1X79 B;  1JEK A;  1YTZ I;  2Z5I A;  4DCK A;  1GU4 A;  1L0L G;  3R2P A;  3BAT A;  2QJY C;  2E42 A;  1GW3 A;  1NTM E;  2B89 A;  5CCG C;  5GTI H;  1IC2 A;  1IFI A;  1AJY A;  2YIU B;  1BGY E;  5AVR B;  1OXZ A;  2L5G B;  5AVQ B;  1W5C E;  1GW4 A;  3SFD C;  1KQG B;  1E5W A;  1A02 F;  5E79 E;  1NU1 G;  1HGZ A;  3H1K E;  1JY3 O;  2GUS A;  3L75 E;  1OFC X;  2E5Y A;  3KZI H;  2M3B A;  1NTZ E;  5KTB A;  2K9J B;  1K05 A;  1CI6 B;  3H1L D;  1JUN A;  4Y99 C;  1PZQ A;  2FYU D;  1H0T B;  2N9Y B;  1NTM J;  2N1T D;  3L74 E;  1BDD A;  4XA4 A;  3B4S A;  2GUV A;  2IZ0 A;  3CCM P;  1BGY J;  1FS0 E;  4I7Z B;  5KAI E;  2Q7C A;  3L72 G;  2ZT9 D;  3H1K J;  1S5L E;  2K9J A;  3L75 J;  1CI6 A;  1JOC A;  2JEE A;  5CBN A;  2Q6Q A;  3KXD A;  1H0T A;  4PV1 D;  4DJG A;  1L2P A;  3Q5S A;  1OW6 A;  5K5G B;  2KP8 A;  3Q1M A;  3CI9 A;  1ZV8 A;  1MFT A;  3L74 J;  5AW5 B;  4TT3 H;  1SQV E;  1RQV A;  5GTI E;  2QJK B;  2R5B A;  5KLI B;  5CCH C;  3MP7 B;  2YKQ A;  1ZW0 A;  2L91 A;  1ZOY C;  3AEF C;  2JJL A;  2Z4E A;  2P10 A;  3L70 G;  3KZI E;  3H1I E;  2HPC B;  1A02 J;  1RE3 A;  5APW A;  1SQV J;  3RK2 B;  1YIT P;  1K8A Q;  3H1J D;  3I5C A;  3GF7 A;  2PP6 A;  3BCC D;  1SQP E;  1P84 I;  2KXP B;  1LT1 A;  3CCR P;  2E75 B;  4GOD A;  1FC2 C;  1YJ9 P;  1LNQ A;  2V4H A;  2XZR A;  1VF5 B;  2YNY A;  1VQ4 P;  4GKG A;  3U1A A;  2QSI A;  1HGV A;  1JO5 A;  3CWB E;  3G3Z A;  1LT9 C;  3CX5 D;  3H1I J;  2QEX P;  2ZYD A;  1IO4 A;  1N8R Q;  2YXR B;  3AEA C;  3JC2 2;  5CCH D;  3SSU A;  3MZW B;  3U1C A;  4JPZ B;  3H1L G;  1EZV I;  3NXS A;  1U7J A;  3EQ2 A;  1SQP J;  2KS1 B;  2YKP A;  4WY4 C;  3E7K A;  2Y0D A;  3V6I A;  3CCQ P;  1AQT A;  2FBW C;  1AA0 A;  3B71 A;  4RES B;  2XV5 A;  3IN6 A;  3CL3 D;  4ZKP A;  1KC8 Q;  2O1K A;  3CWB J;  1NTM D;  4H13 C;  2KZI A;  1SS1 A;  1BGY D;  1N7S C;  1KD1 Q;  3T97 B;  1N7L A;  3M91 A;  3R4Y A;  2KS1 A;  2M0B A;  4Y99 B;  3H1K D;  1J1D C;  3L75 D;  1VDF A;  2R3C A;  1NTZ D;  1RH5 B;  2OTK E;  3I56 P;  1GK4 A;  2P2U A;  4OGQ B;  2ZYG A;  4UB8 H;  1DEB A;  2YO2 A;  1JTH B;  2IYP A;  3L73 E;  3T97 A;  2KSJ A;  1M1J A;  4JBZ A;  5EFW B;  2B9B A;  1NHL A;  1H8A A;  3L74 D;  1SQB K;  2Y9Z A;  2POH A;  1NOH A;  3CC7 P;  4WY4 D;  2R32 A;  3HUS B;  3PJS K;  2M3E A;  1G1J A;  3E1I A;  2KLV A;  3HD7 A;  4W7Y A;  3KHU A;  1KQL A;  5CBO A;  1N86 A;  1SQX E;  5AVW B;  4B86 A;  4HB1 A;  2KNC B;  2WIT A;  1JTH A;  4UB6 H;  2QVA A;  2XKM A;  1W2B O;  2D2C D;  1LTB C;  5AW8 B;  1VQ9 P;  3H1J G;  1FBM A;  1HTL C;  3VYI A;  5APX A;  3HUS A;  1YQ3 C;  5CHX A;  3IF4 A;  1AFO A;  3II6 A;  3RK3 C;  1SQV D;  2LXC B;  1NTK G;  1L4A D;  4D6T E;  1RF1 A;  1IJD B;  4N6J A;  1FZB A;  5AVY B;  2KNC A;  2E76 B;  1X22 A;  1PL5 A;  4L73 A;  2AEF A;  1SQX J;  1MZ9 A;  4I7Z C;  1VPC A;  2ZFC A;  2R44 A;  2J5U A;  3TDK A;  2FYU J;  4EOT A;  5GTH H;  4XFJ A;  2C0W A;  2DW3 A;  4KJM A;  3H1I D;  4YPC A;  1GZL A;  2K9Y A;  1YJW P;  2W90 A;  1MKM A;  4UB8 E;  1L0N J;  1URQ A;  1EXI A;  1S72 P;  2AXT H;  2YMK A;  1KQS O;  1YI2 P;  4H44 B;  4D6T J;  3H6P A;  3LW5 J;  3KDP B;  1SQP D;  1ZLL A;  3RL0 g;  3A2A A;  3V2P A;  1NTM G;  5AW9 B;  1X8Y A;  1L0L K;  1RE3 C;  1OVR A;  1BE3 E;  2NPS A;  1OVU A;  3FWL A;  3MUD A;  3CWB D;  1U57 A;  1YJN P;  3MGN A;  1LWU B;  1KB9 I;  3L75 G;  1X9V A;  3M06 A;  4L75 A;  1JMB A;  3WUT A;  3QH9 A;  1NU1 K;  4EYY Q;  3AE5 C;  4IFM A;  3CPW O;  4GDO A;  3CCV P;  2HOD B;  1UII A;  3OAK A;  1GK6 A;  2I1J A;  4H13 B;  3L74 G;  1FJK A;  2J59 M;  4Y28 J;  4ASV A;  1JY2 N;  1BCC E;  3VMX A;  3NTN A;  1ZXG A;  1LWU A;  1BE3 J;  3CCJ P;  5KLV E;  1USD A;  1EC5 A;  1JY2 O;  1ZP0 C;  2E75 C;  2WMM A;  2H7H A;  2WQY C;  4AUW A;  1VF5 C;  1J1D B;  3PRJ A;  2BEZ F;  1JCD A;  1S3J A;  2WSS H;  2RH0 A;  1EDI A;  4C46 A;  1NKZ B;  3VOP A;  2QRX A;  3AEB C;  4ASW A;  2AXT E;  4PJ0 H;  4GOF A;  2O01 N;  3BCC J;  1KIL A;  1FDM A;  1Y9B A;  1GL2 D;  3PP5 A;  1GU5 A;  2OTJ P;  2KK7 A;  5AVS B;  1SQV G;  1T6A A;  4YXW H;  1BCC J;  4O9B A;  1P84 H;  1OIP A;  5KLV J;  1IK7 A;  3V2N A;  1KN7 A;  3L73 D;  2G8Y A;  1QEX A;  4U3F E;  3P8M C;  2WPQ A;  2K88 A;  1SQQ E;  1ZR4 A;  2W6J H;  2WVR A;  3P32 A;  2G3A A;  3B5N B;  3RK2 D;  1KFN A;  4C7N A;  1WMK A;  3QWO C;  3H1I G;  2XND H;  2XDJ A;  3CXH I;  1M1J C;  1SQX D;  1RF0 A;  3RK3 B;  1Q86 Q;  3RL0 D;  1OX3 A;  1J2J B;  2KOG A;  2KYV A;  3AE3 C;  2V7Q H;  5BU8 B;  3HD7 C;  1SQP G;  1FZG A;  1L0N D;  1N73 A;  4U3F J;  1Q82 Q;  1G1I A;  2KUB A;  3B5N A;  4NPE A;  4OGQ C;  4LLH A;  1U7M A;  3C1L A;  4HYT B;  3RGU A;  1QL2 A;  1NKN A;  1OW7 A;  2KB7 P;  3WMM 0;  1SQQ J;  4W7Z A;  2WSC H;  3WU2 H;  4D6T D;  5AW4 B;  2KZJ A; 
#chains in the Genus database with same CATH homology
 1LT9 C;  1KIL B;  2J58 A;  2WZ7 A;  1LTG C;  1IO4 A;  1LTA C;  2YMY A;  2IPP A;  1WT6 A;  2IFN A;  2M8R A;  3M0D C;  5CCH D;  2ZXE B;  4IFF A;  3VP9 A;  4AQR D;  3HUS C;  3U1C A;  5CCG D;  1FU1 A;  2C9N Y;  3BAS A;  3NXS A;  3L4F A;  1CSB A;  3HE4 A;  3A7O A;  1IFJ A;  1LGH B;  2N9B A;  3EQ2 A;  1YTZ T;  2YKP A;  3H32 A;  5CJ4 A;  1T2K D;  4WY4 C;  1T3J A;  1SFC B;  1FZF A;  2PAJ A;  1KZU B;  1RF1 C;  3NMD A;  4JF7 A;  4N78 D;  1LTS C;  1HVV A;  4RES B;  3CLQ A;  1ZR2 A;  5KJ7 A;  2IX7 C;  2XV5 A;  3V5B A;  1L4A B;  3CL3 D;  4ZKP A;  2O1K A;  4C7N B;  4LC1 A;  4HH2 A;  4GIF A;  3SWY A;  3L35 A;  2WSF H;  1T8Z A;  2N1T C;  3L36 A;  1N7S C;  1JY2 P;  3GHG A;  4EIJ A;  3B8E B;  5APY A;  1JCC A;  2FKW B;  2CPS A;  1N7L A;  3M91 A;  5CCH A;  3B5N D;  1URQ C;  2R5D A;  1SFC A;  2IFM A;  1NO4 A;  4Y99 B;  2WSE H;  1GD2 E;  1J1D C;  1SQV K;  1FOS E;  5AW7 B;  3TSI A;  1JMM A;  1VDF A;  2YKO A;  1N73 B;  2C0X A;  2R3C A;  2P1J A;  2WWW A;  1L4A A;  1HUC A;  2OYI B;  5APS A;  1GK4 A;  2P2U A;  1NH4 A;  1MFZ A;  3KYQ A;  1HWT C;  1H89 A;  2I1K A;  2Q3I A;  1DEB A;  1RE4 C;  1T3U A;  2YO2 A;  5APV A;  1WRG A;  1JTH B;  1LT9 B;  3T97 A;  2KSJ A;  1RY3 A;  3P7K A;  1IFN A;  3HE5 B;  5APU A;  1M1J A;  3M9B A;  1JY3 N;  2Q5U A;  3VN0 A;  1NHL A;  1H8A A;  2WTY A;  2NPS C;  2P7J A;  1SQB K;  2OYH C;  2P67 A;  2POH A;  1NOH A;  5AVU B;  3HE4 B;  4WY4 D;  2R32 A;  3HUS B;  1G1J A;  1GL2 C;  3E1I A;  2KLV A;  3HD7 A;  1EQ7 A;  5KJ7 D;  4W7Y A;  1N2D C;  3BRV B;  5AVT B;  1KQL A;  2Z5H A;  4WY4 B;  1KFM A;  5CMZ A;  4W80 A;  2VRS A;  2A45 H;  1N86 A;  5AVW B;  3MIW A;  4B86 A;  1YYC A;  3HRN A;  3BVH A;  2WIT A;  1JTH A;  1LT9 A;  1SQP K;  1MV8 A;  3HE5 A;  2XKM A;  5AW1 B;  1G2C B;  4I1L A;  1LTB C;  5AW8 B;  1S9K D;  4XE5 B;  3P8C E;  1SFC D;  1FBM A;  1HTL C;  3M0D A;  1XTG B;  1IFD A;  3GHG B;  5APX A;  3VYI A;  3HUS A;  1LWU C;  4KHX A;  5CHX A;  3RK2 C;  1AFO A;  2W6B A;  3II6 A;  1N7S B;  4IFD K;  1LTT C;  3RK3 C;  3O8Z A;  1FZA A;  1L4A D;  1SQX K;  4WY4 A;  1GDT A;  4OH8 B;  1QL1 A;  1RF1 A;  1DH3 A;  1NWQ A;  1IJD B;  4ZKU A;  2HYN A;  4N6J A;  1FZB A;  5AVY B;  2FYU K;  1HBW A;  3RL0 C;  1IFM A;  3M9H A;  2WPS A;  4M3L A;  2HOD A;  3TYY A;  2A45 I;  2C9L Y;  4C7R A;  1Z56 A;  1G2C A;  1NTK K;  2MJZ A;  1L0N K;  2QM7 A;  1LTJ C;  1MZ9 A;  1VPC A;  2ZFC A;  1KIL C;  4DOJ A;  1M1J B;  2N1T A;  1DX7 A;  3C9I A;  1JNM A;  1N7S A;  4I2L C;  1HH0 A;  1X79 B;  4EOT A;  3HD7 D;  2C0W A;  1M7L A;  5CJ0 A;  1GZL A;  1YTZ I;  3TK1 A;  1IK9 A;  3V4W A;  4N78 E;  2H43 A;  1CW5 A;  2Z5I A;  2FFD C;  1URQ A;  2OYH B;  4JYC A;  3KPE A;  3LIE A;  1GU4 A;  2E43 A;  3HD7 B;  3R2P A;  2BAS A;  3BAT A;  2E42 A;  1GL2 B;  2CPB A;  3IR9 A;  1GW3 A;  1J1E C;  1MUU A;  3N7N A;  4WBA A;  5CCG C;  5AW6 B;  2O1J A;  1IC2 A;  1IFI A;  2FYZ A;  3H6P A;  3OJA B;  3KDP B;  1ZLL A;  3BRT B;  2W27 A;  3A2A A;  3V2P A;  5AVR B;  1OXZ A;  2L5G B;  5AVQ B;  1W2E A;  3M9Q A;  1T2K C;  1FZE A;  4WB4 A;  1RE4 A;  5AW9 B;  1GW4 A;  1X8Y A;  1L0L K;  3V2Q A;  1SLQ A;  1E5W A;  1LTI C;  1RE3 C;  1A02 F;  1HGZ A;  2WPR A;  2WT7 B;  2Q9I A;  1JY3 O;  2GUS A;  2NPS A;  3MUD A;  1RF0 C;  2OYH A;  3M0A A;  2XU6 A;  3EFG A;  1FAV A;  3OA7 A;  2W6A A;  3MGN A;  1LWU B;  1NTM K;  2M3B A;  3VMZ A;  1X9V A;  3M06 A;  5KTB A;  3NFQ A;  1FZC C;  1GL2 A;  3KQG A;  1CI6 B;  2OAR A;  1JUN A;  1FJP A;  4Y99 C;  1RF1 B;  1NU1 K;  1NAF A;  1PFI A;  4IFM A;  1N73 C;  2LKM A;  2O01 H;  3B5N C;  2FXM A;  2N1T D;  3V2R A;  2HOD B;  1N7S D;  3MD0 A;  4XA4 A;  3RL0 B;  2OYI C;  3OAK A;  4I6M C;  2HPC A;  2GUV A;  5APQ A;  5BU5 A;  2HLO A;  1GK6 A;  2I1J A;  4N3Y B;  2WT7 A;  1FJK A;  1URQ D;  2J59 M;  2QM8 A;  1LTJ B;  2N1T B;  5AVX B;  3VTP C;  1JY2 N;  2Q7C A;  3VMX A;  4DZO A;  5AW3 B;  3NTN A;  3SWF A;  1LWU A;  5AW2 B;  1JY3 P;  1JY2 O;  1HJB A;  1CI6 A;  1JOC A;  1URQ B;  2JEE A;  3VMY A;  1CZQ A;  2H8P D;  2H7H A;  2HFE D;  4AUW A;  2FFD B;  1J1D B;  1JCD A;  4LGD E;  1S9K E;  2GM4 A;  1J1E B;  4C46 A;  1NKZ B;  3VOP A;  3IFM A;  2KP8 A;  3CI9 A;  1ZV8 A;  2NPS D;  5KJ7 C;  5AVV B;  3U59 A;  3VP8 A;  1XTC C;  5KLV K;  1LTJ A;  5AW5 B;  1KIL A;  1FDM A;  3MTU E;  1GL2 D;  3PP5 A;  1AQ5 A;  1GU5 A;  1SP4 A;  4GT1 A;  2NPS B;  5AVS B;  3N4X A;  2R5B A;  3GHG C;  2XNX A;  4O9B A;  3LW5 H;  2FFD A;  3A5T A;  3V2N A;  5CCH C;  2YKQ A;  1SFC C;  1FZC B;  3P8M C;  3UIA A;  1GTW A;  5AVZ B;  2HG5 D;  2WPQ A;  3HTK B;  5CCG A;  3A3Y B;  1SVF A;  1ZR4 A;  2JJL A;  2Z4E A;  3P32 A;  3L37 A;  1L4A C;  3B5N B;  2HPC B;  3RK2 D;  1A02 J;  1KFN A;  3RK3 D;  4C7N A;  1RE3 A;  3TNU B;  2XDJ A;  5APW A;  1M1J C;  1ZN5 A;  5APT A;  1RF0 A;  3RK2 B;  2A45 G;  3RK3 B;  1OWA A;  3V4Q A;  3I5C A;  1FZC A;  2PP6 A;  3RL0 D;  2YO3 A;  1SQQ K;  1J2J B;  2KOG A;  2KYV A;  3HTK A;  3P8C D;  4AYC A;  5BU8 B;  2XZR A;  3HD7 C;  1FZG A;  2YNY A;  4GKG A;  3LID A;  1N73 A;  1KIL D;  3H32 B;  1G1I A;  3B5N A;  3U1A A;  4LLH A;  4JYB A;  5AW0 B;  4HYT B;  1H88 A;  1QL2 A;  1HGV A;  2OYI A;  1NKN A;  1FOS F;  3WMM 0;  2KB7 P;  1JO5 A;  4W7Z A;  2WSC H;  1NTZ K;  3G3Z A;  5AW4 B;  5BVZ A;  3TNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...