3RK3B

Truncated snare complex with complexin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
62
structure length
62
Chain Sequence
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
molecule keywords Vamp2
total genus 29
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk3B00
3RK2D 1KILB 3B5NB 1SFCC 2NPSC 4N78E 2N1TB 5CCHD 2YMYA 1SFCD 4W7YA 5KJ7A 1GL2B 3HD7D 1L4AD 1KILA 5CCGC 3B5NA 4WY4D 3VOPA 2NPSB 3RK3C 4JF7A 1N7SA 5CCGD 1URQC 1L4AC 3KYQA 1SFCA 1SFCB 2N1TD 2XDJA 3HD7A 5CCHC 1KILD 1N7SC 3RK2B 3HD7C 3RK3D 3HTKB 1JTHB 4WY4C 2M8RA 3RK2C 5CCHA 3RL0C 2N1TC 4W7ZA 2WZ7A 2HFED 3P8CE 1T3JA 3RK3B 3TSIA 1N7SD 1KILC 5CCGA 1GL2C 2H8PD 3RL0B 2NPSA 1GL2A 1XTGB 1URQD 3M0DC 1URQB 5KJ7C 3RL0D 1JTHA 1N7SB 1HVVA 4LGDE 2NPSD 1L4AA 4WY4B 1GL2D 3HD7B 1URQA 2PP6A 2N1TA 4W80A 5KJ7D 3B5ND 4WY4A 2KOGA 1L4AB 2HG5D 4OH8B 3B5NC 1NHLA 3PP5A
chains in the Genus database with same CATH superfamily
1JY3O 1OZHA 1SQBG 5EFWB 2A45H 4XA4A 1CI6B 2K9JA 1W5CE 2WT7A 4WBAA 4H0LB 2YO2A 3L74J 1L0NK 1VQPP 1GU4A 2Y0DA 1BDCA 2OYIB 1DD4A 2M3EA 1U7MA 2V7QH 3S4RA 3AE7C 2AEMA 1SFCD 1SQXD 2HLOA 3TGUD 1IZNB 1FZGA 1NOHA 1DH3A 3GW6A 3K5BA 1AFOA 1E5WA 1VF5D 3VP8A 3CCLP 2KLVA 1J1DC 1ZRTE 2JDIH 1QVGO 3HD7D 2QSIA 1YYCA 3IFMA 1M1JC 3H32B 2Q9IA 4I1LA 3CXHD 1PP9E 2KUBA 2C9NY 2IBZI 3H1ID 3KPEA 2WT7B 3WMM0 1JCDA 3H1IJ 3HE4B 5AVQB 1FJPA 1L0LE 2O01J 1KB9E 2JJLA 5BU5A 2KI7B 2M0BA 1EDIA 1LTAC 2WMMA 1OVVA 3T97A 2JR8A 2OYHB 1SQQK 1BE3D 2KNCB 2N9YB 1NH4A 3JCUE 1FZFA 1IK7A 3L71G 1SQXJ 2E75B 3AEEC 4DCKA 3CX5I 1PPJG 2N1TD 3GF3A 3GMAA 2ZAEB 1FJKA 4K3AA 3CCJP 1T2KC 3O6QA 1KILD 3FWNA 4L73A 2Q1KA 2I1KA 3RK2B 2BEZF 3L73D 2B88A 1K9MQ 1KV4A 1RE4C 4Y99B 2FYNC 1FBMA 2ZXEB 1JY2O 3CXHH 4AYCA 2KSEA 1RF1C 2JKVA 3HTKB 3A5TA 1VQ6P 5GTHE 1ZMEC 1FS0E 1PGQA 1NTMG 2N9BA 1W2BO 4NPEA 2WSEH 1EXIA 2QEXP 2Y0EA 1NU1D 1VQ4P 2OTJP 3JC22 1UIIA 1L0NJ 2XV5A 1OWAA 1ZXGA 1L2PA 2BCCG 3IN6A 4UB8H 2OQQA 5APQA 3R4YA 3RBXA 1PP9J 1USDA 3L70G 4JPZB 1P84E 1HBWA 2KP8A 4O9BA 2P67A 1SQQJ 1S3JA 3H1KD 4N78D 2FFDC 3HE4A 3D71A 3B71A 1YJ9P 5B66E 2C0XA 1KILC 2OARA 2Q3EA 1N2DC 3M91A 2IFMA 1E79H 3NTNA 1NTZJ 2R44A 4KT0J 4JYBA 3N7NA 3RL0B 3T97B 4ZMDA 3Q5PA 2ZVOB 3MIWA 1YHQP 2A45I 2W6JH 2YKOA 3H1HG 4PD4I 2OYHA 3M0DC 2HODB 2ZFCA 1SQPJ 1BE3J 3LW5J 1IO4A 1S2EA 1IFDA 1S4XA 2J58A 1DD3A 2K37A 2GUVA 2GUSA 3TDKA 3NFQA 4HJGH 2AEJA 2KYVA 1SLQA 2J5UA 2KXPB 4WB4A 4RJTA 4ZNCA 1YQ4C 2E74C 2D2CD 1OW7A 2R32A 1X79B 1N73B 1K73Q 2AXTE 1DEEG 1TU3F 2IDBA 2WITA 1NAYA 5KLVE 3V4WA 2Z5IA 2HPCB 1IJDB 3CD6P 1L0ND 1T3UA 1LNQA 2ZT9D 1SQVJ 3R2PA 2IBZD 5AVYB 5AW4B 5KLVD 5KLVJ 2LKMA 1SS1A 1L0NG 3OAKA 5KLVG 2ZJSE 4H44C 3I56P 3L75E 4HH2A 1DIPA 4YXWH 2W6AA 5AVVB 1S72P 4U3FJ 2A06G 1LTGC 3II6A 3A0BH 1R8EA 2FYUE 2CPSA 4OGQB 3A7OA 1EZVE 3P8CD 1X0TA 5AW2B 4WY4A 5KLIB 1KYOI 2E76B 3KDPB 1JY3P 1PFIA 3D70A 4OH8B 3BRVB 1L4AD 3H1HD 1LGHB 2E76D 2JP3A 1SQPE 2W83C 3PTZA 3RK2D 1QGKB 2Z5HA 4I7ZB 2NPSC 3A3YB 3BATA 3H1KE 4N78E 2WPRA 4OGQD 3H1IE 4NPFX 2E75D 3RGUA 4ZKPA 1LWUB 4YPCA 4N6JA 1SQQG 1VPCA 3E1IA 1JM0A 2AEFA 5AVZB 1QX8A 2IBZE 1NTKE 2WSCJ 1KZUB 3F89A 3H1KG 4W7YA 1FU1A 1M1JA 1NVOA 2W90A 1GL2B 3AE3C 1HWTC 1IFNA 1GU5A 1KB9I 3CLQA 2H7HA 2YXQB 1ZP0C 4B86A 3GHGB 1Q82Q 2FBWC 1D7MA 4WWIA 1VQ7P 3LIDA 4EDFA 2W27A 2QJPB 2W8ZA 2RN0A 3L75J 2ZYGA 3PLNA 1URQC 1JB0J 1KORA 5AVUB 2D2CB 4EYYQ 1P84H 4AUWA 1W2EA 4UB6E 1NTMD 1GK4A 2ITAA 2YKPA 4QMAA 1N73C 5C39A 3B8EB 1YQ3C 1MKMA 2C0WA 2WSEJ 2KLUA 2YXRB 3A0HH 1SFCB 1M1JB 5BU8B 1AJYA 2LR2A 1OIPA 3VMZA 2QJKB 1EDKA 3W67A 3M9HA 3HD7A 5CCHC 1EC5A 3FX0A 2YNYA 1NTKG 1OFCX 3CWBD 1LTJB 3WU2E 3M06A 5L8RJ 4DT0A 1PPJD 1SQPK 3C1LA 3CI9A 3L71J 5KLIC 2E42A 4R4MA 2FY8A 1JCCA 1BE3E 2K3RA 3H1LJ 3CMEP 3CC2P 1GMJA 5KAIH 1FDOA 1L0NE 2PGDA 4D6TE 1Q2NA 3BCCG 4TT3H 3SFEC 2M8RA 1YIJP 1AV1A 3O6QB 3BCCE 2E76C 4IFFA 4L74A 3WUUA 3H1HE 3CCQP 2O1JA 3RK2C 2E74D 5CJ4A 5CCHA 3L37A 1SQPD 4U3FG 1JY2N 1SQVE 4LC1A 2P2UA 3I5CA 5AVXB 1JUNA 3EFFK 4PD4H 3KQGA 1VQ5P 2N1TC 2QE7H 3A0HE 4U3FE 4W7ZA 3UIAA 2I1JA 1LTSC 3AEBC 3P8CE 1VL2A 3USSA 2B9BA 5GTIH 2QA4P 3TGUG 3G6EP 1T2KD 1EQ7A 1N7SD 2Y0CA 5BVZA 5CCGA 3HUSB 1H0TA 1BGYG 1K04A 3FGAD 4BXLA 4D6TG 3M9BA 1GL2A 3OA7A 2KNCA 3AECC 3CX5D 3M0AA 1XTGB 1URQD 1SQBD 2KK7A 3N4XA 4PV1B 3RK3E 2YKQA 1SVFA 2KZIA 3CMAP 3V5BA 1EXJA 2QRXA 4PV1D 1URQB 3VTPC 1NTZG 4GODA 2IPPA 2D2CC 2HODA 4DOJA 3NMDA 3EFGA 1NTKJ 4KJMA 3VP9A 2WSCH 2P7JA 1JTHA 1RY3A 1N7SB 2MJZA 3AE9C 1SQXK 2WPVB 3L70E 3P7KA 3S1KA 3V4QA 4IFMA 3H1HJ 1H0TB 2WWWA 1IC2A 1KYOH 2E75C 5B5EH 2E43A 2FYUD 2G8YA 4RKUJ 1L4AA 1HTLC 1NKNA 1PGPA 1LTJA 3SFDC 3HE5A 3L74D 3FXEA 5KKZB 1HJ0A 3L4FA 4RESB 1H89A 2PRRA 3HD7B 2OYHC 1KYOD 3AE4C 3L74E 1M7LA 1NTME 5APYA 1LT9B 1FZCC 1Q81Q 1KYOE 3TNUB 1YTZI 5B5EE 1BCCE 2E74B 2N1TA 1GTWA 3RBZA 2AXTH 4W80A 2B89A 3L72D 5E79E 1P84D 3AE2C 5KTBA 2QJYC 1M56D 1LWUC 1ZOYC 1Y9BA 2G3AA 2KOGA 2VRSA 3B5ND 4Y99C 4C46A 1JY2P 1MZ9A 3H1JD 1FDIA 2AXCA 1YI2P 1KB9H 2M3BA 1QLED 1A02J 3U1AA 1KD1Q 5APTA 2YMKA 3MUDC 3NXSA 4H13B 5AW1B 1VQMP 2QM7A 2Q6QA 1BGYE 1X9VA 1A02F 1KC8Q 1PV3A 3B5NB 5K5GB 1SFCC 4HYTB 1BGYD 2FYUK 1LTBC 2V4HA 4D6TD 3D6ZA 1PIXA 3G71P 1NWQA 2B87B 1HGVA 2HYNA 2NRGA 1JNMA 1P84I 3HRNA 1HH0A 1L0LD 1RQVA 3JSVC 4YTPC 1BDDA 1FAVA 1Y8AA 1LWUA 1K05A 2JWAA 2XKMA 1NU1J 1RH5B 1S1CX 5AW6B 3TGUJ 1FOSE 1GD2E 1CW5A 2OYIA 5CCGC 1FE6A 3CCMP 4WY4D 1L0LK 3RK3C 4RO0A 5GTHH 3AE5C 1VQNP 1SQPG 4HB1A 4U3FD 2Q5UA 2ZVNB 2I8DA 2NZ2A 1BCCJ 1FZAA 1HGZA 1AVOA 1X8YA 1NTMJ 1L4AC 3B4SA 4C7NA 3BCCD 3Q5RA 1OMIA 3VN0A 2SPZA 1NJIQ 4R4LA 4UB8E 1NO4A 4IFDK 3EQ2A 2M5AB 1GK6A 3CXHE 1KQGB 1NKZB 1QL1A 1WRGA 3H1LE 4LLHA 2XDJA 2ZYAA 5AVWB 3PH0A 1G1JA 3CWBG 2RMZA 1NTKD 1M1KQ 1Y47A 3VMXA 4C7NB 1OVRA 1QL2A 2P58A 3IR9A 1JO5A 3HE5B 3M9QA 5CMZA 3KXDA 1KTMA 4H0LC 2OTKE 3L73E 5AVTB 3TK1A 4CPGA 1RF0C 1ZRTD 5B66H 1SQBJ 1NU1K 1VQ8P 3C9IA 3CCSP 3V2NA 1G2CA 3D6YA 4PJ0E 1SQBK 1KMIZ 1SQBE 1UIXA 5H2FH 2FXPA 1U7JA 4PV1C 1SQVK 1EDLA 1MV8A 3FWLA 3H1LG 3CCUP 4Y28J 4EIJA 2YO3A 1QVFO 5APVA 2WQYC 3L36A 3V2PA 2WTYA 1JY3N 2WSSH 4GIFA 3CPWO 1M90Q 3RL0g 4HKZH 1KQSO 1FZCA 1RF1B 2K9YA 3JCUH 4XE5B 2ZT9B 2WZ7A 3AEFC 4I7ZC 1HUCA 2HFED 1IFJA 4XFJA 2Q7CA 2BEQD 1H88A 2O01N 3MD0A 1HF9A 1CSBA 3RK3B 2ZT9C 1SQQD 3H1KJ 3MGNA 4OGQC 3SWKA 4YXDC 3ABVC 3G9RA 1M8OB 2OTLP 1R5SA 1NTMK 1BSNA 3BRTB 4H44D 2Q3IA 1U57A 4JQ0D 3U59A 4Z1MH 1ZR2A 1M57D 2H8PD 2JWDA 1LT9C 1LP1A 1RE3A 2ZYDA 3A0BE 5TJHA 5KKZC 1VQOP 1L0LJ 4OWFA 2L5GB 3AEDC 2PAJA 5AW5B 1LTIC 3LIEA 2BCCE 5KAFE 5M1BA 4EOTA 1T6AA 2WPQA 1AVYA 2RKLA 1J2JB 1KQLA 2KB7P 1FZEA 3RL0D 1PP9G 3L70J 3VMYA 3SWFA 4DZOA 2FXMA 1PPJE 3GHGC 2GM4A 1YTZT 2A06D 3AE6C 2OGUA 3SSUA 1BCCD 3CX5E 1GW4A 1RE4A 1NTKK 5AW9B 1ZR4A 3CC7P 3HUSA 1OX3A 2FYUJ 4LGDE 1N73A 3L35A 3QH9A 1EZVD 3PHLA 1JMBA 2FFDA 2QJYB 2V7QJ 4UB6H 1AA0A 2NPSD 2QJKC 2QG4A 1KB9D 2FXOA 2IBZG 1GL2D 4GT1A 2YIUC 5CBOA 1LTJC 1XTCC 4PJ0H 1URQA 3BASA 4JYCA 1GZLA 5H2FE 1EZVG 1RHZB 2XNXA 4ASWA 4GOFA 1Z56A 2PP6A 3GG2A 3OW2O 2HPCA 2A06E 1G2CB 2YIUB 2R3CA 3TNUA 1BCCG 1J1DB 3L71E 4BRYA 3H25A 1AQ5A 1J1EC 1NYHA 1RF0A 3MTUE 4GDOA 5APUA 3LW5H 1FDMA 1LT9A 1PP9D 1RE3C 2OYOA 1H8AA 3GLMA 2PFXA 2R5BA 3EWKA 3TGUE 4TLFA 2IFNA 3MZWB 3RK3D 3GF7A 3CCEP 1L4AB 4ASVA 2K88A 3V6IA 1S5LE 1NHLA 2O01H 3PP5A 3ITKA 3Q5SA 1K8AQ 2FYZA 4IL6H 1YBKA 2KIKA 3HTKA 1LJ2A 1KILB 5AVRB 2FKWB 1KFNA 4BWNA 1PGJA 2N1TB 3BCCJ 4ZKUA 3MHVA 1GW3A 5CCHD 2FFDB 2YMYA 2Y9YA 3CWBE 1NTZE 4U7JA 5TISE 3WU2H 3AE1C 3H6PA 5AW0B 1G1IA 1IFPA 1JOCA 1VDFA 2R5DA 3ZDMA 5KJ7A 1ZLLA 2H88C 3HUSC 2LXBA 3KZIE 1LP1B 2IX7C 2IYOA 4H13C 1KILA 3L70D 3KHUA 3B5NA 3CX5H 3L72E 2A45G 5CCGD 2KZJA 3VOPA 1OVUA 2NPSB 4GOEA 4JF7A 1PL5A 2BCCD 1VQKP 1N7SA 1N7LA 1ZV8A 4DJGA 1JEKA 3H1LD 4IL6E 1S5LX 2K1AA 5APXA 3WUTA 1LTTC 1CZQA 2KS1B 2IZ0A 1FC2C 1S5LH 1NU1G 3CXHI 1T8ZA 3G4SP 4GKGA 3BVHA 3CC4P 2QIWA 3C8VA 3KYQA 5CBNA 1PGOA 1KQFB 1R5LA 4MN4C 1SFCA 2P1JA 5AW8B 2J59M 3WUVA 1YJWP 2Y9ZA 2LXCB 4PD4D 4BRYB 2QM8A 1IK9A 2GA1A 3PJSK 5DJUB 3L73G 3KZIH 4K35A 3H1JE 2ZXXA 3L73J 3A2AA 4H0LD 4EI2A 1N7SC 2O1KA 1S9KD 3HD7C 1MUUA 1OW8A 1WMKA 2QVAA 4H13D 4H44B 1Q7YQ 1S9KE 1VF5C 3AEAC 1VQ9P 2BCCJ 3L71D 1EDJA 2JEEA 1EZVI 1SP4A 1BE3G 3P8MC 1J1EB 1JTHB 4IL6X 4KHXA 5APSA 4WY4C 4A7PA 4C7RA 1HJBA 1KN7A 2E5YA 3Q2YA 1N86A 5CJ0A 2CPBA 2XU6A 2OYIC 3TYYA 1ZW0A 1RQUA 1NGMB 2DW3A 3H1IG 5KAIE 3RL0C 1Q86Q 3CCRP 2C9LY 4JBZA 2JO1A 2WSFJ 4IOIH 3AE8C 1DX7A 1CI6A 2K9JB 3FXDA 3P32A 3SWYA 4NPDA 1OW6A 2W6BA 3CCVP 1T3JA 1AQTA 2H43A 1IFMA 2MKVA 1SQXG 1MFZA 3Q3DA 1L0LG 2CK3H 2KS1A 2KSJA 3MUDA 3F5HA 4I2LC 1SQXE 3TSIA 3I55P 1BGYJ 4OVNF 1GL2C 3CWBJ 1IFIA 1N8RQ 1ZN5A 2E5TA 2NPSA 1QEXA 1LT1A 5CHXA 5APWA 2M5AA 5AVSB 2RH0A 3U1CA 2WPSA 5KLVK 1RF1A 2WVRA 3H1JJ 2BASA 3VMAA 1SQQE 5AW7B 3H1JG 3AEGC 3W68A 5KJ7C 2IYPA 4N3YB 3S9OA 1KILE 2B87A 3V2QA 1Q90D 1VQLP 3L72J 2WSFH 3L72G 4PD4E 1KFMA 3L75D 3OJAB 1PZQA 1SQVD 3H32A 1HVVA 3GHGA 1OXZA 2UWJE 3G3ZA 3PRJA 4WVZA 1NAFA 2POHA 5AW3B 3Q1MA 1GDTA 1FZBA 2H89C 1USEA 5KAFH 1DEBA 3E1RA 2IZ1A 4WY4B 3L74G 4AQRD 3CL3D 4D6TJ 4I6MC 1FOSF 3IF4A 2P10A 3VYIA 5DJTB 2FYUG 1VF5B 1BSHA 1YITP 1WT6A 2FYNB 2O3JA 2XNDH 1NTZK 2Z4EA 4M3LA 1FZCB 3E7KA 1SQVG 3L75G 4L76A 1X22A 2R3SA 3O8ZA 5KJ7D 1JMMA 2QJPC 3IAOA 1MFTA 2L91A 2XZRA 3QWOC 4L75A 2HR3A 3V2RA 1NTZD 3M0DA 5GTIE 1NU1E 3MP7B 5TISH 3TF5A 1YJNP 2HG5D 3B5NC 5E79H
chains in the Genus database with same CATH topology
1JY3O 2A45H 4XA4A 1CI6B 2WT7A 2YO2A 1L0NK 1GU4A 2OYIB 1SFCD 2HLOA 1DH3A 1AFOA 1NOHA 1E5WA 3VP8A 2KLVA 1J1DC 3HD7D 1YYCA 3IFMA 1M1JC 3H32B 2Q9IA 4I1LA 2C9NY 3KPEA 2WT7B 3WMM0 1JCDA 3HE4B 5AVQB 1FJPA 2JJLA 5BU5A 1LTAC 3T97A 2OYHB 1SQQK 1NH4A 1FZFA 2N1TD 1FJKA 1T2KC 1KILD 3RK2B 2I1KA 1RE4C 4Y99B 2ZXEB 1FBMA 1JY2O 4AYCA 1RF1C 3HTKB 3A5TA 2N9BA 2WSEH 2XV5A 1OWAA 5APQA 1HBWA 2KP8A 4O9BA 2P67A 4N78D 2FFDC 3HE4A 2C0XA 3NTNA 3M91A 1KILC 1N2DC 2OARA 2IFMA 4JYBA 3N7NA 3RL0B 3MIWA 2A45I 2YKOA 2OYHA 3M0DC 2HODB 2ZFCA 1IO4A 1IFDA 2J58A 1CW5A 2GUVA 2GUSA 2FFDA 3NFQA 2KYVA 4WB4A 1SLQA 2R32A 1X79B 1N73B 2WITA 2HPCB 3V4WA 2Z5IA 1IJDB 5AVYB 1T3UA 3R2PA 1FZGA 5AW4B 2LKMA 3OAKA 4HH2A 2W6AA 5AVVB 1LTGC 3II6A 2CPSA 3A7OA 3P8CD 5AW2B 4WY4A 3KDPB 1JY3P 1PFIA 4OH8B 3BRVB 1L4AD 1LGHB 3RK2D 2Z5HA 2NPSC 3A3YB 3BATA 4N78E 2WPRA 4ZKPA 1LWUB 4N6JA 1VPCA 3E1IA 5AVZB 1KZUB 4W7YA 1FU1A 1M1JA 1GL2B 1HWTC 1IFNA 1GU5A 3CLQA 2H7HA 4B86A 3GHGB 3LIDA 2W27A 1URQC 5AVUB 4AUWA 1W2EA 1GK4A 2YKPA 1N73C 3B8EB 2C0WA 1SFCB 1M1JB 5BU8B 3VMZA 3M9HA 3HD7A 5CCHC 2YNYA 1LTJB 3M06A 3CI9A 1SQPK 2E42A 1JCCA 2M8RA 4IFFA 2O1JA 3RK2C 5CJ4A 5CCHA 3L37A 1JY2N 4LC1A 5AVXB 2P2UA 3I5CA 1JUNA 3KQGA 2N1TC 3UIAA 4W7ZA 2I1JA 1LTSC 3P8CE 1T2KD 1EQ7A 1N7SD 5CCGA 5BVZA 3HUSB 3M9BA 1GL2A 3OA7A 4AQRD 3M0AA 3N4XA 1XTGB 1URQD 2YKQA 1SVFA 3V5BA 1URQB 3VTPC 2IPPA 2HODA 4DOJA 3NMDA 3EFGA 3VP9A 2WSCH 2P7JA 1JTHA 1RY3A 1N7SB 2MJZA 1SQXK 3P7KA 3V4QA 4IFMA 2WWWA 1IC2A 2E43A 1L4AA 1HTLC 1NKNA 1LTJA 3HE5A 1H89A 3L4FA 2OYHC 4RESB 3HD7B 1FZCC 1M7LA 5APYA 1LT9B 3TNUB 1YTZI 1GTWA 2N1TA 4W80A 5KTBA 1LWUC 4C46A 2VRSA 3B5ND 2KOGA 4Y99C 1JY2P 1MZ9A 2M3BA 1A02J 3U1AA 5APTA 3NXSA 5AW1B 2QM7A 1X9VA 1A02F 3B5NB 1SFCC 4HYTB 2FYUK 1LTBC 1NWQA 1HGVA 2HYNA 1JNMA 3HRNA 1HH0A 1FAVA 1LWUA 5AW6B 1JO5A 2XKMA 1GD2E 1FOSE 2OYIA 5CCGC 4WY4D 1L0LK 3RK3C 2Q5UA 1FZAA 1HGZA 1X8YA 4C7NA 1L4AC 3VN0A 1NO4A 4IFDK 3EQ2A 1GK6A 1NKZB 1QL1A 1WRGA 4LLHA 5AVWB 2XDJA 1G1JA 3VMXA 4C7NB 1QL2A 3IR9A 3HE5B 3M9QA 5CMZA 5AVTB 3TK1A 1RF0C 1NU1K 3C9IA 3V2NA 1G2CA 1SQBK 1SQVK 1MV8A 4EIJA 2YO3A 5APVA 2WTYA 3L36A 3V2PA 1JY3N 4GIFA 1FZCA 1RF1B 4XE5B 2WZ7A 1HUCA 2HFED 1IFJA 2Q7CA 1H88A 3MD0A 1CSBA 3RK3B 3MGNA 1NTMK 3BRTB 3U59A 2Q3IA 1ZR2A 2H8PD 1LT9C 1RE3A 2L5GB 2PAJA 5AW5B 1LTIC 3LIEA 4EOTA 2WPQA 1J2JB 1KQLA 2KB7P 1FZEA 3RL0D 3VMYA 3SWFA 2GM4A 4DZOA 2FXMA 3GHGC 1YTZT 1ZR4A 1GW4A 1RE4A 1NTKK 5AW9B 3HUSA 4LGDE 1N73A 3L35A 2NPSD 2OYIC 1GL2D 4GT1A 1LTJC 1XTCC 1URQA 3BASA 4JYCA 1GZLA 2XNXA 1Z56A 2PP6A 1G2CB 2R3CA 3TNUA 1J1DB 1AQ5A 1FDMA 1J1EC 1RF0A 3MTUE 5APUA 3LW5H 1LT9A 1RE3C 1H8AA 2R5BA 2IFNA 1L4AB 1NHLA 2O01H 3PP5A 2FYZA 3HTKA 1KILB 5AVRB 2FKWB 1KFNA 4ZKUA 2N1TB 1GW3A 5CCHD 2FFDB 2YMYA 3H6PA 5AW0B 1G1IA 1JOCA 1VDFA 2R5DA 5KJ7A 1ZLLA 3HUSC 2HPCA 2IX7C 4WBAA 1KILA 3B5NA 2A45G 3VOPA 2NPSB 4JF7A 1N7SA 1N7LA 1ZV8A 5CCGD 5APXA 1LTTC 1CZQA 1T8ZA 4GKGA 3BVHA 3KYQA 1SFCA 2P1JA 5AW8B 2J59M 2QM8A 1IK9A 3A2AA 1N7SC 2O1KA 1S9KD 3HD7C 1MUUA 1S9KE 2JEEA 1SP4A 3P8MC 3RK3D 1J1EB 1JTHB 4KHXA 5APSA 4C7RA 4WY4C 1HJBA 1N86A 5CJ0A 2CPBA 2XU6A 3TYYA 3RL0C 2C9LY 1DX7A 1CI6A 3P32A 3SWYA 2W6BA 1T3JA 2H43A 1IFMA 1MFZA 3MUDA 2KSJA 3TSIA 4I2LC 1GL2C 1IFIA 1ZN5A 2NPSA 5CHXA 5APWA 5AVSB 3U1CA 2WPSA 5KLVK 1RF1A 2BASA 5AW7B 5KJ7C 4N3YB 3V2QA 2WSFH 1KFMA 3OJAB 3H32A 1HVVA 3GHGA 1OXZA 3G3ZA 5AW3B 1NAFA 2POHA 1GDTA 1FZBA 1DEBA 4WY4B 3CL3D 4I6MC 1FOSF 3VYIA 1WT6A 1NTZK 2Z4EA 4M3LA 1FZCB 3O8ZA 5KJ7D 1JMMA 2XZRA 3V2RA 3M0DA 2HG5D 3B5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK2 D;  1KIL B;  3B5N B;  1SFC C;  2NPS C;  4N78 E;  2N1T B;  5CCH D;  2YMY A;  1SFC D;  4W7Y A;  5KJ7 A;  1GL2 B;  3HD7 D;  1L4A D;  1KIL A;  5CCG C;  3B5N A;  4WY4 D;  3VOP A;  2NPS B;  3RK3 C;  4JF7 A;  1N7S A;  5CCG D;  1URQ C;  1L4A C;  3KYQ A;  1SFC A;  1SFC B;  2N1T D;  2XDJ A;  3HD7 A;  5CCH C;  1KIL D;  1N7S C;  3RK2 B;  3HD7 C;  3RK3 D;  3HTK B;  1JTH B;  4WY4 C;  2M8R A;  3RK2 C;  5CCH A;  3RL0 C;  2N1T C;  4W7Z A;  2WZ7 A;  2HFE D;  3P8C E;  1T3J A;  3RK3 B;  3TSI A;  1N7S D;  1KIL C;  5CCG A;  1GL2 C;  2H8P D;  3RL0 B;  2NPS A;  1GL2 A;  1XTG B;  1URQ D;  3M0D C;  1URQ B;  5KJ7 C;  3RL0 D;  1JTH A;  1N7S B;  1HVV A;  4LGD E;  2NPS D;  1L4A A;  4WY4 B;  1GL2 D;  3HD7 B;  1URQ A;  2PP6 A;  2N1T A;  4W80 A;  5KJ7 D;  3B5N D;  4WY4 A;  2KOG A;  1L4A B;  2HG5 D;  4OH8 B;  3B5N C;  1NHL A;  3PP5 A; 
#chains in the Genus database with same CATH topology
 1JY3 O;  1OZH A;  1SQB G;  5EFW B;  2A45 H;  4XA4 A;  1CI6 B;  2K9J A;  1W5C E;  2WT7 A;  4WBA A;  4H0L B;  2YO2 A;  3L74 J;  1L0N K;  1VQP P;  1GU4 A;  2Y0D A;  1BDC A;  2OYI B;  1DD4 A;  2M3E A;  1U7M A;  2V7Q H;  3S4R A;  3AE7 C;  2AEM A;  1SFC D;  1SQX D;  2HLO A;  3TGU D;  1IZN B;  1FZG A;  1NOH A;  1DH3 A;  3GW6 A;  3K5B A;  1AFO A;  1E5W A;  1VF5 D;  3VP8 A;  3CCL P;  2KLV A;  1J1D C;  1ZRT E;  2JDI H;  1QVG O;  3HD7 D;  2QSI A;  1YYC A;  3IFM A;  1M1J C;  3H32 B;  2Q9I A;  4I1L A;  3CXH D;  1PP9 E;  2KUB A;  2C9N Y;  2IBZ I;  3H1I D;  3KPE A;  2WT7 B;  3WMM 0;  1JCD A;  3H1I J;  3HE4 B;  5AVQ B;  1FJP A;  1L0L E;  2O01 J;  1KB9 E;  2JJL A;  5BU5 A;  2KI7 B;  2M0B A;  1EDI A;  1LTA C;  2WMM A;  1OVV A;  3T97 A;  2JR8 A;  2OYH B;  1SQQ K;  1BE3 D;  2KNC B;  2N9Y B;  1NH4 A;  3JCU E;  1FZF A;  1IK7 A;  3L71 G;  1SQX J;  2E75 B;  3AEE C;  4DCK A;  3CX5 I;  1PPJ G;  2N1T D;  3GF3 A;  3GMA A;  2ZAE B;  1FJK A;  4K3A A;  3CCJ P;  1T2K C;  3O6Q A;  1KIL D;  3FWN A;  4L73 A;  2Q1K A;  2I1K A;  3RK2 B;  2BEZ F;  3L73 D;  2B88 A;  1K9M Q;  1KV4 A;  1RE4 C;  4Y99 B;  2FYN C;  1FBM A;  2ZXE B;  1JY2 O;  3CXH H;  4AYC A;  2KSE A;  1RF1 C;  2JKV A;  3HTK B;  3A5T A;  1VQ6 P;  5GTH E;  1ZME C;  1FS0 E;  1PGQ A;  1NTM G;  2N9B A;  1W2B O;  4NPE A;  2WSE H;  1EXI A;  2QEX P;  2Y0E A;  1NU1 D;  1VQ4 P;  2OTJ P;  3JC2 2;  1UII A;  1L0N J;  2XV5 A;  1OWA A;  1ZXG A;  1L2P A;  2BCC G;  3IN6 A;  4UB8 H;  2OQQ A;  5APQ A;  3R4Y A;  3RBX A;  1PP9 J;  1USD A;  3L70 G;  4JPZ B;  1P84 E;  1HBW A;  2KP8 A;  4O9B A;  2P67 A;  1SQQ J;  1S3J A;  3H1K D;  4N78 D;  2FFD C;  3HE4 A;  3D71 A;  3B71 A;  1YJ9 P;  5B66 E;  2C0X A;  1KIL C;  2OAR A;  2Q3E A;  1N2D C;  3M91 A;  2IFM A;  1E79 H;  3NTN A;  1NTZ J;  2R44 A;  4KT0 J;  4JYB A;  3N7N A;  3RL0 B;  3T97 B;  4ZMD A;  3Q5P A;  2ZVO B;  3MIW A;  1YHQ P;  2A45 I;  2W6J H;  2YKO A;  3H1H G;  4PD4 I;  2OYH A;  3M0D C;  2HOD B;  2ZFC A;  1SQP J;  1BE3 J;  3LW5 J;  1IO4 A;  1S2E A;  1IFD A;  1S4X A;  2J58 A;  1DD3 A;  2K37 A;  2GUV A;  2GUS A;  3TDK A;  3NFQ A;  4HJG H;  2AEJ A;  2KYV A;  1SLQ A;  2J5U A;  2KXP B;  4WB4 A;  4RJT A;  4ZNC A;  1YQ4 C;  2E74 C;  2D2C D;  1OW7 A;  2R32 A;  1X79 B;  1N73 B;  1K73 Q;  2AXT E;  1DEE G;  1TU3 F;  2IDB A;  2WIT A;  1NAY A;  5KLV E;  3V4W A;  2Z5I A;  2HPC B;  1IJD B;  3CD6 P;  1L0N D;  1T3U A;  1LNQ A;  2ZT9 D;  1SQV J;  3R2P A;  2IBZ D;  5AVY B;  5AW4 B;  5KLV D;  5KLV J;  2LKM A;  1SS1 A;  1L0N G;  3OAK A;  5KLV G;  2ZJS E;  4H44 C;  3I56 P;  3L75 E;  4HH2 A;  1DIP A;  4YXW H;  2W6A A;  5AVV B;  1S72 P;  4U3F J;  2A06 G;  1LTG C;  3II6 A;  3A0B H;  1R8E A;  2FYU E;  2CPS A;  4OGQ B;  3A7O A;  1EZV E;  3P8C D;  1X0T A;  5AW2 B;  4WY4 A;  5KLI B;  1KYO I;  2E76 B;  3KDP B;  1JY3 P;  1PFI A;  3D70 A;  4OH8 B;  3BRV B;  1L4A D;  3H1H D;  1LGH B;  2E76 D;  2JP3 A;  1SQP E;  2W83 C;  3PTZ A;  3RK2 D;  1QGK B;  2Z5H A;  4I7Z B;  2NPS C;  3A3Y B;  3BAT A;  3H1K E;  4N78 E;  2WPR A;  4OGQ D;  3H1I E;  4NPF X;  2E75 D;  3RGU A;  4ZKP A;  1LWU B;  4YPC A;  4N6J A;  1SQQ G;  1VPC A;  3E1I A;  1JM0 A;  2AEF A;  5AVZ B;  1QX8 A;  2IBZ E;  1NTK E;  2WSC J;  1KZU B;  3F89 A;  3H1K G;  4W7Y A;  1FU1 A;  1M1J A;  1NVO A;  2W90 A;  1GL2 B;  3AE3 C;  1HWT C;  1IFN A;  1GU5 A;  1KB9 I;  3CLQ A;  2H7H A;  2YXQ B;  1ZP0 C;  4B86 A;  3GHG B;  1Q82 Q;  2FBW C;  1D7M A;  4WWI A;  1VQ7 P;  3LID A;  4EDF A;  2W27 A;  2QJP B;  2W8Z A;  2RN0 A;  3L75 J;  2ZYG A;  3PLN A;  1URQ C;  1JB0 J;  1KOR A;  5AVU B;  2D2C B;  4EYY Q;  1P84 H;  4AUW A;  1W2E A;  4UB6 E;  1NTM D;  1GK4 A;  2ITA A;  2YKP A;  4QMA A;  1N73 C;  5C39 A;  3B8E B;  1YQ3 C;  1MKM A;  2C0W A;  2WSE J;  2KLU A;  2YXR B;  3A0H H;  1SFC B;  1M1J B;  5BU8 B;  1AJY A;  2LR2 A;  1OIP A;  3VMZ A;  2QJK B;  1EDK A;  3W67 A;  3M9H A;  3HD7 A;  5CCH C;  1EC5 A;  3FX0 A;  2YNY A;  1NTK G;  1OFC X;  3CWB D;  1LTJ B;  3WU2 E;  3M06 A;  5L8R J;  4DT0 A;  1PPJ D;  1SQP K;  3C1L A;  3CI9 A;  3L71 J;  5KLI C;  2E42 A;  4R4M A;  2FY8 A;  1JCC A;  1BE3 E;  2K3R A;  3H1L J;  3CME P;  3CC2 P;  1GMJ A;  5KAI H;  1FDO A;  1L0N E;  2PGD A;  4D6T E;  1Q2N A;  3BCC G;  4TT3 H;  3SFE C;  2M8R A;  1YIJ P;  1AV1 A;  3O6Q B;  3BCC E;  2E76 C;  4IFF A;  4L74 A;  3WUU A;  3H1H E;  3CCQ P;  2O1J A;  3RK2 C;  2E74 D;  5CJ4 A;  5CCH A;  3L37 A;  1SQP D;  4U3F G;  1JY2 N;  1SQV E;  4LC1 A;  2P2U A;  3I5C A;  5AVX B;  1JUN A;  3EFF K;  4PD4 H;  3KQG A;  1VQ5 P;  2N1T C;  2QE7 H;  3A0H E;  4U3F E;  4W7Z A;  3UIA A;  2I1J A;  1LTS C;  3AEB C;  3P8C E;  1VL2 A;  3USS A;  2B9B A;  5GTI H;  2QA4 P;  3TGU G;  3G6E P;  1T2K D;  1EQ7 A;  1N7S D;  2Y0C A;  5BVZ A;  5CCG A;  3HUS B;  1H0T A;  1BGY G;  1K04 A;  3FGA D;  4BXL A;  4D6T G;  3M9B A;  1GL2 A;  3OA7 A;  2KNC A;  3AEC C;  3CX5 D;  3M0A A;  1XTG B;  1URQ D;  1SQB D;  2KK7 A;  3N4X A;  4PV1 B;  3RK3 E;  2YKQ A;  1SVF A;  2KZI A;  3CMA P;  3V5B A;  1EXJ A;  2QRX A;  4PV1 D;  1URQ B;  3VTP C;  1NTZ G;  4GOD A;  2IPP A;  2D2C C;  2HOD A;  4DOJ A;  3NMD A;  3EFG A;  1NTK J;  4KJM A;  3VP9 A;  2WSC H;  2P7J A;  1JTH A;  1RY3 A;  1N7S B;  2MJZ A;  3AE9 C;  1SQX K;  2WPV B;  3L70 E;  3P7K A;  3S1K A;  3V4Q A;  4IFM A;  3H1H J;  1H0T B;  2WWW A;  1IC2 A;  1KYO H;  2E75 C;  5B5E H;  2E43 A;  2FYU D;  2G8Y A;  4RKU J;  1L4A A;  1HTL C;  1NKN A;  1PGP A;  1LTJ A;  3SFD C;  3HE5 A;  3L74 D;  3FXE A;  5KKZ B;  1HJ0 A;  3L4F A;  4RES B;  1H89 A;  2PRR A;  3HD7 B;  2OYH C;  1KYO D;  3AE4 C;  3L74 E;  1M7L A;  1NTM E;  5APY A;  1LT9 B;  1FZC C;  1Q81 Q;  1KYO E;  3TNU B;  1YTZ I;  5B5E E;  1BCC E;  2E74 B;  2N1T A;  1GTW A;  3RBZ A;  2AXT H;  4W80 A;  2B89 A;  3L72 D;  5E79 E;  1P84 D;  3AE2 C;  5KTB A;  2QJY C;  1M56 D;  1LWU C;  1ZOY C;  1Y9B A;  2G3A A;  2KOG A;  2VRS A;  3B5N D;  4Y99 C;  4C46 A;  1JY2 P;  1MZ9 A;  3H1J D;  1FDI A;  2AXC A;  1YI2 P;  1KB9 H;  2M3B A;  1QLE D;  1A02 J;  3U1A A;  1KD1 Q;  5APT A;  2YMK A;  3MUD C;  3NXS A;  4H13 B;  5AW1 B;  1VQM P;  2QM7 A;  2Q6Q A;  1BGY E;  1X9V A;  1A02 F;  1KC8 Q;  1PV3 A;  3B5N B;  5K5G B;  1SFC C;  4HYT B;  1BGY D;  2FYU K;  1LTB C;  2V4H A;  4D6T D;  3D6Z A;  1PIX A;  3G71 P;  1NWQ A;  2B87 B;  1HGV A;  2HYN A;  2NRG A;  1JNM A;  1P84 I;  3HRN A;  1HH0 A;  1L0L D;  1RQV A;  3JSV C;  4YTP C;  1BDD A;  1FAV A;  1Y8A A;  1LWU A;  1K05 A;  2JWA A;  2XKM A;  1NU1 J;  1RH5 B;  1S1C X;  5AW6 B;  3TGU J;  1FOS E;  1GD2 E;  1CW5 A;  2OYI A;  5CCG C;  1FE6 A;  3CCM P;  4WY4 D;  1L0L K;  3RK3 C;  4RO0 A;  5GTH H;  3AE5 C;  1VQN P;  1SQP G;  4HB1 A;  4U3F D;  2Q5U A;  2ZVN B;  2I8D A;  2NZ2 A;  1BCC J;  1FZA A;  1HGZ A;  1AVO A;  1X8Y A;  1NTM J;  1L4A C;  3B4S A;  4C7N A;  3BCC D;  3Q5R A;  1OMI A;  3VN0 A;  2SPZ A;  1NJI Q;  4R4L A;  4UB8 E;  1NO4 A;  4IFD K;  3EQ2 A;  2M5A B;  1GK6 A;  3CXH E;  1KQG B;  1NKZ B;  1QL1 A;  1WRG A;  3H1L E;  4LLH A;  2XDJ A;  2ZYA A;  5AVW B;  3PH0 A;  1G1J A;  3CWB G;  2RMZ A;  1NTK D;  1M1K Q;  1Y47 A;  3VMX A;  4C7N B;  1OVR A;  1QL2 A;  2P58 A;  3IR9 A;  1JO5 A;  3HE5 B;  3M9Q A;  5CMZ A;  3KXD A;  1KTM A;  4H0L C;  2OTK E;  3L73 E;  5AVT B;  3TK1 A;  4CPG A;  1RF0 C;  1ZRT D;  5B66 H;  1SQB J;  1NU1 K;  1VQ8 P;  3C9I A;  3CCS P;  3V2N A;  1G2C A;  3D6Y A;  4PJ0 E;  1SQB K;  1KMI Z;  1SQB E;  1UIX A;  5H2F H;  2FXP A;  1U7J A;  4PV1 C;  1SQV K;  1EDL A;  1MV8 A;  3FWL A;  3H1L G;  3CCU P;  4Y28 J;  4EIJ A;  2YO3 A;  1QVF O;  5APV A;  2WQY C;  3L36 A;  3V2P A;  2WTY A;  1JY3 N;  2WSS H;  4GIF A;  3CPW O;  1M90 Q;  3RL0 g;  4HKZ H;  1KQS O;  1FZC A;  1RF1 B;  2K9Y A;  3JCU H;  4XE5 B;  2ZT9 B;  2WZ7 A;  3AEF C;  4I7Z C;  1HUC A;  2HFE D;  1IFJ A;  4XFJ A;  2Q7C A;  2BEQ D;  1H88 A;  2O01 N;  3MD0 A;  1HF9 A;  1CSB A;  3RK3 B;  2ZT9 C;  1SQQ D;  3H1K J;  3MGN A;  4OGQ C;  3SWK A;  4YXD C;  3ABV C;  3G9R A;  1M8O B;  2OTL P;  1R5S A;  1NTM K;  1BSN A;  3BRT B;  4H44 D;  2Q3I A;  1U57 A;  4JQ0 D;  3U59 A;  4Z1M H;  1ZR2 A;  1M57 D;  2H8P D;  2JWD A;  1LT9 C;  1LP1 A;  1RE3 A;  2ZYD A;  3A0B E;  5TJH A;  5KKZ C;  1VQO P;  1L0L J;  4OWF A;  2L5G B;  3AED C;  2PAJ A;  5AW5 B;  1LTI C;  3LIE A;  2BCC E;  5KAF E;  5M1B A;  4EOT A;  1T6A A;  2WPQ A;  1AVY A;  2RKL A;  1J2J B;  1KQL A;  2KB7 P;  1FZE A;  3RL0 D;  1PP9 G;  3L70 J;  3VMY A;  3SWF A;  4DZO A;  2FXM A;  1PPJ E;  3GHG C;  2GM4 A;  1YTZ T;  2A06 D;  3AE6 C;  2OGU A;  3SSU A;  1BCC D;  3CX5 E;  1GW4 A;  1RE4 A;  1NTK K;  5AW9 B;  1ZR4 A;  3CC7 P;  3HUS A;  1OX3 A;  2FYU J;  4LGD E;  1N73 A;  3L35 A;  3QH9 A;  1EZV D;  3PHL A;  1JMB A;  2FFD A;  2QJY B;  2V7Q J;  4UB6 H;  1AA0 A;  2NPS D;  2QJK C;  2QG4 A;  1KB9 D;  2FXO A;  2IBZ G;  1GL2 D;  4GT1 A;  2YIU C;  5CBO A;  1LTJ C;  1XTC C;  4PJ0 H;  1URQ A;  3BAS A;  4JYC A;  1GZL A;  5H2F E;  1EZV G;  1RHZ B;  2XNX A;  4ASW A;  4GOF A;  1Z56 A;  2PP6 A;  3GG2 A;  3OW2 O;  2HPC A;  2A06 E;  1G2C B;  2YIU B;  2R3C A;  3TNU A;  1BCC G;  1J1D B;  3L71 E;  4BRY A;  3H25 A;  1AQ5 A;  1J1E C;  1NYH A;  1RF0 A;  3MTU E;  4GDO A;  5APU A;  3LW5 H;  1FDM A;  1LT9 A;  1PP9 D;  1RE3 C;  2OYO A;  1H8A A;  3GLM A;  2PFX A;  2R5B A;  3EWK A;  3TGU E;  4TLF A;  2IFN A;  3MZW B;  3RK3 D;  3GF7 A;  3CCE P;  1L4A B;  4ASV A;  2K88 A;  3V6I A;  1S5L E;  1NHL A;  2O01 H;  3PP5 A;  3ITK A;  3Q5S A;  1K8A Q;  2FYZ A;  4IL6 H;  1YBK A;  2KIK A;  3HTK A;  1LJ2 A;  1KIL B;  5AVR B;  2FKW B;  1KFN A;  4BWN A;  1PGJ A;  2N1T B;  3BCC J;  4ZKU A;  3MHV A;  1GW3 A;  5CCH D;  2FFD B;  2YMY A;  2Y9Y A;  3CWB E;  1NTZ E;  4U7J A;  5TIS E;  3WU2 H;  3AE1 C;  3H6P A;  5AW0 B;  1G1I A;  1IFP A;  1JOC A;  1VDF A;  2R5D A;  3ZDM A;  5KJ7 A;  1ZLL A;  2H88 C;  3HUS C;  2LXB A;  3KZI E;  1LP1 B;  2IX7 C;  2IYO A;  4H13 C;  1KIL A;  3L70 D;  3KHU A;  3B5N A;  3CX5 H;  3L72 E;  2A45 G;  5CCG D;  2KZJ A;  3VOP A;  1OVU A;  2NPS B;  4GOE A;  4JF7 A;  1PL5 A;  2BCC D;  1VQK P;  1N7S A;  1N7L A;  1ZV8 A;  4DJG A;  1JEK A;  3H1L D;  4IL6 E;  1S5L X;  2K1A A;  5APX A;  3WUT A;  1LTT C;  1CZQ A;  2KS1 B;  2IZ0 A;  1FC2 C;  1S5L H;  1NU1 G;  3CXH I;  1T8Z A;  3G4S P;  4GKG A;  3BVH A;  3CC4 P;  2QIW A;  3C8V A;  3KYQ A;  5CBN A;  1PGO A;  1KQF B;  1R5L A;  4MN4 C;  1SFC A;  2P1J A;  5AW8 B;  2J59 M;  3WUV A;  1YJW P;  2Y9Z A;  2LXC B;  4PD4 D;  4BRY B;  2QM8 A;  1IK9 A;  2GA1 A;  3PJS K;  5DJU B;  3L73 G;  3KZI H;  4K35 A;  3H1J E;  2ZXX A;  3L73 J;  3A2A A;  4H0L D;  4EI2 A;  1N7S C;  2O1K A;  1S9K D;  3HD7 C;  1MUU A;  1OW8 A;  1WMK A;  2QVA A;  4H13 D;  4H44 B;  1Q7Y Q;  1S9K E;  1VF5 C;  3AEA C;  1VQ9 P;  2BCC J;  3L71 D;  1EDJ A;  2JEE A;  1EZV I;  1SP4 A;  1BE3 G;  3P8M C;  1J1E B;  1JTH B;  4IL6 X;  4KHX A;  5APS A;  4WY4 C;  4A7P A;  4C7R A;  1HJB A;  1KN7 A;  2E5Y A;  3Q2Y A;  1N86 A;  5CJ0 A;  2CPB A;  2XU6 A;  2OYI C;  3TYY A;  1ZW0 A;  1RQU A;  1NGM B;  2DW3 A;  3H1I G;  5KAI E;  3RL0 C;  1Q86 Q;  3CCR P;  2C9L Y;  4JBZ A;  2JO1 A;  2WSF J;  4IOI H;  3AE8 C;  1DX7 A;  1CI6 A;  2K9J B;  3FXD A;  3P32 A;  3SWY A;  4NPD A;  1OW6 A;  2W6B A;  3CCV P;  1T3J A;  1AQT A;  2H43 A;  1IFM A;  2MKV A;  1SQX G;  1MFZ A;  3Q3D A;  1L0L G;  2CK3 H;  2KS1 A;  2KSJ A;  3MUD A;  3F5H A;  4I2L C;  1SQX E;  3TSI A;  3I55 P;  1BGY J;  4OVN F;  1GL2 C;  3CWB J;  1IFI A;  1N8R Q;  1ZN5 A;  2E5T A;  2NPS A;  1QEX A;  1LT1 A;  5CHX A;  5APW A;  2M5A A;  5AVS B;  2RH0 A;  3U1C A;  2WPS A;  5KLV K;  1RF1 A;  2WVR A;  3H1J J;  2BAS A;  3VMA A;  1SQQ E;  5AW7 B;  3H1J G;  3AEG C;  3W68 A;  5KJ7 C;  2IYP A;  4N3Y B;  3S9O A;  1KIL E;  2B87 A;  3V2Q A;  1Q90 D;  1VQL P;  3L72 J;  2WSF H;  3L72 G;  4PD4 E;  1KFM A;  3L75 D;  3OJA B;  1PZQ A;  1SQV D;  3H32 A;  1HVV A;  3GHG A;  1OXZ A;  2UWJ E;  3G3Z A;  3PRJ A;  4WVZ A;  1NAF A;  2POH A;  5AW3 B;  3Q1M A;  1GDT A;  1FZB A;  2H89 C;  1USE A;  5KAF H;  1DEB A;  3E1R A;  2IZ1 A;  4WY4 B;  3L74 G;  4AQR D;  3CL3 D;  4D6T J;  4I6M C;  1FOS F;  3IF4 A;  2P10 A;  3VYI A;  5DJT B;  2FYU G;  1VF5 B;  1BSH A;  1YIT P;  1WT6 A;  2FYN B;  2O3J A;  2XND H;  1NTZ K;  2Z4E A;  4M3L A;  1FZC B;  3E7K A;  1SQV G;  3L75 G;  4L76 A;  1X22 A;  2R3S A;  3O8Z A;  5KJ7 D;  1JMM A;  2QJP C;  3IAO A;  1MFT A;  2L91 A;  2XZR A;  3QWO C;  4L75 A;  2HR3 A;  3V2R A;  1NTZ D;  3M0D A;  5GTI E;  1NU1 E;  3MP7 B;  5TIS H;  3TF5 A;  1YJN P;  2HG5 D;  3B5N C;  5E79 H; 
#chains in the Genus database with same CATH homology
 1JY3 O;  2A45 H;  4XA4 A;  1CI6 B;  2WT7 A;  2YO2 A;  1L0N K;  1GU4 A;  2OYI B;  1SFC D;  2HLO A;  1DH3 A;  1AFO A;  1NOH A;  1E5W A;  3VP8 A;  2KLV A;  1J1D C;  3HD7 D;  1YYC A;  3IFM A;  1M1J C;  3H32 B;  2Q9I A;  4I1L A;  2C9N Y;  3KPE A;  2WT7 B;  3WMM 0;  1JCD A;  3HE4 B;  5AVQ B;  1FJP A;  2JJL A;  5BU5 A;  1LTA C;  3T97 A;  2OYH B;  1SQQ K;  1NH4 A;  1FZF A;  2N1T D;  1FJK A;  1T2K C;  1KIL D;  3RK2 B;  2I1K A;  1RE4 C;  4Y99 B;  2ZXE B;  1FBM A;  1JY2 O;  4AYC A;  1RF1 C;  3HTK B;  3A5T A;  2N9B A;  2WSE H;  2XV5 A;  1OWA A;  5APQ A;  1HBW A;  2KP8 A;  4O9B A;  2P67 A;  4N78 D;  2FFD C;  3HE4 A;  2C0X A;  3NTN A;  3M91 A;  1KIL C;  1N2D C;  2OAR A;  2IFM A;  4JYB A;  3N7N A;  3RL0 B;  3MIW A;  2A45 I;  2YKO A;  2OYH A;  3M0D C;  2HOD B;  2ZFC A;  1IO4 A;  1IFD A;  2J58 A;  1CW5 A;  2GUV A;  2GUS A;  2FFD A;  3NFQ A;  2KYV A;  4WB4 A;  1SLQ A;  2R32 A;  1X79 B;  1N73 B;  2WIT A;  2HPC B;  3V4W A;  2Z5I A;  1IJD B;  5AVY B;  1T3U A;  3R2P A;  1FZG A;  5AW4 B;  2LKM A;  3OAK A;  4HH2 A;  2W6A A;  5AVV B;  1LTG C;  3II6 A;  2CPS A;  3A7O A;  3P8C D;  5AW2 B;  4WY4 A;  3KDP B;  1JY3 P;  1PFI A;  4OH8 B;  3BRV B;  1L4A D;  1LGH B;  3RK2 D;  2Z5H A;  2NPS C;  3A3Y B;  3BAT A;  4N78 E;  2WPR A;  4ZKP A;  1LWU B;  4N6J A;  1VPC A;  3E1I A;  5AVZ B;  1KZU B;  4W7Y A;  1FU1 A;  1M1J A;  1GL2 B;  1HWT C;  1IFN A;  1GU5 A;  3CLQ A;  2H7H A;  4B86 A;  3GHG B;  3LID A;  2W27 A;  1URQ C;  5AVU B;  4AUW A;  1W2E A;  1GK4 A;  2YKP A;  1N73 C;  3B8E B;  2C0W A;  1SFC B;  1M1J B;  5BU8 B;  3VMZ A;  3M9H A;  3HD7 A;  5CCH C;  2YNY A;  1LTJ B;  3M06 A;  3CI9 A;  1SQP K;  2E42 A;  1JCC A;  2M8R A;  4IFF A;  2O1J A;  3RK2 C;  5CJ4 A;  5CCH A;  3L37 A;  1JY2 N;  4LC1 A;  5AVX B;  2P2U A;  3I5C A;  1JUN A;  3KQG A;  2N1T C;  3UIA A;  4W7Z A;  2I1J A;  1LTS C;  3P8C E;  1T2K D;  1EQ7 A;  1N7S D;  5CCG A;  5BVZ A;  3HUS B;  3M9B A;  1GL2 A;  3OA7 A;  4AQR D;  3M0A A;  3N4X A;  1XTG B;  1URQ D;  2YKQ A;  1SVF A;  3V5B A;  1URQ B;  3VTP C;  2IPP A;  2HOD A;  4DOJ A;  3NMD A;  3EFG A;  3VP9 A;  2WSC H;  2P7J A;  1JTH A;  1RY3 A;  1N7S B;  2MJZ A;  1SQX K;  3P7K A;  3V4Q A;  4IFM A;  2WWW A;  1IC2 A;  2E43 A;  1L4A A;  1HTL C;  1NKN A;  1LTJ A;  3HE5 A;  1H89 A;  3L4F A;  2OYH C;  4RES B;  3HD7 B;  1FZC C;  1M7L A;  5APY A;  1LT9 B;  3TNU B;  1YTZ I;  1GTW A;  2N1T A;  4W80 A;  5KTB A;  1LWU C;  4C46 A;  2VRS A;  3B5N D;  2KOG A;  4Y99 C;  1JY2 P;  1MZ9 A;  2M3B A;  1A02 J;  3U1A A;  5APT A;  3NXS A;  5AW1 B;  2QM7 A;  1X9V A;  1A02 F;  3B5N B;  1SFC C;  4HYT B;  2FYU K;  1LTB C;  1NWQ A;  1HGV A;  2HYN A;  1JNM A;  3HRN A;  1HH0 A;  1FAV A;  1LWU A;  5AW6 B;  1JO5 A;  2XKM A;  1GD2 E;  1FOS E;  2OYI A;  5CCG C;  4WY4 D;  1L0L K;  3RK3 C;  2Q5U A;  1FZA A;  1HGZ A;  1X8Y A;  4C7N A;  1L4A C;  3VN0 A;  1NO4 A;  4IFD K;  3EQ2 A;  1GK6 A;  1NKZ B;  1QL1 A;  1WRG A;  4LLH A;  5AVW B;  2XDJ A;  1G1J A;  3VMX A;  4C7N B;  1QL2 A;  3IR9 A;  3HE5 B;  3M9Q A;  5CMZ A;  5AVT B;  3TK1 A;  1RF0 C;  1NU1 K;  3C9I A;  3V2N A;  1G2C A;  1SQB K;  1SQV K;  1MV8 A;  4EIJ A;  2YO3 A;  5APV A;  2WTY A;  3L36 A;  3V2P A;  1JY3 N;  4GIF A;  1FZC A;  1RF1 B;  4XE5 B;  2WZ7 A;  1HUC A;  2HFE D;  1IFJ A;  2Q7C A;  1H88 A;  3MD0 A;  1CSB A;  3RK3 B;  3MGN A;  1NTM K;  3BRT B;  3U59 A;  2Q3I A;  1ZR2 A;  2H8P D;  1LT9 C;  1RE3 A;  2L5G B;  2PAJ A;  5AW5 B;  1LTI C;  3LIE A;  4EOT A;  2WPQ A;  1J2J B;  1KQL A;  2KB7 P;  1FZE A;  3RL0 D;  3VMY A;  3SWF A;  2GM4 A;  4DZO A;  2FXM A;  3GHG C;  1YTZ T;  1ZR4 A;  1GW4 A;  1RE4 A;  1NTK K;  5AW9 B;  3HUS A;  4LGD E;  1N73 A;  3L35 A;  2NPS D;  2OYI C;  1GL2 D;  4GT1 A;  1LTJ C;  1XTC C;  1URQ A;  3BAS A;  4JYC A;  1GZL A;  2XNX A;  1Z56 A;  2PP6 A;  1G2C B;  2R3C A;  3TNU A;  1J1D B;  1AQ5 A;  1FDM A;  1J1E C;  1RF0 A;  3MTU E;  5APU A;  3LW5 H;  1LT9 A;  1RE3 C;  1H8A A;  2R5B A;  2IFN A;  1L4A B;  1NHL A;  2O01 H;  3PP5 A;  2FYZ A;  3HTK A;  1KIL B;  5AVR B;  2FKW B;  1KFN A;  4ZKU A;  2N1T B;  1GW3 A;  5CCH D;  2FFD B;  2YMY A;  3H6P A;  5AW0 B;  1G1I A;  1JOC A;  1VDF A;  2R5D A;  5KJ7 A;  1ZLL A;  3HUS C;  2HPC A;  2IX7 C;  4WBA A;  1KIL A;  3B5N A;  2A45 G;  3VOP A;  2NPS B;  4JF7 A;  1N7S A;  1N7L A;  1ZV8 A;  5CCG D;  5APX A;  1LTT C;  1CZQ A;  1T8Z A;  4GKG A;  3BVH A;  3KYQ A;  1SFC A;  2P1J A;  5AW8 B;  2J59 M;  2QM8 A;  1IK9 A;  3A2A A;  1N7S C;  2O1K A;  1S9K D;  3HD7 C;  1MUU A;  1S9K E;  2JEE A;  1SP4 A;  3P8M C;  3RK3 D;  1J1E B;  1JTH B;  4KHX A;  5APS A;  4C7R A;  4WY4 C;  1HJB A;  1N86 A;  5CJ0 A;  2CPB A;  2XU6 A;  3TYY A;  3RL0 C;  2C9L Y;  1DX7 A;  1CI6 A;  3P32 A;  3SWY A;  2W6B A;  1T3J A;  2H43 A;  1IFM A;  1MFZ A;  3MUD A;  2KSJ A;  3TSI A;  4I2L C;  1GL2 C;  1IFI A;  1ZN5 A;  2NPS A;  5CHX A;  5APW A;  5AVS B;  3U1C A;  2WPS A;  5KLV K;  1RF1 A;  2BAS A;  5AW7 B;  5KJ7 C;  4N3Y B;  3V2Q A;  2WSF H;  1KFM A;  3OJA B;  3H32 A;  1HVV A;  3GHG A;  1OXZ A;  3G3Z A;  5AW3 B;  1NAF A;  2POH A;  1GDT A;  1FZB A;  1DEB A;  4WY4 B;  3CL3 D;  4I6M C;  1FOS F;  3VYI A;  1WT6 A;  1NTZ K;  2Z4E A;  4M3L A;  1FZC B;  3O8Z A;  5KJ7 D;  1JMM A;  2XZR A;  3V2R A;  3M0D A;  2HG5 D;  3B5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...