3RK3B

Truncated snare complex with complexin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
62
structure length
62
Chain Sequence
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vamp2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 29
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rk3B00
3B5NB 3HD7D 1JTHB 3KYQA 5CCHC 3RK2B 1L4AB 1SFCD 5KJ7D 3TSIA 5CCGD 2NPSA 3RK2C 3RL0C 1KILB 1URQA 2NPSC 1KILC 2N1TA 2XDJA 3RK3B 2KOGA 1HVVA 2N1TC 3RK3C 2WZ7A 3P8CE 5CCHD 3B5ND 2H8PD 3RL0B 1GL2A 1N7SA 3RK2D 1L4AD 3RL0D 3VOPA 2NPSB 4W7ZA 1GL2C 1T3JA 4WY4A 1N7SC 1URQB 1KILD 3HD7A 2N1TB 1URQC 4LGDE 1SFCA 2N1TD 5CCGA 5KJ7A 3PP5A 3HD7C 1XTGB 3RK3D 1NHLA 1SFCC 3M0DC 1GL2B 1N7SB 3HTKB 1GL2D 2HG5D 2YMYA 4OH8B 2NPSD 4WY4B 3HD7B 5CCHA 4WY4C 1URQD 3B5NA 1JTHA 1SFCB 2PP6A 1L4AA 3B5NC 5CCGC 5KJ7C 4JF7A 4N78E 1KILA 1L4AC 2M8RA 1N7SD 2HFED 4W7YA 4WY4D 4W80A
chains in the Genus database with same CATH superfamily
3AE4C 2XKMA 1SP4A 1KYOE 3KYQA 2ZT9C 3EFGA 1MFZA 1NTKG 1M8OB 5KAIH 1SQVD 3JSVC 2B89A 3PJSK 1NTMD 1YTZT 3HE5A 3H1LE 1ZR2A 1Q81Q 2JJLA 2GUVA 1EQ7A 5KLVK 2FFDA 3FGAD 3U1CA 3Q1MA 1FZAA 5H2FE 3AEDC 1PPJE 2ZYGA 2QSIA 2A45H 3PH0A 3L73D 1HGVA 3CWBG 1J1EB 3CMEP 3NFQA 1GL2C 1NTZD 1DD3A 1HJ0A 1MZ9A 3ITKA 1RY3A 3EWKA 2BCCD 3MP7B 1LNQA 5AW3B 4M3LA 4H13C 1N86A 1QVGO 3ABVC 1JY2N 2OTJP 2LKMA 1QX8A 3L70D 1EDLA 1SQXK 3H1JD 1JCCA 1T3UA 1AA0A 2Q3EA 5CCHA 5AW0B 4WY4C 1VQOP 3CPWO 3CI9A 1PPJG 1IFMA 1SFCB 2QE7H 1HUCA 3AE7C 3PRJA 1L4AA 1A02F 2C9NY 5APUA 3CX5D 3BATA 2YXRB 1NGMB 1L0NK 1BE3E 2Q6QA 1LTJA 5APTA 4YTPC 2WITA 1S1CX 5TISH 4Z1MH 3MIWA 1U7MA 2E42A 4H13D 2N9BA 3TSIA 2E75D 1Y9BA 2FXPA 1CI6A 2E74B 1OIPA 2E43A 1H89A 2K3RA 2NPSC 1KQGB 2NZ2A 5KKZC 1OWAA 4I6MC 3Q5PA 4U3FE 2WZ7A 1OVUA 1IFPA 2H88C 2JO1A 5GTIH 1VQLP 4KT0J 4ZNCA 2H8PD 4CPGA 1FE6A 3M9HA 1KYOD 1NO4A 3RK2D 3VOPA 3F89A 4W7ZA 1ZRTE 1T3JA 1LTTC 5APXA 4DCKA 1W2BO 1GK4A 1YYCA 2L91A 4D6TJ 2XZRA 1LTGC 1IC2A 3SFDC 1N8RQ 2WQYC 4C46A 1KB9I 2OYOA 5KAIE 3AEFC 4C7RA 3M9BA 1PPJD 3TNUB 1FZCA 2IX7C 2OGUA 4EOTA 4WB4A 1JB0J 2O01J 1FZEA 2NPSD 2HPCB 2J59M 3L35A 3GF7A 3S1KA 3AE9C 4HJGH 3TGUJ 5AVTB 2W83C 2KP8A 1IK7A 2M8RA 1Q82Q 3MUDC 5AVXB 3VMAA 2OYHC 1DEBA 1N73B 5KLVJ 3I55P 4H44B 1LJ2A 2PRRA 2ZVOB 3BRTB 2KI7B 4AUWA 2M0BA 4GOEA 1FC2C 4PJ0H 3TK1A 2N1TA 2WPVB 2IFMA 4WWIA 4BRYA 1BE3D 3JC22 2WSEJ 3SWFA 1RE3C 1BDDA 3B8EB 1VF5C 2N9YB 3RL0B 1X79B 1RF1B 4JYBA 1KZUB 4JQ0D 1ZLLA 1JY3P 2OYIC 2GM4A 5TISE 1PV3A 1YQ3C 3H32A 3VN0A 1L0LJ 5AW8B 1JM0A 4Y28J 2OQQA 2WSFH 1SQXJ 2G3AA 2P1JA 4U3FD 2RH0A 2WWWA 1S3JA 1PZQA 1FDIA 3N7NA 3D6YA 1IFIA 1ZRTD 3GG2A 1PP9E 1AV1A 2JDIH 3CD6P 3H1KJ 3KQGA 5GTIE 3HUSB 5B66H 1VQ7P 3CMAP 1S2EA 3T97B 2Q1KA 2ZYAA 3AE5C 3QWOC 3GLMA 3CC7P 1YBKA 3NXSA 3TGUG 1USEA 1FOSF 3Q3DA 2FYUE 5CCHC 1DIPA 2HODB 2KLVA 2LXCB 2MJZA 2K9YA 2IZ0A 3L75J 1KILB 1KFNA 3ZDMA 1M57D 2HR3A 1LT9B 1YJ9P 4YXWH 3SSUA 1RQVA 1NKZB 2QJKB 1SQQE 1KQLA 5KLVG 3D6ZA 2A06G 2FXOA 2IDBA 3PLNA 4ASVA 1GL2A 1T6AA 3CXHD 2W6BA 1URQB 1S9KE 1WT6A 2JR8A 3GHGB 2FYUG 3PP5A 2YNYA 1FZFA 2KZJA 1W2EA 1AJYA 3FXDA 1LWUB 4PJ0E 1IO4A 5CJ0A 2ZYDA 3LIDA 3CCLP 2IBZE 1JEKA 2WT7B 1G1JA 1YJNP 1SLQA 4L76A 5DJTB 4PD4H 2CK3H 3B5NC 2Y9ZA 1IFDA 3PTZA 2M5AA 1JO5A 5AVRB 1GW4A 2FYNC 1L0NG 1EC5A 4NPFX 4OGQB 3C8VA 3L74J 2ZT9B 1NKNA 1M1JC 2I1KA 2AXTH 1RF0C 1HJBA 1NTME 2J5UA 2KXPB 1YJWP 3R2PA 1VQKP 2NPSA 2FYZA 1YQ4C 2A06D 2AEMA 1U57A 4L74A 1JMMA 3IF4A 5B66E 3B5ND 1LP1A 5AW4B 2FYUD 3RL0D 2AEFA 2BCCE 1JY3O 2R3SA 2Q7CA 3L71G 2QJPC 2ZFCA 3HD7C 3F5HA 3L70E 3H1JE 3P32A 2E76B 2LXBA 3BCCJ 2P2UA 4WY4B 2KIKA 3H6PA 1QL2A 4BWNA 2QIWA 4HB1A 5APVA 1AVOA 2R5BA 3USSA 1L0ND 2IYOA 2OTKE 3H1LJ 3CC4P 1NTKE 2FXMA 3RL0g 3MUDA 3CX5I 2HFED 4K3AA 1GU4A 2OYHA 2K37A 2IBZD 4GT1A 3HD7D 1GMJA 2PGDA 4DZOA 2FY8A 4TT3H 3CCSP 2R44A 1VQNP 1QGKB 1ZXGA 2BASA 3L74G 3CWBE 1X0TA 1RE3A 3RK3E 5GTHH 2KS1B 1BGYJ 3L72J 5DJUB 2WSCJ 4PD4E 3AEBC 3D71A 1AFOA 3CCMP 5L8RJ 1EZVE 3L71D 2YO2A 1SQPK 2OYIA 2WSSH 4JBZA 1N7SC 1JY2P 1IK9A 3H1IE 1OXZA 3M9QA 1T8ZA 5AW7B 1FJPA 2AXTE 1VPCA 1DD4A 2P67A 4QMAA 3HTKB 1PGQA 4IOIH 3S9OA 1YITP 1EZVG 1NU1K 1R8EA 1BCCG 3C1LA 2E75C 4A7PA 3CXHH 4H0LC 4JF7A 4K35A 3JCUH 1L0LK 3AE6C 3H1IG 1SQBG 2PAJA 3PHLA 2D2CB 2V7QJ 2YIUB 1N7SD 5APYA 1QEXA 5CBNA 1A02J 4C7NB 3HE4B 1H0TB 2Z5HA 1J2JB 1Q7YQ 3TNUA 3RK2C 1K05A 2B87A 2O1KA 5APSA 1OZHA 1NTKD 3FWLA 1EXJA 1OW7A 2C0XA 2E5TA 3WMM0 4UB6H 4PV1B 4B86A 4H0LD 2W6AA 1JCDA 1X22A 4YPCA 2K9JA 2B88A 1G2CA 3HE5B 1KFMA 4Y99B 2FFDB 3E1IA 3CWBD 3RK3D 4WBAA 1EDKA 2M3BA 1XTCC 4PD4D 1H8AA 1EZVD 2E76D 1BCCD 5GTHE 2KSEA 4GIFA 2Y0DA 3B5NA 2WSEH 1JTHA 3H1ID 3S4RA 1SQBD 1TU3F 1AQTA 3W68A 1SQVK 5KTBA 1NTMK 1WMKA 2Y9YA 2YMKA 1M1JA 1RF0A 2YKQA 2QJYB 3CCQP 4N3YB 1L4AB 5CCGD 1IJDB 2ZXEB 3A2AA 3O8ZA 1OMIA 1ZOYC 2AXCA 1LTJB 1NTZK 3WUTA 3CCUP 3P8MC 1SQPJ 2A45I 2Y0EA 3QH9A 5E79H 2CPBA 2HLOA 4AQRD 3TDKA 3CXHE 1NOHA 2P7JA 1MFTA 3P8CD 3JCUE 3C9IA 1J1DB 1CI6B 3H1HJ 3VTPC 1M7LA 1NVOA 3AE3C 3HD7A 3FX0A 1GD2E 3W67A 1JY2O 1PP9J 4D6TE 1SFCC 5C39A 3RBXA 5KLIC 1FJKA 5AW1B 1D7MA 1P84I 1NU1J 3V2NA 4OH8B 1KQSO 1GDTA 4UB6E 1NYHA 3TGUE 2JWAA 5B5EH 5K5GB 1GZLA 1BSHA 1FZBA 3GMAA 3D70A 4I2LC 2E74C 2WPSA 4D6TG 1FZCB 3Q5RA 2XU6A 3CCEP 3CCRP 3WU2H 1SQQJ 1K8AQ 1LTIC 2D2CD 3I56P 5AW2B 4KHXA 1LGHB 3L37A 1SFCD 5KLVE 1JOCA 1YIJP 2QM7A 2A06E 2DW3A 1E79H 2C0WA 1VL2A 4R4MA 2R5DA 1DH3A 4L73A 1L2PA 1KQFB 1ZR4A 1FDOA 4RESB 3KXDA 1GW3A 3AE2C 2KNCA 2YKPA 1LTSC 3BVHA 2ZVNB 1IFNA 1N7SA 1EDJA 4PV1D 2QJPB 2E74D 4ZKUA 2KZIA 2N1TB 2P58A 2Q5UA 3V5BA 1AVYA 4LGDE 4BRYB 4HH2A 2WTYA 1NH4A 1SQXE 1QLED 1HBWA 2LR2A 3E1RA 1PFIA 4UB8H 2YMYA 1FZGA 2QA4P 2ZXXA 2OARA 1SQVJ 3WUUA 2WSFJ 1L0NE 3H32B 5E79E 1S5LX 1NTMJ 3H1KE 3L36A 2WPRA 4D6TD 2AEJA 1DEEG 1N73C 4H44C 4N78D 1L0LG 3L73J 1SQXG 4O9BA 4EIJA 1U7JA 1LTAC 3IR9A 1NTZJ 3U59A 3LW5J 3M91A 1KILE 3L75E 3RL0C 2IBZI 3FWNA 1RF1C 2UWJE 2BCCJ 3TGUD 1VQ8P 3B4SA 2XNXA 3A0HH 3H1KG 2YXQB 3K5BA 1HF9A 4IL6X 3L71E 3L70J 1EXIA 3AE1C 5B5EE 3H1JJ 1FU1A 3SWKA 4H44D 5KLVD 1S5LH 1PL5A 1JUNA 3WU2E 2ZAEB 5AVUB 5CCGA 4BXLA 3L75G 2GUSA 3V4QA 5KAFH 3M0DC 3HUSC 5M1BA 1GL2B 3NTNA 5AVZB 4R4LA 4KJMA 1QL1A 2FBWC 4H13B 1OFCX 2E75B 2WSCH 1RE4C 2W27A 1S4XA 1Y8AA 2KLUA 3VP8A 4WVZA 4OVNF 1L0LD 2W90A 1SQXD 2K88A 2V4HA 4IL6H 1CW5A 1JMBA 1FS0E 2JWDA 1LT9C 3O6QB 3L74E 2CPSA 1PIXA 3RK2B 5KJ7D 5BU5A 3MHVA 3AECC 3MGNA 4ZKPA 4UB8E 3H1KD 1FBMA 2M5AB 2C9LY 1M90Q 5APQA 2WMMA 3GHGC 1M1KQ 1KORA 3VMXA 2GA1A 2NPSB 3V2QA 1UIIA 2W6JH 5KKZB 4I7ZC 3U1AA 1KILD 5AVWB 3L75D 3KHUA 3A7OA 2V7QH 1ZMEC 1SFCA 2N1TD 3EFFK 1LTBC 1MV8A 1ZP0C 2JKVA 1LP1B 1BCCE 4XFJA 1KB9H 2MKVA 3BCCE 1MKMA 4PD4I 1KMIZ 3A0HE 1HTLC 1T2KC 1KYOI 1URQD 4OGQC 1SQBE 1NAFA 3B71A 1EZVI 2I1JA 1Q90D 3KZIH 4LC1A 1BE3J 4RO0A 1S5LE 5CMZA 1Y47A 3N4XA 1M56D 4W80A 1K73Q 5KAFE 2BEQD 4L75A 3BCCG 1VQ6P 2FYUK 3G6EP 1S72P 3A0BH 2IPPA 3Q2YA 2XNDH 3RK3C 4U3FJ 1BGYE 1T2KD 2OYHB 4OGQD 3L72E 3P8CE 2ZT9D 5AW6B 3L74D 3H1LG 2PFXA 1RHZB 1SQQK 3AE8C 4IL6E 3G4SP 2E76C 1FAVA 2HPCA 1P84H 1OW6A 3V2PA 2O01H 1QVFO 2O1JA 2HYNA 1VF5B 4EI2A 4JPZB 5KLIB 5CHXA 2QRXA 1GK6A 1HWTC 5TJHA 2OYIB 1NJIQ 2RMZA 1GL2D 2Z4EA 2RN0A 3I5CA 1BGYG 3L72G 5APWA 1Q86Q 3CC2P 1PGPA 1X8YA 5CJ4A 3TYYA 1N73A 3GW6A 3EQ2A 2KSJA 5CCGC 5AVQB 1GTWA 3MTUE 5AVSB 3BCCD 4WY4D 2ITAA 4TLFA 1BE3G 3UIAA 1RF1A 4RKUJ 1DX7A 4GDOA 3SFEC 1KB9E 1PGJA 3II6A 3VP9A 2KOGA 3H1LD 1HVVA 4OWFA 2XV5A 1BSNA 1OX3A 3FXEA 1IFJA 2WVRA 1E5WA 3KZIE 2SPZA 2YO3A 5AVYB 1EDIA 1J1EC 1KV4A 4U3FG 2B87B 3GF3A 5KJ7A 3WUVA 1NWQA 3M0DA 3HUSA 3AEGC 1BGYD 4GOFA 3IFMA 3L72D 3T97A 3RBZA 3A0BE 2QG4A 2K9JB 2HG5D 1G2CB 2KYVA 2D2CC 1KN7A 3Q5SA 2FKWB 2YIUC 1RE4A 1MUUA 3CXHI 1USDA 2PP6A 2HODA 2QM8A 1ZV8A 4N78E 1KILA 1ZN5A 4IFDK 1LT9A 3AEEC 5AW5B 2JEEA 1P84E 1RH5B 3OW2O 2A45G 1NTKK 2WPQA 3B5NB 2H89C 3MZWB 2FYUJ 1JTHB 4YXDC 1H88A 1NAYA 3TF5A 3MD0A 1HH0A 2B9BA 4ASWA 3VYIA 2FYNB 4PV1C 3VMYA 3KPEA 1URQA 3GHGA 1R5LA 2M3EA 4EDFA 2BEZF 2JP3A 1M1JB 1SQPE 4Y99C 2FFDC 1LWUA 1K9MQ 2KB7P 3BRVB 3V4WA 1SVFA 1OW8A 3H1HE 4JYCA 2WT7A 1KB9D 3BASA 1L0NJ 1XTGB 2H43A 1VF5D 3VMZA 1JY3N 1CSBA 2QEXP 1SQBK 3LW5H 4RJTA 5EFWB 1OVRA 1NU1E 2Y0CA 1G1IA 1SQPG 1RQUA 4DJGA 2Q3IA 2P10A 2YKOA 3HD7B 1K04A 3G9RA 1OVVA 1L0LE 1N2DC 4DT0A 4AYCA 1KD1Q 2QJYC 4I1LA 3NMDA 1X9VA 1L4AC 2R32A 3H1HG 4XE5B 3HRNA 1KTMA 3KDPB 1PP9G 3L4FA 1LTJC 3CX5H 3L71J 1JNMA 1W5CE 3M06A 3IN6A 1VQPP 3A3YB 1VQ9P 1NU1G 2IZ1A 2RKLA 1J1DC 3LIEA 3G71P 2XDJA 1YI2P 2J58A 5CBOA 4XA4A 1FOSE 1GU5A 3P7KA 1P84D 3IAOA 4LLHA 5CCHD 1BDCA 4NPEA 4I7ZB 1Z56A 1L4AD 4GODA 1SQQG 4WY4A 3O6QA 4HYTB 2H7HA 3CCJP 3SWYA 4ZMDA 2L5GB 1KYOH 1SQPD 3V6IA 2KNCB 1N7SB 1PGOA 2KK7A 2POHA 3R4YA 1FZCC 2QVAA 3H1HD 3V2RA 1WRGA 1Q2NA 1SQVE 5AVVB 5H2FH 2IYPA 1PP9D 5KJ7C 2G8YA 1R5SA 2IBZG 2Z5IA 1NTKJ 1VQ4P 1HGZA 2KS1A 2R3CA 1YTZI 4W7YA 1VQ5P 1NU1D 3L73E 2Q9IA 1N7LA 5AW9B 4H0LB 1ZW0A 1FDMA 1NTZE 2IFNA 3CCVP 1KC8Q 1YHQP 3OJAB 3CWBJ 1CZQA 1KILC 3CLQA 1IZNB 4U7JA 1SQVG 3RK3B 2N1TC 2O3JA 1NTMG 4GKGA 3RGUA 2QJKC 1SQQD 3H25A 1BCCJ 2I8DA 3HTKA 4IFFA 3E7KA 3L73G 3H1IJ 1SQBJ 4N6JA 1URQC 3AEAC 3CX5E 1S9KD 1NTZG 2E5YA 1NHLA 2O01N 2BCCG 2VRSA 3CL3D 4NPDA 1LWUC 2KUBA 1VDFA 1SS1A 2K1AA 2NRGA 4C7NA 3HE4A 3L70G 1H0TA 4HKZH 5BVZA 3A5TA 1UIXA 3H1JG 3OAKA 3OA7A 1VQMP 2ZJSE 3G3ZA 4MN4C 5BU8B 4DOJA 4EYYQ 3M0AA 2OTLP 1LT1A 1AQ5A 2W8ZA 4IFMA
chains in the Genus database with same CATH topology
2XKMA 1NKNA 1SP4A 1M1JC 3KYQA 2I1KA 5AW2B 3EFGA 4KHXA 1RF0C 1MFZA 1HJBA 1LGHB 3L37A 3UIAA 1SFCD 1RF1A 1JOCA 1DX7A 3R2PA 2QM7A 2NPSA 2FYZA 2C0WA 3II6A 1YTZT 3HE5A 1ZR2A 2JJLA 2GUVA 1EQ7A 2R5DA 5KLVK 3VP9A 2KOGA 2FFDA 3U1CA 1DH3A 1JMMA 1HVVA 1FZAA 1ZR4A 2XV5A 4RESB 1GW3A 2YKPA 1LTSC 2A45H 3B5ND 1IFJA 1HGVA 1E5WA 3BVHA 1J1EB 1IFNA 1N7SA 5AW4B 2YO3A 3RL0D 3NFQA 5AVYB 1J1EC 1GL2C 4ZKUA 1JY3O 2Q7CA 2N1TB 1MZ9A 3V5BA 1RY3A 2Q5UA 2ZFCA 4LGDE 5AW3B 5KJ7A 3HD7C 4M3LA 1NWQA 1N86A 3M0DA 3HUSA 4HH2A 2WTYA 1NH4A 1HBWA 1JY2N 3IFMA 3T97A 2LKMA 1PFIA 3P32A 1SQXK 2HG5D 1JCCA 2P2UA 2YMYA 4WY4B 1FZGA 1G2CB 1T3UA 2KYVA 3H6PA 5CCHA 5AW0B 2FKWB 1RE4A 4WY4C 2OARA 3CI9A 1QL2A 1MUUA 1IFMA 1SFCB 3H32B 1HUCA 5APVA 2PP6A 2HODA 2QM8A 1L4AA 1A02F 1ZV8A 3L36A 2C9NY 2WPRA 5APUA 2R5BA 1N73C 3BATA 4N78E 1KILA 1ZN5A 1L0NK 4IFDK 2FXMA 1LT9A 4N78D 1LTJA 3MUDA 5AW5B 2JEEA 5APTA 2HFED 2WITA 1GU4A 2OYHA 2A45G 4O9BA 1NTKK 3MIWA 4EIJA 2WPQA 3B5NB 4GT1A 2E42A 3HD7D 1JTHB 1LTAC 3IR9A 2N9BA 4DZOA 1H88A 3TSIA 3MD0A 1HH0A 3U59A 3M91A 3VYIA 3RL0C 1CI6A 1RF1C 2E43A 1H89A 3VMYA 3KPEA 1URQA 2BASA 2NPSC 3GHGA 1OWAA 1RE3A 2XNXA 4I6MC 1M1JB 4Y99C 2FFDC 2WZ7A 1AFOA 1LWUA 2KB7P 3BRVB 3V4WA 2H8PD 1FU1A 3M9HA 2YO2A 1SQPK 2OYIA 1NO4A 3RK2D 3VOPA 4W7ZA 1SVFA 1T3JA 1LTTC 5APXA 1N7SC 4JYCA 2WT7A 1GK4A 1YYCA 1JY2P 1JUNA 1IK9A 3BASA 5AVUB 1OXZA 5CCGA 2XZRA 1LTGC 1XTGB 1IC2A 2H43A 3M9QA 1T8ZA 5AW7B 4C46A 1FJPA 3VMZA 2GUSA 1JY3N 3V4QA 1VPCA 3M0DC 1CSBA 3HUSC 2P67A 1SQBK 1GL2B 3LW5H 4C7RA 3M9BA 3HTKB 3TNUB 1FZCA 3NTNA 2IX7C 1G1IA 4EOTA 4WB4A 5AVZB 1FZEA 2NPSD 1QL1A 2Q3IA 2YKOA 2HPCB 3HD7B 2J59M 3L35A 1NU1K 2WSCH 1N2DC 1RE4C 2W27A 4AYCA 3VP8A 5AVTB 4JF7A 4I1LA 3NMDA 1X9VA 1L4AC 2R32A 4XE5B 2KP8A 3HRNA 1L0LK 3KDPB 2PAJA 1CW5A 2M8RA 1N7SD 5APYA 3L4FA 1LT9C 1LTJC 5AVXB 1A02J 1JNMA 4C7NB 3HE4B 2CPSA 2Z5HA 3M06A 2OYHC 1J2JB 1DEBA 1N73B 3RK2B 5KJ7D 3A3YB 5BU5A 3BRTB 3TNUA 4AUWA 3RK2C 3MGNA 4ZKPA 1FBMA 2C9LY 3TK1A 1J1DC 2N1TA 3LIEA 2O1KA 2XDJA 5APQA 2J58A 2IFMA 5APSA 4XA4A 1FOSE 3SWFA 1GU5A 3GHGC 1RE3C 3B8EB 2C0XA 3P7KA 3WMM0 4LLHA 5CCHD 3RL0B 4B86A 1X79B 1RF1B 3VMXA 2W6AA 1JCDA 1Z56A 4JYBA 1L4AD 2NPSB 1KZUB 3V2QA 4WY4A 1G2CA 1ZLLA 1JY3P 3U1AA 3HE5B 2OYIC 1KILD 5AVWB 4HYTB 2H7HA 2GM4A 3A7OA 1KFMA 4Y99B 2FFDB 1SFCA 2N1TD 3H32A 3SWYA 3E1IA 3VN0A 5AW8B 3RK3D 2L5GB 1LTBC 1MV8A 2WSFH 4WBAA 2M3BA 1XTCC 2P1JA 2WWWA 1H8AA 1N7SB 3N7NA 1IFIA 2POHA 1FZCC 4GIFA 1HTLC 1T2KC 1URQD 3B5NA 2WSEH 1WRGA 3V2RA 1JTHA 1NAFA 5AVVB 2I1JA 3KQGA 3HUSB 5KJ7C 2Z5IA 1SQVK 4LC1A 5KTBA 5CMZA 1NTMK 1HGZA 3N4XA 2R3CA 1YTZI 1M1JA 3NXSA 4W7YA 1RF0A 4W80A 1FOSF 2Q9IA 1N7LA 2YKQA 5AW9B 5CCHC 2HODB 2KLVA 2MJZA 4N3YB 1FDMA 1L4AB 5CCGD 1IJDB 2ZXEB 2IFNA 3A2AA 3O8ZA 1KILB 1KFNA 3OJAB 2FYUK 1KILC 1CZQA 3CLQA 1LT9B 1LTJB 2IPPA 1NTZK 3RK3B 3P8MC 1NKZB 2N1TC 1KQLA 4GKGA 3RK3C 2A45I 1T2KD 2OYHB 2CPBA 3P8CE 2HLOA 5AW6B 4AQRD 1NOHA 2P7JA 1GL2A 3P8CD 1SQQK 3HTKA 3C9IA 1J1DB 2W6BA 4IFFA 1CI6B 3VTPC 1M7LA 1URQB 1S9KE 1FAVA 2HPCA 1WT6A 3HD7A 1GD2E 3V2PA 1JY2O 3GHGB 2O01H 2O1JA 4N6JA 1URQC 1S9KD 2HYNA 2YNYA 3PP5A 1FZFA 1W2EA 1NHLA 5CHXA 1SFCC 1LWUB 1FJKA 1GK6A 2VRSA 5AW1B 3CL3D 1HWTC 1LWUC 1IO4A 2OYIB 5CJ0A 1VDFA 3V2NA 1GL2D 2Z4EA 3LIDA 3I5CA 4OH8B 5APWA 2WT7B 1G1JA 4C7NA 3HE4A 1X8YA 1SLQA 5BVZA 3TYYA 5CJ4A 3A5TA 1GDTA 1N73A 3OAKA 3EQ2A 3OA7A 2KSJA 3B5NC 5CCGC 1IFDA 3G3ZA 1GZLA 5AVQB 1FZBA 5BU8B 4DOJA 1JO5A 5AVRB 1GW4A 4I2LC 1GTWA 3MTUE 2WPSA 1FZCB 5AVSB 3M0AA 2XU6A 1AQ5A 1LTIC 4IFMA 4WY4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N B;  3HD7 D;  1JTH B;  3KYQ A;  5CCH C;  3RK2 B;  1L4A B;  1SFC D;  5KJ7 D;  3TSI A;  5CCG D;  2NPS A;  3RK2 C;  3RL0 C;  1KIL B;  1URQ A;  2NPS C;  1KIL C;  2N1T A;  2XDJ A;  3RK3 B;  2KOG A;  1HVV A;  2N1T C;  3RK3 C;  2WZ7 A;  3P8C E;  5CCH D;  3B5N D;  2H8P D;  3RL0 B;  1GL2 A;  1N7S A;  3RK2 D;  1L4A D;  3RL0 D;  3VOP A;  2NPS B;  4W7Z A;  1GL2 C;  1T3J A;  4WY4 A;  1N7S C;  1URQ B;  1KIL D;  3HD7 A;  2N1T B;  1URQ C;  4LGD E;  1SFC A;  2N1T D;  5CCG A;  5KJ7 A;  3PP5 A;  3HD7 C;  1XTG B;  3RK3 D;  1NHL A;  1SFC C;  3M0D C;  1GL2 B;  1N7S B;  3HTK B;  1GL2 D;  2HG5 D;  2YMY A;  4OH8 B;  2NPS D;  4WY4 B;  3HD7 B;  5CCH A;  4WY4 C;  1URQ D;  3B5N A;  1JTH A;  1SFC B;  2PP6 A;  1L4A A;  3B5N C;  5CCG C;  5KJ7 C;  4JF7 A;  4N78 E;  1KIL A;  1L4A C;  2M8R A;  1N7S D;  2HFE D;  4W7Y A;  4WY4 D;  4W80 A; 
#chains in the Genus database with same CATH topology
 3AE4 C;  2XKM A;  1SP4 A;  1KYO E;  3KYQ A;  2ZT9 C;  3EFG A;  1MFZ A;  1NTK G;  1M8O B;  5KAI H;  1SQV D;  3JSV C;  2B89 A;  3PJS K;  1NTM D;  1YTZ T;  3HE5 A;  3H1L E;  1ZR2 A;  1Q81 Q;  2JJL A;  2GUV A;  1EQ7 A;  5KLV K;  2FFD A;  3FGA D;  3U1C A;  3Q1M A;  1FZA A;  5H2F E;  3AED C;  1PPJ E;  2ZYG A;  2QSI A;  2A45 H;  3PH0 A;  3L73 D;  1HGV A;  3CWB G;  1J1E B;  3CME P;  3NFQ A;  1GL2 C;  1NTZ D;  1DD3 A;  1HJ0 A;  1MZ9 A;  3ITK A;  1RY3 A;  3EWK A;  2BCC D;  3MP7 B;  1LNQ A;  5AW3 B;  4M3L A;  4H13 C;  1N86 A;  1QVG O;  3ABV C;  1JY2 N;  2OTJ P;  2LKM A;  1QX8 A;  3L70 D;  1EDL A;  1SQX K;  3H1J D;  1JCC A;  1T3U A;  1AA0 A;  2Q3E A;  5CCH A;  5AW0 B;  4WY4 C;  1VQO P;  3CPW O;  3CI9 A;  1PPJ G;  1IFM A;  1SFC B;  2QE7 H;  1HUC A;  3AE7 C;  3PRJ A;  1L4A A;  1A02 F;  2C9N Y;  5APU A;  3CX5 D;  3BAT A;  2YXR B;  1NGM B;  1L0N K;  1BE3 E;  2Q6Q A;  1LTJ A;  5APT A;  4YTP C;  2WIT A;  1S1C X;  5TIS H;  4Z1M H;  3MIW A;  1U7M A;  2E42 A;  4H13 D;  2N9B A;  3TSI A;  2E75 D;  1Y9B A;  2FXP A;  1CI6 A;  2E74 B;  1OIP A;  2E43 A;  1H89 A;  2K3R A;  2NPS C;  1KQG B;  2NZ2 A;  5KKZ C;  1OWA A;  4I6M C;  3Q5P A;  4U3F E;  2WZ7 A;  1OVU A;  1IFP A;  2H88 C;  2JO1 A;  5GTI H;  1VQL P;  4KT0 J;  4ZNC A;  2H8P D;  4CPG A;  1FE6 A;  3M9H A;  1KYO D;  1NO4 A;  3RK2 D;  3VOP A;  3F89 A;  4W7Z A;  1ZRT E;  1T3J A;  1LTT C;  5APX A;  4DCK A;  1W2B O;  1GK4 A;  1YYC A;  2L91 A;  4D6T J;  2XZR A;  1LTG C;  1IC2 A;  3SFD C;  1N8R Q;  2WQY C;  4C46 A;  1KB9 I;  2OYO A;  5KAI E;  3AEF C;  4C7R A;  3M9B A;  1PPJ D;  3TNU B;  1FZC A;  2IX7 C;  2OGU A;  4EOT A;  4WB4 A;  1JB0 J;  2O01 J;  1FZE A;  2NPS D;  2HPC B;  2J59 M;  3L35 A;  3GF7 A;  3S1K A;  3AE9 C;  4HJG H;  3TGU J;  5AVT B;  2W83 C;  2KP8 A;  1IK7 A;  2M8R A;  1Q82 Q;  3MUD C;  5AVX B;  3VMA A;  2OYH C;  1DEB A;  1N73 B;  5KLV J;  3I55 P;  4H44 B;  1LJ2 A;  2PRR A;  2ZVO B;  3BRT B;  2KI7 B;  4AUW A;  2M0B A;  4GOE A;  1FC2 C;  4PJ0 H;  3TK1 A;  2N1T A;  2WPV B;  2IFM A;  4WWI A;  4BRY A;  1BE3 D;  3JC2 2;  2WSE J;  3SWF A;  1RE3 C;  1BDD A;  3B8E B;  1VF5 C;  2N9Y B;  3RL0 B;  1X79 B;  1RF1 B;  4JYB A;  1KZU B;  4JQ0 D;  1ZLL A;  1JY3 P;  2OYI C;  2GM4 A;  5TIS E;  1PV3 A;  1YQ3 C;  3H32 A;  3VN0 A;  1L0L J;  5AW8 B;  1JM0 A;  4Y28 J;  2OQQ A;  2WSF H;  1SQX J;  2G3A A;  2P1J A;  4U3F D;  2RH0 A;  2WWW A;  1S3J A;  1PZQ A;  1FDI A;  3N7N A;  3D6Y A;  1IFI A;  1ZRT D;  3GG2 A;  1PP9 E;  1AV1 A;  2JDI H;  3CD6 P;  3H1K J;  3KQG A;  5GTI E;  3HUS B;  5B66 H;  1VQ7 P;  3CMA P;  1S2E A;  3T97 B;  2Q1K A;  2ZYA A;  3AE5 C;  3QWO C;  3GLM A;  3CC7 P;  1YBK A;  3NXS A;  3TGU G;  1USE A;  1FOS F;  3Q3D A;  2FYU E;  5CCH C;  1DIP A;  2HOD B;  2KLV A;  2LXC B;  2MJZ A;  2K9Y A;  2IZ0 A;  3L75 J;  1KIL B;  1KFN A;  3ZDM A;  1M57 D;  2HR3 A;  1LT9 B;  1YJ9 P;  4YXW H;  3SSU A;  1RQV A;  1NKZ B;  2QJK B;  1SQQ E;  1KQL A;  5KLV G;  3D6Z A;  2A06 G;  2FXO A;  2IDB A;  3PLN A;  4ASV A;  1GL2 A;  1T6A A;  3CXH D;  2W6B A;  1URQ B;  1S9K E;  1WT6 A;  2JR8 A;  3GHG B;  2FYU G;  3PP5 A;  2YNY A;  1FZF A;  2KZJ A;  1W2E A;  1AJY A;  3FXD A;  1LWU B;  4PJ0 E;  1IO4 A;  5CJ0 A;  2ZYD A;  3LID A;  3CCL P;  2IBZ E;  1JEK A;  2WT7 B;  1G1J A;  1YJN P;  1SLQ A;  4L76 A;  5DJT B;  4PD4 H;  2CK3 H;  3B5N C;  2Y9Z A;  1IFD A;  3PTZ A;  2M5A A;  1JO5 A;  5AVR B;  1GW4 A;  2FYN C;  1L0N G;  1EC5 A;  4NPF X;  4OGQ B;  3C8V A;  3L74 J;  2ZT9 B;  1NKN A;  1M1J C;  2I1K A;  2AXT H;  1RF0 C;  1HJB A;  1NTM E;  2J5U A;  2KXP B;  1YJW P;  3R2P A;  1VQK P;  2NPS A;  2FYZ A;  1YQ4 C;  2A06 D;  2AEM A;  1U57 A;  4L74 A;  1JMM A;  3IF4 A;  5B66 E;  3B5N D;  1LP1 A;  5AW4 B;  2FYU D;  3RL0 D;  2AEF A;  2BCC E;  1JY3 O;  2R3S A;  2Q7C A;  3L71 G;  2QJP C;  2ZFC A;  3HD7 C;  3F5H A;  3L70 E;  3H1J E;  3P32 A;  2E76 B;  2LXB A;  3BCC J;  2P2U A;  4WY4 B;  2KIK A;  3H6P A;  1QL2 A;  4BWN A;  2QIW A;  4HB1 A;  5APV A;  1AVO A;  2R5B A;  3USS A;  1L0N D;  2IYO A;  2OTK E;  3H1L J;  3CC4 P;  1NTK E;  2FXM A;  3RL0 g;  3MUD A;  3CX5 I;  2HFE D;  4K3A A;  1GU4 A;  2OYH A;  2K37 A;  2IBZ D;  4GT1 A;  3HD7 D;  1GMJ A;  2PGD A;  4DZO A;  2FY8 A;  4TT3 H;  3CCS P;  2R44 A;  1VQN P;  1QGK B;  1ZXG A;  2BAS A;  3L74 G;  3CWB E;  1X0T A;  1RE3 A;  3RK3 E;  5GTH H;  2KS1 B;  1BGY J;  3L72 J;  5DJU B;  2WSC J;  4PD4 E;  3AEB C;  3D71 A;  1AFO A;  3CCM P;  5L8R J;  1EZV E;  3L71 D;  2YO2 A;  1SQP K;  2OYI A;  2WSS H;  4JBZ A;  1N7S C;  1JY2 P;  1IK9 A;  3H1I E;  1OXZ A;  3M9Q A;  1T8Z A;  5AW7 B;  1FJP A;  2AXT E;  1VPC A;  1DD4 A;  2P67 A;  4QMA A;  3HTK B;  1PGQ A;  4IOI H;  3S9O A;  1YIT P;  1EZV G;  1NU1 K;  1R8E A;  1BCC G;  3C1L A;  2E75 C;  4A7P A;  3CXH H;  4H0L C;  4JF7 A;  4K35 A;  3JCU H;  1L0L K;  3AE6 C;  3H1I G;  1SQB G;  2PAJ A;  3PHL A;  2D2C B;  2V7Q J;  2YIU B;  1N7S D;  5APY A;  1QEX A;  5CBN A;  1A02 J;  4C7N B;  3HE4 B;  1H0T B;  2Z5H A;  1J2J B;  1Q7Y Q;  3TNU A;  3RK2 C;  1K05 A;  2B87 A;  2O1K A;  5APS A;  1OZH A;  1NTK D;  3FWL A;  1EXJ A;  1OW7 A;  2C0X A;  2E5T A;  3WMM 0;  4UB6 H;  4PV1 B;  4B86 A;  4H0L D;  2W6A A;  1JCD A;  1X22 A;  4YPC A;  2K9J A;  2B88 A;  1G2C A;  3HE5 B;  1KFM A;  4Y99 B;  2FFD B;  3E1I A;  3CWB D;  3RK3 D;  4WBA A;  1EDK A;  2M3B A;  1XTC C;  4PD4 D;  1H8A A;  1EZV D;  2E76 D;  1BCC D;  5GTH E;  2KSE A;  4GIF A;  2Y0D A;  3B5N A;  2WSE H;  1JTH A;  3H1I D;  3S4R A;  1SQB D;  1TU3 F;  1AQT A;  3W68 A;  1SQV K;  5KTB A;  1NTM K;  1WMK A;  2Y9Y A;  2YMK A;  1M1J A;  1RF0 A;  2YKQ A;  2QJY B;  3CCQ P;  4N3Y B;  1L4A B;  5CCG D;  1IJD B;  2ZXE B;  3A2A A;  3O8Z A;  1OMI A;  1ZOY C;  2AXC A;  1LTJ B;  1NTZ K;  3WUT A;  3CCU P;  3P8M C;  1SQP J;  2A45 I;  2Y0E A;  3QH9 A;  5E79 H;  2CPB A;  2HLO A;  4AQR D;  3TDK A;  3CXH E;  1NOH A;  2P7J A;  1MFT A;  3P8C D;  3JCU E;  3C9I A;  1J1D B;  1CI6 B;  3H1H J;  3VTP C;  1M7L A;  1NVO A;  3AE3 C;  3HD7 A;  3FX0 A;  1GD2 E;  3W67 A;  1JY2 O;  1PP9 J;  4D6T E;  1SFC C;  5C39 A;  3RBX A;  5KLI C;  1FJK A;  5AW1 B;  1D7M A;  1P84 I;  1NU1 J;  3V2N A;  4OH8 B;  1KQS O;  1GDT A;  4UB6 E;  1NYH A;  3TGU E;  2JWA A;  5B5E H;  5K5G B;  1GZL A;  1BSH A;  1FZB A;  3GMA A;  3D70 A;  4I2L C;  2E74 C;  2WPS A;  4D6T G;  1FZC B;  3Q5R A;  2XU6 A;  3CCE P;  3CCR P;  3WU2 H;  1SQQ J;  1K8A Q;  1LTI C;  2D2C D;  3I56 P;  5AW2 B;  4KHX A;  1LGH B;  3L37 A;  1SFC D;  5KLV E;  1JOC A;  1YIJ P;  2QM7 A;  2A06 E;  2DW3 A;  1E79 H;  2C0W A;  1VL2 A;  4R4M A;  2R5D A;  1DH3 A;  4L73 A;  1L2P A;  1KQF B;  1ZR4 A;  1FDO A;  4RES B;  3KXD A;  1GW3 A;  3AE2 C;  2KNC A;  2YKP A;  1LTS C;  3BVH A;  2ZVN B;  1IFN A;  1N7S A;  1EDJ A;  4PV1 D;  2QJP B;  2E74 D;  4ZKU A;  2KZI A;  2N1T B;  2P58 A;  2Q5U A;  3V5B A;  1AVY A;  4LGD E;  4BRY B;  4HH2 A;  2WTY A;  1NH4 A;  1SQX E;  1QLE D;  1HBW A;  2LR2 A;  3E1R A;  1PFI A;  4UB8 H;  2YMY A;  1FZG A;  2QA4 P;  2ZXX A;  2OAR A;  1SQV J;  3WUU A;  2WSF J;  1L0N E;  3H32 B;  5E79 E;  1S5L X;  1NTM J;  3H1K E;  3L36 A;  2WPR A;  4D6T D;  2AEJ A;  1DEE G;  1N73 C;  4H44 C;  4N78 D;  1L0L G;  3L73 J;  1SQX G;  4O9B A;  4EIJ A;  1U7J A;  1LTA C;  3IR9 A;  1NTZ J;  3U59 A;  3LW5 J;  3M91 A;  1KIL E;  3L75 E;  3RL0 C;  2IBZ I;  3FWN A;  1RF1 C;  2UWJ E;  2BCC J;  3TGU D;  1VQ8 P;  3B4S A;  2XNX A;  3A0H H;  3H1K G;  2YXQ B;  3K5B A;  1HF9 A;  4IL6 X;  3L71 E;  3L70 J;  1EXI A;  3AE1 C;  5B5E E;  3H1J J;  1FU1 A;  3SWK A;  4H44 D;  5KLV D;  1S5L H;  1PL5 A;  1JUN A;  3WU2 E;  2ZAE B;  5AVU B;  5CCG A;  4BXL A;  3L75 G;  2GUS A;  3V4Q A;  5KAF H;  3M0D C;  3HUS C;  5M1B A;  1GL2 B;  3NTN A;  5AVZ B;  4R4L A;  4KJM A;  1QL1 A;  2FBW C;  4H13 B;  1OFC X;  2E75 B;  2WSC H;  1RE4 C;  2W27 A;  1S4X A;  1Y8A A;  2KLU A;  3VP8 A;  4WVZ A;  4OVN F;  1L0L D;  2W90 A;  1SQX D;  2K88 A;  2V4H A;  4IL6 H;  1CW5 A;  1JMB A;  1FS0 E;  2JWD A;  1LT9 C;  3O6Q B;  3L74 E;  2CPS A;  1PIX A;  3RK2 B;  5KJ7 D;  5BU5 A;  3MHV A;  3AEC C;  3MGN A;  4ZKP A;  4UB8 E;  3H1K D;  1FBM A;  2M5A B;  2C9L Y;  1M90 Q;  5APQ A;  2WMM A;  3GHG C;  1M1K Q;  1KOR A;  3VMX A;  2GA1 A;  2NPS B;  3V2Q A;  1UII A;  2W6J H;  5KKZ B;  4I7Z C;  3U1A A;  1KIL D;  5AVW B;  3L75 D;  3KHU A;  3A7O A;  2V7Q H;  1ZME C;  1SFC A;  2N1T D;  3EFF K;  1LTB C;  1MV8 A;  1ZP0 C;  2JKV A;  1LP1 B;  1BCC E;  4XFJ A;  1KB9 H;  2MKV A;  3BCC E;  1MKM A;  4PD4 I;  1KMI Z;  3A0H E;  1HTL C;  1T2K C;  1KYO I;  1URQ D;  4OGQ C;  1SQB E;  1NAF A;  3B71 A;  1EZV I;  2I1J A;  1Q90 D;  3KZI H;  4LC1 A;  1BE3 J;  4RO0 A;  1S5L E;  5CMZ A;  1Y47 A;  3N4X A;  1M56 D;  4W80 A;  1K73 Q;  5KAF E;  2BEQ D;  4L75 A;  3BCC G;  1VQ6 P;  2FYU K;  3G6E P;  1S72 P;  3A0B H;  2IPP A;  3Q2Y A;  2XND H;  3RK3 C;  4U3F J;  1BGY E;  1T2K D;  2OYH B;  4OGQ D;  3L72 E;  3P8C E;  2ZT9 D;  5AW6 B;  3L74 D;  3H1L G;  2PFX A;  1RHZ B;  1SQQ K;  3AE8 C;  4IL6 E;  3G4S P;  2E76 C;  1FAV A;  2HPC A;  1P84 H;  1OW6 A;  3V2P A;  2O01 H;  1QVF O;  2O1J A;  2HYN A;  1VF5 B;  4EI2 A;  4JPZ B;  5KLI B;  5CHX A;  2QRX A;  1GK6 A;  1HWT C;  5TJH A;  2OYI B;  1NJI Q;  2RMZ A;  1GL2 D;  2Z4E A;  2RN0 A;  3I5C A;  1BGY G;  3L72 G;  5APW A;  1Q86 Q;  3CC2 P;  1PGP A;  1X8Y A;  5CJ4 A;  3TYY A;  1N73 A;  3GW6 A;  3EQ2 A;  2KSJ A;  5CCG C;  5AVQ B;  1GTW A;  3MTU E;  5AVS B;  3BCC D;  4WY4 D;  2ITA A;  4TLF A;  1BE3 G;  3UIA A;  1RF1 A;  4RKU J;  1DX7 A;  4GDO A;  3SFE C;  1KB9 E;  1PGJ A;  3II6 A;  3VP9 A;  2KOG A;  3H1L D;  1HVV A;  4OWF A;  2XV5 A;  1BSN A;  1OX3 A;  3FXE A;  1IFJ A;  2WVR A;  1E5W A;  3KZI E;  2SPZ A;  2YO3 A;  5AVY B;  1EDI A;  1J1E C;  1KV4 A;  4U3F G;  2B87 B;  3GF3 A;  5KJ7 A;  3WUV A;  1NWQ A;  3M0D A;  3HUS A;  3AEG C;  1BGY D;  4GOF A;  3IFM A;  3L72 D;  3T97 A;  3RBZ A;  3A0B E;  2QG4 A;  2K9J B;  2HG5 D;  1G2C B;  2KYV A;  2D2C C;  1KN7 A;  3Q5S A;  2FKW B;  2YIU C;  1RE4 A;  1MUU A;  3CXH I;  1USD A;  2PP6 A;  2HOD A;  2QM8 A;  1ZV8 A;  4N78 E;  1KIL A;  1ZN5 A;  4IFD K;  1LT9 A;  3AEE C;  5AW5 B;  2JEE A;  1P84 E;  1RH5 B;  3OW2 O;  2A45 G;  1NTK K;  2WPQ A;  3B5N B;  2H89 C;  3MZW B;  2FYU J;  1JTH B;  4YXD C;  1H88 A;  1NAY A;  3TF5 A;  3MD0 A;  1HH0 A;  2B9B A;  4ASW A;  3VYI A;  2FYN B;  4PV1 C;  3VMY A;  3KPE A;  1URQ A;  3GHG A;  1R5L A;  2M3E A;  4EDF A;  2BEZ F;  2JP3 A;  1M1J B;  1SQP E;  4Y99 C;  2FFD C;  1LWU A;  1K9M Q;  2KB7 P;  3BRV B;  3V4W A;  1SVF A;  1OW8 A;  3H1H E;  4JYC A;  2WT7 A;  1KB9 D;  3BAS A;  1L0N J;  1XTG B;  2H43 A;  1VF5 D;  3VMZ A;  1JY3 N;  1CSB A;  2QEX P;  1SQB K;  3LW5 H;  4RJT A;  5EFW B;  1OVR A;  1NU1 E;  2Y0C A;  1G1I A;  1SQP G;  1RQU A;  4DJG A;  2Q3I A;  2P10 A;  2YKO A;  3HD7 B;  1K04 A;  3G9R A;  1OVV A;  1L0L E;  1N2D C;  4DT0 A;  4AYC A;  1KD1 Q;  2QJY C;  4I1L A;  3NMD A;  1X9V A;  1L4A C;  2R32 A;  3H1H G;  4XE5 B;  3HRN A;  1KTM A;  3KDP B;  1PP9 G;  3L4F A;  1LTJ C;  3CX5 H;  3L71 J;  1JNM A;  1W5C E;  3M06 A;  3IN6 A;  1VQP P;  3A3Y B;  1VQ9 P;  1NU1 G;  2IZ1 A;  2RKL A;  1J1D C;  3LIE A;  3G71 P;  2XDJ A;  1YI2 P;  2J58 A;  5CBO A;  4XA4 A;  1FOS E;  1GU5 A;  3P7K A;  1P84 D;  3IAO A;  4LLH A;  5CCH D;  1BDC A;  4NPE A;  4I7Z B;  1Z56 A;  1L4A D;  4GOD A;  1SQQ G;  4WY4 A;  3O6Q A;  4HYT B;  2H7H A;  3CCJ P;  3SWY A;  4ZMD A;  2L5G B;  1KYO H;  1SQP D;  3V6I A;  2KNC B;  1N7S B;  1PGO A;  2KK7 A;  2POH A;  3R4Y A;  1FZC C;  2QVA A;  3H1H D;  3V2R A;  1WRG A;  1Q2N A;  1SQV E;  5AVV B;  5H2F H;  2IYP A;  1PP9 D;  5KJ7 C;  2G8Y A;  1R5S A;  2IBZ G;  2Z5I A;  1NTK J;  1VQ4 P;  1HGZ A;  2KS1 A;  2R3C A;  1YTZ I;  4W7Y A;  1VQ5 P;  1NU1 D;  3L73 E;  2Q9I A;  1N7L A;  5AW9 B;  4H0L B;  1ZW0 A;  1FDM A;  1NTZ E;  2IFN A;  3CCV P;  1KC8 Q;  1YHQ P;  3OJA B;  3CWB J;  1CZQ A;  1KIL C;  3CLQ A;  1IZN B;  4U7J A;  1SQV G;  3RK3 B;  2N1T C;  2O3J A;  1NTM G;  4GKG A;  3RGU A;  2QJK C;  1SQQ D;  3H25 A;  1BCC J;  2I8D A;  3HTK A;  4IFF A;  3E7K A;  3L73 G;  3H1I J;  1SQB J;  4N6J A;  1URQ C;  3AEA C;  3CX5 E;  1S9K D;  1NTZ G;  2E5Y A;  1NHL A;  2O01 N;  2BCC G;  2VRS A;  3CL3 D;  4NPD A;  1LWU C;  2KUB A;  1VDF A;  1SS1 A;  2K1A A;  2NRG A;  4C7N A;  3HE4 A;  3L70 G;  1H0T A;  4HKZ H;  5BVZ A;  3A5T A;  1UIX A;  3H1J G;  3OAK A;  3OA7 A;  1VQM P;  2ZJS E;  3G3Z A;  4MN4 C;  5BU8 B;  4DOJ A;  4EYY Q;  3M0A A;  2OTL P;  1LT1 A;  1AQ5 A;  2W8Z A;  4IFM A; 
#chains in the Genus database with same CATH homology
 2XKM A;  1NKN A;  1SP4 A;  1M1J C;  3KYQ A;  2I1K A;  5AW2 B;  3EFG A;  4KHX A;  1RF0 C;  1MFZ A;  1HJB A;  1LGH B;  3L37 A;  3UIA A;  1SFC D;  1RF1 A;  1JOC A;  1DX7 A;  3R2P A;  2QM7 A;  2NPS A;  2FYZ A;  2C0W A;  3II6 A;  1YTZ T;  3HE5 A;  1ZR2 A;  2JJL A;  2GUV A;  1EQ7 A;  2R5D A;  5KLV K;  3VP9 A;  2KOG A;  2FFD A;  3U1C A;  1DH3 A;  1JMM A;  1HVV A;  1FZA A;  1ZR4 A;  2XV5 A;  4RES B;  1GW3 A;  2YKP A;  1LTS C;  2A45 H;  3B5N D;  1IFJ A;  1HGV A;  1E5W A;  3BVH A;  1J1E B;  1IFN A;  1N7S A;  5AW4 B;  2YO3 A;  3RL0 D;  3NFQ A;  5AVY B;  1J1E C;  1GL2 C;  4ZKU A;  1JY3 O;  2Q7C A;  2N1T B;  1MZ9 A;  3V5B A;  1RY3 A;  2Q5U A;  2ZFC A;  4LGD E;  5AW3 B;  5KJ7 A;  3HD7 C;  4M3L A;  1NWQ A;  1N86 A;  3M0D A;  3HUS A;  4HH2 A;  2WTY A;  1NH4 A;  1HBW A;  1JY2 N;  3IFM A;  3T97 A;  2LKM A;  1PFI A;  3P32 A;  1SQX K;  2HG5 D;  1JCC A;  2P2U A;  2YMY A;  4WY4 B;  1FZG A;  1G2C B;  1T3U A;  2KYV A;  3H6P A;  5CCH A;  5AW0 B;  2FKW B;  1RE4 A;  4WY4 C;  2OAR A;  3CI9 A;  1QL2 A;  1MUU A;  1IFM A;  1SFC B;  3H32 B;  1HUC A;  5APV A;  2PP6 A;  2HOD A;  2QM8 A;  1L4A A;  1A02 F;  1ZV8 A;  3L36 A;  2C9N Y;  2WPR A;  5APU A;  2R5B A;  1N73 C;  3BAT A;  4N78 E;  1KIL A;  1ZN5 A;  1L0N K;  4IFD K;  2FXM A;  1LT9 A;  4N78 D;  1LTJ A;  3MUD A;  5AW5 B;  2JEE A;  5APT A;  2HFE D;  2WIT A;  1GU4 A;  2OYH A;  2A45 G;  4O9B A;  1NTK K;  3MIW A;  4EIJ A;  2WPQ A;  3B5N B;  4GT1 A;  2E42 A;  3HD7 D;  1JTH B;  1LTA C;  3IR9 A;  2N9B A;  4DZO A;  1H88 A;  3TSI A;  3MD0 A;  1HH0 A;  3U59 A;  3M91 A;  3VYI A;  3RL0 C;  1CI6 A;  1RF1 C;  2E43 A;  1H89 A;  3VMY A;  3KPE A;  1URQ A;  2BAS A;  2NPS C;  3GHG A;  1OWA A;  1RE3 A;  2XNX A;  4I6M C;  1M1J B;  4Y99 C;  2FFD C;  2WZ7 A;  1AFO A;  1LWU A;  2KB7 P;  3BRV B;  3V4W A;  2H8P D;  1FU1 A;  3M9H A;  2YO2 A;  1SQP K;  2OYI A;  1NO4 A;  3RK2 D;  3VOP A;  4W7Z A;  1SVF A;  1T3J A;  1LTT C;  5APX A;  1N7S C;  4JYC A;  2WT7 A;  1GK4 A;  1YYC A;  1JY2 P;  1JUN A;  1IK9 A;  3BAS A;  5AVU B;  1OXZ A;  5CCG A;  2XZR A;  1LTG C;  1XTG B;  1IC2 A;  2H43 A;  3M9Q A;  1T8Z A;  5AW7 B;  4C46 A;  1FJP A;  3VMZ A;  2GUS A;  1JY3 N;  3V4Q A;  1VPC A;  3M0D C;  1CSB A;  3HUS C;  2P67 A;  1SQB K;  1GL2 B;  3LW5 H;  4C7R A;  3M9B A;  3HTK B;  3TNU B;  1FZC A;  3NTN A;  2IX7 C;  1G1I A;  4EOT A;  4WB4 A;  5AVZ B;  1FZE A;  2NPS D;  1QL1 A;  2Q3I A;  2YKO A;  2HPC B;  3HD7 B;  2J59 M;  3L35 A;  1NU1 K;  2WSC H;  1N2D C;  1RE4 C;  2W27 A;  4AYC A;  3VP8 A;  5AVT B;  4JF7 A;  4I1L A;  3NMD A;  1X9V A;  1L4A C;  2R32 A;  4XE5 B;  2KP8 A;  3HRN A;  1L0L K;  3KDP B;  2PAJ A;  1CW5 A;  2M8R A;  1N7S D;  5APY A;  3L4F A;  1LT9 C;  1LTJ C;  5AVX B;  1A02 J;  1JNM A;  4C7N B;  3HE4 B;  2CPS A;  2Z5H A;  3M06 A;  2OYH C;  1J2J B;  1DEB A;  1N73 B;  3RK2 B;  5KJ7 D;  3A3Y B;  5BU5 A;  3BRT B;  3TNU A;  4AUW A;  3RK2 C;  3MGN A;  4ZKP A;  1FBM A;  2C9L Y;  3TK1 A;  1J1D C;  2N1T A;  3LIE A;  2O1K A;  2XDJ A;  5APQ A;  2J58 A;  2IFM A;  5APS A;  4XA4 A;  1FOS E;  3SWF A;  1GU5 A;  3GHG C;  1RE3 C;  3B8E B;  2C0X A;  3P7K A;  3WMM 0;  4LLH A;  5CCH D;  3RL0 B;  4B86 A;  1X79 B;  1RF1 B;  3VMX A;  2W6A A;  1JCD A;  1Z56 A;  4JYB A;  1L4A D;  2NPS B;  1KZU B;  3V2Q A;  4WY4 A;  1G2C A;  1ZLL A;  1JY3 P;  3U1A A;  3HE5 B;  2OYI C;  1KIL D;  5AVW B;  4HYT B;  2H7H A;  2GM4 A;  3A7O A;  1KFM A;  4Y99 B;  2FFD B;  1SFC A;  2N1T D;  3H32 A;  3SWY A;  3E1I A;  3VN0 A;  5AW8 B;  3RK3 D;  2L5G B;  1LTB C;  1MV8 A;  2WSF H;  4WBA A;  2M3B A;  1XTC C;  2P1J A;  2WWW A;  1H8A A;  1N7S B;  3N7N A;  1IFI A;  2POH A;  1FZC C;  4GIF A;  1HTL C;  1T2K C;  1URQ D;  3B5N A;  2WSE H;  1WRG A;  3V2R A;  1JTH A;  1NAF A;  5AVV B;  2I1J A;  3KQG A;  3HUS B;  5KJ7 C;  2Z5I A;  1SQV K;  4LC1 A;  5KTB A;  5CMZ A;  1NTM K;  1HGZ A;  3N4X A;  2R3C A;  1YTZ I;  1M1J A;  3NXS A;  4W7Y A;  1RF0 A;  4W80 A;  1FOS F;  2Q9I A;  1N7L A;  2YKQ A;  5AW9 B;  5CCH C;  2HOD B;  2KLV A;  2MJZ A;  4N3Y B;  1FDM A;  1L4A B;  5CCG D;  1IJD B;  2ZXE B;  2IFN A;  3A2A A;  3O8Z A;  1KIL B;  1KFN A;  3OJA B;  2FYU K;  1KIL C;  1CZQ A;  3CLQ A;  1LT9 B;  1LTJ B;  2IPP A;  1NTZ K;  3RK3 B;  3P8M C;  1NKZ B;  2N1T C;  1KQL A;  4GKG A;  3RK3 C;  2A45 I;  1T2K D;  2OYH B;  2CPB A;  3P8C E;  2HLO A;  5AW6 B;  4AQR D;  1NOH A;  2P7J A;  1GL2 A;  3P8C D;  1SQQ K;  3HTK A;  3C9I A;  1J1D B;  2W6B A;  4IFF A;  1CI6 B;  3VTP C;  1M7L A;  1URQ B;  1S9K E;  1FAV A;  2HPC A;  1WT6 A;  3HD7 A;  1GD2 E;  3V2P A;  1JY2 O;  3GHG B;  2O01 H;  2O1J A;  4N6J A;  1URQ C;  1S9K D;  2HYN A;  2YNY A;  3PP5 A;  1FZF A;  1W2E A;  1NHL A;  5CHX A;  1SFC C;  1LWU B;  1FJK A;  1GK6 A;  2VRS A;  5AW1 B;  3CL3 D;  1HWT C;  1LWU C;  1IO4 A;  2OYI B;  5CJ0 A;  1VDF A;  3V2N A;  1GL2 D;  2Z4E A;  3LID A;  3I5C A;  4OH8 B;  5APW A;  2WT7 B;  1G1J A;  4C7N A;  3HE4 A;  1X8Y A;  1SLQ A;  5BVZ A;  3TYY A;  5CJ4 A;  3A5T A;  1GDT A;  1N73 A;  3OAK A;  3EQ2 A;  3OA7 A;  2KSJ A;  3B5N C;  5CCG C;  1IFD A;  3G3Z A;  1GZL A;  5AVQ B;  1FZB A;  5BU8 B;  4DOJ A;  1JO5 A;  5AVR B;  1GW4 A;  4I2L C;  1GTW A;  3MTU E;  2WPS A;  1FZC B;  5AVS B;  3M0A A;  2XU6 A;  1AQ5 A;  1LTI C;  4IFM A;  4WY4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...