3RK3B

Truncated snare complex with complexin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
62
structure length
62
Chain Sequence
b'GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vamp2
molecule tags Membrane protein/exocytosis
source organism Homo sapiens
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
total genus 29
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk3B00
2N1TA 2XDJA 1SFCA 3RK3D 1URQA 3RK2C 5KJ7D 4LGDE 1GL2D 2NPSD 3RL0B 1KILA 4WY4D 5CCHC 5CCGC 1XTGB 2NPSC 4WY4B 3RL0C 1JTHB 3TSIA 3HTKB 1KILC 3RL0D 1GL2B 1L4AC 2H8PD 3M0DC 3RK3B 2WZ7A 1SFCB 2KOGA 5CCHD 3HD7D 1HVVA 3KYQA 1URQD 5KJ7A 4WY4C 3P8CE 1KILB 1GL2A 2NPSA 1N7SD 3B5ND 3VOPA 4N78E 4W7YA 1JTHA 2HFED 5CCGA 1KILD 3RK2B 1NHLA 1L4AA 2N1TD 1SFCD 2YMYA 1URQC 2PP6A 3HD7C 4WY4A 3PP5A 2N1TB 3RK3C 1N7SC 3B5NC 5CCHA 3RK2D 2M8RA 4JF7A 1T3JA 4W80A 1L4AB 2HG5D 1N7SA 3B5NA 1N7SB 3B5NB 4W7ZA 4OH8B 2N1TC 1SFCC 2NPSB 5CCGD 1URQB 5KJ7C 3HD7B 3HD7A 1GL2C 1L4AD
chains in the Genus database with same CATH superfamily
1S1CX 1URQA 5E79H 3Q5RA 1JY2O 2AXCA 1L0ND 2QG4A 5E79E 5KJ7D 3WUTA 3D6YA 2A45I 3IR9A 3L37A 1PP9E 2R3CA 2ZVNB 3L72D 5KLVE 5TISH 3H1JJ 1KC8Q 1FOSF 1KTMA 4N78D 4HYTB 3H1LD 1LT9A 2Q1KA 2WSFH 3L72J 5AW5B 2W6JH 3A0BH 2WT7B 4JYBA 1KN7A 1VF5D 5AW2B 1OVRA 3PHLA 3PRJA 3BCCD 5H2FH 1KB9I 4WY4D 3WU2E 1VPCA 2QJKB 3CCQP 1MKMA 3O6QA 4IL6X 1J1DC 2FXPA 4QMAA 4C46A 5KAFH 1VF5C 4U3FE 1KYOH 2W8ZA 4YTPC 1KQFB 3W68A 2Z5HA 2YO3A 4R4MA 4H0LC 2NPSC 3KPEA 4RO0A 3E1RA 5AVYB 5KLVK 1AA0A 3AEGC 4GDOA 3CMEP 1MUUA 3EFGA 1SQXG 1EZVG 1NAYA 3VMXA 1IFJA 1NH4A 2KUBA 4RJTA 5AVSB 5KKZB 2GUSA 2QJPC 3L73E 1A02F 1EDJA 1G1IA 1JY3P 1X0TA 2OTKE 2N9BA 1S5LX 3R4YA 5GTHH 1USDA 3CX5E 4UB6E 2AEFA 3QH9A 3HTKB 2M5AB 1S9KE 1OVUA 2N9YB 3KZIH 1FBMA 1GL2B 2C0XA 3AE9C 1GW4A 1N73A 2LKMA 3V6IA 4RESB 3HRNA 5AW4B 4I2LC 1WMKA 1IFDA 4BXLA 5CCHD 1BCCG 3CX5H 1QL2A 1KQLA 1OX3A 2Y0DA 3HD7D 2RMZA 3S1KA 2JR8A 5KKZC 2QVAA 5AVWB 1FZCA 4ZMDA 2ZXXA 2E75B 3CLQA 5KJ7A 1YITP 1M1KQ 3FXEA 1KILB 3MZWB 2B9BA 1N73B 4IL6H 1GDTA 2KI7B 3FGAD 1BGYD 3MUDC 3D6ZA 3CCLP 3NFQA 1SQQK 3KQGA 4AQRD 2GA1A 4H13B 1KYOE 3H1HG 2BEZF 3W67A 1BGYJ 1N86A 3Q3DA 3HE4B 2HFED 3L75G 4GKGA 2PRRA 2H43A 3H1KG 5H2FE 4C7RA 2BCCJ 2FBWC 2Q3EA 3USSA 2E42A 1BE3E 1NU1D 3L35A 1NHLA 2G3AA 4WVZA 1M1JB 4I6MC 2JWAA 1PPJE 2M0BA 1LT1A 2N1TD 1OWAA 4L73A 2AXTE 2L91A 3O6QB 3N7NA 1QEXA 4JYCA 2YMYA 1Q81Q 2LXCB 1K9MQ 3JSVC 2IDBA 4U7JA 1VQ7P 3CXHI 2H88C 1MFTA 1GTWA 2PP6A 3L71J 4EIJA 2KNCA 2WT7A 4D6TG 3VMZA 3CCJP 1HBWA 5APTA 2KNCB 3Q5SA 2A06D 3D70A 5TJHA 4WY4A 1M1JC 1NTKK 4RKUJ 3H1LJ 3NMDA 2BASA 2E76C 3GF3A 4YPCA 2N1TB 2POHA 3RK3C 1HWTC 5B5EH 5CCHA 2OYIA 4Y28J 1NTMJ 2L5GB 1BCCJ 4JF7A 1PIXA 1SVFA 3TGUG 1M90Q 1KFNA 1SQVJ 1SQPJ 5AVXB 3EWKA 3T97A 2FYUG 2E76B 2FXOA 2Y0EA 3H1JG 4DJGA 1SQBJ 4GOEA 3WUVA 5B66E 1H88A 4HKZH 4BRYA 1SQPD 3CWBE 3NTNA 1J1DB 1N7SA 3M9HA 1G2CA 2RN0A 1ZR4A 1CW5A 1NTZE 1R5LA 4OH8B 5KAFE 2A45G 3CC7P 1FZEA 1IC2A 2N1TC 3KDPB 2Q5UA 1SFCC 1HH0A 2K9JB 2WQYC 2CPBA 3CXHD 2XNDH 4IFFA 5APYA 4A7PA 2QIWA 1SQXJ 1YQ3C 5CMZA 3A0BE 1RF1C 4EYYQ 4OWFA 3R2PA 1VQ8P 1VQ9P 1GL2C 1PGJA 1H0TB 2N1TA 2I8DA 2ZVOB 3CX5I 2K88A 2P58A 4LC1A 5AW6B 5GTHE 1EDIA 1AVOA 3MGNA 1TU3F 2KZIA 3A0HH 4L75A 1GL2D 4YXWH 2C9LY 1L0NJ 2VRSA 4D6TD 2W6BA 2UWJE 2W83C 3Q1MA 1JB0J 1PFIA 3LW5J 4DCKA 3GHGA 2YNYA 3AEDC 1CI6B 1L0LK 1ZW0A 1PV3A 3IFMA 5AVVB 2E5YA 2IYOA 2XNXA 3MTUE 1OW8A 5CCGC 1VQOP 1N2DC 3L72G 1PPJD 3HUSC 3S4RA 3PLNA 4EDFA 2C0WA 2O01H 3MUDA 5APWA 1M1JA 4PD4H 1T8ZA 1Y9BA 1L0NG 1BE3D 1XTGB 2KSEA 2QE7H 3GMAA 1Q7YQ 1GK6A 3VN0A 1Q86Q 2ZYAA 3RL0g 1YTZT 1NWQA 3M0AA 1FZCC 3L70J 4C7NA 1SQVD 3HE4A 1SQPG 3AE7C 1JTHB 1KYOD 2J5UA 2KLVA 1NU1K 2V7QH 1SQBD 1GZLA 2YKQA 3OW2O 4WBAA 1BGYE 1Q2NA 3TYYA 3CC4P 1T2KD 3L71D 1P84I 4KT0J 1VQLP 1SQQE 1SQBG 4L74A 4B86A 1LTBC 2OQQA 1FZBA 3AE2C 1SQVG 2B89A 3C9IA 5AVRB 1SQXD 3M0DC 2WZ7A 5AW0B 5KAIE 2O3JA 1QVGO 4UB6H 1FDOA 1NTME 2AEJA 4KJMA 1M8OB 2LXBA 3GLMA 1HVVA 1BDDA 3Q5PA 1AVYA 1KMIZ 2A45H 1IO4A 5CJ4A 1AJYA 1RE3C 3L71G 2FYNC 1JOCA 2IBZI 4PD4I 1YQ4C 2NRGA 3GF7A 1JMBA 3AEAC 1GL2A 1S72P 1IFMA 2HPCB 1S9KD 1SS1A 1SQQJ 3H32B 2OYHB 1LNQA 3B5ND 1NAFA 3CX5D 1FC2C 3OA7A 1JCDA 1RQUA 1JCCA 1KORA 1RE3A 1JY3N 2DW3A 2NZ2A 3H1LG 3LIEA 3M9QA 1KILD 4ZKUA 3WU2H 4U3FG 1JY2N 1KQGB 1KYOI 1RF0C 2E75D 2K1AA 1NTMG 3L73J 4ASWA 1GD2E 2H7HA 1FJPA 3L75J 2Q7CA 4HB1A 5APUA 5L8RJ 3TF5A 2W6AA 2Z5IA 2BCCD 3FWLA 3GHGC 3M06A 5DJTB 3H1HJ 1ZRTE 4N3YB 3I5CA 4U3FD 3L75E 2Q3IA 1Q90D 1BE3J 5KLVG 1R8EA 5TISE 3H1HD 1WT6A 1D7MA 1RF1B 1OXZA 2BCCG 4Y99C 2WSEJ 1BGYG 4PV1B 5C39A 1EDLA 2E74B 2B87B 5APQA 5KLVJ 3CCVP 3S9OA 3B8EB 2MJZA 4ZNCA 1KD1Q 1EC5A 1NTZK 3SWKA 3AEBC 2KZJA 2QRXA 2Q6QA 3H1LE 2FFDB 2M3EA 3HD7C 1ZXGA 2IBZD 3BRTB 4C7NB 1PP9D 3L72E 4PV1D 1VQPP 3AEEC 2FKWB 3BASA 1L0NE 1CZQA 3P32A 3TNUA 1DEBA 1BCCE 1J2JB 3L70G 1VQMP 2E75C 3B5NC 4K3AA 1YTZI 3CI9A 4PJ0E 4EI2A 2M8RA 3M0DA 3VP9A 1GMJA 3C8VA 1KQSO 1U7JA 1KFMA 1BCCD 1LT9C 1EDKA 5GTIE 2AEMA 4GT1A 4DT0A 2JKVA 3VP8A 2IBZE 2OYIC 3EFFK 1SQQG 1SLQA 4GODA 4W7ZA 3B5NB 1NKNA 1RQVA 1M56D 1RHZB 4PD4D 1K73Q 4R4LA 1GU5A 1JO5A 1K04A 3B4SA 3L70E 1GU4A 1R5SA 1P84H 2KLUA 2IYPA 3H1HE 2J59M 4UB8H 1K8AQ 2QM7A 2YKOA 1E79H 2IFMA 3L75D 1L4AB 1ZRTD 3HUSA 2JJLA 4NPFX 2YXRB 3V4QA 5CBNA 2BCCE 1T2KC 1MFZA 1SFCA 1RY3A 3RK3D 3RK2C 3CXHH 3SWFA 1NTZJ 4LGDE 1FE6A 2A06G 2WSCJ 2W27A 3JC22 1KILE 2ZFCA 4JPZB 3RL0B 5BVZA 2E43A 3OAKA 1OZHA 3HTKA 5EFWB 4MN4C 4CPGA 2OGUA 3F89A 4L76A 5AVTB 1BDCA 5BU8B 4AYCA 4DZOA 1DD3A 4N6JA 3SFDC 3TK1A 1ZP0C 3JCUH 2OTLP 3VMAA 3LIDA 2OARA 1DD4A 2YXQB 1VQ5P 2V4HA 1EZVE 1NTKD 2ZAEB 2OYIB 1LTSC 4IFMA 3H1ID 1NTMD 2JEEA 3RBZA 3N4XA 2WSFJ 5APSA 3G4SP 3TNUB 1SQXE 3A2AA 3WMM0 2FYUK 2MKVA 1YYCA 1Q82Q 4Z1MH 1EQ7A 1SQQD 2P10A 3L71E 1NGMB 1T6AA 3CWBJ 2HR3A 3AE8C 1VQKP 1LT9B 2B87A 1SQBE 1KILC 3KXDA 4XFJA 3L36A 3U59A 1X79B 3V2NA 3P8CD 5CBOA 2E74D 3AECC 1SQVE 2H8PD 4H44D 1QLED 2KIKA 1YJWP 4KHXA 2Y9YA 3MHVA 2K37A 1E5WA 1AV1A 2O01N 2Y9ZA 3TGUE 1ZR2A 1YHQP 1LTGC 4ASVA 3CC2P 3ITKA 1S4XA 2V7QJ 1N8RQ 2WTYA 1PP9G 1XTCC 3KYQA 5AW3B 1JY3O 2FY8A 1URQD 1FZFA 2YO2A 4JQ0D 2IPPA 4WY4C 3VMYA 2LR2A 2NPSA 1NOHA 3AE6C 3SWYA 1KZUB 1S5LE 3CD6P 4AUWA 1IFIA 5CJ0A 1KB9H 3VOPA 3IAOA 4W7YA 4OGQD 2E76D 1IZNB 4D6TE 1L0LG 1LTIC 1FZAA 3MD0A 2IX7C 1S3JA 2RKLA 1LJ2A 4NPDA 2D2CC 2JWDA 3BATA 1EXJA 1FU1A 2M3BA 1L0NK 1OFCX 2GUVA 1L4AA 2FYUJ 3ABVC 1KB9D 1L2PA 3FXDA 1SFCD 3HUSB 1S5LH 3RGUA 1OMIA 1W5CE 3I55P 2R5DA 2BEQD 4EOTA 1RF0A 4U3FJ 2FFDC 3IF4A 3H6PA 1ZMEC 1BE3G 1URQC 2HODA 3CXHE 2W90A 1X22A 1NU1G 3V2RA 3H1JD 3IN6A 1N7LA 1L0LJ 3CCRP 1JMMA 1RE4C 4ZKPA 2P67A 2PFXA 3G71P 1NTZD 4YXDC 1VQNP 5KAIH 1CSBA 1LTTC 3K5BA 3CWBD 1SQPE 4BRYB 2ZT9D 4TT3H 4UB8E 1SQBK 1ZLLA 1RH5B 1P84E 2Z4EA 1NO4A 3II6A 1SQVK 2HODB 5AVUB 1HGZA 3T97B 2ZYDA 2P7JA 1X8YA 3MIWA 1PGPA 2KS1A 2KYVA 1RE4A 3E1IA 3PP5A 3SSUA 1ZV8A 1LTAC 4I1LA 2Q9IA 4K35A 1USEA 2QM8A 1M57D 3CWBG 1PZQA 1U57A 3FX0A 3VYIA 5BU5A 1MZ9A 1M7LA 1NTKJ 4WB4A 4OGQC 1T3JA 4WWIA 4W80A 2B88A 3H1IJ 3PTZA 2WPSA 4BWNA 1HF9A 1SQXK 3AE3C 4OGQB 1HJ0A 3L74D 1NVOA 4H13D 3CMAP 2A06E 2QJPB 1JNMA 3B5NA 4PJ0H 5AVQB 2JP3A 3H1KJ 3L74J 4HH2A 3L4FA 3L74E 5CHXA 3ZDMA 1FZCB 1YJNP 1LTJC 1LWUC 2ITAA 2G8YA 2I1JA 2NPSB 3AE5C 1NTMK 3U1AA 4DOJA 1URQB 2J58A 1YJ9P 2D2CD 5M1BA 1RF1A 1YI2P 1LP1B 2E5TA 1H0TA 3AE4C 2YIUC 5KLIC 3HD7B 2R5BA 1AFOA 2OYOA 1ZN5A 2WPRA 2KP8A 3AEFC 3BCCG 1QGKB 1NU1E 2XDJA 1OVVA 1OW7A 2E74C 3HE5A 5AW1B 3UIAA 3V4WA 4Y99B 2K9JA 2D2CB 2ZXEB 3GW6A 3MP7B 4PV1C 1P84D 1PPJG 3B71A 5DJUB 2NPSD 1G1JA 3A3YB 2O01J 3NXSA 1NTZG 2HLOA 2WWWA 2FFDA 2KB7P 1J1EB 2R3SA 3E7KA 2WITA 1SP4A 3TDKA 3BCCJ 2JO1A 3G3ZA 1HTLC 1YBKA 4OVNF 2WPVB 3H1JE 3H32A 3P7KA 3CPWO 4GIFA 1OIPA 2OYHA 1KILA 1PGQA 2SPZA 1J1EC 1IJDB 4XE5B 5AW9B 4I7ZB 1GW3A 5CCHC 3H25A 2WMMA 1KV4A 2XKMA 4H13C 2WSCH 1HGVA 1KB9E 1X9VA 3G9RA 1JM0A 2O1KA 2FXMA 2K3RA 1K05A 1IFNA 3SFEC 3KHUA 4IOIH 5KTBA 1A02J 4O9BA 5B66H 1EXIA 1LGHB 2RH0A 1Y8AA 3WUUA 3U1CA 2XV5A 3G6EP 2K9YA 4WY4B 3V2QA 3V5BA 3RL0C 3A5TA 3TSIA 1VDFA 2I1KA 2ZT9B 3F5HA 3CCMP 2PAJA 1UIXA 3PH0A 3M91A 2QEXP 1T3UA 3VTPC 1IFPA 4M3LA 2OTJP 3H1IG 3L73D 2ZT9C 3GG2A 1L4AC 2YMKA 3RL0D 4LLHA 3L74G 4HJGH 3Q2YA 2C9NY 1NTKG 2JDIH 5AVZB 2IZ1A 1NYHA 3RK3B 5K5GB 1AQ5A 3HE5B 1SFCB 2KOGA 1ZOYC 1Z56A 1QX8A 1FAVA 3TGUD 1NKZB 5AW7B 3I56P 2FYZA 3TGUJ 1QVFO 3D71A 1H8AA 4NPEA 3QWOC 1IK7A 3BRVB 3P8CE 1HJBA 1BSHA 1DIPA 3BCCE 3GHGB 1N7SD 2QSIA 2XZRA 4H44C 1AQTA 1FZGA 3BVHA 1GK4A 1PP9J 4IFDK 4N78E 3P8MC 1JTHA 2WSEH 2IBZG 3CL3D 4GOFA 5CCGA 5KLVD 1PGOA 2QJKC 1DX7A 1MV8A 2WPQA 1VL2A 3JCUE 4TLFA 2HYNA 2IZ0A 5CCGD 4H0LB 2KK7A 3RK2B 3H1IE 2OYHC 1Y47A 1YIJP 2FYUE 3CCUP 1EZVD 1NTKE 1IK9A 2IFNA 2GM4A 2YIUB 5KLIB 4I7ZC 1FDMA 3V2PA 2XU6A 2H89C 2KS1B 1FJKA 2PGDA 3A0HE 1CI6A 4H44B 1U7MA 2M5AA 2ZJSE 3C1LA 4D6TJ 1UIIA 1JY2P 2AXTH 2P1JA 2R32A 3H1KD 1L0LD 5AW8B 3O8ZA 1QL1A 3M9BA 4XA4A 1OW6A 3EQ2A 1LTJA 1LWUA 1HUCA 2KSJA 3A7OA 1S2EA 2Y0CA 2WVRA 3FWNA 2ZYGA 3OJAB 3RK3E 2QA4P 3CCEP 1N7SC 1FOSE 1FDIA 1NU1J 1JUNA 2QJYB 3RK2D 4H0LD 1VQ4P 2CPSA 5GTIH 1LTJB 1FS0E 1LWUB 3L70D 4IL6E 1W2BO 3RBXA 1N73C 1H89A 1DH3A 4PD4E 1SQPK 1VF5B 2HG5D 1DEEG 1EZVI 2FYNB 2O1JA 1G2CB 2YKPA 1L0LE 1N7SB 4JBZA 3H1KE 5APXA 3L73G 5B5EE 1NJIQ 1PL5A 3AE1C 2CK3H 2HPCA 1WRGA 3CCSP 2R44A 2P2UA 2QJYC 1W2EA 1VQ6P 2WSSH 2KXPB 3LW5H 5APVA 3PJSK 3KZIE 3HD7A 1JEKA 5KJ7C 1BSNA 2FYUD 1LP1A 1L4AD
chains in the Genus database with same CATH topology
1URQA 1JY2O 5KJ7D 2A45I 3IR9A 3L37A 1FOSF 2R3CA 4N78D 4HYTB 1LT9A 2WSFH 2WT7B 5AW5B 4JYBA 5AW2B 4WY4D 1VPCA 1J1DC 4C46A 2Z5HA 2YO3A 2NPSC 3KPEA 5AVYB 5KLVK 1MUUA 3EFGA 3VMXA 1IFJA 1NH4A 1A02F 5AVSB 2GUSA 1G1IA 1JY3P 2N9BA 3HTKB 1S9KE 1FBMA 1GL2B 2C0XA 1N73A 1GW4A 2LKMA 4RESB 3HRNA 5AW4B 4I2LC 1IFDA 5CCHD 3HD7D 1QL2A 1KQLA 5AVWB 1FZCA 3CLQA 5KJ7A 1N73B 1KILB 1GDTA 3NFQA 1SQQK 3KQGA 4AQRD 1N86A 3HE4B 2HFED 4GKGA 2H43A 4C7RA 2E42A 3L35A 1NHLA 1M1JB 4I6MC 2N1TD 1OWAA 4JYCA 3N7NA 2YMYA 1GTWA 2PP6A 4EIJA 2WT7A 1HBWA 3VMZA 5APTA 4WY4A 1M1JC 1NTKK 2BASA 2N1TB 2POHA 3RK3C 1HWTC 5CCHA 2OYIA 2L5GB 4JF7A 1SVFA 1KFNA 5AVXB 3T97A 1H88A 3NTNA 1J1DB 1N7SA 3M9HA 1G2CA 1ZR4A 1CW5A 4OH8B 2A45G 1FZEA 1IC2A 2N1TC 3KDPB 2Q5UA 1SFCC 1HH0A 5CCGD 2CPBA 4IFFA 5APYA 5CMZA 1RF1C 3R2PA 1GL2C 2N1TA 4LC1A 5AW6B 3MGNA 1GL2D 2C9LY 2VRSA 2W6BA 1PFIA 3GHGA 2YNYA 1CI6B 1L0LK 3IFMA 5AVVB 2XNXA 3MTUE 5CCGC 1N2DC 3HUSC 2C0WA 3MUDA 2O01H 5APWA 1M1JA 1T8ZA 1XTGB 1GK6A 3VN0A 1NWQA 1YTZT 3M0AA 1FZCC 4C7NA 3HE4A 1JTHB 2KLVA 1NU1K 2YKQA 1GZLA 4WBAA 3TYYA 1T2KD 4B86A 1LTBC 1FZBA 1FZCB 5AW0B 3C9IA 5AVRB 3M0DC 2WZ7A 1HVVA 2A45H 1IO4A 5CJ4A 1RE3C 1JOCA 1GL2A 1IFMA 2HPCB 1S9KD 3H32B 2OYHB 3B5ND 1NAFA 3OA7A 1JCDA 3M9QA 1JCCA 1RE3A 3LIEA 1JY3N 4ZKUA 1KILD 1JY2N 1RF0C 1GD2E 2H7HA 1FJPA 2Q7CA 5APUA 2W6AA 2Z5IA 3M06A 3GHGC 4N3YB 3I5CA 2Q3IA 1RF1B 1WT6A 1OXZA 4Y99C 5APQA 3B8EB 2MJZA 1NTZK 2FFDB 3HD7C 3BRTB 4C7NB 2FKWB 3BASA 1CZQA 3P32A 3TNUA 1DEBA 1J2JB 3B5NC 1YTZI 3CI9A 2M8RA 3M0DA 3VP9A 1KFMA 1LT9C 4GT1A 3VP8A 2OYIC 1SLQA 4W7ZA 3B5NB 1NKNA 1JO5A 1GU5A 2J59M 2QM7A 2YKOA 2IFMA 1L4AB 3HUSA 2JJLA 3V4QA 1T2KC 1MFZA 1SFCA 1RY3A 3RK3D 3RK2C 3SWFA 4LGDE 2W27A 2ZFCA 3RL0B 5BVZA 2E43A 3OAKA 3HTKA 5AVTB 5BU8B 4AYCA 4DZOA 4N6JA 3TK1A 3LIDA 2OARA 2OYIB 1LTSC 4IFMA 2JEEA 3N4XA 5APSA 3TNUB 3A2AA 3WMM0 2FYUK 1YYCA 1EQ7A 1LT9B 3V2NA 1KILC 3U59A 3L36A 1X79B 3P8CD 2H8PD 4KHXA 1E5WA 1ZR2A 1LTGC 2WTYA 1XTCC 3KYQA 5AW3B 1FZFA 1JY3O 1URQD 2YO2A 4WY4C 2IPPA 3VMYA 2NPSA 1NOHA 3SWYA 1KZUB 4AUWA 1IFIA 5CJ0A 3VOPA 4W7YA 1LTIC 3MD0A 1FZAA 2IX7C 3BATA 1FU1A 2M3BA 1L0NK 2GUVA 3HUSB 1L4AA 1SFCD 2GM4A 4EOTA 2FFDC 2R5DA 1RF0A 3H6PA 1URQC 2HODA 3V2RA 1N7LA 1JMMA 1RE4C 4ZKPA 2P67A 1CSBA 1LTTC 1SQBK 1ZLLA 2Z4EA 3II6A 1NO4A 1SQVK 2HODB 5AVUB 1HGZA 2P7JA 1X8YA 3MIWA 3PP5A 2KYVA 3E1IA 1RE4A 1ZV8A 1LTAC 4I1LA 2Q9IA 2QM8A 3VYIA 5BU5A 1MZ9A 1M7LA 4WB4A 1T3JA 4W80A 2WPSA 1SQXK 1JNMA 3B5NA 5AVQB 4HH2A 3L4FA 5CHXA 1LTJC 1LWUC 4DOJA 2I1JA 2NPSB 1NTMK 3U1AA 1URQB 2J58A 1RF1A 3HD7B 2R5BA 1AFOA 2WPRA 1ZN5A 2KP8A 5AW1B 2XDJA 3HE5A 3UIAA 3V4WA 4Y99B 2ZXEB 2NPSD 1G1JA 3A3YB 3NXSA 2HLOA 2WWWA 2FFDA 2KB7P 1J1EB 2WITA 1SP4A 3G3ZA 1HTLC 1L4AD 3P7KA 3H32A 2OYHA 4GIFA 1KILA 4XE5B 1J1EC 1IJDB 5AW9B 1GW3A 5CCHC 2XKMA 2WSCH 1HGVA 1X9VA 5KTBA 2O1KA 2FXMA 1A02J 1IFNA 4O9BA 1LGHB 3U1CA 2XV5A 4WY4B 3V2QA 3V5BA 3RL0C 3A5TA 3TSIA 1VDFA 2I1KA 2PAJA 3M91A 1T3UA 3VTPC 4M3LA 3RL0D 2C9NY 1L4AC 4LLHA 5AVZB 3RK3B 1AQ5A 3HE5B 1SFCB 2KOGA 1Z56A 1FAVA 1NKZB 5AW7B 2FYZA 1H8AA 3BRVB 3P8CE 1HJBA 3GHGB 1N7SD 2XZRA 1FZGA 3BVHA 1GK4A 4IFDK 4N78E 3P8MC 1JTHA 3CL3D 2WSEH 5CCGA 1DX7A 1MV8A 2WPQA 2HYNA 3RK2B 2OYHC 1IK9A 2IFNA 1FDMA 3V2PA 2XU6A 1FJKA 1CI6A 1JY2P 2P1JA 2R32A 5AW8B 3O8ZA 1QL1A 3M9BA 4XA4A 3EQ2A 1LTJA 1LWUA 1HUCA 2KSJA 3A7OA 3OJAB 1N7SC 1FOSE 1JUNA 3RK2D 2CPSA 1LTJB 1LWUB 1N73C 1H89A 1DH3A 1SQPK 2HG5D 2O1JA 2YKPA 1G2CB 5APXA 1N7SB 2HPCA 1WRGA 2P2UA 1W2EA 3LW5H 5APVA 5KJ7C 3HD7A 1GU4A 3NMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T A;  2XDJ A;  1SFC A;  3RK3 D;  1URQ A;  3RK2 C;  5KJ7 D;  4LGD E;  1GL2 D;  2NPS D;  3RL0 B;  1KIL A;  4WY4 D;  5CCH C;  5CCG C;  1XTG B;  2NPS C;  4WY4 B;  3RL0 C;  1JTH B;  3TSI A;  3HTK B;  1KIL C;  3RL0 D;  1GL2 B;  1L4A C;  2H8P D;  3M0D C;  3RK3 B;  2WZ7 A;  1SFC B;  2KOG A;  5CCH D;  3HD7 D;  1HVV A;  3KYQ A;  1URQ D;  5KJ7 A;  4WY4 C;  3P8C E;  1KIL B;  1GL2 A;  2NPS A;  1N7S D;  3B5N D;  3VOP A;  4N78 E;  4W7Y A;  1JTH A;  2HFE D;  5CCG A;  1KIL D;  3RK2 B;  1NHL A;  1L4A A;  2N1T D;  1SFC D;  2YMY A;  1URQ C;  2PP6 A;  3HD7 C;  4WY4 A;  3PP5 A;  2N1T B;  3RK3 C;  1N7S C;  3B5N C;  5CCH A;  3RK2 D;  2M8R A;  4JF7 A;  1T3J A;  4W80 A;  1L4A B;  2HG5 D;  1N7S A;  3B5N A;  1N7S B;  3B5N B;  4W7Z A;  4OH8 B;  2N1T C;  1SFC C;  2NPS B;  5CCG D;  1URQ B;  5KJ7 C;  3HD7 B;  3HD7 A;  1GL2 C;  1L4A D; 
#chains in the Genus database with same CATH topology
 1S1C X;  1URQ A;  5E79 H;  3Q5R A;  1JY2 O;  2AXC A;  1L0N D;  2QG4 A;  5E79 E;  5KJ7 D;  3WUT A;  3D6Y A;  2A45 I;  3IR9 A;  3L37 A;  1PP9 E;  2R3C A;  2ZVN B;  3L72 D;  5KLV E;  5TIS H;  3H1J J;  1KC8 Q;  1FOS F;  1KTM A;  4N78 D;  4HYT B;  3H1L D;  1LT9 A;  2Q1K A;  2WSF H;  3L72 J;  5AW5 B;  2W6J H;  3A0B H;  2WT7 B;  4JYB A;  1KN7 A;  1VF5 D;  5AW2 B;  1OVR A;  3PHL A;  3PRJ A;  3BCC D;  5H2F H;  1KB9 I;  4WY4 D;  3WU2 E;  1VPC A;  2QJK B;  3CCQ P;  1MKM A;  3O6Q A;  4IL6 X;  1J1D C;  2FXP A;  4QMA A;  4C46 A;  5KAF H;  1VF5 C;  4U3F E;  1KYO H;  2W8Z A;  4YTP C;  1KQF B;  3W68 A;  2Z5H A;  2YO3 A;  4R4M A;  4H0L C;  2NPS C;  3KPE A;  4RO0 A;  3E1R A;  5AVY B;  5KLV K;  1AA0 A;  3AEG C;  4GDO A;  3CME P;  1MUU A;  3EFG A;  1SQX G;  1EZV G;  1NAY A;  3VMX A;  1IFJ A;  1NH4 A;  2KUB A;  4RJT A;  5AVS B;  5KKZ B;  2GUS A;  2QJP C;  3L73 E;  1A02 F;  1EDJ A;  1G1I A;  1JY3 P;  1X0T A;  2OTK E;  2N9B A;  1S5L X;  3R4Y A;  5GTH H;  1USD A;  3CX5 E;  4UB6 E;  2AEF A;  3QH9 A;  3HTK B;  2M5A B;  1S9K E;  1OVU A;  2N9Y B;  3KZI H;  1FBM A;  1GL2 B;  2C0X A;  3AE9 C;  1GW4 A;  1N73 A;  2LKM A;  3V6I A;  4RES B;  3HRN A;  5AW4 B;  4I2L C;  1WMK A;  1IFD A;  4BXL A;  5CCH D;  1BCC G;  3CX5 H;  1QL2 A;  1KQL A;  1OX3 A;  2Y0D A;  3HD7 D;  2RMZ A;  3S1K A;  2JR8 A;  5KKZ C;  2QVA A;  5AVW B;  1FZC A;  4ZMD A;  2ZXX A;  2E75 B;  3CLQ A;  5KJ7 A;  1YIT P;  1M1K Q;  3FXE A;  1KIL B;  3MZW B;  2B9B A;  1N73 B;  4IL6 H;  1GDT A;  2KI7 B;  3FGA D;  1BGY D;  3MUD C;  3D6Z A;  3CCL P;  3NFQ A;  1SQQ K;  3KQG A;  4AQR D;  2GA1 A;  4H13 B;  1KYO E;  3H1H G;  2BEZ F;  3W67 A;  1BGY J;  1N86 A;  3Q3D A;  3HE4 B;  2HFE D;  3L75 G;  4GKG A;  2PRR A;  2H43 A;  3H1K G;  5H2F E;  4C7R A;  2BCC J;  2FBW C;  2Q3E A;  3USS A;  2E42 A;  1BE3 E;  1NU1 D;  3L35 A;  1NHL A;  2G3A A;  4WVZ A;  1M1J B;  4I6M C;  2JWA A;  1PPJ E;  2M0B A;  1LT1 A;  2N1T D;  1OWA A;  4L73 A;  2AXT E;  2L91 A;  3O6Q B;  3N7N A;  1QEX A;  4JYC A;  2YMY A;  1Q81 Q;  2LXC B;  1K9M Q;  3JSV C;  2IDB A;  4U7J A;  1VQ7 P;  3CXH I;  2H88 C;  1MFT A;  1GTW A;  2PP6 A;  3L71 J;  4EIJ A;  2KNC A;  2WT7 A;  4D6T G;  3VMZ A;  3CCJ P;  1HBW A;  5APT A;  2KNC B;  3Q5S A;  2A06 D;  3D70 A;  5TJH A;  4WY4 A;  1M1J C;  1NTK K;  4RKU J;  3H1L J;  3NMD A;  2BAS A;  2E76 C;  3GF3 A;  4YPC A;  2N1T B;  2POH A;  3RK3 C;  1HWT C;  5B5E H;  5CCH A;  2OYI A;  4Y28 J;  1NTM J;  2L5G B;  1BCC J;  4JF7 A;  1PIX A;  1SVF A;  3TGU G;  1M90 Q;  1KFN A;  1SQV J;  1SQP J;  5AVX B;  3EWK A;  3T97 A;  2FYU G;  2E76 B;  2FXO A;  2Y0E A;  3H1J G;  4DJG A;  1SQB J;  4GOE A;  3WUV A;  5B66 E;  1H88 A;  4HKZ H;  4BRY A;  1SQP D;  3CWB E;  3NTN A;  1J1D B;  1N7S A;  3M9H A;  1G2C A;  2RN0 A;  1ZR4 A;  1CW5 A;  1NTZ E;  1R5L A;  4OH8 B;  5KAF E;  2A45 G;  3CC7 P;  1FZE A;  1IC2 A;  2N1T C;  3KDP B;  2Q5U A;  1SFC C;  1HH0 A;  2K9J B;  2WQY C;  2CPB A;  3CXH D;  2XND H;  4IFF A;  5APY A;  4A7P A;  2QIW A;  1SQX J;  1YQ3 C;  5CMZ A;  3A0B E;  1RF1 C;  4EYY Q;  4OWF A;  3R2P A;  1VQ8 P;  1VQ9 P;  1GL2 C;  1PGJ A;  1H0T B;  2N1T A;  2I8D A;  2ZVO B;  3CX5 I;  2K88 A;  2P58 A;  4LC1 A;  5AW6 B;  5GTH E;  1EDI A;  1AVO A;  3MGN A;  1TU3 F;  2KZI A;  3A0H H;  4L75 A;  1GL2 D;  4YXW H;  2C9L Y;  1L0N J;  2VRS A;  4D6T D;  2W6B A;  2UWJ E;  2W83 C;  3Q1M A;  1JB0 J;  1PFI A;  3LW5 J;  4DCK A;  3GHG A;  2YNY A;  3AED C;  1CI6 B;  1L0L K;  1ZW0 A;  1PV3 A;  3IFM A;  5AVV B;  2E5Y A;  2IYO A;  2XNX A;  3MTU E;  1OW8 A;  5CCG C;  1VQO P;  1N2D C;  3L72 G;  1PPJ D;  3HUS C;  3S4R A;  3PLN A;  4EDF A;  2C0W A;  2O01 H;  3MUD A;  5APW A;  1M1J A;  4PD4 H;  1T8Z A;  1Y9B A;  1L0N G;  1BE3 D;  1XTG B;  2KSE A;  2QE7 H;  3GMA A;  1Q7Y Q;  1GK6 A;  3VN0 A;  1Q86 Q;  2ZYA A;  3RL0 g;  1YTZ T;  1NWQ A;  3M0A A;  1FZC C;  3L70 J;  4C7N A;  1SQV D;  3HE4 A;  1SQP G;  3AE7 C;  1JTH B;  1KYO D;  2J5U A;  2KLV A;  1NU1 K;  2V7Q H;  1SQB D;  1GZL A;  2YKQ A;  3OW2 O;  4WBA A;  1BGY E;  1Q2N A;  3TYY A;  3CC4 P;  1T2K D;  3L71 D;  1P84 I;  4KT0 J;  1VQL P;  1SQQ E;  1SQB G;  4L74 A;  4B86 A;  1LTB C;  2OQQ A;  1FZB A;  3AE2 C;  1SQV G;  2B89 A;  3C9I A;  5AVR B;  1SQX D;  3M0D C;  2WZ7 A;  5AW0 B;  5KAI E;  2O3J A;  1QVG O;  4UB6 H;  1FDO A;  1NTM E;  2AEJ A;  4KJM A;  1M8O B;  2LXB A;  3GLM A;  1HVV A;  1BDD A;  3Q5P A;  1AVY A;  1KMI Z;  2A45 H;  1IO4 A;  5CJ4 A;  1AJY A;  1RE3 C;  3L71 G;  2FYN C;  1JOC A;  2IBZ I;  4PD4 I;  1YQ4 C;  2NRG A;  3GF7 A;  1JMB A;  3AEA C;  1GL2 A;  1S72 P;  1IFM A;  2HPC B;  1S9K D;  1SS1 A;  1SQQ J;  3H32 B;  2OYH B;  1LNQ A;  3B5N D;  1NAF A;  3CX5 D;  1FC2 C;  3OA7 A;  1JCD A;  1RQU A;  1JCC A;  1KOR A;  1RE3 A;  1JY3 N;  2DW3 A;  2NZ2 A;  3H1L G;  3LIE A;  3M9Q A;  1KIL D;  4ZKU A;  3WU2 H;  4U3F G;  1JY2 N;  1KQG B;  1KYO I;  1RF0 C;  2E75 D;  2K1A A;  1NTM G;  3L73 J;  4ASW A;  1GD2 E;  2H7H A;  1FJP A;  3L75 J;  2Q7C A;  4HB1 A;  5APU A;  5L8R J;  3TF5 A;  2W6A A;  2Z5I A;  2BCC D;  3FWL A;  3GHG C;  3M06 A;  5DJT B;  3H1H J;  1ZRT E;  4N3Y B;  3I5C A;  4U3F D;  3L75 E;  2Q3I A;  1Q90 D;  1BE3 J;  5KLV G;  1R8E A;  5TIS E;  3H1H D;  1WT6 A;  1D7M A;  1RF1 B;  1OXZ A;  2BCC G;  4Y99 C;  2WSE J;  1BGY G;  4PV1 B;  5C39 A;  1EDL A;  2E74 B;  2B87 B;  5APQ A;  5KLV J;  3CCV P;  3S9O A;  3B8E B;  2MJZ A;  4ZNC A;  1KD1 Q;  1EC5 A;  1NTZ K;  3SWK A;  3AEB C;  2KZJ A;  2QRX A;  2Q6Q A;  3H1L E;  2FFD B;  2M3E A;  3HD7 C;  1ZXG A;  2IBZ D;  3BRT B;  4C7N B;  1PP9 D;  3L72 E;  4PV1 D;  1VQP P;  3AEE C;  2FKW B;  3BAS A;  1L0N E;  1CZQ A;  3P32 A;  3TNU A;  1DEB A;  1BCC E;  1J2J B;  3L70 G;  1VQM P;  2E75 C;  3B5N C;  4K3A A;  1YTZ I;  3CI9 A;  4PJ0 E;  4EI2 A;  2M8R A;  3M0D A;  3VP9 A;  1GMJ A;  3C8V A;  1KQS O;  1U7J A;  1KFM A;  1BCC D;  1LT9 C;  1EDK A;  5GTI E;  2AEM A;  4GT1 A;  4DT0 A;  2JKV A;  3VP8 A;  2IBZ E;  2OYI C;  3EFF K;  1SQQ G;  1SLQ A;  4GOD A;  4W7Z A;  3B5N B;  1NKN A;  1RQV A;  1M56 D;  1RHZ B;  4PD4 D;  1K73 Q;  4R4L A;  1GU5 A;  1JO5 A;  1K04 A;  3B4S A;  3L70 E;  1GU4 A;  1R5S A;  1P84 H;  2KLU A;  2IYP A;  3H1H E;  2J59 M;  4UB8 H;  1K8A Q;  2QM7 A;  2YKO A;  1E79 H;  2IFM A;  3L75 D;  1L4A B;  1ZRT D;  3HUS A;  2JJL A;  4NPF X;  2YXR B;  3V4Q A;  5CBN A;  2BCC E;  1T2K C;  1MFZ A;  1SFC A;  1RY3 A;  3RK3 D;  3RK2 C;  3CXH H;  3SWF A;  1NTZ J;  4LGD E;  1FE6 A;  2A06 G;  2WSC J;  2W27 A;  3JC2 2;  1KIL E;  2ZFC A;  4JPZ B;  3RL0 B;  5BVZ A;  2E43 A;  3OAK A;  1OZH A;  3HTK A;  5EFW B;  4MN4 C;  4CPG A;  2OGU A;  3F89 A;  4L76 A;  5AVT B;  1BDC A;  5BU8 B;  4AYC A;  4DZO A;  1DD3 A;  4N6J A;  3SFD C;  3TK1 A;  1ZP0 C;  3JCU H;  2OTL P;  3VMA A;  3LID A;  2OAR A;  1DD4 A;  2YXQ B;  1VQ5 P;  2V4H A;  1EZV E;  1NTK D;  2ZAE B;  2OYI B;  1LTS C;  4IFM A;  3H1I D;  1NTM D;  2JEE A;  3RBZ A;  3N4X A;  2WSF J;  5APS A;  3G4S P;  3TNU B;  1SQX E;  3A2A A;  3WMM 0;  2FYU K;  2MKV A;  1YYC A;  1Q82 Q;  4Z1M H;  1EQ7 A;  1SQQ D;  2P10 A;  3L71 E;  1NGM B;  1T6A A;  3CWB J;  2HR3 A;  3AE8 C;  1VQK P;  1LT9 B;  2B87 A;  1SQB E;  1KIL C;  3KXD A;  4XFJ A;  3L36 A;  3U59 A;  1X79 B;  3V2N A;  3P8C D;  5CBO A;  2E74 D;  3AEC C;  1SQV E;  2H8P D;  4H44 D;  1QLE D;  2KIK A;  1YJW P;  4KHX A;  2Y9Y A;  3MHV A;  2K37 A;  1E5W A;  1AV1 A;  2O01 N;  2Y9Z A;  3TGU E;  1ZR2 A;  1YHQ P;  1LTG C;  4ASV A;  3CC2 P;  3ITK A;  1S4X A;  2V7Q J;  1N8R Q;  2WTY A;  1PP9 G;  1XTC C;  3KYQ A;  5AW3 B;  1JY3 O;  2FY8 A;  1URQ D;  1FZF A;  2YO2 A;  4JQ0 D;  2IPP A;  4WY4 C;  3VMY A;  2LR2 A;  2NPS A;  1NOH A;  3AE6 C;  3SWY A;  1KZU B;  1S5L E;  3CD6 P;  4AUW A;  1IFI A;  5CJ0 A;  1KB9 H;  3VOP A;  3IAO A;  4W7Y A;  4OGQ D;  2E76 D;  1IZN B;  4D6T E;  1L0L G;  1LTI C;  1FZA A;  3MD0 A;  2IX7 C;  1S3J A;  2RKL A;  1LJ2 A;  4NPD A;  2D2C C;  2JWD A;  3BAT A;  1EXJ A;  1FU1 A;  2M3B A;  1L0N K;  1OFC X;  2GUV A;  1L4A A;  2FYU J;  3ABV C;  1KB9 D;  1L2P A;  3FXD A;  1SFC D;  3HUS B;  1S5L H;  3RGU A;  1OMI A;  1W5C E;  3I55 P;  2R5D A;  2BEQ D;  4EOT A;  1RF0 A;  4U3F J;  2FFD C;  3IF4 A;  3H6P A;  1ZME C;  1BE3 G;  1URQ C;  2HOD A;  3CXH E;  2W90 A;  1X22 A;  1NU1 G;  3V2R A;  3H1J D;  3IN6 A;  1N7L A;  1L0L J;  3CCR P;  1JMM A;  1RE4 C;  4ZKP A;  2P67 A;  2PFX A;  3G71 P;  1NTZ D;  4YXD C;  1VQN P;  5KAI H;  1CSB A;  1LTT C;  3K5B A;  3CWB D;  1SQP E;  4BRY B;  2ZT9 D;  4TT3 H;  4UB8 E;  1SQB K;  1ZLL A;  1RH5 B;  1P84 E;  2Z4E A;  1NO4 A;  3II6 A;  1SQV K;  2HOD B;  5AVU B;  1HGZ A;  3T97 B;  2ZYD A;  2P7J A;  1X8Y A;  3MIW A;  1PGP A;  2KS1 A;  2KYV A;  1RE4 A;  3E1I A;  3PP5 A;  3SSU A;  1ZV8 A;  1LTA C;  4I1L A;  2Q9I A;  4K35 A;  1USE A;  2QM8 A;  1M57 D;  3CWB G;  1PZQ A;  1U57 A;  3FX0 A;  3VYI A;  5BU5 A;  1MZ9 A;  1M7L A;  1NTK J;  4WB4 A;  4OGQ C;  1T3J A;  4WWI A;  4W80 A;  2B88 A;  3H1I J;  3PTZ A;  2WPS A;  4BWN A;  1HF9 A;  1SQX K;  3AE3 C;  4OGQ B;  1HJ0 A;  3L74 D;  1NVO A;  4H13 D;  3CMA P;  2A06 E;  2QJP B;  1JNM A;  3B5N A;  4PJ0 H;  5AVQ B;  2JP3 A;  3H1K J;  3L74 J;  4HH2 A;  3L4F A;  3L74 E;  5CHX A;  3ZDM A;  1FZC B;  1YJN P;  1LTJ C;  1LWU C;  2ITA A;  2G8Y A;  2I1J A;  2NPS B;  3AE5 C;  1NTM K;  3U1A A;  4DOJ A;  1URQ B;  2J58 A;  1YJ9 P;  2D2C D;  5M1B A;  1RF1 A;  1YI2 P;  1LP1 B;  2E5T A;  1H0T A;  3AE4 C;  2YIU C;  5KLI C;  3HD7 B;  2R5B A;  1AFO A;  2OYO A;  1ZN5 A;  2WPR A;  2KP8 A;  3AEF C;  3BCC G;  1QGK B;  1NU1 E;  2XDJ A;  1OVV A;  1OW7 A;  2E74 C;  3HE5 A;  5AW1 B;  3UIA A;  3V4W A;  4Y99 B;  2K9J A;  2D2C B;  2ZXE B;  3GW6 A;  3MP7 B;  4PV1 C;  1P84 D;  1PPJ G;  3B71 A;  5DJU B;  2NPS D;  1G1J A;  3A3Y B;  2O01 J;  3NXS A;  1NTZ G;  2HLO A;  2WWW A;  2FFD A;  2KB7 P;  1J1E B;  2R3S A;  3E7K A;  2WIT A;  1SP4 A;  3TDK A;  3BCC J;  2JO1 A;  3G3Z A;  1HTL C;  1YBK A;  4OVN F;  2WPV B;  3H1J E;  3H32 A;  3P7K A;  3CPW O;  4GIF A;  1OIP A;  2OYH A;  1KIL A;  1PGQ A;  2SPZ A;  1J1E C;  1IJD B;  4XE5 B;  5AW9 B;  4I7Z B;  1GW3 A;  5CCH C;  3H25 A;  2WMM A;  1KV4 A;  2XKM A;  4H13 C;  2WSC H;  1HGV A;  1KB9 E;  1X9V A;  3G9R A;  1JM0 A;  2O1K A;  2FXM A;  2K3R A;  1K05 A;  1IFN A;  3SFE C;  3KHU A;  4IOI H;  5KTB A;  1A02 J;  4O9B A;  5B66 H;  1EXI A;  1LGH B;  2RH0 A;  1Y8A A;  3WUU A;  3U1C A;  2XV5 A;  3G6E P;  2K9Y A;  4WY4 B;  3V2Q A;  3V5B A;  3RL0 C;  3A5T A;  3TSI A;  1VDF A;  2I1K A;  2ZT9 B;  3F5H A;  3CCM P;  2PAJ A;  1UIX A;  3PH0 A;  3M91 A;  2QEX P;  1T3U A;  3VTP C;  1IFP A;  4M3L A;  2OTJ P;  3H1I G;  3L73 D;  2ZT9 C;  3GG2 A;  1L4A C;  2YMK A;  3RL0 D;  4LLH A;  3L74 G;  4HJG H;  3Q2Y A;  2C9N Y;  1NTK G;  2JDI H;  5AVZ B;  2IZ1 A;  1NYH A;  3RK3 B;  5K5G B;  1AQ5 A;  3HE5 B;  1SFC B;  2KOG A;  1ZOY C;  1Z56 A;  1QX8 A;  1FAV A;  3TGU D;  1NKZ B;  5AW7 B;  3I56 P;  2FYZ A;  3TGU J;  1QVF O;  3D71 A;  1H8A A;  4NPE A;  3QWO C;  1IK7 A;  3BRV B;  3P8C E;  1HJB A;  1BSH A;  1DIP A;  3BCC E;  3GHG B;  1N7S D;  2QSI A;  2XZR A;  4H44 C;  1AQT A;  1FZG A;  3BVH A;  1GK4 A;  1PP9 J;  4IFD K;  4N78 E;  3P8M C;  1JTH A;  2WSE H;  2IBZ G;  3CL3 D;  4GOF A;  5CCG A;  5KLV D;  1PGO A;  2QJK C;  1DX7 A;  1MV8 A;  2WPQ A;  1VL2 A;  3JCU E;  4TLF A;  2HYN A;  2IZ0 A;  5CCG D;  4H0L B;  2KK7 A;  3RK2 B;  3H1I E;  2OYH C;  1Y47 A;  1YIJ P;  2FYU E;  3CCU P;  1EZV D;  1NTK E;  1IK9 A;  2IFN A;  2GM4 A;  2YIU B;  5KLI B;  4I7Z C;  1FDM A;  3V2P A;  2XU6 A;  2H89 C;  2KS1 B;  1FJK A;  2PGD A;  3A0H E;  1CI6 A;  4H44 B;  1U7M A;  2M5A A;  2ZJS E;  3C1L A;  4D6T J;  1UII A;  1JY2 P;  2AXT H;  2P1J A;  2R32 A;  3H1K D;  1L0L D;  5AW8 B;  3O8Z A;  1QL1 A;  3M9B A;  4XA4 A;  1OW6 A;  3EQ2 A;  1LTJ A;  1LWU A;  1HUC A;  2KSJ A;  3A7O A;  1S2E A;  2Y0C A;  2WVR A;  3FWN A;  2ZYG A;  3OJA B;  3RK3 E;  2QA4 P;  3CCE P;  1N7S C;  1FOS E;  1FDI A;  1NU1 J;  1JUN A;  2QJY B;  3RK2 D;  4H0L D;  1VQ4 P;  2CPS A;  5GTI H;  1LTJ B;  1FS0 E;  1LWU B;  3L70 D;  4IL6 E;  1W2B O;  3RBX A;  1N73 C;  1H89 A;  1DH3 A;  4PD4 E;  1SQP K;  1VF5 B;  2HG5 D;  1DEE G;  1EZV I;  2FYN B;  2O1J A;  1G2C B;  2YKP A;  1L0L E;  1N7S B;  4JBZ A;  3H1K E;  5APX A;  3L73 G;  5B5E E;  1NJI Q;  1PL5 A;  3AE1 C;  2CK3 H;  2HPC A;  1WRG A;  3CCS P;  2R44 A;  2P2U A;  2QJY C;  1W2E A;  1VQ6 P;  2WSS H;  2KXP B;  3LW5 H;  5APV A;  3PJS K;  3KZI E;  3HD7 A;  1JEK A;  5KJ7 C;  1BSN A;  2FYU D;  1LP1 A;  1L4A D; 
#chains in the Genus database with same CATH homology
 1URQ A;  1JY2 O;  5KJ7 D;  2A45 I;  3IR9 A;  3L37 A;  1FOS F;  2R3C A;  4N78 D;  4HYT B;  1LT9 A;  2WSF H;  2WT7 B;  5AW5 B;  4JYB A;  5AW2 B;  4WY4 D;  1VPC A;  1J1D C;  4C46 A;  2Z5H A;  2YO3 A;  2NPS C;  3KPE A;  5AVY B;  5KLV K;  1MUU A;  3EFG A;  3VMX A;  1IFJ A;  1NH4 A;  1A02 F;  5AVS B;  2GUS A;  1G1I A;  1JY3 P;  2N9B A;  3HTK B;  1S9K E;  1FBM A;  1GL2 B;  2C0X A;  1N73 A;  1GW4 A;  2LKM A;  4RES B;  3HRN A;  5AW4 B;  4I2L C;  1IFD A;  5CCH D;  3HD7 D;  1QL2 A;  1KQL A;  5AVW B;  1FZC A;  3CLQ A;  5KJ7 A;  1N73 B;  1KIL B;  1GDT A;  3NFQ A;  1SQQ K;  3KQG A;  4AQR D;  1N86 A;  3HE4 B;  2HFE D;  4GKG A;  2H43 A;  4C7R A;  2E42 A;  3L35 A;  1NHL A;  1M1J B;  4I6M C;  2N1T D;  1OWA A;  4JYC A;  3N7N A;  2YMY A;  1GTW A;  2PP6 A;  4EIJ A;  2WT7 A;  1HBW A;  3VMZ A;  5APT A;  4WY4 A;  1M1J C;  1NTK K;  2BAS A;  2N1T B;  2POH A;  3RK3 C;  1HWT C;  5CCH A;  2OYI A;  2L5G B;  4JF7 A;  1SVF A;  1KFN A;  5AVX B;  3T97 A;  1H88 A;  3NTN A;  1J1D B;  1N7S A;  3M9H A;  1G2C A;  1ZR4 A;  1CW5 A;  4OH8 B;  2A45 G;  1FZE A;  1IC2 A;  2N1T C;  3KDP B;  2Q5U A;  1SFC C;  1HH0 A;  5CCG D;  2CPB A;  4IFF A;  5APY A;  5CMZ A;  1RF1 C;  3R2P A;  1GL2 C;  2N1T A;  4LC1 A;  5AW6 B;  3MGN A;  1GL2 D;  2C9L Y;  2VRS A;  2W6B A;  1PFI A;  3GHG A;  2YNY A;  1CI6 B;  1L0L K;  3IFM A;  5AVV B;  2XNX A;  3MTU E;  5CCG C;  1N2D C;  3HUS C;  2C0W A;  3MUD A;  2O01 H;  5APW A;  1M1J A;  1T8Z A;  1XTG B;  1GK6 A;  3VN0 A;  1NWQ A;  1YTZ T;  3M0A A;  1FZC C;  4C7N A;  3HE4 A;  1JTH B;  2KLV A;  1NU1 K;  2YKQ A;  1GZL A;  4WBA A;  3TYY A;  1T2K D;  4B86 A;  1LTB C;  1FZB A;  1FZC B;  5AW0 B;  3C9I A;  5AVR B;  3M0D C;  2WZ7 A;  1HVV A;  2A45 H;  1IO4 A;  5CJ4 A;  1RE3 C;  1JOC A;  1GL2 A;  1IFM A;  2HPC B;  1S9K D;  3H32 B;  2OYH B;  3B5N D;  1NAF A;  3OA7 A;  1JCD A;  3M9Q A;  1JCC A;  1RE3 A;  3LIE A;  1JY3 N;  4ZKU A;  1KIL D;  1JY2 N;  1RF0 C;  1GD2 E;  2H7H A;  1FJP A;  2Q7C A;  5APU A;  2W6A A;  2Z5I A;  3M06 A;  3GHG C;  4N3Y B;  3I5C A;  2Q3I A;  1RF1 B;  1WT6 A;  1OXZ A;  4Y99 C;  5APQ A;  3B8E B;  2MJZ A;  1NTZ K;  2FFD B;  3HD7 C;  3BRT B;  4C7N B;  2FKW B;  3BAS A;  1CZQ A;  3P32 A;  3TNU A;  1DEB A;  1J2J B;  3B5N C;  1YTZ I;  3CI9 A;  2M8R A;  3M0D A;  3VP9 A;  1KFM A;  1LT9 C;  4GT1 A;  3VP8 A;  2OYI C;  1SLQ A;  4W7Z A;  3B5N B;  1NKN A;  1JO5 A;  1GU5 A;  2J59 M;  2QM7 A;  2YKO A;  2IFM A;  1L4A B;  3HUS A;  2JJL A;  3V4Q A;  1T2K C;  1MFZ A;  1SFC A;  1RY3 A;  3RK3 D;  3RK2 C;  3SWF A;  4LGD E;  2W27 A;  2ZFC A;  3RL0 B;  5BVZ A;  2E43 A;  3OAK A;  3HTK A;  5AVT B;  5BU8 B;  4AYC A;  4DZO A;  4N6J A;  3TK1 A;  3LID A;  2OAR A;  2OYI B;  1LTS C;  4IFM A;  2JEE A;  3N4X A;  5APS A;  3TNU B;  3A2A A;  3WMM 0;  2FYU K;  1YYC A;  1EQ7 A;  1LT9 B;  3V2N A;  1KIL C;  3U59 A;  3L36 A;  1X79 B;  3P8C D;  2H8P D;  4KHX A;  1E5W A;  1ZR2 A;  1LTG C;  2WTY A;  1XTC C;  3KYQ A;  5AW3 B;  1FZF A;  1JY3 O;  1URQ D;  2YO2 A;  4WY4 C;  2IPP A;  3VMY A;  2NPS A;  1NOH A;  3SWY A;  1KZU B;  4AUW A;  1IFI A;  5CJ0 A;  3VOP A;  4W7Y A;  1LTI C;  3MD0 A;  1FZA A;  2IX7 C;  3BAT A;  1FU1 A;  2M3B A;  1L0N K;  2GUV A;  3HUS B;  1L4A A;  1SFC D;  2GM4 A;  4EOT A;  2FFD C;  2R5D A;  1RF0 A;  3H6P A;  1URQ C;  2HOD A;  3V2R A;  1N7L A;  1JMM A;  1RE4 C;  4ZKP A;  2P67 A;  1CSB A;  1LTT C;  1SQB K;  1ZLL A;  2Z4E A;  3II6 A;  1NO4 A;  1SQV K;  2HOD B;  5AVU B;  1HGZ A;  2P7J A;  1X8Y A;  3MIW A;  3PP5 A;  2KYV A;  3E1I A;  1RE4 A;  1ZV8 A;  1LTA C;  4I1L A;  2Q9I A;  2QM8 A;  3VYI A;  5BU5 A;  1MZ9 A;  1M7L A;  4WB4 A;  1T3J A;  4W80 A;  2WPS A;  1SQX K;  1JNM A;  3B5N A;  5AVQ B;  4HH2 A;  3L4F A;  5CHX A;  1LTJ C;  1LWU C;  4DOJ A;  2I1J A;  2NPS B;  1NTM K;  3U1A A;  1URQ B;  2J58 A;  1RF1 A;  3HD7 B;  2R5B A;  1AFO A;  2WPR A;  1ZN5 A;  2KP8 A;  5AW1 B;  2XDJ A;  3HE5 A;  3UIA A;  3V4W A;  4Y99 B;  2ZXE B;  2NPS D;  1G1J A;  3A3Y B;  3NXS A;  2HLO A;  2WWW A;  2FFD A;  2KB7 P;  1J1E B;  2WIT A;  1SP4 A;  3G3Z A;  1HTL C;  1L4A D;  3P7K A;  3H32 A;  2OYH A;  4GIF A;  1KIL A;  4XE5 B;  1J1E C;  1IJD B;  5AW9 B;  1GW3 A;  5CCH C;  2XKM A;  2WSC H;  1HGV A;  1X9V A;  5KTB A;  2O1K A;  2FXM A;  1A02 J;  1IFN A;  4O9B A;  1LGH B;  3U1C A;  2XV5 A;  4WY4 B;  3V2Q A;  3V5B A;  3RL0 C;  3A5T A;  3TSI A;  1VDF A;  2I1K A;  2PAJ A;  3M91 A;  1T3U A;  3VTP C;  4M3L A;  3RL0 D;  2C9N Y;  1L4A C;  4LLH A;  5AVZ B;  3RK3 B;  1AQ5 A;  3HE5 B;  1SFC B;  2KOG A;  1Z56 A;  1FAV A;  1NKZ B;  5AW7 B;  2FYZ A;  1H8A A;  3BRV B;  3P8C E;  1HJB A;  3GHG B;  1N7S D;  2XZR A;  1FZG A;  3BVH A;  1GK4 A;  4IFD K;  4N78 E;  3P8M C;  1JTH A;  3CL3 D;  2WSE H;  5CCG A;  1DX7 A;  1MV8 A;  2WPQ A;  2HYN A;  3RK2 B;  2OYH C;  1IK9 A;  2IFN A;  1FDM A;  3V2P A;  2XU6 A;  1FJK A;  1CI6 A;  1JY2 P;  2P1J A;  2R32 A;  5AW8 B;  3O8Z A;  1QL1 A;  3M9B A;  4XA4 A;  3EQ2 A;  1LTJ A;  1LWU A;  1HUC A;  2KSJ A;  3A7O A;  3OJA B;  1N7S C;  1FOS E;  1JUN A;  3RK2 D;  2CPS A;  1LTJ B;  1LWU B;  1N73 C;  1H89 A;  1DH3 A;  1SQP K;  2HG5 D;  2O1J A;  2YKP A;  1G2C B;  5APX A;  1N7S B;  2HPC A;  1WRG A;  2P2U A;  1W2E A;  3LW5 H;  5APV A;  5KJ7 C;  3HD7 A;  1GU4 A;  3NMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...