3RK3E

Truncated snare complex with complexin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
50
structure length
50
Chain Sequence
b'GSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vamp2
molecule tags Membrane protein/exocytosis
source organism Homo sapiens
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
total genus 20
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3rk3E00
3RL0g 3RK3E 1KILE 4GDOA
chains in the Genus database with same CATH superfamily
3FGAD 3FX0A 1JY2N 3SWKA 3P8CE 5B5EE 1AVOA 3AE8C 1J1EB 3L4FA 3BVHA 1N73B 2E74D 2KNCA 3IN6A 3H1JE 4M3LA 3SWYA 2KLUA 2Y9YA 2W90A 3A2AA 3SWFA 2M8RA 2O01J 3HUSC 1VQOP 2YKQA 1PP9J 2YKPA 1L4AA 3K5BA 1Q82Q 4IFMA 1NH4A 1S4XA 1WT6A 3N4XA 2XNDH 2QA4P 3BCCJ 3P8CD 5B66E 1MUUA 2Q1KA 1FDMA 1G2CB 1JY3O 1LP1B 1FOSE 1FDIA 1CZQA 1PGQA 2L91A 4NPEA 2KS1B 2AEMA 1KQGB 2G8YA 2KIKA 5AVWB 1LJ2A 2O3JA 3A0BH 3V4QA 2KB7P 1LTTC 2C9LY 1NTMG 1GMJA 4DZOA 1M1JC 5CBOA 3USSA 1Q86Q 2Q9IA 1YIJP 3T97A 2E75B 1HGVA 2IFMA 5AW9B 1GU4A 3KZIE 1URQD 2R3SA 4PV1B 3PTZA 1A02F 2OYHB 1VQ4P 1VQLP 3TSIA 1DX7A 3MUDA 1JUNA 1VQKP 1WMKA 4I7ZC 1EDJA 2GM4A 3TF5A 1R5LA 1H8AA 2IPPA 3RL0g 2E5TA 3MUDC 1LWUA 1VQ9P 4C7NA 1G1JA 5AW2B 5E79E 2QJYC 4WY4B 3L37A 2M5AB 3P8MC 3AEAC 2FFDA 3I56P 2B87B 2H8PD 2PRRA 3SSUA 3W67A 1JY3N 3G3ZA 3Q3DA 2C9NY 3CX5D 3R4YA 1BCCE 2NPSC 1EXJA 2A45H 2IFNA 2IZ0A 2ZVOB 1EDIA 1SLQA 2M5AA 3L73J 4Z1MH 2BASA 1FJPA 2FYUE 5AVRB 1M90Q 3AEBC 1PP9G 1YJNP 1S5LE 3GHGC 1KYOE 1J1DC 1L0ND 1PGPA 2ZYDA 4L73A 1YJWP 1GDTA 1PP9D 3RBZA 1KFNA 2K88A 2XZRA 1FZFA 2O1JA 1HUCA 2IBZI 3VTPC 1FOSF 3HRNA 5AW4B 2WSFJ 1JEKA 4LGDE 1OZHA 1S72P 3RL0C 3HTKB 2H43A 3WUVA 1ZMEC 1RF0A 2WT7A 1N7SD 2P2UA 4AUWA 3PJSK 1NTKK 1LTBC 1NU1K 1J2JB 2E43A 2PP6A 1BSHA 3A0HH 5APYA 3MGNA 1NO4A 2E5YA 3GF3A 1Q90D 3L70D 1LP1A 4PJ0H 3B5ND 5TJHA 1X0TA 1L0NE 1KILD 2NZ2A 2D2CD 3AE4C 1MKMA 2YXQB 3L71E 3MP7B 4QMAA 3HE5B 2FBWC 1Q81Q 3KPEA 2KK7A 1LTJA 1JMBA 4YXDC 1KQLA 3HD7D 2M0BA 3L36A 3G6EP 1PFIA 1K05A 3JC22 3CMEP 4Y99B 3BCCG 2ZXXA 2NPSD 1L4AB 3HD7C 1BE3E 1QGKB 1T3UA 5KLIB 4JQ0D 1LTIC 1PZQA 2I1JA 1U57A 2FXPA 2Y9ZA 2I8DA 5CMZA 1IK7A 1L0NJ 2RN0A 2WPRA 3KDPB 2KNCB 3LW5J 3IAOA 1IFIA 1SFCB 1A02J 2QJPB 3CXHI 3O8ZA 1K8AQ 1S5LH 1N7SC 4D6TD 1SP4A 1NU1J 1Q7YQ 3CWBG 1FE6A 2FXMA 3H1JG 1NTZD 4GIFA 4H13C 5CCGC 4ZNCA 3L75G 1BE3D 1HVVA 4IL6X 2H89C 4IOIH 4IL6H 1S2EA 5APWA 1NTZG 1SQXE 1P84E 3F5HA 3G9RA 1JOCA 2RMZA 3FWNA 2RKLA 5KLVD 3VP9A 2WWWA 4ASWA 1NKZB 5AVZB 1OX3A 1IC2A 3UIAA 4D6TJ 2FYUJ 1GL2D 1NAYA 4H13B 2HODA 3L72G 4JYCA 4PJ0E 2G3AA 2YNYA 1KILB 1L2PA 3V2NA 4BXLA 4JYBA 3L74E 3TGUE 3CPWO 1S9KE 2SPZA 3T97B 2WVRA 3GF7A 5AVTB 1NTKG 2Y0DA 3CC4P 1NOHA 1NAFA 3EFGA 2E74C 3H1LE 1P84D 1H0TB 4H44D 3H1JD 1NWQA 2IDBA 4CPGA 1R5SA 3CMAP 5BU5A 2LR2A 1JY2P 1JY3P 5EFWB 1ZLLA 1OW6A 1SQBK 3AEEC 4C7NB 1ZV8A 1NTKJ 2JR8A 2V7QH 3NFQA 1J1EC 2LXBA 1X8YA 3L72E 4NPDA 5CCHD 4GT1A 4JF7A 2J59M 1HTLC 1EDKA 1OVRA 2E74B 1L4AD 2OYOA 2QJKC 3LW5H 3QH9A 4PD4E 2L5GB 3RK2D 5KKZC 1YHQP 1YITP 1LT9B 1QL2A 1FS0E 3A0BE 3M9BA 2IYPA 5AW7B 2ZYGA 1KILC 2BCCG 3VN0A 2FYUG 4W7ZA 5AVSB 3G71P 1LTGC 3GG2A 1RF1A 3KXDA 4KJMA 1BSNA 1JMMA 3KZIH 4UB8E 3L70G 2ITAA 5APUA 2N1TD 1U7JA 1EZVG 4B86A 3MZWB 3GHGB 4GKGA 3B8EB 3M0DA 3H1JJ 2R44A 2W27A 3FXEA 2JKVA 1SQBD 1P84I 1RE4A 3JCUE 3PRJA 3WMM0 1W5CE 1KYOD 2LXCB 3L73G 4YXWH 2PGDA 2FFDC 2R5DA 2ZT9B 4H44C 2OYHC 1SQVE 2AEFA 4K3AA 2QM7A 2P58A 4ASVA 3H1KG 3AEDC 4IFDK 1T6AA 2FYUD 2KSJA 1OXZA 2QE7H 3L71G 5APVA 3CXHD 3WU2H 1DH3A 3A5TA 5APQA 1CSBA 1SQQD 1L0LE 2VRSA 1L0LJ 2FXOA 3PH0A 3VMAA 2WTYA 2WSCH 4KHXA 4WY4D 1BCCD 2NPSA 2K3RA 2ZFCA 3HE4A 2KLVA 3NTNA 4L75A 2ZAEB 3L35A 5AW3B 2KUBA 1WRGA 3CCJP 1M1JB 1VL2A 3MTUE 1NU1D 1ZW0A 1CI6A 3W68A 1T8ZA 1NTMJ 1DD3A 1IFJA 1AA0A 4H0LD 3WU2E 2HPCB 2QJKB 3H1LJ 1SQPJ 3QWOC 1NYHA 3CWBE 1Z56A 3FWLA 3RK3B 1LTSC 1LT9C 3TGUJ 1RQVA 4ZKPA 5GTHE 1EZVI 2YMYA 1AFOA 1MFTA 1SQXK 3CWBD 4IL6E 2WT7B 2B88A 2O1KA 4I6MC 5L8RJ 1NGMB 1Y9BA 1JTHB 4C7RA 3HD7A 3VYIA 3CCEP 1MZ9A 3GMAA 2IBZE 2HG5D 5GTIH 1L0LK 1HWTC 2QSIA 3E1IA 1S5LX 4XE5B 2D2CB 1KD1Q 4ZMDA 3AEGC 3RK3C 1KB9D 1ZRTE 2C0XA 4ZKUA 4WB4A 4DOJA 1DEEG 4BRYB 2XDJA 3G4SP 1L0NK 2CPBA 5AVXB 1W2BO 1SQVK 3FXDA 3H1KD 5BU8B 1PGJA 1OW8A 2NRGA 2AXTE 2OYIB 1URQC 5CCGD 1NTKE 5GTIE 1NHLA 4OGQD 3CCQP 3OA7A 1SQQJ 4EIJA 3ITKA 2A45G 2N9BA 1KN7A 3PP5A 1BE3G 2HLOA 4H0LC 3L73E 4R4LA 3F89A 2JP3A 2Z5IA 1OVUA 1E79H 1IFNA 1SFCA 2BEQD 2GUVA 1VPCA 2MJZA 2Q3IA 3S4RA 1LGHB 1DEBA 2WSFH 1LT1A 2OTLP 1MV8A 2HPCA 3H1KE 4C46A 5KAIH 1Y8AA 4OVNF 1URQA 3H1HG 4HB1A 2B9BA 1KC8Q 1KZUB 2P10A 2WQYC 3GLMA 2R32A 2V7QJ 1D7MA 2PAJA 2B87A 3L71J 4H44B 1BGYD 2ZXEB 5KJ7C 2A45I 1N8RQ 4LLHA 1SFCC 4GODA 4PD4D 3C1LA 2WITA 1G2CA 3B4SA 1QL1A 3ZDMA 3V2PA 2KZIA 5KJ7A 1FZCA 1LNQA 2MKVA 3AECC 5KLIC 1W2EA 2YXRB 2KXPB 2WSEH 3MIWA 3TNUB 1AQTA 2KYVA 4HKZH 4Y99C 3TGUG 3RL0D 3E7KA 1JTHA 5BVZA 1S1CX 1H0TA 3BCCE 1HBWA 3HTKA 3V6IA 1JNMA 1K04A 3L70J 1S9KD 1M7LA 1BCCG 2Y0CA 3BATA 3CI9A 1JCDA 3H1ID 2HR3A 3C9IA 4N78D 4PV1D 3V4WA 2XU6A 3CLQA 1HF9A 1YYCA 4AQRD 4DJGA 1RF1B 5AVQB 1YTZI 2BCCD 1T2KC 3SFDC 4GOFA 3L75J 1BDDA 2JWAA 2O01H 1GZLA 3RK2B 2E76B 3AE7C 1GD2E 4IFFA 3MHVA 3IR9A 4GDOA 4XA4A 3U1CA 3AE2C 4MN4C 1EZVD 1RE3C 1HJ0A 1VDFA 2O01N 3HUSA 1EC5A 4GOEA 1VQ5P 2NPSB 1RE4C 2B89A 3RGUA 5CJ4A 1L0NG 1HJBA 1L0LD 3O6QA 3Q5RA 1GL2A 3H1IG 1SQQK 4JBZA 2DW3A 1NJIQ 2N1TB 1YTZT 2ZT9C 3KYQA 3M0DC 3O6QB 4JPZB 1X22A 2P67A 2WZ7A 2JO1A 3M91A 1NU1E 2PFXA 3CL3D 3RBXA 2OQQA 1EZVE 1MFZA 1RE3A 1IFDA 2YO2A 3AEFC 2JWDA 4Y28J 4D6TG 1YI2P 3VMXA 2A06D 2ZVNB 2K9JB 3C8VA 2YIUC 3A3YB 4RO0A 3OW2O 2M3EA 1PP9E 1T2KD 1ZP0C 4PV1C 1CW5A 2E75D 1SQQG 3CXHE 1ZN5A 3ABVC 1GW4A 4H0LB 3CWBJ 4HYTB 1PPJE 2JEEA 1JB0J 1SQPE 2I1KA 1E5WA 1AVYA 3TYYA 5B66H 4I2LC 2QJPC 1YJ9P 5AW5B 1IO4A 1ZXGA 3WUTA 1XTCC 2Z5HA 3V5BA 2OYIC 3PHLA 3CX5I 1NU1G 3H32A 1NTME 2A06E 2YO3A 1EXIA 2CPSA 3II6A 3H1HD 2FYZA 1PV3A 1KMIZ 2WSCJ 2K37A 3HUSB 5AW6B 2OYIA 1RH5B 1NTMD 3E1RA 1X79B 3H1IJ 5C39A 3CX5H 4R4MA 3GHGA 3B5NA 5KJ7D 1ZR4A 1T3JA 1FBMA 5APXA 3GW6A 3S9OA 1R8EA 1SQPD 1M1KQ 2W6AA 5AW0B 3Q2YA 3PLNA 4EI2A 3L70E 1GU5A 2WPSA 2FYUK 3RK3D 3TDKA 1PPJG 1ZRTD 2FKWB 4N3YB 4U3FD 5KKZB 5APTA 1NVOA 2YIUB 4U3FG 1PGOA 2IBZD 5AVVB 4OGQB 1Q2NA 1QEXA 2IX7C 4WBAA 4H13D 1NKNA 2IZ1A 2BEZF 4W80A 5M1BA 5KAIE 2OGUA 3LIEA 3TNUA 2FY8A 3VP8A 1QX8A 4KT0J 1BDCA 1FZGA 2Z4EA 3CC7P 1LTJC 4LC1A 2N1TC 1SQBJ 2YKOA 1J1DB 1N2DC 1SQXD 1P84H 2WPQA 3A0HE 3CCVP 1CI6B 4YPCA 1GTWA 1FZEA 2HFED 4RJTA 1N7LA 3OJAB 1VQ8P 1TU3F 1JCCA 2OTKE 3H1KJ 4RKUJ 1RHZB 1N7SB 2P1JA 5TISE 4AYCA 2KS1A 5CCHA 3I55P 5H2FH 3Q1MA 3Q5PA 5CHXA 1FZBA 1BGYE 3IFMA 1IFPA 2OTJP 1KORA 4UB8H 1EDLA 3VOPA 2QM8A 3B5NB 1OWAA 2K1AA 1USDA 2YMKA 3JSVC 1S3JA 4TLFA 1DD4A 1SQBG 3H6PA 3N7NA 3L72D 1VQMP 3U59A 4NPFX 4TT3H 3AE5C 3HD7B 2XNXA 1L4AC 2A06G 2WMMA 2Y0EA 2QG4A 3JCUH 4BWNA 3D71A 3Q5SA 3CCLP 1IZNB 5TISH 5CCHC 5AVUB 3H1LG 4OGQC 2AXCA 1KV4A 3V2QA 3L75D 3BCCD 3AE3C 4U3FJ 3H1LD 3R2PA 4WY4A 3WUUA 4OH8B 2H88C 1K73Q 2ZJSE 1YQ4C 3HE5A 4YTPC 1L0LG 5DJUB 3TGUD 4RESB 2FYNC 3V2RA 5H2FE 4DT0A 1H88A 2C0WA 1SS1A 4L74A 2ZYAA 3A7OA 3AE9C 1XTGB 3VMZA 3TK1A 3L75E 2H7HA 1JY2O 1KFMA 2W8ZA 3BASA 3OAKA 2W83C 2BCCE 2WSSH 2POHA 4K35A 2HODB 3M06A 1KILA 2V4HA 4PD4I 2R5BA 3H1HJ 4N78E 1YBKA 3M0AA 2JJLA 2E76D 5AW1B 1AV1A 3CX5E 5CBNA 2RH0A 3CCRP 1SQPG 3LIDA 5APSA 1M1JA 2QEXP 1M57D 2J58A 1SQVD 1U7MA 3SFEC 1QVFO 4W7YA 1GW3A 2CK3H 3CCUP 1JM0A 5DJTB 1VF5B 2KP8A 5CJ0A 1BE3J 1Y47A 3B71A 2IBZG 1URQB 2Q6QA 4I7ZB 5B5EH 4U7JA 1BGYG 1OMIA 2XV5A 3U1AA 4UB6H 3D6YA 1AQ5A 1UIXA 1NTZJ 3P32A 3BRVB 2E75C 1OW7A 1USEA 4HH2A 4EYYQ 4N6JA 2K9YA 2W6JH 3BRTB 1QLED 2R3CA 5KLVJ 2D2CC 1GL2C 1JO5A 1SQBE 1IJDB 2XKMA 1LT9A 2W6BA 1VQNP 2KZJA 5AW8B 1N86A 2AEJA 1K9MQ 2K9JA 1N73A 2WSEJ 3CCSP 3EQ2A 1OFCX 1LWUC 1FJKA 2Q7CA 2N9YB 5KTBA 1KYOH 5E79H 1FDOA 1KB9H 1KYOI 1YQ3C 2ZT9D 4BRYA 1LTAC 2E76C 1RY3A 2QVAA 3EWKA 1HH0A 1SQQE 1FU1A 1GK4A 1KILE 2FYNB 3L74G 1AJYA 1VQ7P 5CCGA 1ZR2A 2KOGA 3CXHH 3H1HE 3CD6P 3H32B 1M8OB 1N73C 3CCMP 2AXTH 1PPJD 1PL5A 2GUSA 2KI7B 1KTMA 5KAFH 1NTKD 1BCCJ 3L72J 2BCCJ 1BGYJ 2N1TA 1QVGO 1VQ6P 1SQVG 1VF5D 3H25A 2JDIH 3KQGA 1KQFB 3M9QA 3L73D 3VMYA 1RF0C 2HYNA 3MD0A 3RK3E 1OVVA 3S1KA 1FC2C 4L76A 1EQ7A 1FZCB 3AE1C 2Q5UA 3L74J 4EDFA 1DIPA 3I5CA 5KLVE 3D6ZA 2Q3EA 1KQSO 3B5NC 3RL0B 1KB9E 3L71D 4HJGH 1OIPA 4WWIA 1GK6A 1ZOYC 4WVZA 1G1IA 3HE4B 4D6TE 5KAFE 4EOTA 1NTMK 1NTZE 1SQXG 1LWUB 1RQUA 2LKMA 2M3BA 1IK9A 3EFFK 3IF4A 3P7KA 4OWFA 4PD4H 2FFDB 1X9VA 3D70A 4XFJA 4U3FE 1VQPP 1SQPK 3NXSA 1SFCD 2IYOA 4UB6E 5GTHH 4A7PA 1SVFA 2E42A 1GL2B 4O9BA 2J5UA 1KB9I 2OYHA 1SQXJ 1M56D 1UIIA 2QIWA 1NTZK 1IFMA 2QRXA 5KLVG 2QJYB 4WY4C 1FAVA 4I1LA 5AVYB 3KHUA 1PIXA 1H89A 1HGZA 3RK2C 1VF5C 1N7SA 5KLVK 1LTJB 2KSEA 1FZAA 3M9HA 1FZCC 2WPVB 3H1IE 3AE6C 2OARA 2UWJE 1RF1C 3L74D 3CC2P 3NMDA 5K5GB 1SQVJ 4DCKA 2P7JA 2GA1A
chains in the Genus database with same CATH topology
3FGAD 2MKVA 4OGQC 2IDBA 3AECC 3AE8C 5KLIC 3AE3C 2E74D 3IN6A 1OW6A 3AEEC 2H88C 1S1CX 1YQ4C 4YTPC 1K04A 2FYNC 2O01J 4PV1D 2QJKC 2E74B 5KKZC 1HF9A 3AE9C 3SFDC 1FDIA 2E76B 3AE7C 2G8YA 1KQGB 4GDOA 3AE2C 1GMJA 1HJ0A 2E76D 2E75B 3O6QA 3Q5RA 4PV1B 3SFEC 1WMKA 4I7ZC 2ZT9C 2ZT9B 1VF5B 4H44C 4I7ZB 3B71A 3RL0g 2JO1A 4U7JA 1OMIA 2OQQA 3D6YA 2QJYC 3AEFC 4Y28J 1UIXA 3AEAC 3AEDC 3Q3DA 2E75C 1OW7A 3C8VA 3R4YA 2K9YA 2YIUC 1EXJA 4Z1MH 2D2CC 1ZP0C 4PV1C 3AEBC 2E75D 3ABVC 4H0LB 2WSEJ 1JB0J 1VL2A 2QJPC 1FDOA 2ZT9D 1YQ3C 2WSFJ 1DD3A 1EXIA 4H0LD 1ZMEC 2E76C 3EWKA 1PV3A 1KMIZ 2WSCJ 1KILE 1NYHA 1AJYA 3GF3A 4R4MA 1Q90D 1RQVA 2NZ2A 3AE4C 2D2CD 3S9OA 1MKMA 1PL5A 1R8EA 5L8RJ 1KTMA 2FBWC 3Q2YA 1NGMB 1Y9BA 4YXDC 3GMAA 1VF5D 3H25A 1K05A 1KQFB 2QSIA 1S5LX 2D2CB 3RK3E 3AEGC 1ZRTE 3AE1C 4OGQB 1DIPA 1U57A 2FXPA 4H13D 3D6ZA 1IK7A 2BEZF 5M1BA 1OW8A 3LW5J 3IAOA 1ZOYC 4KT0J 4OGQD 1RQUA 3D70A 4XFJA 4H0LC 4R4LA 4H13C 2JP3A 2BEQD 4IL6X 2H89C 2J5UA 1TU3F 4RKUJ 3G9RA 3Q5PA 3Q1MA 2QIWA 1KORA 4H13B 2P10A 2WQYC 1PIXA 3GLMA 2V7QJ 2G3AA 2YMKA 1VF5C 4H44B 1DD4A 2WPVB 3T97B 4TT3H 3AE5C 3AE6C 3GF7A 3D71A 3Q5SA 2E74C 4H44D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 g;  3RK3 E;  1KIL E;  4GDO A; 
#chains in the Genus database with same CATH topology
 3FGA D;  3FX0 A;  1JY2 N;  3SWK A;  3P8C E;  5B5E E;  1AVO A;  3AE8 C;  1J1E B;  3L4F A;  3BVH A;  1N73 B;  2E74 D;  2KNC A;  3IN6 A;  3H1J E;  4M3L A;  3SWY A;  2KLU A;  2Y9Y A;  2W90 A;  3A2A A;  3SWF A;  2M8R A;  2O01 J;  3HUS C;  1VQO P;  2YKQ A;  1PP9 J;  2YKP A;  1L4A A;  3K5B A;  1Q82 Q;  4IFM A;  1NH4 A;  1S4X A;  1WT6 A;  3N4X A;  2XND H;  2QA4 P;  3BCC J;  3P8C D;  5B66 E;  1MUU A;  2Q1K A;  1FDM A;  1G2C B;  1JY3 O;  1LP1 B;  1FOS E;  1FDI A;  1CZQ A;  1PGQ A;  2L91 A;  4NPE A;  2KS1 B;  2AEM A;  1KQG B;  2G8Y A;  2KIK A;  5AVW B;  1LJ2 A;  2O3J A;  3A0B H;  3V4Q A;  2KB7 P;  1LTT C;  2C9L Y;  1NTM G;  1GMJ A;  4DZO A;  1M1J C;  5CBO A;  3USS A;  1Q86 Q;  2Q9I A;  1YIJ P;  3T97 A;  2E75 B;  1HGV A;  2IFM A;  5AW9 B;  1GU4 A;  3KZI E;  1URQ D;  2R3S A;  4PV1 B;  3PTZ A;  1A02 F;  2OYH B;  1VQ4 P;  1VQL P;  3TSI A;  1DX7 A;  3MUD A;  1JUN A;  1VQK P;  1WMK A;  4I7Z C;  1EDJ A;  2GM4 A;  3TF5 A;  1R5L A;  1H8A A;  2IPP A;  3RL0 g;  2E5T A;  3MUD C;  1LWU A;  1VQ9 P;  4C7N A;  1G1J A;  5AW2 B;  5E79 E;  2QJY C;  4WY4 B;  3L37 A;  2M5A B;  3P8M C;  3AEA C;  2FFD A;  3I56 P;  2B87 B;  2H8P D;  2PRR A;  3SSU A;  3W67 A;  1JY3 N;  3G3Z A;  3Q3D A;  2C9N Y;  3CX5 D;  3R4Y A;  1BCC E;  2NPS C;  1EXJ A;  2A45 H;  2IFN A;  2IZ0 A;  2ZVO B;  1EDI A;  1SLQ A;  2M5A A;  3L73 J;  4Z1M H;  2BAS A;  1FJP A;  2FYU E;  5AVR B;  1M90 Q;  3AEB C;  1PP9 G;  1YJN P;  1S5L E;  3GHG C;  1KYO E;  1J1D C;  1L0N D;  1PGP A;  2ZYD A;  4L73 A;  1YJW P;  1GDT A;  1PP9 D;  3RBZ A;  1KFN A;  2K88 A;  2XZR A;  1FZF A;  2O1J A;  1HUC A;  2IBZ I;  3VTP C;  1FOS F;  3HRN A;  5AW4 B;  2WSF J;  1JEK A;  4LGD E;  1OZH A;  1S72 P;  3RL0 C;  3HTK B;  2H43 A;  3WUV A;  1ZME C;  1RF0 A;  2WT7 A;  1N7S D;  2P2U A;  4AUW A;  3PJS K;  1NTK K;  1LTB C;  1NU1 K;  1J2J B;  2E43 A;  2PP6 A;  1BSH A;  3A0H H;  5APY A;  3MGN A;  1NO4 A;  2E5Y A;  3GF3 A;  1Q90 D;  3L70 D;  1LP1 A;  4PJ0 H;  3B5N D;  5TJH A;  1X0T A;  1L0N E;  1KIL D;  2NZ2 A;  2D2C D;  3AE4 C;  1MKM A;  2YXQ B;  3L71 E;  3MP7 B;  4QMA A;  3HE5 B;  2FBW C;  1Q81 Q;  3KPE A;  2KK7 A;  1LTJ A;  1JMB A;  4YXD C;  1KQL A;  3HD7 D;  2M0B A;  3L36 A;  3G6E P;  1PFI A;  1K05 A;  3JC2 2;  3CME P;  4Y99 B;  3BCC G;  2ZXX A;  2NPS D;  1L4A B;  3HD7 C;  1BE3 E;  1QGK B;  1T3U A;  5KLI B;  4JQ0 D;  1LTI C;  1PZQ A;  2I1J A;  1U57 A;  2FXP A;  2Y9Z A;  2I8D A;  5CMZ A;  1IK7 A;  1L0N J;  2RN0 A;  2WPR A;  3KDP B;  2KNC B;  3LW5 J;  3IAO A;  1IFI A;  1SFC B;  1A02 J;  2QJP B;  3CXH I;  3O8Z A;  1K8A Q;  1S5L H;  1N7S C;  4D6T D;  1SP4 A;  1NU1 J;  1Q7Y Q;  3CWB G;  1FE6 A;  2FXM A;  3H1J G;  1NTZ D;  4GIF A;  4H13 C;  5CCG C;  4ZNC A;  3L75 G;  1BE3 D;  1HVV A;  4IL6 X;  2H89 C;  4IOI H;  4IL6 H;  1S2E A;  5APW A;  1NTZ G;  1SQX E;  1P84 E;  3F5H A;  3G9R A;  1JOC A;  2RMZ A;  3FWN A;  2RKL A;  5KLV D;  3VP9 A;  2WWW A;  4ASW A;  1NKZ B;  5AVZ B;  1OX3 A;  1IC2 A;  3UIA A;  4D6T J;  2FYU J;  1GL2 D;  1NAY A;  4H13 B;  2HOD A;  3L72 G;  4JYC A;  4PJ0 E;  2G3A A;  2YNY A;  1KIL B;  1L2P A;  3V2N A;  4BXL A;  4JYB A;  3L74 E;  3TGU E;  3CPW O;  1S9K E;  2SPZ A;  3T97 B;  2WVR A;  3GF7 A;  5AVT B;  1NTK G;  2Y0D A;  3CC4 P;  1NOH A;  1NAF A;  3EFG A;  2E74 C;  3H1L E;  1P84 D;  1H0T B;  4H44 D;  3H1J D;  1NWQ A;  2IDB A;  4CPG A;  1R5S A;  3CMA P;  5BU5 A;  2LR2 A;  1JY2 P;  1JY3 P;  5EFW B;  1ZLL A;  1OW6 A;  1SQB K;  3AEE C;  4C7N B;  1ZV8 A;  1NTK J;  2JR8 A;  2V7Q H;  3NFQ A;  1J1E C;  2LXB A;  1X8Y A;  3L72 E;  4NPD A;  5CCH D;  4GT1 A;  4JF7 A;  2J59 M;  1HTL C;  1EDK A;  1OVR A;  2E74 B;  1L4A D;  2OYO A;  2QJK C;  3LW5 H;  3QH9 A;  4PD4 E;  2L5G B;  3RK2 D;  5KKZ C;  1YHQ P;  1YIT P;  1LT9 B;  1QL2 A;  1FS0 E;  3A0B E;  3M9B A;  2IYP A;  5AW7 B;  2ZYG A;  1KIL C;  2BCC G;  3VN0 A;  2FYU G;  4W7Z A;  5AVS B;  3G71 P;  1LTG C;  3GG2 A;  1RF1 A;  3KXD A;  4KJM A;  1BSN A;  1JMM A;  3KZI H;  4UB8 E;  3L70 G;  2ITA A;  5APU A;  2N1T D;  1U7J A;  1EZV G;  4B86 A;  3MZW B;  3GHG B;  4GKG A;  3B8E B;  3M0D A;  3H1J J;  2R44 A;  2W27 A;  3FXE A;  2JKV A;  1SQB D;  1P84 I;  1RE4 A;  3JCU E;  3PRJ A;  3WMM 0;  1W5C E;  1KYO D;  2LXC B;  3L73 G;  4YXW H;  2PGD A;  2FFD C;  2R5D A;  2ZT9 B;  4H44 C;  2OYH C;  1SQV E;  2AEF A;  4K3A A;  2QM7 A;  2P58 A;  4ASV A;  3H1K G;  3AED C;  4IFD K;  1T6A A;  2FYU D;  2KSJ A;  1OXZ A;  2QE7 H;  3L71 G;  5APV A;  3CXH D;  3WU2 H;  1DH3 A;  3A5T A;  5APQ A;  1CSB A;  1SQQ D;  1L0L E;  2VRS A;  1L0L J;  2FXO A;  3PH0 A;  3VMA A;  2WTY A;  2WSC H;  4KHX A;  4WY4 D;  1BCC D;  2NPS A;  2K3R A;  2ZFC A;  3HE4 A;  2KLV A;  3NTN A;  4L75 A;  2ZAE B;  3L35 A;  5AW3 B;  2KUB A;  1WRG A;  3CCJ P;  1M1J B;  1VL2 A;  3MTU E;  1NU1 D;  1ZW0 A;  1CI6 A;  3W68 A;  1T8Z A;  1NTM J;  1DD3 A;  1IFJ A;  1AA0 A;  4H0L D;  3WU2 E;  2HPC B;  2QJK B;  3H1L J;  1SQP J;  3QWO C;  1NYH A;  3CWB E;  1Z56 A;  3FWL A;  3RK3 B;  1LTS C;  1LT9 C;  3TGU J;  1RQV A;  4ZKP A;  5GTH E;  1EZV I;  2YMY A;  1AFO A;  1MFT A;  1SQX K;  3CWB D;  4IL6 E;  2WT7 B;  2B88 A;  2O1K A;  4I6M C;  5L8R J;  1NGM B;  1Y9B A;  1JTH B;  4C7R A;  3HD7 A;  3VYI A;  3CCE P;  1MZ9 A;  3GMA A;  2IBZ E;  2HG5 D;  5GTI H;  1L0L K;  1HWT C;  2QSI A;  3E1I A;  1S5L X;  4XE5 B;  2D2C B;  1KD1 Q;  4ZMD A;  3AEG C;  3RK3 C;  1KB9 D;  1ZRT E;  2C0X A;  4ZKU A;  4WB4 A;  4DOJ A;  1DEE G;  4BRY B;  2XDJ A;  3G4S P;  1L0N K;  2CPB A;  5AVX B;  1W2B O;  1SQV K;  3FXD A;  3H1K D;  5BU8 B;  1PGJ A;  1OW8 A;  2NRG A;  2AXT E;  2OYI B;  1URQ C;  5CCG D;  1NTK E;  5GTI E;  1NHL A;  4OGQ D;  3CCQ P;  3OA7 A;  1SQQ J;  4EIJ A;  3ITK A;  2A45 G;  2N9B A;  1KN7 A;  3PP5 A;  1BE3 G;  2HLO A;  4H0L C;  3L73 E;  4R4L A;  3F89 A;  2JP3 A;  2Z5I A;  1OVU A;  1E79 H;  1IFN A;  1SFC A;  2BEQ D;  2GUV A;  1VPC A;  2MJZ A;  2Q3I A;  3S4R A;  1LGH B;  1DEB A;  2WSF H;  1LT1 A;  2OTL P;  1MV8 A;  2HPC A;  3H1K E;  4C46 A;  5KAI H;  1Y8A A;  4OVN F;  1URQ A;  3H1H G;  4HB1 A;  2B9B A;  1KC8 Q;  1KZU B;  2P10 A;  2WQY C;  3GLM A;  2R32 A;  2V7Q J;  1D7M A;  2PAJ A;  2B87 A;  3L71 J;  4H44 B;  1BGY D;  2ZXE B;  5KJ7 C;  2A45 I;  1N8R Q;  4LLH A;  1SFC C;  4GOD A;  4PD4 D;  3C1L A;  2WIT A;  1G2C A;  3B4S A;  1QL1 A;  3ZDM A;  3V2P A;  2KZI A;  5KJ7 A;  1FZC A;  1LNQ A;  2MKV A;  3AEC C;  5KLI C;  1W2E A;  2YXR B;  2KXP B;  2WSE H;  3MIW A;  3TNU B;  1AQT A;  2KYV A;  4HKZ H;  4Y99 C;  3TGU G;  3RL0 D;  3E7K A;  1JTH A;  5BVZ A;  1S1C X;  1H0T A;  3BCC E;  1HBW A;  3HTK A;  3V6I A;  1JNM A;  1K04 A;  3L70 J;  1S9K D;  1M7L A;  1BCC G;  2Y0C A;  3BAT A;  3CI9 A;  1JCD A;  3H1I D;  2HR3 A;  3C9I A;  4N78 D;  4PV1 D;  3V4W A;  2XU6 A;  3CLQ A;  1HF9 A;  1YYC A;  4AQR D;  4DJG A;  1RF1 B;  5AVQ B;  1YTZ I;  2BCC D;  1T2K C;  3SFD C;  4GOF A;  3L75 J;  1BDD A;  2JWA A;  2O01 H;  1GZL A;  3RK2 B;  2E76 B;  3AE7 C;  1GD2 E;  4IFF A;  3MHV A;  3IR9 A;  4GDO A;  4XA4 A;  3U1C A;  3AE2 C;  4MN4 C;  1EZV D;  1RE3 C;  1HJ0 A;  1VDF A;  2O01 N;  3HUS A;  1EC5 A;  4GOE A;  1VQ5 P;  2NPS B;  1RE4 C;  2B89 A;  3RGU A;  5CJ4 A;  1L0N G;  1HJB A;  1L0L D;  3O6Q A;  3Q5R A;  1GL2 A;  3H1I G;  1SQQ K;  4JBZ A;  2DW3 A;  1NJI Q;  2N1T B;  1YTZ T;  2ZT9 C;  3KYQ A;  3M0D C;  3O6Q B;  4JPZ B;  1X22 A;  2P67 A;  2WZ7 A;  2JO1 A;  3M91 A;  1NU1 E;  2PFX A;  3CL3 D;  3RBX A;  2OQQ A;  1EZV E;  1MFZ A;  1RE3 A;  1IFD A;  2YO2 A;  3AEF C;  2JWD A;  4Y28 J;  4D6T G;  1YI2 P;  3VMX A;  2A06 D;  2ZVN B;  2K9J B;  3C8V A;  2YIU C;  3A3Y B;  4RO0 A;  3OW2 O;  2M3E A;  1PP9 E;  1T2K D;  1ZP0 C;  4PV1 C;  1CW5 A;  2E75 D;  1SQQ G;  3CXH E;  1ZN5 A;  3ABV C;  1GW4 A;  4H0L B;  3CWB J;  4HYT B;  1PPJ E;  2JEE A;  1JB0 J;  1SQP E;  2I1K A;  1E5W A;  1AVY A;  3TYY A;  5B66 H;  4I2L C;  2QJP C;  1YJ9 P;  5AW5 B;  1IO4 A;  1ZXG A;  3WUT A;  1XTC C;  2Z5H A;  3V5B A;  2OYI C;  3PHL A;  3CX5 I;  1NU1 G;  3H32 A;  1NTM E;  2A06 E;  2YO3 A;  1EXI A;  2CPS A;  3II6 A;  3H1H D;  2FYZ A;  1PV3 A;  1KMI Z;  2WSC J;  2K37 A;  3HUS B;  5AW6 B;  2OYI A;  1RH5 B;  1NTM D;  3E1R A;  1X79 B;  3H1I J;  5C39 A;  3CX5 H;  4R4M A;  3GHG A;  3B5N A;  5KJ7 D;  1ZR4 A;  1T3J A;  1FBM A;  5APX A;  3GW6 A;  3S9O A;  1R8E A;  1SQP D;  1M1K Q;  2W6A A;  5AW0 B;  3Q2Y A;  3PLN A;  4EI2 A;  3L70 E;  1GU5 A;  2WPS A;  2FYU K;  3RK3 D;  3TDK A;  1PPJ G;  1ZRT D;  2FKW B;  4N3Y B;  4U3F D;  5KKZ B;  5APT A;  1NVO A;  2YIU B;  4U3F G;  1PGO A;  2IBZ D;  5AVV B;  4OGQ B;  1Q2N A;  1QEX A;  2IX7 C;  4WBA A;  4H13 D;  1NKN A;  2IZ1 A;  2BEZ F;  4W80 A;  5M1B A;  5KAI E;  2OGU A;  3LIE A;  3TNU A;  2FY8 A;  3VP8 A;  1QX8 A;  4KT0 J;  1BDC A;  1FZG A;  2Z4E A;  3CC7 P;  1LTJ C;  4LC1 A;  2N1T C;  1SQB J;  2YKO A;  1J1D B;  1N2D C;  1SQX D;  1P84 H;  2WPQ A;  3A0H E;  3CCV P;  1CI6 B;  4YPC A;  1GTW A;  1FZE A;  2HFE D;  4RJT A;  1N7L A;  3OJA B;  1VQ8 P;  1TU3 F;  1JCC A;  2OTK E;  3H1K J;  4RKU J;  1RHZ B;  1N7S B;  2P1J A;  5TIS E;  4AYC A;  2KS1 A;  5CCH A;  3I55 P;  5H2F H;  3Q1M A;  3Q5P A;  5CHX A;  1FZB A;  1BGY E;  3IFM A;  1IFP A;  2OTJ P;  1KOR A;  4UB8 H;  1EDL A;  3VOP A;  2QM8 A;  3B5N B;  1OWA A;  2K1A A;  1USD A;  2YMK A;  3JSV C;  1S3J A;  4TLF A;  1DD4 A;  1SQB G;  3H6P A;  3N7N A;  3L72 D;  1VQM P;  3U59 A;  4NPF X;  4TT3 H;  3AE5 C;  3HD7 B;  2XNX A;  1L4A C;  2A06 G;  2WMM A;  2Y0E A;  2QG4 A;  3JCU H;  4BWN A;  3D71 A;  3Q5S A;  3CCL P;  1IZN B;  5TIS H;  5CCH C;  5AVU B;  3H1L G;  4OGQ C;  2AXC A;  1KV4 A;  3V2Q A;  3L75 D;  3BCC D;  3AE3 C;  4U3F J;  3H1L D;  3R2P A;  4WY4 A;  3WUU A;  4OH8 B;  2H88 C;  1K73 Q;  2ZJS E;  1YQ4 C;  3HE5 A;  4YTP C;  1L0L G;  5DJU B;  3TGU D;  4RES B;  2FYN C;  3V2R A;  5H2F E;  4DT0 A;  1H88 A;  2C0W A;  1SS1 A;  4L74 A;  2ZYA A;  3A7O A;  3AE9 C;  1XTG B;  3VMZ A;  3TK1 A;  3L75 E;  2H7H A;  1JY2 O;  1KFM A;  2W8Z A;  3BAS A;  3OAK A;  2W83 C;  2BCC E;  2WSS H;  2POH A;  4K35 A;  2HOD B;  3M06 A;  1KIL A;  2V4H A;  4PD4 I;  2R5B A;  3H1H J;  4N78 E;  1YBK A;  3M0A A;  2JJL A;  2E76 D;  5AW1 B;  1AV1 A;  3CX5 E;  5CBN A;  2RH0 A;  3CCR P;  1SQP G;  3LID A;  5APS A;  1M1J A;  2QEX P;  1M57 D;  2J58 A;  1SQV D;  1U7M A;  3SFE C;  1QVF O;  4W7Y A;  1GW3 A;  2CK3 H;  3CCU P;  1JM0 A;  5DJT B;  1VF5 B;  2KP8 A;  5CJ0 A;  1BE3 J;  1Y47 A;  3B71 A;  2IBZ G;  1URQ B;  2Q6Q A;  4I7Z B;  5B5E H;  4U7J A;  1BGY G;  1OMI A;  2XV5 A;  3U1A A;  4UB6 H;  3D6Y A;  1AQ5 A;  1UIX A;  1NTZ J;  3P32 A;  3BRV B;  2E75 C;  1OW7 A;  1USE A;  4HH2 A;  4EYY Q;  4N6J A;  2K9Y A;  2W6J H;  3BRT B;  1QLE D;  2R3C A;  5KLV J;  2D2C C;  1GL2 C;  1JO5 A;  1SQB E;  1IJD B;  2XKM A;  1LT9 A;  2W6B A;  1VQN P;  2KZJ A;  5AW8 B;  1N86 A;  2AEJ A;  1K9M Q;  2K9J A;  1N73 A;  2WSE J;  3CCS P;  3EQ2 A;  1OFC X;  1LWU C;  1FJK A;  2Q7C A;  2N9Y B;  5KTB A;  1KYO H;  5E79 H;  1FDO A;  1KB9 H;  1KYO I;  1YQ3 C;  2ZT9 D;  4BRY A;  1LTA C;  2E76 C;  1RY3 A;  2QVA A;  3EWK A;  1HH0 A;  1SQQ E;  1FU1 A;  1GK4 A;  1KIL E;  2FYN B;  3L74 G;  1AJY A;  1VQ7 P;  5CCG A;  1ZR2 A;  2KOG A;  3CXH H;  3H1H E;  3CD6 P;  3H32 B;  1M8O B;  1N73 C;  3CCM P;  2AXT H;  1PPJ D;  1PL5 A;  2GUS A;  2KI7 B;  1KTM A;  5KAF H;  1NTK D;  1BCC J;  3L72 J;  2BCC J;  1BGY J;  2N1T A;  1QVG O;  1VQ6 P;  1SQV G;  1VF5 D;  3H25 A;  2JDI H;  3KQG A;  1KQF B;  3M9Q A;  3L73 D;  3VMY A;  1RF0 C;  2HYN A;  3MD0 A;  3RK3 E;  1OVV A;  3S1K A;  1FC2 C;  4L76 A;  1EQ7 A;  1FZC B;  3AE1 C;  2Q5U A;  3L74 J;  4EDF A;  1DIP A;  3I5C A;  5KLV E;  3D6Z A;  2Q3E A;  1KQS O;  3B5N C;  3RL0 B;  1KB9 E;  3L71 D;  4HJG H;  1OIP A;  4WWI A;  1GK6 A;  1ZOY C;  4WVZ A;  1G1I A;  3HE4 B;  4D6T E;  5KAF E;  4EOT A;  1NTM K;  1NTZ E;  1SQX G;  1LWU B;  1RQU A;  2LKM A;  2M3B A;  1IK9 A;  3EFF K;  3IF4 A;  3P7K A;  4OWF A;  4PD4 H;  2FFD B;  1X9V A;  3D70 A;  4XFJ A;  4U3F E;  1VQP P;  1SQP K;  3NXS A;  1SFC D;  2IYO A;  4UB6 E;  5GTH H;  4A7P A;  1SVF A;  2E42 A;  1GL2 B;  4O9B A;  2J5U A;  1KB9 I;  2OYH A;  1SQX J;  1M56 D;  1UII A;  2QIW A;  1NTZ K;  1IFM A;  2QRX A;  5KLV G;  2QJY B;  4WY4 C;  1FAV A;  4I1L A;  5AVY B;  3KHU A;  1PIX A;  1H89 A;  1HGZ A;  3RK2 C;  1VF5 C;  1N7S A;  5KLV K;  1LTJ B;  2KSE A;  1FZA A;  3M9H A;  1FZC C;  2WPV B;  3H1I E;  3AE6 C;  2OAR A;  2UWJ E;  1RF1 C;  3L74 D;  3CC2 P;  3NMD A;  5K5G B;  1SQV J;  4DCK A;  2P7J A;  2GA1 A; 
#chains in the Genus database with same CATH homology
 3FGA D;  2MKV A;  4OGQ C;  2IDB A;  3AEC C;  3AE8 C;  5KLI C;  3AE3 C;  2E74 D;  3IN6 A;  1OW6 A;  3AEE C;  2H88 C;  1S1C X;  1YQ4 C;  4YTP C;  1K04 A;  2FYN C;  2O01 J;  4PV1 D;  2QJK C;  2E74 B;  5KKZ C;  1HF9 A;  3AE9 C;  3SFD C;  1FDI A;  2E76 B;  3AE7 C;  2G8Y A;  1KQG B;  4GDO A;  3AE2 C;  1GMJ A;  1HJ0 A;  2E76 D;  2E75 B;  3O6Q A;  3Q5R A;  4PV1 B;  3SFE C;  1WMK A;  4I7Z C;  2ZT9 C;  2ZT9 B;  1VF5 B;  4H44 C;  4I7Z B;  3B71 A;  3RL0 g;  2JO1 A;  4U7J A;  1OMI A;  2OQQ A;  3D6Y A;  2QJY C;  3AEF C;  4Y28 J;  1UIX A;  3AEA C;  3AED C;  3Q3D A;  2E75 C;  1OW7 A;  3C8V A;  3R4Y A;  2K9Y A;  2YIU C;  1EXJ A;  4Z1M H;  2D2C C;  1ZP0 C;  4PV1 C;  3AEB C;  2E75 D;  3ABV C;  4H0L B;  2WSE J;  1JB0 J;  1VL2 A;  2QJP C;  1FDO A;  2ZT9 D;  1YQ3 C;  2WSF J;  1DD3 A;  1EXI A;  4H0L D;  1ZME C;  2E76 C;  3EWK A;  1PV3 A;  1KMI Z;  2WSC J;  1KIL E;  1NYH A;  1AJY A;  3GF3 A;  4R4M A;  1Q90 D;  1RQV A;  2NZ2 A;  3AE4 C;  2D2C D;  3S9O A;  1MKM A;  1PL5 A;  1R8E A;  5L8R J;  1KTM A;  2FBW C;  3Q2Y A;  1NGM B;  1Y9B A;  4YXD C;  3GMA A;  1VF5 D;  3H25 A;  1K05 A;  1KQF B;  2QSI A;  1S5L X;  2D2C B;  3RK3 E;  3AEG C;  1ZRT E;  3AE1 C;  4OGQ B;  1DIP A;  1U57 A;  2FXP A;  4H13 D;  3D6Z A;  1IK7 A;  2BEZ F;  5M1B A;  1OW8 A;  3LW5 J;  3IAO A;  1ZOY C;  4KT0 J;  4OGQ D;  1RQU A;  3D70 A;  4XFJ A;  4H0L C;  4R4L A;  4H13 C;  2JP3 A;  2BEQ D;  4IL6 X;  2H89 C;  2J5U A;  1TU3 F;  4RKU J;  3G9R A;  3Q5P A;  3Q1M A;  2QIW A;  1KOR A;  4H13 B;  2P10 A;  2WQY C;  1PIX A;  3GLM A;  2V7Q J;  2G3A A;  2YMK A;  1VF5 C;  4H44 B;  1DD4 A;  2WPV B;  3T97 B;  4TT3 H;  3AE5 C;  3AE6 C;  3GF7 A;  3D71 A;  3Q5S A;  2E74 C;  4H44 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...