3RK3E

Truncated snare complex with complexin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
50
structure length
50
Chain Sequence
b'GSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vamp2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 20
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3rk3E00
3RK3E 1KILE 4GDOA 3RL0g
chains in the Genus database with same CATH superfamily
1M7LA 1NWQA 4XFJA 1YQ3C 1ZRTD 1L0LD 1VQ8P 2ZVOB 2KLUA 2ZT9C 4MN4C 4DOJA 3BCCE 5KJ7A 2ZT9D 2YMYA 1KB9H 3C8VA 1KYOH 4U3FG 1Q90D 4R4LA 2OTJP 5AVVB 2W6AA 5CJ4A 3V2QA 2YO3A 1YTZT 2YO2A 3L73G 2JP3A 2P2UA 3B4SA 3H1ID 2KLVA 1SS1A 1N73A 4UB8H 3N7NA 1L0NG 2QJYB 4EOTA 3L75G 1JY2N 1QVGO 2FKWB 3S9OA 1W2BO 1HGVA 3AECC 2QRXA 1RF1B 2IX7C 3B71A 3I5CA 4U3FD 1LT9B 1PP9E 1SQBK 2KZJA 1YTZI 2IYOA 3M0DC 3L73D 4BWNA 1DEBA 5AVUB 2BCCG 3V2NA 3NMDA 5KAIH 1YBKA 1DD3A 3KQGA 1L0ND 1J1EB 4PJ0E 2R32A 5AVQB 3L75D 3CX5H 2WITA 2WSCH 3H6PA 1BCCG 4H13B 2Z5IA 4W7YA 4KJMA 1RHZB 3MGNA 3H1JJ 1HBWA 2WSEH 2NZ2A 1HH0A 1S9KE 2BCCD 4W7ZA 3CCMP 3M91A 1BE3G 4JQ0D 2GUSA 1L0LK 3L70E 2M5AA 4UB6E 1L0LJ 3RBXA 2G3AA 1BCCD 4PD4H 1P84I 2MJZA 1USEA 3MZWB 1GTWA 1JEKA 1JO5A 3H1KG 5AVTB 1KV4A 3H1IJ 1AQTA 1OIPA 2H89C 3OA7A 2PRRA 2FXOA 1JOCA 1BE3D 2QIWA 4OVNF 3SWFA 3M0AA 1R8EA 3T97A 1FDMA 5B66E 3H1KD 3FWLA 2K3RA 2KIKA 2I1KA 1PFIA 2I1JA 4KT0J 2YXQB 3FWNA 2H8PD 2K9JB 2RH0A 1PL5A 3CWBE 1AJYA 3L75J 1CZQA 1KILC 1NU1E 3TYYA 4JBZA 1KILD 2B87B 1LWUC 1K9MQ 1JB0J 2YMKA 3PP5A 3JSVC 2WT7B 4DT0A 3H1LE 3M9BA 5GTIE 1VF5B 2WVRA 1S3JA 1D7MA 2R5DA 3CCSP 1KD1Q 2O1JA 3Q5SA 1OVUA 1EDIA 1BGYG 3AE6C 4AQRD 1L4AC 5APVA 1BCCJ 3GF3A 1L4AD 1RE4C 1S5LH 2WSCJ 1N8RQ 1JCCA 5APTA 5BVZA 1NTKE 3R2PA 2Z4EA 3AE3C 1T6AA 4C7NA 3WUVA 5KAIE 4GOEA 3AE4C 1BDCA 1SQPG 1BGYD 1JY3N 5APYA 1LTIC 1HJ0A 1OW6A 3TGUG 1ZV8A 3AE5C 1KQFB 2IPPA 1KQGB 3FGAD 3KHUA 4Y99B 1AFOA 5APXA 5AVSB 1Q81Q 2PFXA 2M8RA 5K5GB 1SQPD 1NYHA 1NVOA 3TGUD 4D6TE 2FYUE 3H25A 4H44B 1X8YA 1MUUA 5KKZC 4M3LA 3ABVC 1M90Q 1K8AQ 2KUBA 2HPCB 1VQMP 3IF4A 2M3BA 1N7SB 2D2CC 1ZR2A 3V4WA 2D2CD 2YKOA 4R4MA 2WT7A 3RBZA 2E76B 4GODA 1FOSE 1FZEA 4WVZA 2L91A 3RL0g 5APSA 2JO1A 1VDFA 1BSNA 5KJ7C 5KJ7D 2BEQD 2GUVA 1VQKP 3M9QA 3KPEA 2HLOA 1KN7A 1N73C 4EYYQ 2OTLP 4JYCA 2E74B 1URQB 2H7HA 1SQPK 3P32A 1SQPJ 5CHXA 3WMM0 1OZHA 4L76A 5GTHE 2WQYC 1S4XA 2O01H 3BCCG 4K35A 2PGDA 2W6JH 3IAOA 4OWFA 3S1KA 2Z5HA 3O6QA 4PV1B 3RK3C 1T2KC 3RK3D 3HE4A 1T2KD 2QJPB 4Y28J 1QX8A 3PH0A 2Y9ZA 3FXEA 4YTPC 1L4AA 3BCCD 1OWAA 1G1IA 1RE4A 1EXJA 2IYPA 1FDIA 1FJPA 2XV5A 1GL2C 4L74A 4RO0A 1RH5B 1EZVG 5AVXB 2O01N 1GL2D 4CPGA 3EFFK 4DZOA 1NTZJ 1EDKA 5APUA 2B89A 3CCQP 1SVFA 3B5NB 1GMJA 1PGQA 2QSIA 3FXDA 2DW3A 1EZVD 3WUUA 4UB6H 1YI2P 1P84E 1USDA 1SQXJ 1HTLC 2AXCA 5APQA 3V4QA 3V2RA 1T3UA 4OGQB 1FU1A 2QJYC 1DX7A 1Z56A 3H1JG 1M57D 2ITAA 2B88A 2ZVNB 2WZ7A 1JMBA 3K5BA 3E1IA 1S72P 1K73Q 1FBMA 4KHXA 1CW5A 1RF1C 1S9KD 3LIDA 2UWJE 4AYCA 1RF0C 2OYHB 1G2CB 3II6A 1FZCB 4H0LC 5AW3B 3L35A 1CI6B 4H0LD 3H1HG 4WB4A 2ZXEB 3BCCJ 4NPFX 2K88A 3H1JD 2JKVA 1JTHA 1JNMA 2WPQA 2HODB 4H13C 4IL6X 2OYIB 4H13D 3L74E 3CXHD 1KTMA 3P8CD 1IFIA 2LR2A 2XNXA 1PPJE 1ZMEC 3H1HD 3M06A 1LTJB 5AVZB 2CPBA 1IK7A 5GTIH 2YKQA 4ASVA 1PP9J 2R5BA 3AE2C 2R3SA 3RGUA 2FXPA 3PLNA 2IDBA 4HJGH 1VQ7P 5KLIB 2WSFH 2N1TB 2QEXP 2NRGA 4K3AA 3CCLP 4BXLA 2WSSH 3A5TA 4HB1A 3AE8C 4IFMA 1KB9D 1KYOD 2GM4A 2FYNB 1GK4A 1QGKB 1NTKG 3Q5PA 1OVVA 5AVWB 2WMMA 1IFMA 2P58A 3RK2B 2BEZF 2A45H 1PIXA 5H2FH 1YJNP 3BASA 4I2LC 1ZLLA 4IL6E 1HF9A 2QJKB 1AVOA 4N78E 2QVAA 3N4XA 2KNCB 1NTKD 1U57A 1GL2A 3UIAA 3CCJP 2FFDB 3CCUP 1SQBE 1CI6A 4JF7A 3VP8A 1J1DB 3U59A 1KQLA 3Q1MA 3G71P 1M1JB 1VF5C 2ZT9B 3CX5D 1VF5D 2E43A 3H1HJ 3IFMA 2LXBA 4LC1A 3H32B 1SQVG 1NGMB 1OXZA 1HWTC 1FJKA 5KLVG 1NTME 5M1BA 3CWBJ 2QE7H 1LTJA 5AW9B 2C9LY 1R5LA 1NU1K 1ZP0C 2XU6A 1ZRTE 1QVFO 2W27A 3HE5B 4PD4D 1NU1J 4C46A 3SWYA 2IBZG 1SQVD 2E75B 3IR9A 1X9VA 2L5GB 3H1LJ 4I7ZB 2CPSA 5KLVD 2JEEA 1RF1A 2OYOA 1AV1A 4LLHA 1RF0A 2YIUB 3CPWO 1LT9A 3KYQA 2RMZA 4Y99C 2Y9YA 2M3EA 2OARA 1LTAC 4BRYB 3VMXA 1MV8A 1DIPA 2IBZD 1CSBA 3L36A 3RL0B 1NTKK 3TDKA 4U3FE 1NTKJ 1HVVA 1G1JA 3BATA 1SQQG 2HR3A 3L73E 4WY4B 5GTHH 2KB7P 3VMZA 4GIFA 1NJIQ 1VQLP 2E42A 1L0NE 2C9NY 3MTUE 1LGHB 2IFNA 1GZLA 2KNCA 5DJTB 1KQSO 1LTSC 4GOFA 3MUDA 1N7SD 1VQ5P 5EFWB 1OW7A 4OH8B 2FFDA 2P10A 2WSEJ 5AVYB 1M1JA 1Q2NA 2Q3IA 1SQQD 3PHLA 5TJHA 2BCCE 1IO4A 3V5BA 5E79E 5H2FE 3H32A 3O8ZA 1EZVI 1JY2P 1U7JA 5KAFH 4D6TJ 3B8EB 1SQVK 1E5WA 2FYUJ 2H88C 1BCCE 1SQVJ 3HTKB 1M8OB 1S1CX 1EXIA 1GU5A 4DCKA 1T3JA 5KLVK 5KLVJ 2P7JA 2C0WA 3F5HA 5CBOA 1FOSF 2O3JA 3NFQA 1BE3E 2E74C 1URQC 1ZW0A 2E74D 2K9JA 2P67A 1URQD 2Y0CA 2KS1B 3H1KE 2A06G 3CC2P 1P84H 3W67A 2FXMA 1NTZG 2LXCB 2B87A 4HKZH 1J2JB 4BRYA 2NPSB 3U1AA 2Y0DA 3GHGB 2W6BA 3F89A 3CXHI 2QJPC 1EDJA 3AEBC 3LW5H 1KILE 1JM0A 4WY4A 3HRNA 1SQQK 2A06D 3KDPB 3A0BE 1SQQJ 2YXRB 1NTZD 1SQXG 1WMKA 3QWOC 3PRJA 4YXWH 2CK3H 2LKMA 3U1CA 2N9YB 3LIEA 1GW3A 2J58A 1XTCC 2JWDA 2ZYGA 5TISE 2FY8A 3CD6P 2ZFCA 4EDFA 1NKZB 3L71E 1IC2A 1LP1B 1SQXD 1KB9I 1KYOI 1IZNB 1PPJG 1L2PA 3GMAA 1LNQA 1BGYE 1QL2A 3L72E 3E7KA 3VYIA 3NXSA 3SSUA 4OGQC 5L8RJ 2V7QH 4OGQD 1PGJA 1X79B 2W8ZA 2YKPA 3P7KA 4JPZB 1X22A 2E5TA 3IN6A 1PPJD 2MKVA 2KS1A 4NPDA 1LTTC 2HPCA 5CCHA 1KFMA 5KAFE 1PP9G 2KP8A 1HJBA 3V2PA 3TGUE 1N7SA 3AE7C 5B5EH 3L37A 3CX5I 3WU2H 2Q1KA 4O9BA 1NTZK 1AA0A 3SWKA 4YXDC 2AEJA 3E1RA 1R5SA 4IL6H 1SP4A 3D70A 4DJGA 1JY3P 1N73B 1PP9D 1VQ6P 3ZDMA 4N6JA 3BRTB 4C7RA 3ITKA 1IFPA 1LTJC 3I55P 1SQXK 4PD4I 1GK6A 3L70G 4A7PA 1FZFA 1Q7YQ 2OQQA 2R3CA 1DD4A 3G3ZA 1S2EA 3M9HA 1FC2C 1JY3O 2WPSA 3G6EP 1URQA 1E79H 1M56D 4WWIA 1LP1A 1KZUB 5BU8B 1XTGB 1PGPA 5APWA 1LT9C 2G8YA 2POHA 3L4FA 3L74J 3R4YA 3L70D 1GU4A 2IBZI 2FYNC 3VP9A 1FS0E 2ZYDA 1J1EC 3VMYA 2AEFA 3GF7A 3RK2C 1QLED 1FZGA 2O01J 3RK2D 1OVRA 2XDJA 1FZBA 1ZR4A 2KSEA 3CC4P 2Q6QA 3CMAP 2QJKC 3CWBG 2V7QJ 1VQ4P 1VPCA 4L75A 4IFFA 2ZYAA 3I56P 4Z1MH 3RK3E 4XE5B 2FYZA 3JCUE 1NU1G 3MUDC 3SFDC 2FFDC 3MIWA 2GA1A 1J1DC 2HG5D 3QH9A 3OJAB 1M1JC 4B86A 3H1LG 1SFCB 1N7LA 1M1KQ 1RE3C 5CCGA 3CWBD 3T97B 2HFED 2QM7A 5KTBA 5BU5A 3B5NA 1LTBC 5DJUB 3A7OA 1NU1D 1MFTA 3HUSB 2RN0A 4GKGA 3H1LD 1N2DC 3HD7B 1GDTA 3TSIA 2Y0EA 5B5EE 1LT1A 5CBNA 3WU2E 5AW4B 5AW0B 3L70J 2E75C 5E79H 1EZVE 1SQBJ 3BRVB 4H0LB 2E75D 2B9BA 4ASWA 2A45G 4I7ZC 4HH2A 1AVYA 2W83C 2J59M 2YIUC 2K1AA 3AEFC 3C9IA 3AE9C 1VQNP 2K37A 3MP7B 2XNDH 1UIXA 1Y9BA 2OYHA 1NAYA 4JYBA 1G2CA 1FZCA 2H43A 1BSHA 1NKNA 3KZIH 1NTMK 3RL0C 1NTMJ 3EQ2A 3RL0D 1HUCA 2HODA 2OYIA 4D6TG 2FYUG 1IFJA 3TNUB 1N86A 4WY4C 3VN0A 4C7NB 2KOGA 1EDLA 1PGOA 4WY4D 1LJ2A 2WPRA 4ZMDA 2Q9IA 3H1JE 1FDOA 2QM8A 1NHLA 4W80A 1ZOYC 1AQ5A 2KZIA 2ZXXA 3VTPC 1VL2A 3CXHE 1OMIA 3P8CE 3GG2A 1FZAA 3WUTA 1L0LE 1YIJP 1K05A 4D6TD 2FYUD 1SFCA 3H1HE 2N1TA 3A0BH 1QL1A 3SFEC 1A02F 1H8AA 3GW6A 1KMIZ 1ZXGA 1Q86Q 4U3FJ 3H1IE 2O1KA 5AVRB 4RJTA 1KORA 3L73J 3HUSA 3Q2YA 1NO4A 1QEXA 2WSFJ 1PZQA 1Q82Q 2R44A 1L0NK 2HYNA 1A02J 2IZ0A 1MZ9A 3HD7A 1L0NJ 5TISH 2BASA 4WBAA 2M0BA 5AW8B 3C1LA 1FE6A 2K9YA 1YITP 1YYCA 4H44C 1KB9E 1KYOE 4H44D 3L71G 3FX0A 1GD2E 5CCHC 3L75E 2BCCJ 5CCHD 5C39A 4UB8E 1N7SC 1HGZA 2W90A 1MFZA 2AEMA 2JWAA 2PP6A 3AEAC 2NPSC 2XZRA 3GHGC 3L72G 1LTGC 3KXDA 2E76C 2OGUA 1H0TB 2NPSD 1NOHA 3MD0A 2E76D 4ZNCA 1YQ4C 2ZJSE 2VRSA 1KFNA 3L71D 1RE3A 3TF5A 3TNUA 4EI2A 2YNYA 2FYUK 1BE3J 3TK1A 3BVHA 2J5UA 3CX5E 5CJ0A 3L72D 4HYTB 1YHQP 3H1KJ 3HE5A 1VQOP 1PV3A 1JCDA 3KZIE 1KILB 2V4HA 3NTNA 2IFMA 2OTKE 2KYVA 1JY2O 4EIJA 3A0HH 3M0DA 2Q5UA 1LWUB 3VMAA 3O6QB 1NAFA 1JMMA 2JJLA 3HE4B 4PD4E 3AEEC 2KK7A 5AW6B 1SQVE 3Q3DA 4RESB 4RKUJ 1S5LX 1L4AB 3P8MC 4I6MC 3CCRP 4PV1C 1DH3A 1ZN5A 5KLVE 2Q3EA 4PV1D 4IOIH 5AW5B 3CL3D 4GDOA 2I8DA 4N3YB 1IJDB 3OAKA 3A3YB 2QA4P 1UIIA 3Q5RA 1YJWP 2IBZE 1OX3A 3L71J 5CMZA 1IFNA 3V6IA 1P84D 1EC5A 3CC7P 2P1JA 1RQVA 1MKMA 1H0TA 1VQPP 2WTYA 1BGYJ 2C0XA 5CCGC 1BDDA 2KSJA 3L72J 5CCGD 4L73A 3VOPA 4ZKPA 1RY3A 3L74G 1SLQA 2AXTH 3B5NC 1Y47A 3B5ND 2WPVB 3JCUH 5AW2B 4IFDK 4XA4A 3G4SP 1SQQE 3HTKA 3S4RA 3JC22 5KKZB 1NH4A 2Q7CA 1H88A 4TLFA 3TGUJ 1VQ9P 3AEGC 1S5LE 3A2AA 3L74D 1KILA 2D2CB 2KI7B 1LWUA 2XKMA 2PAJA 2RKLA 1JTHB 1SQPE 1YJ9P 2E5YA 3D6ZA 3EFGA 2OYHC 1FZCC 2ZAEB 1W2EA 1K04A 3EWKA 4ZKUA 1W5CE 2NPSA 2A45I 3GHGA 3OW2O 4YPCA 2JR8A 3CCEP 4NPEA 2OYIC 3D6YA 2JDIH 3CI9A 3CMEP 2WWWA 5AW7B 4PJ0H 1DEEG 3G9RA 3A0HE 3MHVA 2QG4A 1Y8AA 3USSA 1EQ7A 1RQUA 3LW5J 2FBWC 5AW1B 1U7MA 1SQBG 2SPZA 1SFCC 2A06E 2N9BA 1SFCD 3AEDC 1NTZE 5KLIC 1IK9A 1FAVA 2N1TC 3CLQA 3CCVP 4U7JA 2N1TD 1OW8A 4N78D 3AE1C 3RK3B 1OFCX 2IZ1A 1GW4A 1KC8Q 3HUSC 4GT1A 4AUWA 1SQBD 1NTMG 3CXHH 4LGDE 4TT3H 3HD7C 1T8ZA 3HD7D 3PJSK 1SQXE 1L0LG 1IFDA 1WRGA 4I1LA 1GL2B 3W68A 2M5AB 1WT6A 5B66H 3D71A 3PTZA 1X0TA 4QMAA 3GLMA 2AXTE 1TU3F 1JUNA 2KXPB 1NTMD 1H89A 3H1IG
chains in the Genus database with same CATH topology
3D6YA 1VL2A 1OMIA 4Y28J 2BEZF 2OQQA 3G9RA 1PIXA 2D2CC 1YQ3C 4XFJA 3Q5SA 1DD4A 1RQVA 4H0LC 1MKMA 3AE6C 1K05A 2D2CD 3GMAA 4H0LD 2E74C 2G3AA 4R4MA 2ZT9C 3GF3A 4YTPC 2E76B 2J5UA 2E74D 2ZT9D 1HF9A 2WSCJ 3C8VA 1DIPA 1EXJA 1Q90D 4R4LA 1FDIA 4OGQC 5L8RJ 3RL0g 1RQUA 3LW5J 4H13C 2FBWC 4IL6X 3SFEC 4OGQD 1KMIZ 2G8YA 4H13D 1U57A 2WPVB 2JP3A 2H89C 3AE3C 2JO1A 1PV3A 3R4YA 1KTMA 2E75C 1KORA 3Q2YA 2QIWA 2FYNC 4H0LB 3AE4C 2E75D 3AEDC 2WSFJ 5KLIC 3Q1MA 1VF5C 2ZT9B 4I7ZC 2BEQD 3IN6A 1ZMEC 1VF5D 4U7JA 2MKVA 1OW8A 3GF7A 1HJ0A 1R8EA 3S9OA 1OW6A 3AECC 3AE1C 2QJPC 2YIUC 3AEFC 2O01J 1IK7A 3AE5C 3AE9C 1UIXA 1Y9BA 1GMJA 2K9YA 3AEEC 3AEBC 1OW7A 3B71A 3AEGC 1KQFB 3AE7C 1KILE 2QSIA 4H44C 2P10A 1KQGB 3AE2C 3FGAD 2WSEJ 3Q3DA 2D2CB 4KT0J 2FXPA 4H44D 2QJKC 4RKUJ 2IDBA 4YXDC 4TT3H 1S5LX 2V7QJ 2E74B 1WMKA 4PV1C 5M1BA 1DD3A 1PL5A 1AJYA 4PV1D 4Z1MH 3RK3E 3D6ZA 1NYHA 4GDOA 4OGQB 3SFDC 3D70A 4H13B 1ZP0C 1ZRTE 2WQYC 2QJYC 1K04A 3AE8C 3AEAC 3EWKA 3H25A 2H88C 3D71A 2E76C 4H44B 1JB0J 2YMKA 3IAOA 2E75B 2E76D 5KKZC 1FDOA 3Q5RA 1S1CX 1YQ4C 3ABVC 3GLMA 1EXIA 1TU3F 2NZ2A 1VF5B 1ZOYC 4I7ZB 3O6QA 4PV1B 3Q5PA 3T97B 1NGMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 E;  1KIL E;  4GDO A;  3RL0 g; 
#chains in the Genus database with same CATH topology
 1M7L A;  1NWQ A;  4XFJ A;  1YQ3 C;  1ZRT D;  1L0L D;  1VQ8 P;  2ZVO B;  2KLU A;  2ZT9 C;  4MN4 C;  4DOJ A;  3BCC E;  5KJ7 A;  2ZT9 D;  2YMY A;  1KB9 H;  3C8V A;  1KYO H;  4U3F G;  1Q90 D;  4R4L A;  2OTJ P;  5AVV B;  2W6A A;  5CJ4 A;  3V2Q A;  2YO3 A;  1YTZ T;  2YO2 A;  3L73 G;  2JP3 A;  2P2U A;  3B4S A;  3H1I D;  2KLV A;  1SS1 A;  1N73 A;  4UB8 H;  3N7N A;  1L0N G;  2QJY B;  4EOT A;  3L75 G;  1JY2 N;  1QVG O;  2FKW B;  3S9O A;  1W2B O;  1HGV A;  3AEC C;  2QRX A;  1RF1 B;  2IX7 C;  3B71 A;  3I5C A;  4U3F D;  1LT9 B;  1PP9 E;  1SQB K;  2KZJ A;  1YTZ I;  2IYO A;  3M0D C;  3L73 D;  4BWN A;  1DEB A;  5AVU B;  2BCC G;  3V2N A;  3NMD A;  5KAI H;  1YBK A;  1DD3 A;  3KQG A;  1L0N D;  1J1E B;  4PJ0 E;  2R32 A;  5AVQ B;  3L75 D;  3CX5 H;  2WIT A;  2WSC H;  3H6P A;  1BCC G;  4H13 B;  2Z5I A;  4W7Y A;  4KJM A;  1RHZ B;  3MGN A;  3H1J J;  1HBW A;  2WSE H;  2NZ2 A;  1HH0 A;  1S9K E;  2BCC D;  4W7Z A;  3CCM P;  3M91 A;  1BE3 G;  4JQ0 D;  2GUS A;  1L0L K;  3L70 E;  2M5A A;  4UB6 E;  1L0L J;  3RBX A;  2G3A A;  1BCC D;  4PD4 H;  1P84 I;  2MJZ A;  1USE A;  3MZW B;  1GTW A;  1JEK A;  1JO5 A;  3H1K G;  5AVT B;  1KV4 A;  3H1I J;  1AQT A;  1OIP A;  2H89 C;  3OA7 A;  2PRR A;  2FXO A;  1JOC A;  1BE3 D;  2QIW A;  4OVN F;  3SWF A;  3M0A A;  1R8E A;  3T97 A;  1FDM A;  5B66 E;  3H1K D;  3FWL A;  2K3R A;  2KIK A;  2I1K A;  1PFI A;  2I1J A;  4KT0 J;  2YXQ B;  3FWN A;  2H8P D;  2K9J B;  2RH0 A;  1PL5 A;  3CWB E;  1AJY A;  3L75 J;  1CZQ A;  1KIL C;  1NU1 E;  3TYY A;  4JBZ A;  1KIL D;  2B87 B;  1LWU C;  1K9M Q;  1JB0 J;  2YMK A;  3PP5 A;  3JSV C;  2WT7 B;  4DT0 A;  3H1L E;  3M9B A;  5GTI E;  1VF5 B;  2WVR A;  1S3J A;  1D7M A;  2R5D A;  3CCS P;  1KD1 Q;  2O1J A;  3Q5S A;  1OVU A;  1EDI A;  1BGY G;  3AE6 C;  4AQR D;  1L4A C;  5APV A;  1BCC J;  3GF3 A;  1L4A D;  1RE4 C;  1S5L H;  2WSC J;  1N8R Q;  1JCC A;  5APT A;  5BVZ A;  1NTK E;  3R2P A;  2Z4E A;  3AE3 C;  1T6A A;  4C7N A;  3WUV A;  5KAI E;  4GOE A;  3AE4 C;  1BDC A;  1SQP G;  1BGY D;  1JY3 N;  5APY A;  1LTI C;  1HJ0 A;  1OW6 A;  3TGU G;  1ZV8 A;  3AE5 C;  1KQF B;  2IPP A;  1KQG B;  3FGA D;  3KHU A;  4Y99 B;  1AFO A;  5APX A;  5AVS B;  1Q81 Q;  2PFX A;  2M8R A;  5K5G B;  1SQP D;  1NYH A;  1NVO A;  3TGU D;  4D6T E;  2FYU E;  3H25 A;  4H44 B;  1X8Y A;  1MUU A;  5KKZ C;  4M3L A;  3ABV C;  1M90 Q;  1K8A Q;  2KUB A;  2HPC B;  1VQM P;  3IF4 A;  2M3B A;  1N7S B;  2D2C C;  1ZR2 A;  3V4W A;  2D2C D;  2YKO A;  4R4M A;  2WT7 A;  3RBZ A;  2E76 B;  4GOD A;  1FOS E;  1FZE A;  4WVZ A;  2L91 A;  3RL0 g;  5APS A;  2JO1 A;  1VDF A;  1BSN A;  5KJ7 C;  5KJ7 D;  2BEQ D;  2GUV A;  1VQK P;  3M9Q A;  3KPE A;  2HLO A;  1KN7 A;  1N73 C;  4EYY Q;  2OTL P;  4JYC A;  2E74 B;  1URQ B;  2H7H A;  1SQP K;  3P32 A;  1SQP J;  5CHX A;  3WMM 0;  1OZH A;  4L76 A;  5GTH E;  2WQY C;  1S4X A;  2O01 H;  3BCC G;  4K35 A;  2PGD A;  2W6J H;  3IAO A;  4OWF A;  3S1K A;  2Z5H A;  3O6Q A;  4PV1 B;  3RK3 C;  1T2K C;  3RK3 D;  3HE4 A;  1T2K D;  2QJP B;  4Y28 J;  1QX8 A;  3PH0 A;  2Y9Z A;  3FXE A;  4YTP C;  1L4A A;  3BCC D;  1OWA A;  1G1I A;  1RE4 A;  1EXJ A;  2IYP A;  1FDI A;  1FJP A;  2XV5 A;  1GL2 C;  4L74 A;  4RO0 A;  1RH5 B;  1EZV G;  5AVX B;  2O01 N;  1GL2 D;  4CPG A;  3EFF K;  4DZO A;  1NTZ J;  1EDK A;  5APU A;  2B89 A;  3CCQ P;  1SVF A;  3B5N B;  1GMJ A;  1PGQ A;  2QSI A;  3FXD A;  2DW3 A;  1EZV D;  3WUU A;  4UB6 H;  1YI2 P;  1P84 E;  1USD A;  1SQX J;  1HTL C;  2AXC A;  5APQ A;  3V4Q A;  3V2R A;  1T3U A;  4OGQ B;  1FU1 A;  2QJY C;  1DX7 A;  1Z56 A;  3H1J G;  1M57 D;  2ITA A;  2B88 A;  2ZVN B;  2WZ7 A;  1JMB A;  3K5B A;  3E1I A;  1S72 P;  1K73 Q;  1FBM A;  4KHX A;  1CW5 A;  1RF1 C;  1S9K D;  3LID A;  2UWJ E;  4AYC A;  1RF0 C;  2OYH B;  1G2C B;  3II6 A;  1FZC B;  4H0L C;  5AW3 B;  3L35 A;  1CI6 B;  4H0L D;  3H1H G;  4WB4 A;  2ZXE B;  3BCC J;  4NPF X;  2K88 A;  3H1J D;  2JKV A;  1JTH A;  1JNM A;  2WPQ A;  2HOD B;  4H13 C;  4IL6 X;  2OYI B;  4H13 D;  3L74 E;  3CXH D;  1KTM A;  3P8C D;  1IFI A;  2LR2 A;  2XNX A;  1PPJ E;  1ZME C;  3H1H D;  3M06 A;  1LTJ B;  5AVZ B;  2CPB A;  1IK7 A;  5GTI H;  2YKQ A;  4ASV A;  1PP9 J;  2R5B A;  3AE2 C;  2R3S A;  3RGU A;  2FXP A;  3PLN A;  2IDB A;  4HJG H;  1VQ7 P;  5KLI B;  2WSF H;  2N1T B;  2QEX P;  2NRG A;  4K3A A;  3CCL P;  4BXL A;  2WSS H;  3A5T A;  4HB1 A;  3AE8 C;  4IFM A;  1KB9 D;  1KYO D;  2GM4 A;  2FYN B;  1GK4 A;  1QGK B;  1NTK G;  3Q5P A;  1OVV A;  5AVW B;  2WMM A;  1IFM A;  2P58 A;  3RK2 B;  2BEZ F;  2A45 H;  1PIX A;  5H2F H;  1YJN P;  3BAS A;  4I2L C;  1ZLL A;  4IL6 E;  1HF9 A;  2QJK B;  1AVO A;  4N78 E;  2QVA A;  3N4X A;  2KNC B;  1NTK D;  1U57 A;  1GL2 A;  3UIA A;  3CCJ P;  2FFD B;  3CCU P;  1SQB E;  1CI6 A;  4JF7 A;  3VP8 A;  1J1D B;  3U59 A;  1KQL A;  3Q1M A;  3G71 P;  1M1J B;  1VF5 C;  2ZT9 B;  3CX5 D;  1VF5 D;  2E43 A;  3H1H J;  3IFM A;  2LXB A;  4LC1 A;  3H32 B;  1SQV G;  1NGM B;  1OXZ A;  1HWT C;  1FJK A;  5KLV G;  1NTM E;  5M1B A;  3CWB J;  2QE7 H;  1LTJ A;  5AW9 B;  2C9L Y;  1R5L A;  1NU1 K;  1ZP0 C;  2XU6 A;  1ZRT E;  1QVF O;  2W27 A;  3HE5 B;  4PD4 D;  1NU1 J;  4C46 A;  3SWY A;  2IBZ G;  1SQV D;  2E75 B;  3IR9 A;  1X9V A;  2L5G B;  3H1L J;  4I7Z B;  2CPS A;  5KLV D;  2JEE A;  1RF1 A;  2OYO A;  1AV1 A;  4LLH A;  1RF0 A;  2YIU B;  3CPW O;  1LT9 A;  3KYQ A;  2RMZ A;  4Y99 C;  2Y9Y A;  2M3E A;  2OAR A;  1LTA C;  4BRY B;  3VMX A;  1MV8 A;  1DIP A;  2IBZ D;  1CSB A;  3L36 A;  3RL0 B;  1NTK K;  3TDK A;  4U3F E;  1NTK J;  1HVV A;  1G1J A;  3BAT A;  1SQQ G;  2HR3 A;  3L73 E;  4WY4 B;  5GTH H;  2KB7 P;  3VMZ A;  4GIF A;  1NJI Q;  1VQL P;  2E42 A;  1L0N E;  2C9N Y;  3MTU E;  1LGH B;  2IFN A;  1GZL A;  2KNC A;  5DJT B;  1KQS O;  1LTS C;  4GOF A;  3MUD A;  1N7S D;  1VQ5 P;  5EFW B;  1OW7 A;  4OH8 B;  2FFD A;  2P10 A;  2WSE J;  5AVY B;  1M1J A;  1Q2N A;  2Q3I A;  1SQQ D;  3PHL A;  5TJH A;  2BCC E;  1IO4 A;  3V5B A;  5E79 E;  5H2F E;  3H32 A;  3O8Z A;  1EZV I;  1JY2 P;  1U7J A;  5KAF H;  4D6T J;  3B8E B;  1SQV K;  1E5W A;  2FYU J;  2H88 C;  1BCC E;  1SQV J;  3HTK B;  1M8O B;  1S1C X;  1EXI A;  1GU5 A;  4DCK A;  1T3J A;  5KLV K;  5KLV J;  2P7J A;  2C0W A;  3F5H A;  5CBO A;  1FOS F;  2O3J A;  3NFQ A;  1BE3 E;  2E74 C;  1URQ C;  1ZW0 A;  2E74 D;  2K9J A;  2P67 A;  1URQ D;  2Y0C A;  2KS1 B;  3H1K E;  2A06 G;  3CC2 P;  1P84 H;  3W67 A;  2FXM A;  1NTZ G;  2LXC B;  2B87 A;  4HKZ H;  1J2J B;  4BRY A;  2NPS B;  3U1A A;  2Y0D A;  3GHG B;  2W6B A;  3F89 A;  3CXH I;  2QJP C;  1EDJ A;  3AEB C;  3LW5 H;  1KIL E;  1JM0 A;  4WY4 A;  3HRN A;  1SQQ K;  2A06 D;  3KDP B;  3A0B E;  1SQQ J;  2YXR B;  1NTZ D;  1SQX G;  1WMK A;  3QWO C;  3PRJ A;  4YXW H;  2CK3 H;  2LKM A;  3U1C A;  2N9Y B;  3LIE A;  1GW3 A;  2J58 A;  1XTC C;  2JWD A;  2ZYG A;  5TIS E;  2FY8 A;  3CD6 P;  2ZFC A;  4EDF A;  1NKZ B;  3L71 E;  1IC2 A;  1LP1 B;  1SQX D;  1KB9 I;  1KYO I;  1IZN B;  1PPJ G;  1L2P A;  3GMA A;  1LNQ A;  1BGY E;  1QL2 A;  3L72 E;  3E7K A;  3VYI A;  3NXS A;  3SSU A;  4OGQ C;  5L8R J;  2V7Q H;  4OGQ D;  1PGJ A;  1X79 B;  2W8Z A;  2YKP A;  3P7K A;  4JPZ B;  1X22 A;  2E5T A;  3IN6 A;  1PPJ D;  2MKV A;  2KS1 A;  4NPD A;  1LTT C;  2HPC A;  5CCH A;  1KFM A;  5KAF E;  1PP9 G;  2KP8 A;  1HJB A;  3V2P A;  3TGU E;  1N7S A;  3AE7 C;  5B5E H;  3L37 A;  3CX5 I;  3WU2 H;  2Q1K A;  4O9B A;  1NTZ K;  1AA0 A;  3SWK A;  4YXD C;  2AEJ A;  3E1R A;  1R5S A;  4IL6 H;  1SP4 A;  3D70 A;  4DJG A;  1JY3 P;  1N73 B;  1PP9 D;  1VQ6 P;  3ZDM A;  4N6J A;  3BRT B;  4C7R A;  3ITK A;  1IFP A;  1LTJ C;  3I55 P;  1SQX K;  4PD4 I;  1GK6 A;  3L70 G;  4A7P A;  1FZF A;  1Q7Y Q;  2OQQ A;  2R3C A;  1DD4 A;  3G3Z A;  1S2E A;  3M9H A;  1FC2 C;  1JY3 O;  2WPS A;  3G6E P;  1URQ A;  1E79 H;  1M56 D;  4WWI A;  1LP1 A;  1KZU B;  5BU8 B;  1XTG B;  1PGP A;  5APW A;  1LT9 C;  2G8Y A;  2POH A;  3L4F A;  3L74 J;  3R4Y A;  3L70 D;  1GU4 A;  2IBZ I;  2FYN C;  3VP9 A;  1FS0 E;  2ZYD A;  1J1E C;  3VMY A;  2AEF A;  3GF7 A;  3RK2 C;  1QLE D;  1FZG A;  2O01 J;  3RK2 D;  1OVR A;  2XDJ A;  1FZB A;  1ZR4 A;  2KSE A;  3CC4 P;  2Q6Q A;  3CMA P;  2QJK C;  3CWB G;  2V7Q J;  1VQ4 P;  1VPC A;  4L75 A;  4IFF A;  2ZYA A;  3I56 P;  4Z1M H;  3RK3 E;  4XE5 B;  2FYZ A;  3JCU E;  1NU1 G;  3MUD C;  3SFD C;  2FFD C;  3MIW A;  2GA1 A;  1J1D C;  2HG5 D;  3QH9 A;  3OJA B;  1M1J C;  4B86 A;  3H1L G;  1SFC B;  1N7L A;  1M1K Q;  1RE3 C;  5CCG A;  3CWB D;  3T97 B;  2HFE D;  2QM7 A;  5KTB A;  5BU5 A;  3B5N A;  1LTB C;  5DJU B;  3A7O A;  1NU1 D;  1MFT A;  3HUS B;  2RN0 A;  4GKG A;  3H1L D;  1N2D C;  3HD7 B;  1GDT A;  3TSI A;  2Y0E A;  5B5E E;  1LT1 A;  5CBN A;  3WU2 E;  5AW4 B;  5AW0 B;  3L70 J;  2E75 C;  5E79 H;  1EZV E;  1SQB J;  3BRV B;  4H0L B;  2E75 D;  2B9B A;  4ASW A;  2A45 G;  4I7Z C;  4HH2 A;  1AVY A;  2W83 C;  2J59 M;  2YIU C;  2K1A A;  3AEF C;  3C9I A;  3AE9 C;  1VQN P;  2K37 A;  3MP7 B;  2XND H;  1UIX A;  1Y9B A;  2OYH A;  1NAY A;  4JYB A;  1G2C A;  1FZC A;  2H43 A;  1BSH A;  1NKN A;  3KZI H;  1NTM K;  3RL0 C;  1NTM J;  3EQ2 A;  3RL0 D;  1HUC A;  2HOD A;  2OYI A;  4D6T G;  2FYU G;  1IFJ A;  3TNU B;  1N86 A;  4WY4 C;  3VN0 A;  4C7N B;  2KOG A;  1EDL A;  1PGO A;  4WY4 D;  1LJ2 A;  2WPR A;  4ZMD A;  2Q9I A;  3H1J E;  1FDO A;  2QM8 A;  1NHL A;  4W80 A;  1ZOY C;  1AQ5 A;  2KZI A;  2ZXX A;  3VTP C;  1VL2 A;  3CXH E;  1OMI A;  3P8C E;  3GG2 A;  1FZA A;  3WUT A;  1L0L E;  1YIJ P;  1K05 A;  4D6T D;  2FYU D;  1SFC A;  3H1H E;  2N1T A;  3A0B H;  1QL1 A;  3SFE C;  1A02 F;  1H8A A;  3GW6 A;  1KMI Z;  1ZXG A;  1Q86 Q;  4U3F J;  3H1I E;  2O1K A;  5AVR B;  4RJT A;  1KOR A;  3L73 J;  3HUS A;  3Q2Y A;  1NO4 A;  1QEX A;  2WSF J;  1PZQ A;  1Q82 Q;  2R44 A;  1L0N K;  2HYN A;  1A02 J;  2IZ0 A;  1MZ9 A;  3HD7 A;  1L0N J;  5TIS H;  2BAS A;  4WBA A;  2M0B A;  5AW8 B;  3C1L A;  1FE6 A;  2K9Y A;  1YIT P;  1YYC A;  4H44 C;  1KB9 E;  1KYO E;  4H44 D;  3L71 G;  3FX0 A;  1GD2 E;  5CCH C;  3L75 E;  2BCC J;  5CCH D;  5C39 A;  4UB8 E;  1N7S C;  1HGZ A;  2W90 A;  1MFZ A;  2AEM A;  2JWA A;  2PP6 A;  3AEA C;  2NPS C;  2XZR A;  3GHG C;  3L72 G;  1LTG C;  3KXD A;  2E76 C;  2OGU A;  1H0T B;  2NPS D;  1NOH A;  3MD0 A;  2E76 D;  4ZNC A;  1YQ4 C;  2ZJS E;  2VRS A;  1KFN A;  3L71 D;  1RE3 A;  3TF5 A;  3TNU A;  4EI2 A;  2YNY A;  2FYU K;  1BE3 J;  3TK1 A;  3BVH A;  2J5U A;  3CX5 E;  5CJ0 A;  3L72 D;  4HYT B;  1YHQ P;  3H1K J;  3HE5 A;  1VQO P;  1PV3 A;  1JCD A;  3KZI E;  1KIL B;  2V4H A;  3NTN A;  2IFM A;  2OTK E;  2KYV A;  1JY2 O;  4EIJ A;  3A0H H;  3M0D A;  2Q5U A;  1LWU B;  3VMA A;  3O6Q B;  1NAF A;  1JMM A;  2JJL A;  3HE4 B;  4PD4 E;  3AEE C;  2KK7 A;  5AW6 B;  1SQV E;  3Q3D A;  4RES B;  4RKU J;  1S5L X;  1L4A B;  3P8M C;  4I6M C;  3CCR P;  4PV1 C;  1DH3 A;  1ZN5 A;  5KLV E;  2Q3E A;  4PV1 D;  4IOI H;  5AW5 B;  3CL3 D;  4GDO A;  2I8D A;  4N3Y B;  1IJD B;  3OAK A;  3A3Y B;  2QA4 P;  1UII A;  3Q5R A;  1YJW P;  2IBZ E;  1OX3 A;  3L71 J;  5CMZ A;  1IFN A;  3V6I A;  1P84 D;  1EC5 A;  3CC7 P;  2P1J A;  1RQV A;  1MKM A;  1H0T A;  1VQP P;  2WTY A;  1BGY J;  2C0X A;  5CCG C;  1BDD A;  2KSJ A;  3L72 J;  5CCG D;  4L73 A;  3VOP A;  4ZKP A;  1RY3 A;  3L74 G;  1SLQ A;  2AXT H;  3B5N C;  1Y47 A;  3B5N D;  2WPV B;  3JCU H;  5AW2 B;  4IFD K;  4XA4 A;  3G4S P;  1SQQ E;  3HTK A;  3S4R A;  3JC2 2;  5KKZ B;  1NH4 A;  2Q7C A;  1H88 A;  4TLF A;  3TGU J;  1VQ9 P;  3AEG C;  1S5L E;  3A2A A;  3L74 D;  1KIL A;  2D2C B;  2KI7 B;  1LWU A;  2XKM A;  2PAJ A;  2RKL A;  1JTH B;  1SQP E;  1YJ9 P;  2E5Y A;  3D6Z A;  3EFG A;  2OYH C;  1FZC C;  2ZAE B;  1W2E A;  1K04 A;  3EWK A;  4ZKU A;  1W5C E;  2NPS A;  2A45 I;  3GHG A;  3OW2 O;  4YPC A;  2JR8 A;  3CCE P;  4NPE A;  2OYI C;  3D6Y A;  2JDI H;  3CI9 A;  3CME P;  2WWW A;  5AW7 B;  4PJ0 H;  1DEE G;  3G9R A;  3A0H E;  3MHV A;  2QG4 A;  1Y8A A;  3USS A;  1EQ7 A;  1RQU A;  3LW5 J;  2FBW C;  5AW1 B;  1U7M A;  1SQB G;  2SPZ A;  1SFC C;  2A06 E;  2N9B A;  1SFC D;  3AED C;  1NTZ E;  5KLI C;  1IK9 A;  1FAV A;  2N1T C;  3CLQ A;  3CCV P;  4U7J A;  2N1T D;  1OW8 A;  4N78 D;  3AE1 C;  3RK3 B;  1OFC X;  2IZ1 A;  1GW4 A;  1KC8 Q;  3HUS C;  4GT1 A;  4AUW A;  1SQB D;  1NTM G;  3CXH H;  4LGD E;  4TT3 H;  3HD7 C;  1T8Z A;  3HD7 D;  3PJS K;  1SQX E;  1L0L G;  1IFD A;  1WRG A;  4I1L A;  1GL2 B;  3W68 A;  2M5A B;  1WT6 A;  5B66 H;  3D71 A;  3PTZ A;  1X0T A;  4QMA A;  3GLM A;  2AXT E;  1TU3 F;  1JUN A;  2KXP B;  1NTM D;  1H89 A;  3H1I G; 
#chains in the Genus database with same CATH homology
 3D6Y A;  1VL2 A;  1OMI A;  4Y28 J;  2BEZ F;  2OQQ A;  3G9R A;  1PIX A;  2D2C C;  1YQ3 C;  4XFJ A;  3Q5S A;  1DD4 A;  1RQV A;  4H0L C;  1MKM A;  3AE6 C;  1K05 A;  2D2C D;  3GMA A;  4H0L D;  2E74 C;  2G3A A;  4R4M A;  2ZT9 C;  3GF3 A;  4YTP C;  2E76 B;  2J5U A;  2E74 D;  2ZT9 D;  1HF9 A;  2WSC J;  3C8V A;  1DIP A;  1EXJ A;  1Q90 D;  4R4L A;  1FDI A;  4OGQ C;  5L8R J;  3RL0 g;  1RQU A;  3LW5 J;  4H13 C;  2FBW C;  4IL6 X;  3SFE C;  4OGQ D;  1KMI Z;  2G8Y A;  4H13 D;  1U57 A;  2WPV B;  2JP3 A;  2H89 C;  3AE3 C;  2JO1 A;  1PV3 A;  3R4Y A;  1KTM A;  2E75 C;  1KOR A;  3Q2Y A;  2QIW A;  2FYN C;  4H0L B;  3AE4 C;  2E75 D;  3AED C;  2WSF J;  5KLI C;  3Q1M A;  1VF5 C;  2ZT9 B;  4I7Z C;  2BEQ D;  3IN6 A;  1ZME C;  1VF5 D;  4U7J A;  2MKV A;  1OW8 A;  3GF7 A;  1HJ0 A;  1R8E A;  3S9O A;  1OW6 A;  3AEC C;  3AE1 C;  2QJP C;  2YIU C;  3AEF C;  2O01 J;  1IK7 A;  3AE5 C;  3AE9 C;  1UIX A;  1Y9B A;  1GMJ A;  2K9Y A;  3AEE C;  3AEB C;  1OW7 A;  3B71 A;  3AEG C;  1KQF B;  3AE7 C;  1KIL E;  2QSI A;  4H44 C;  2P10 A;  1KQG B;  3AE2 C;  3FGA D;  2WSE J;  3Q3D A;  2D2C B;  4KT0 J;  2FXP A;  4H44 D;  2QJK C;  4RKU J;  2IDB A;  4YXD C;  4TT3 H;  1S5L X;  2V7Q J;  2E74 B;  1WMK A;  4PV1 C;  5M1B A;  1DD3 A;  1PL5 A;  1AJY A;  4PV1 D;  4Z1M H;  3RK3 E;  3D6Z A;  1NYH A;  4GDO A;  4OGQ B;  3SFD C;  3D70 A;  4H13 B;  1ZP0 C;  1ZRT E;  2WQY C;  2QJY C;  1K04 A;  3AE8 C;  3AEA C;  3EWK A;  3H25 A;  2H88 C;  3D71 A;  2E76 C;  4H44 B;  1JB0 J;  2YMK A;  3IAO A;  2E75 B;  2E76 D;  5KKZ C;  1FDO A;  3Q5R A;  1S1C X;  1YQ4 C;  3ABV C;  3GLM A;  1EXI A;  1TU3 F;  2NZ2 A;  1VF5 B;  1ZOY C;  4I7Z B;  3O6Q A;  4PV1 B;  3Q5P A;  3T97 B;  1NGM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...