3RK3E

Truncated snare complex with complexin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
50
structure length
50
Chain Sequence
GSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vamp2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 20
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3rk3E00
4GDOA 1KILE 3RL0g 3RK3E
chains in the Genus database with same CATH superfamily
1PGPA 5CCGA 5DJUB 3V4QA 2FYNC 5AW3B 5TISH 3O6QB 1GU4A 3KHUA 3AEFC 2FYUJ 3L71E 3A0BH 1GZLA 5CBNA 2YIUC 1R5SA 4QMAA 1GL2B 1JTHA 1JMBA 2G3AA 3RK3E 4WB4A 1SLQA 2GUSA 2H88C 2YO2A 1X0TA 2LXBA 3PH0A 4L74A 3AE9C 1KFMA 3MUDA 1DD3A 3Q5RA 2ITAA 2N1TB 1BSHA 3AEDC 1RF0C 4MN4C 1S2EA 3RK2B 2J58A 3AE4C 3CL3D 2NZ2A 2Y0EA 3MIWA 2LKMA 3TGUE 2CPBA 3L70D 1VQ9P 4C7NA 3VP8A 5BVZA 2FYUK 2C9LY 3BASA 4UB6H 3TYYA 1Q7YQ 3T97B 1HF9A 3CC7P 1VQKP 1QVFO 5TISE 2QSIA 3U1CA 2CK3H 2Q5UA 1U7MA 2O01J 5BU5A 4AUWA 3A0BE 2OYHB 1VQ7P 5AVSB 3H1HD 3HE4A 3SWFA 1N7SB 1RE4C 4OGQB 4BRYB 3W67A 4L75A 3A3YB 4WY4A 3C8VA 1SS1A 4BWNA 2POHA 1ZRTE 3M06A 1L4AC 1OW6A 1T3UA 2O3JA 1SQPE 5APQA 3AEEC 1EDJA 4NPFX 1AFOA 3HD7C 2AXTH 3A7OA 4GOEA 1IJDB 1K05A 2WVRA 1BCCE 4W7YA 2JR8A 2WWWA 1LTGC 1RF0A 3JSVC 5APUA 1OVUA 3RK3C 1NTMK 3VMXA 3KZIH 1VL2A 1VPCA 1SQQE 3EQ2A 1IC2A 3HTKB 1P84H 2KXPB 2E76B 1LWUB 2IBZG 1PGOA 1L0NE 3KDPB 2M3EA 2NPSD 1KFNA 2FFDB 1Y8AA 1PP9G 2AEMA 3A0HH 1SQVE 2Z5IA 1BDDA 1RE4A 1M1JB 3H1KG 2D2CC 3H25A 1H0TA 1H88A 3CCQP 1OW7A 4D6TG 4Z1MH 3Q5SA 4I7ZB 2QJKC 4HH2A 1PP9D 3RL0g 2BCCE 2SPZA 3HD7A 1PP9J 5AW7B 3L4FA 4EYYQ 3H1KJ 3KZIE 1QLED 1M8OB 3SFEC 4D6TD 1LP1A 2KLUA 3V5BA 4RJTA 2A45H 5CJ0A 3MTUE 2LR2A 3L72E 4D6TJ 3I55P 1P84E 1BE3E 1CI6B 1VQNP 5EFWB 1OZHA 3EWKA 1QL2A 4ASWA 1WT6A 3BRTB 3R2PA 3M0DC 1MFZA 1N7LA 3A0HE 3MHVA 4JF7A 3VOPA 1RE3C 2N1TC 2E43A 3ZDMA 3P8MC 3RK2C 5AW9B 1RF1B 3VMAA 4DCKA 3BATA 2BEZF 1KQLA 5APTA 1MUUA 2E74B 3CCMP 3OAKA 3P8CE 4L76A 1Z56A 2W90A 1GW4A 2KS1B 1RQUA 2W83C 1M7LA 1T2KC 2O01H 3C1LA 3JCUH 3L73G 2FYUE 2QM8A 1VQ5P 3CX5I 1K73Q 1FZAA 4C7RA 1JOCA 2E75D 4H44B 2ZJSE 1A02F 4ZKPA 3WUUA 2H8PD 1LT9B 2FXPA 2OYHC 5KLVJ 3L73J 1PFIA 1N7SC 1OVVA 2Y0CA 4OGQC 2Q3IA 2KZIA 4OH8B 3E1IA 1NU1D 4L73A 1NTZD 1G2CB 1GK4A 3H1LD 4M3LA 1S5LH 2FXOA 3HE5A 3GW6A 1SFCD 1PL5A 1GL2A 2R3CA 2NPSB 2ZAEB 2OQQA 1Y9BA 2O01N 2C0XA 1GDTA 5APSA 3TF5A 5E79H 1URQB 1KV4A 2N1TA 3F5HA 3JCUE 2G8YA 4JBZA 1ZR4A 5KLVK 3L36A 2ZYGA 3E1RA 2IYOA 1SQPK 2GUVA 4PD4D 3VMYA 2KNCB 3KPEA 1BSNA 2KB7P 1X22A 4H13D 4DOJA 1FE6A 1LTJB 2MKVA 3Q1MA 2E76C 1LWUC 1AA0A 1QX8A 1FS0E 4I6MC 3CXHI 1R8EA 2FFDC 4AYCA 1FBMA 1VF5D 1S5LE 1UIXA 2ZYAA 2AEJA 1M1JC 4R4MA 3B5NA 3E7KA 1MKMA 3CWBG 1JY3P 1JEKA 1EDKA 1KYOH 1IFDA 2R32A 2XNDH 2V4HA 3D71A 4I7ZC 1L0NK 2IFMA 2QIWA 5E79E 5KJ7D 2WSSH 1NGMB 1FAVA 1NTKD 2Y9YA 2HFED 3R4YA 2GA1A 4AQRD 2E42A 1JY2N 1KORA 3CWBD 1PPJG 3M9QA 4GOFA 1N86A 3CWBJ 3MD0A 4HYTB 3MP7B 2Z4EA 2KUBA 5CCHC 1IFJA 5KAFH 2OYOA 3M9HA 2XDJA 5AVYB 3L35A 3I56P 2W27A 1LTTC 3BRVB 3PLNA 2IBZE 1L0LJ 1E79H 1IFMA 3HTKA 2NRGA 1RQVA 2FY8A 1LWUA 1NYHA 1PP9E 3II6A 3V6IA 4YPCA 3PP5A 1RF1C 3WUVA 5CCGD 1IFNA 3H1ID 5CBOA 3H1KE 2FFDA 2E74C 1KB9D 1VQOP 1PZQA 1KYOE 3CX5D 4H0LB 1SFCB 2ZVNB 1M1JA 4D6TE 1G1JA 4YXWH 3L70G 3CMAP 2Q9IA 3BCCD 2R5BA 1M57D 1QL1A 3V2QA 1Q90D 1YIJP 3CPWO 2ZXEB 1NKZB 1L0LK 5AVTB 2ZT9D 2GM4A 4H44C 3CMEP 1NHLA 5KAFE 5AW8B 4UB8H 1LT9C 4IL6H 3NMDA 1EZVG 3VMZA 1FZEA 3L70J 2IZ1A 1ZOYC 4U3FG 3H1HG 5CCHA 3RL0B 3H1JG 3OA7A 4GT1A 4YXDC 1CI6A 1HUCA 4KJMA 1KILA 1AVOA 1LJ2A 3PRJA 3CCLP 3GHGA 1NJIQ 3AE1C 1EZVD 2NPSC 1WMKA 3KXDA 1L2PA 4U3FD 1NOHA 1VF5B 4PD4H 2H43A 3H1JD 1WRGA 2I1KA 4U3FJ 3H1HJ 1URQC 3QH9A 3U1AA 2ZFCA 1VQ6P 2LXCB 3H1JJ 2Q7CA 3VTPC 1RF1A 5AW5B 2YMKA 5KLVE 1NAFA 3L73E 1HGVA 1DEBA 2HLOA 3L74G 4WY4D 2V7QJ 1NVOA 2WSCH 2JJLA 1DEEG 2KS1A 3KQGA 4N78D 3B4SA 1SQBG 4ZNCA 1LTJC 3SFDC 4UB8E 4IL6E 1JY3N 2M8RA 3VYIA 3AE7C 3L74D 4Y99B 1AQTA 4R4LA 1SQXG 3EFFK 2YKPA 4UB6E 2DW3A 2KP8A 1FZFA 1LT9A 1SQBD 1NWQA 1S3JA 3M9BA 2OTKE 1SQBJ 2FXMA 3FXEA 2W8ZA 1LTSC 3H32B 1NKNA 2O1KA 4OWFA 1SQXD 2B87B 4PD4E 4I1LA 3S1KA 1SQXJ 2FYZA 3IN6A 1JMMA 2IPPA 1ZMEC 4LLHA 1URQA 2AXTE 3CC2P 3IR9A 3AECC 1USDA 1KZUB 1L4AA 1JTHB 3KYQA 4IFMA 2OYIB 3AEBC 2J59M 2M5AA 2PP6A 5B66H 1XTGB 2J5UA 3LIEA 1RHZB 2E5TA 2BASA 2IZ0A 1LTJA 1IK9A 3W68A 1KB9H 2PFXA 1OFCX 2WPSA 1QVGO 2QA4P 1M56D 2W6JH 2HYNA 5KLIB 2JWAA 3N7NA 2KOGA 1X79B 2Y0DA 2CPSA 1LTAC 3CWBE 4TT3H 1E5WA 3RK3D 1P84I 4H0LC 1OXZA 1S1CX 1SFCC 1OMIA 3PHLA 1D7MA 2K9YA 3B71A 3N4XA 3OW2O 1MZ9A 4IFDK 1TU3F 2AEFA 2JP3A 3MZWB 2OTJP 1L0LE 2PRRA 1PPJE 3TGUD 2YKQA 1FZBA 3WMM0 4WY4B 1Q81Q 5B66E 3RL0C 1S4XA 2D2CD 3TNUA 2I1JA 1KB9E 1NU1G 3G3ZA 1HTLC 5AVZB 4EOTA 1NTZG 1JCDA 1X9VA 2Q1KA 3H1LG 2QJYB 3TSIA 3P32A 4NPDA 2QM7A 2HR3A 3SWYA 1MV8A 1JY2O 2V7QH 2A45I 3CD6P 1IO4A 1BCCG 1VF5C 2WT7B 2HODB 1IK7A 3O6QA 2Z5HA 4LGDE 1YJ9P 1K9MQ 2H7HA 4DJGA 1VQ4P 1J2JB 3TDKA 1NU1J 3AEGC 3TK1A 1NTZJ 3L70E 3AE8C 3H1LJ 1OWAA 3FX0A 3USSA 4PV1D 3D6ZA 5TJHA 1BCCD 1LTBC 2I8DA 3CCRP 3M0DA 1J1DB 1OVRA 1JUNA 1GL2D 3HUSB 1S72P 1RE3A 1YQ4C 2QG4A 1FOSE 2VRSA 1S9KD 2QRXA 1VQLP 4Y99C 1EZVE 1SQQD 3D6YA 2HG5D 2N1TD 1QGKB 2R5DA 2K3RA 1SVFA 4U3FE 2JEEA 3H1HE 1SQVG 1PGJA 1NO4A 3H1JE 3L75G 1HJBA 3G4SP 1NU1K 1NTZK 1N2DC 5AVUB 2N9BA 4TLFA 3QWOC 3CCUP 4EI2A 1BGYG 1RY3A 2JDIH 3T97A 1H8AA 2O1JA 3S9OA 1T3JA 2WSCJ 3CLQA 4IFFA 3ABVC 1SQVD 2RKLA 2BCCG 3RBZA 3L75D 1VDFA 3SWKA 5CCGC 2OYHA 1UIIA 1NTKG 1DIPA 1EC5A 3L75J 3FWNA 1N7SA 1A02J 3ITKA 3AE2C 4BRYA 5GTIH 3A5TA 1BGYD 5AW1B 2KSJA 2KYVA 1BGYJ 1YBKA 2WPVB 2XNXA 1PIXA 3B5ND 4OGQD 1BE3G 2BCCD 1HGZA 1SQBE 2OYIC 1OW8A 1ZV8A 1S5LX 2JO1A 2P1JA 2BEQD 1VQPP 1NTKJ 1PGQA 3MGNA 3MUDC 5H2FH 1JB0J 1KTMA 2WSFJ 2A06G 3LW5J 4ZKUA 1IFIA 1SQXE 1J1EB 1P84D 3U59A 1EXJA 3B8EB 1BE3D 4RESB 5KLIC 2WMMA 3CC4P 1MFTA 4WWIA 2R44A 1Y47A 3I5CA 1VQMP 2E75B 4RKUJ 1N8RQ 3V2PA 5CMZA 3H1IG 4C46A 1T6AA 2A06D 2K88A 4BXLA 5DJTB 4WVZA 4A7PA 2OTLP 3H32A 1SP4A 2IYPA 2KZJA 2YXRB 3BCCG 2IBZI 5APVA 2B87A 5GTIE 1NTKK 1ZW0A 3AE5C 3AEAC 1YITP 3P8CD 3UIAA 1KQSO 1EDIA 2KLVA 5AW6B 1ZR2A 4I2LC 4JYBA 3H1IJ 1IFPA 3D70A 2FYUD 2WSEJ 2XU6A 4HJGH 4WY4C 1HWTC 1NH4A 2QEXP 4PV1B 4YTPC 1KYOI 4W7ZA 2W6BA 3VN0A 2ZYDA 3HE5B 1DH3A 3S4RA 3BCCJ 5H2FE 1H89A 4K35A 2OYIA 1JM0A 1LTIC 2HPCB 3IAOA 2WPRA 2QJYC 3FXDA 1HVVA 4H13B 2Y9ZA 4ZMDA 1NAYA 3EFGA 1JO5A 2L5GB 2RH0A 1NTMG 5CCHD 2WQYC 3WUTA 2P7JA 5AVQB 1KILD 2AXCA 2PAJA 1U57A 1GW3A 2K1AA 1J1DC 1GTWA 5GTHH 3HUSC 2RMZA 5AVWB 1FZCB 3O8ZA 3PJSK 1FDOA 1NTMD 1Q82Q 4XA4A 3GMAA 1LGHB 1NTMJ 2XKMA 2QJPB 1YYCA 3B5NB 1QEXA 1FJPA 1EDLA 3HRNA 3CCEP 2E74D 2Q3EA 1G1IA 4OVNF 1NU1E 3CXHD 1PV3A 1FU1A 1NTZE 3H6PA 3H1LE 1R5LA 5AVXB 3AE6C 4WBAA 1ZN5A 4Y28J 4JPZB 1VQ8P 3NFQA 3L74J 2UWJE 1ZP0C 4LC1A 4H44D 5APXA 4IL6X 1ZXGA 2WT7A 2HODA 2P58A 2WSFH 3LW5H 3OJAB 1S9KE 1FC2C 2KK7A 1KD1Q 1G2CA 2YNYA 2K9JB 4PJ0H 5GTHE 5AW0B 4DT0A 5KTBA 1RH5B 1N73B 3FWLA 1YQ3C 3RBXA 2ZVOB 2NPSA 4PD4I 4HB1A 1KN7A 2ZXXA 2IFNA 2QE7H 2JKVA 5KKZB 3HUSA 4CPGA 3RGUA 1J1EC 3G71P 1LNQA 3L71G 1T8ZA 1SQBK 3L75E 1URQD 2KNCA 1IZNB 2IBZD 2E75C 1OIPA 2ZT9B 1GD2E 1L4AD 3CCJP 4JQ0D 5BU8B 1BGYE 4N6JA 5M1BA 2IX7C 2WSEH 3HD7D 2H89C 3CX5H 3JC22 1SQXK 3P7KA 2R3SA 3L71D 2WITA 3H1KD 3G6EP 3L71J 1NTKE 1ZLLA 1KYOD 4C7NB 3WU2H 2M3BA 1W2EA 3PTZA 3TGUG 5CHXA 4PJ0E 4HKZH 1KMIZ 1KQFB 4PV1C 1KILB 5AW4B 4JYCA 1GK6A 4XFJA 1AJYA 3M0AA 4RO0A 3GHGB 3Q5PA 1GL2C 1U7JA 3Q3DA 1HBWA 1JY2P 3C9IA 1K04A 2KSEA 2A06E 1KQGB 3HE4B 3CI9A 2K37A 5L8RJ 3TGUJ 2B89A 2FYNB 1X8YA 1YTZI 2YIUB 4H13C 2C9NY 1JNMA 2OGUA 3BVHA 3H1IE 2M0BA 2Q6QA 2RN0A 2IDBA 4N3YB 5KLVG 1USEA 3CX5E 4XE5B 4GKGA 2QVAA 1SQPG 2P10A 5AW2B 1KB9I 3BCCE 1EXIA 2E5YA 3M91A 2KIKA 3WU2E 2MJZA 2N9YB 4NPEA 2OARA 4ASVA 1YJWP 1FZCC 1YI2P 1ZRTD 5KLVD 3L37A 2YO3A 2PGDA 2P2UA 3L73D 1Q2NA 3CCVP 1SQPD 1FJKA 3CXHH 3FGAD 2YKOA 1SQPJ 4GODA 2QJPC 3B5NC 1SQQG 3NTNA 1SFCA 5KJ7C 3IFMA 1YTZT 1BCCJ 2C0WA 4H0LD 3IF4A 1K8AQ 3LIDA 1W2BO 2HPCA 3F89A 2JWDA 1L0NG 1M90Q 1KILE 3RK2D 2FKWB 1SQQJ 1H0TB 1HH0A 1EZVI 1EQ7A 4GIFA 5KAIH 1FDIA 5B5EH 1L4AB 3GLMA 3SSUA 1DD4A 4W80A 1CW5A 2M5AB 1NTME 1T2KD 3V2RA 1L0ND 3HD7B 3NXSA 2YMYA 3GG2A 1L0NJ 2XV5A 2P67A 3Q2YA 1LT1A 3RL0D 1N73C 1FDMA 4N78E 1W5CE 1LP1B 1SQVJ 3CXHE 3GF7A 2WZ7A 4EDFA 4KT0J 5KKZC 3RK3B 4EIJA 4KHXA 1FZCA 5APYA 2WPQA 3L74E 1SQQK 3L72G 1N7SD 3V2NA 1GU5A 4B86A 1BDCA 1DX7A 1AV1A 1XTCC 2YXQB 1CZQA 1Q86Q 2BCCJ 1AQ5A 2ZT9C 5KJ7A 5AVVB 2W6AA 4GDOA 3K5BA 5C39A 2L91A 1GMJA 2WTYA 3L72D 3GF3A 3A2AA 1HJ0A 5K5GB 3L72J 5AVRB 1SQVK 5KAIE 4IOIH 5B5EE 1L0LG 3AE3C 1BE3J 1M1KQ 2D2CB 1YHQP 2B88A 3VP9A 1YJNP 1FZGA 2FBWC 3V4WA 1JCCA 2KI7B 3G9RA 3CCSP 5APWA 2FYUG 3TNUB 1OX3A 1FOSF 2QJKB 4U7JA 1KILC 1KC8Q 1AVYA 4DZOA 4O9BA 5CJ4A 1L0LD 3GHGC 1JY3O 4K3AA 2B9BA 1PPJD 2K9JA 1CSBA 1N73A 2A45G 2E76D 2XZRA
chains in the Genus database with same CATH topology
1OMIA 3AE6C 3GF7A 3IAOA 4PV1D 3D6ZA 2FYNC 4KT0J 2K9YA 3B71A 4OGQB 4Y28J 5KKZC 4YXDC 2BEQD 2QJYC 2D2CC 1RQUA 3H25A 3AEFC 1JB0J 1KTMA 3C8VA 2WSFJ 4H13D 3LW5J 1TU3F 2JP3A 3AE1C 2YIUC 1ZP0C 1S1CX 1OW7A 1YQ4C 1ZRTE 4H44D 1OW6A 4Z1MH 3FGAD 3IN6A 3Q5SA 4I7ZB 1RQVA 1EXJA 4H13B 4IL6X 2QJKC 2QJPC 2MKVA 1WMKA 3AEEC 5KLIC 1ZMEC 3Q1MA 2E75D 2E76C 1KMIZ 3RL0g 1KQFB 4H44B 3D6YA 1VF5B 2G3AA 2ZT9C 3RK3E 1NYHA 4GDOA 4PV1C 1K05A 2H88C 4XFJA 2E75B 1AJYA 4RKUJ 3AE9C 4H0LD 1DD3A 3Q5PA 2FXPA 3Q5RA 1R8EA 3AEDC 2WQYC 3AECC 1GMJA 2YMKA 2E74C 1VF5D 3Q3DA 1UIXA 3SFEC 3GF3A 3AE4C 1K04A 1YQ3C 4H0LB 2D2CD 2NZ2A 4OGQC 1KQGB 1HJ0A 1U57A 3AEBC 4R4MA 2V7QJ 5L8RJ 1MKMA 3AE3C 2J5UA 1KILE 1VL2A 2D2CB 3S9OA 2WSCJ 3AE5C 2FBWC 3ABVC 3AEAC 3EWKA 3SFDC 1FDOA 3D71A 4I7ZC 4H13C 3G9RA 1Q90D 1FDIA 1PL5A 2QIWA 3GLMA 2ZT9D 3GMAA 1NGMB 1DIPA 4H44C 1DD4A 1VF5C 3D70A 3R4YA 3AE7C 2OQQA 2WSEJ 4U7JA 2IDBA 1Y9BA 2E76B 3AE2C 1IK7A 3T97B 4R4LA 1HF9A 1KORA 3O6QA 2E75C 2ZT9B 2P10A 4PV1B 4YTPC 2E74D 2QSIA 3Q2YA 2WPVB 1PIXA 2O01J 3AEGC 1PV3A 4OGQD 1EXIA 4TT3H 3AE8C 5M1BA 2G8YA 2BEZF 1ZOYC 2E76D 4H0LC 1OW8A 2E74B 1S5LX 2H89C 2JO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDO A;  1KIL E;  3RL0 g;  3RK3 E; 
#chains in the Genus database with same CATH topology
 1PGP A;  5CCG A;  5DJU B;  3V4Q A;  2FYN C;  5AW3 B;  5TIS H;  3O6Q B;  1GU4 A;  3KHU A;  3AEF C;  2FYU J;  3L71 E;  3A0B H;  1GZL A;  5CBN A;  2YIU C;  1R5S A;  4QMA A;  1GL2 B;  1JTH A;  1JMB A;  2G3A A;  3RK3 E;  4WB4 A;  1SLQ A;  2GUS A;  2H88 C;  2YO2 A;  1X0T A;  2LXB A;  3PH0 A;  4L74 A;  3AE9 C;  1KFM A;  3MUD A;  1DD3 A;  3Q5R A;  2ITA A;  2N1T B;  1BSH A;  3AED C;  1RF0 C;  4MN4 C;  1S2E A;  3RK2 B;  2J58 A;  3AE4 C;  3CL3 D;  2NZ2 A;  2Y0E A;  3MIW A;  2LKM A;  3TGU E;  2CPB A;  3L70 D;  1VQ9 P;  4C7N A;  3VP8 A;  5BVZ A;  2FYU K;  2C9L Y;  3BAS A;  4UB6 H;  3TYY A;  1Q7Y Q;  3T97 B;  1HF9 A;  3CC7 P;  1VQK P;  1QVF O;  5TIS E;  2QSI A;  3U1C A;  2CK3 H;  2Q5U A;  1U7M A;  2O01 J;  5BU5 A;  4AUW A;  3A0B E;  2OYH B;  1VQ7 P;  5AVS B;  3H1H D;  3HE4 A;  3SWF A;  1N7S B;  1RE4 C;  4OGQ B;  4BRY B;  3W67 A;  4L75 A;  3A3Y B;  4WY4 A;  3C8V A;  1SS1 A;  4BWN A;  2POH A;  1ZRT E;  3M06 A;  1L4A C;  1OW6 A;  1T3U A;  2O3J A;  1SQP E;  5APQ A;  3AEE C;  1EDJ A;  4NPF X;  1AFO A;  3HD7 C;  2AXT H;  3A7O A;  4GOE A;  1IJD B;  1K05 A;  2WVR A;  1BCC E;  4W7Y A;  2JR8 A;  2WWW A;  1LTG C;  1RF0 A;  3JSV C;  5APU A;  1OVU A;  3RK3 C;  1NTM K;  3VMX A;  3KZI H;  1VL2 A;  1VPC A;  1SQQ E;  3EQ2 A;  1IC2 A;  3HTK B;  1P84 H;  2KXP B;  2E76 B;  1LWU B;  2IBZ G;  1PGO A;  1L0N E;  3KDP B;  2M3E A;  2NPS D;  1KFN A;  2FFD B;  1Y8A A;  1PP9 G;  2AEM A;  3A0H H;  1SQV E;  2Z5I A;  1BDD A;  1RE4 A;  1M1J B;  3H1K G;  2D2C C;  3H25 A;  1H0T A;  1H88 A;  3CCQ P;  1OW7 A;  4D6T G;  4Z1M H;  3Q5S A;  4I7Z B;  2QJK C;  4HH2 A;  1PP9 D;  3RL0 g;  2BCC E;  2SPZ A;  3HD7 A;  1PP9 J;  5AW7 B;  3L4F A;  4EYY Q;  3H1K J;  3KZI E;  1QLE D;  1M8O B;  3SFE C;  4D6T D;  1LP1 A;  2KLU A;  3V5B A;  4RJT A;  2A45 H;  5CJ0 A;  3MTU E;  2LR2 A;  3L72 E;  4D6T J;  3I55 P;  1P84 E;  1BE3 E;  1CI6 B;  1VQN P;  5EFW B;  1OZH A;  3EWK A;  1QL2 A;  4ASW A;  1WT6 A;  3BRT B;  3R2P A;  3M0D C;  1MFZ A;  1N7L A;  3A0H E;  3MHV A;  4JF7 A;  3VOP A;  1RE3 C;  2N1T C;  2E43 A;  3ZDM A;  3P8M C;  3RK2 C;  5AW9 B;  1RF1 B;  3VMA A;  4DCK A;  3BAT A;  2BEZ F;  1KQL A;  5APT A;  1MUU A;  2E74 B;  3CCM P;  3OAK A;  3P8C E;  4L76 A;  1Z56 A;  2W90 A;  1GW4 A;  2KS1 B;  1RQU A;  2W83 C;  1M7L A;  1T2K C;  2O01 H;  3C1L A;  3JCU H;  3L73 G;  2FYU E;  2QM8 A;  1VQ5 P;  3CX5 I;  1K73 Q;  1FZA A;  4C7R A;  1JOC A;  2E75 D;  4H44 B;  2ZJS E;  1A02 F;  4ZKP A;  3WUU A;  2H8P D;  1LT9 B;  2FXP A;  2OYH C;  5KLV J;  3L73 J;  1PFI A;  1N7S C;  1OVV A;  2Y0C A;  4OGQ C;  2Q3I A;  2KZI A;  4OH8 B;  3E1I A;  1NU1 D;  4L73 A;  1NTZ D;  1G2C B;  1GK4 A;  3H1L D;  4M3L A;  1S5L H;  2FXO A;  3HE5 A;  3GW6 A;  1SFC D;  1PL5 A;  1GL2 A;  2R3C A;  2NPS B;  2ZAE B;  2OQQ A;  1Y9B A;  2O01 N;  2C0X A;  1GDT A;  5APS A;  3TF5 A;  5E79 H;  1URQ B;  1KV4 A;  2N1T A;  3F5H A;  3JCU E;  2G8Y A;  4JBZ A;  1ZR4 A;  5KLV K;  3L36 A;  2ZYG A;  3E1R A;  2IYO A;  1SQP K;  2GUV A;  4PD4 D;  3VMY A;  2KNC B;  3KPE A;  1BSN A;  2KB7 P;  1X22 A;  4H13 D;  4DOJ A;  1FE6 A;  1LTJ B;  2MKV A;  3Q1M A;  2E76 C;  1LWU C;  1AA0 A;  1QX8 A;  1FS0 E;  4I6M C;  3CXH I;  1R8E A;  2FFD C;  4AYC A;  1FBM A;  1VF5 D;  1S5L E;  1UIX A;  2ZYA A;  2AEJ A;  1M1J C;  4R4M A;  3B5N A;  3E7K A;  1MKM A;  3CWB G;  1JY3 P;  1JEK A;  1EDK A;  1KYO H;  1IFD A;  2R32 A;  2XND H;  2V4H A;  3D71 A;  4I7Z C;  1L0N K;  2IFM A;  2QIW A;  5E79 E;  5KJ7 D;  2WSS H;  1NGM B;  1FAV A;  1NTK D;  2Y9Y A;  2HFE D;  3R4Y A;  2GA1 A;  4AQR D;  2E42 A;  1JY2 N;  1KOR A;  3CWB D;  1PPJ G;  3M9Q A;  4GOF A;  1N86 A;  3CWB J;  3MD0 A;  4HYT B;  3MP7 B;  2Z4E A;  2KUB A;  5CCH C;  1IFJ A;  5KAF H;  2OYO A;  3M9H A;  2XDJ A;  5AVY B;  3L35 A;  3I56 P;  2W27 A;  1LTT C;  3BRV B;  3PLN A;  2IBZ E;  1L0L J;  1E79 H;  1IFM A;  3HTK A;  2NRG A;  1RQV A;  2FY8 A;  1LWU A;  1NYH A;  1PP9 E;  3II6 A;  3V6I A;  4YPC A;  3PP5 A;  1RF1 C;  3WUV A;  5CCG D;  1IFN A;  3H1I D;  5CBO A;  3H1K E;  2FFD A;  2E74 C;  1KB9 D;  1VQO P;  1PZQ A;  1KYO E;  3CX5 D;  4H0L B;  1SFC B;  2ZVN B;  1M1J A;  4D6T E;  1G1J A;  4YXW H;  3L70 G;  3CMA P;  2Q9I A;  3BCC D;  2R5B A;  1M57 D;  1QL1 A;  3V2Q A;  1Q90 D;  1YIJ P;  3CPW O;  2ZXE B;  1NKZ B;  1L0L K;  5AVT B;  2ZT9 D;  2GM4 A;  4H44 C;  3CME P;  1NHL A;  5KAF E;  5AW8 B;  4UB8 H;  1LT9 C;  4IL6 H;  3NMD A;  1EZV G;  3VMZ A;  1FZE A;  3L70 J;  2IZ1 A;  1ZOY C;  4U3F G;  3H1H G;  5CCH A;  3RL0 B;  3H1J G;  3OA7 A;  4GT1 A;  4YXD C;  1CI6 A;  1HUC A;  4KJM A;  1KIL A;  1AVO A;  1LJ2 A;  3PRJ A;  3CCL P;  3GHG A;  1NJI Q;  3AE1 C;  1EZV D;  2NPS C;  1WMK A;  3KXD A;  1L2P A;  4U3F D;  1NOH A;  1VF5 B;  4PD4 H;  2H43 A;  3H1J D;  1WRG A;  2I1K A;  4U3F J;  3H1H J;  1URQ C;  3QH9 A;  3U1A A;  2ZFC A;  1VQ6 P;  2LXC B;  3H1J J;  2Q7C A;  3VTP C;  1RF1 A;  5AW5 B;  2YMK A;  5KLV E;  1NAF A;  3L73 E;  1HGV A;  1DEB A;  2HLO A;  3L74 G;  4WY4 D;  2V7Q J;  1NVO A;  2WSC H;  2JJL A;  1DEE G;  2KS1 A;  3KQG A;  4N78 D;  3B4S A;  1SQB G;  4ZNC A;  1LTJ C;  3SFD C;  4UB8 E;  4IL6 E;  1JY3 N;  2M8R A;  3VYI A;  3AE7 C;  3L74 D;  4Y99 B;  1AQT A;  4R4L A;  1SQX G;  3EFF K;  2YKP A;  4UB6 E;  2DW3 A;  2KP8 A;  1FZF A;  1LT9 A;  1SQB D;  1NWQ A;  1S3J A;  3M9B A;  2OTK E;  1SQB J;  2FXM A;  3FXE A;  2W8Z A;  1LTS C;  3H32 B;  1NKN A;  2O1K A;  4OWF A;  1SQX D;  2B87 B;  4PD4 E;  4I1L A;  3S1K A;  1SQX J;  2FYZ A;  3IN6 A;  1JMM A;  2IPP A;  1ZME C;  4LLH A;  1URQ A;  2AXT E;  3CC2 P;  3IR9 A;  3AEC C;  1USD A;  1KZU B;  1L4A A;  1JTH B;  3KYQ A;  4IFM A;  2OYI B;  3AEB C;  2J59 M;  2M5A A;  2PP6 A;  5B66 H;  1XTG B;  2J5U A;  3LIE A;  1RHZ B;  2E5T A;  2BAS A;  2IZ0 A;  1LTJ A;  1IK9 A;  3W68 A;  1KB9 H;  2PFX A;  1OFC X;  2WPS A;  1QVG O;  2QA4 P;  1M56 D;  2W6J H;  2HYN A;  5KLI B;  2JWA A;  3N7N A;  2KOG A;  1X79 B;  2Y0D A;  2CPS A;  1LTA C;  3CWB E;  4TT3 H;  1E5W A;  3RK3 D;  1P84 I;  4H0L C;  1OXZ A;  1S1C X;  1SFC C;  1OMI A;  3PHL A;  1D7M A;  2K9Y A;  3B71 A;  3N4X A;  3OW2 O;  1MZ9 A;  4IFD K;  1TU3 F;  2AEF A;  2JP3 A;  3MZW B;  2OTJ P;  1L0L E;  2PRR A;  1PPJ E;  3TGU D;  2YKQ A;  1FZB A;  3WMM 0;  4WY4 B;  1Q81 Q;  5B66 E;  3RL0 C;  1S4X A;  2D2C D;  3TNU A;  2I1J A;  1KB9 E;  1NU1 G;  3G3Z A;  1HTL C;  5AVZ B;  4EOT A;  1NTZ G;  1JCD A;  1X9V A;  2Q1K A;  3H1L G;  2QJY B;  3TSI A;  3P32 A;  4NPD A;  2QM7 A;  2HR3 A;  3SWY A;  1MV8 A;  1JY2 O;  2V7Q H;  2A45 I;  3CD6 P;  1IO4 A;  1BCC G;  1VF5 C;  2WT7 B;  2HOD B;  1IK7 A;  3O6Q A;  2Z5H A;  4LGD E;  1YJ9 P;  1K9M Q;  2H7H A;  4DJG A;  1VQ4 P;  1J2J B;  3TDK A;  1NU1 J;  3AEG C;  3TK1 A;  1NTZ J;  3L70 E;  3AE8 C;  3H1L J;  1OWA A;  3FX0 A;  3USS A;  4PV1 D;  3D6Z A;  5TJH A;  1BCC D;  1LTB C;  2I8D A;  3CCR P;  3M0D A;  1J1D B;  1OVR A;  1JUN A;  1GL2 D;  3HUS B;  1S72 P;  1RE3 A;  1YQ4 C;  2QG4 A;  1FOS E;  2VRS A;  1S9K D;  2QRX A;  1VQL P;  4Y99 C;  1EZV E;  1SQQ D;  3D6Y A;  2HG5 D;  2N1T D;  1QGK B;  2R5D A;  2K3R A;  1SVF A;  4U3F E;  2JEE A;  3H1H E;  1SQV G;  1PGJ A;  1NO4 A;  3H1J E;  3L75 G;  1HJB A;  3G4S P;  1NU1 K;  1NTZ K;  1N2D C;  5AVU B;  2N9B A;  4TLF A;  3QWO C;  3CCU P;  4EI2 A;  1BGY G;  1RY3 A;  2JDI H;  3T97 A;  1H8A A;  2O1J A;  3S9O A;  1T3J A;  2WSC J;  3CLQ A;  4IFF A;  3ABV C;  1SQV D;  2RKL A;  2BCC G;  3RBZ A;  3L75 D;  1VDF A;  3SWK A;  5CCG C;  2OYH A;  1UII A;  1NTK G;  1DIP A;  1EC5 A;  3L75 J;  3FWN A;  1N7S A;  1A02 J;  3ITK A;  3AE2 C;  4BRY A;  5GTI H;  3A5T A;  1BGY D;  5AW1 B;  2KSJ A;  2KYV A;  1BGY J;  1YBK A;  2WPV B;  2XNX A;  1PIX A;  3B5N D;  4OGQ D;  1BE3 G;  2BCC D;  1HGZ A;  1SQB E;  2OYI C;  1OW8 A;  1ZV8 A;  1S5L X;  2JO1 A;  2P1J A;  2BEQ D;  1VQP P;  1NTK J;  1PGQ A;  3MGN A;  3MUD C;  5H2F H;  1JB0 J;  1KTM A;  2WSF J;  2A06 G;  3LW5 J;  4ZKU A;  1IFI A;  1SQX E;  1J1E B;  1P84 D;  3U59 A;  1EXJ A;  3B8E B;  1BE3 D;  4RES B;  5KLI C;  2WMM A;  3CC4 P;  1MFT A;  4WWI A;  2R44 A;  1Y47 A;  3I5C A;  1VQM P;  2E75 B;  4RKU J;  1N8R Q;  3V2P A;  5CMZ A;  3H1I G;  4C46 A;  1T6A A;  2A06 D;  2K88 A;  4BXL A;  5DJT B;  4WVZ A;  4A7P A;  2OTL P;  3H32 A;  1SP4 A;  2IYP A;  2KZJ A;  2YXR B;  3BCC G;  2IBZ I;  5APV A;  2B87 A;  5GTI E;  1NTK K;  1ZW0 A;  3AE5 C;  3AEA C;  1YIT P;  3P8C D;  3UIA A;  1KQS O;  1EDI A;  2KLV A;  5AW6 B;  1ZR2 A;  4I2L C;  4JYB A;  3H1I J;  1IFP A;  3D70 A;  2FYU D;  2WSE J;  2XU6 A;  4HJG H;  4WY4 C;  1HWT C;  1NH4 A;  2QEX P;  4PV1 B;  4YTP C;  1KYO I;  4W7Z A;  2W6B A;  3VN0 A;  2ZYD A;  3HE5 B;  1DH3 A;  3S4R A;  3BCC J;  5H2F E;  1H89 A;  4K35 A;  2OYI A;  1JM0 A;  1LTI C;  2HPC B;  3IAO A;  2WPR A;  2QJY C;  3FXD A;  1HVV A;  4H13 B;  2Y9Z A;  4ZMD A;  1NAY A;  3EFG A;  1JO5 A;  2L5G B;  2RH0 A;  1NTM G;  5CCH D;  2WQY C;  3WUT A;  2P7J A;  5AVQ B;  1KIL D;  2AXC A;  2PAJ A;  1U57 A;  1GW3 A;  2K1A A;  1J1D C;  1GTW A;  5GTH H;  3HUS C;  2RMZ A;  5AVW B;  1FZC B;  3O8Z A;  3PJS K;  1FDO A;  1NTM D;  1Q82 Q;  4XA4 A;  3GMA A;  1LGH B;  1NTM J;  2XKM A;  2QJP B;  1YYC A;  3B5N B;  1QEX A;  1FJP A;  1EDL A;  3HRN A;  3CCE P;  2E74 D;  2Q3E A;  1G1I A;  4OVN F;  1NU1 E;  3CXH D;  1PV3 A;  1FU1 A;  1NTZ E;  3H6P A;  3H1L E;  1R5L A;  5AVX B;  3AE6 C;  4WBA A;  1ZN5 A;  4Y28 J;  4JPZ B;  1VQ8 P;  3NFQ A;  3L74 J;  2UWJ E;  1ZP0 C;  4LC1 A;  4H44 D;  5APX A;  4IL6 X;  1ZXG A;  2WT7 A;  2HOD A;  2P58 A;  2WSF H;  3LW5 H;  3OJA B;  1S9K E;  1FC2 C;  2KK7 A;  1KD1 Q;  1G2C A;  2YNY A;  2K9J B;  4PJ0 H;  5GTH E;  5AW0 B;  4DT0 A;  5KTB A;  1RH5 B;  1N73 B;  3FWL A;  1YQ3 C;  3RBX A;  2ZVO B;  2NPS A;  4PD4 I;  4HB1 A;  1KN7 A;  2ZXX A;  2IFN A;  2QE7 H;  2JKV A;  5KKZ B;  3HUS A;  4CPG A;  3RGU A;  1J1E C;  3G71 P;  1LNQ A;  3L71 G;  1T8Z A;  1SQB K;  3L75 E;  1URQ D;  2KNC A;  1IZN B;  2IBZ D;  2E75 C;  1OIP A;  2ZT9 B;  1GD2 E;  1L4A D;  3CCJ P;  4JQ0 D;  5BU8 B;  1BGY E;  4N6J A;  5M1B A;  2IX7 C;  2WSE H;  3HD7 D;  2H89 C;  3CX5 H;  3JC2 2;  1SQX K;  3P7K A;  2R3S A;  3L71 D;  2WIT A;  3H1K D;  3G6E P;  3L71 J;  1NTK E;  1ZLL A;  1KYO D;  4C7N B;  3WU2 H;  2M3B A;  1W2E A;  3PTZ A;  3TGU G;  5CHX A;  4PJ0 E;  4HKZ H;  1KMI Z;  1KQF B;  4PV1 C;  1KIL B;  5AW4 B;  4JYC A;  1GK6 A;  4XFJ A;  1AJY A;  3M0A A;  4RO0 A;  3GHG B;  3Q5P A;  1GL2 C;  1U7J A;  3Q3D A;  1HBW A;  1JY2 P;  3C9I A;  1K04 A;  2KSE A;  2A06 E;  1KQG B;  3HE4 B;  3CI9 A;  2K37 A;  5L8R J;  3TGU J;  2B89 A;  2FYN B;  1X8Y A;  1YTZ I;  2YIU B;  4H13 C;  2C9N Y;  1JNM A;  2OGU A;  3BVH A;  3H1I E;  2M0B A;  2Q6Q A;  2RN0 A;  2IDB A;  4N3Y B;  5KLV G;  1USE A;  3CX5 E;  4XE5 B;  4GKG A;  2QVA A;  1SQP G;  2P10 A;  5AW2 B;  1KB9 I;  3BCC E;  1EXI A;  2E5Y A;  3M91 A;  2KIK A;  3WU2 E;  2MJZ A;  2N9Y B;  4NPE A;  2OAR A;  4ASV A;  1YJW P;  1FZC C;  1YI2 P;  1ZRT D;  5KLV D;  3L37 A;  2YO3 A;  2PGD A;  2P2U A;  3L73 D;  1Q2N A;  3CCV P;  1SQP D;  1FJK A;  3CXH H;  3FGA D;  2YKO A;  1SQP J;  4GOD A;  2QJP C;  3B5N C;  1SQQ G;  3NTN A;  1SFC A;  5KJ7 C;  3IFM A;  1YTZ T;  1BCC J;  2C0W A;  4H0L D;  3IF4 A;  1K8A Q;  3LID A;  1W2B O;  2HPC A;  3F89 A;  2JWD A;  1L0N G;  1M90 Q;  1KIL E;  3RK2 D;  2FKW B;  1SQQ J;  1H0T B;  1HH0 A;  1EZV I;  1EQ7 A;  4GIF A;  5KAI H;  1FDI A;  5B5E H;  1L4A B;  3GLM A;  3SSU A;  1DD4 A;  4W80 A;  1CW5 A;  2M5A B;  1NTM E;  1T2K D;  3V2R A;  1L0N D;  3HD7 B;  3NXS A;  2YMY A;  3GG2 A;  1L0N J;  2XV5 A;  2P67 A;  3Q2Y A;  1LT1 A;  3RL0 D;  1N73 C;  1FDM A;  4N78 E;  1W5C E;  1LP1 B;  1SQV J;  3CXH E;  3GF7 A;  2WZ7 A;  4EDF A;  4KT0 J;  5KKZ C;  3RK3 B;  4EIJ A;  4KHX A;  1FZC A;  5APY A;  2WPQ A;  3L74 E;  1SQQ K;  3L72 G;  1N7S D;  3V2N A;  1GU5 A;  4B86 A;  1BDC A;  1DX7 A;  1AV1 A;  1XTC C;  2YXQ B;  1CZQ A;  1Q86 Q;  2BCC J;  1AQ5 A;  2ZT9 C;  5KJ7 A;  5AVV B;  2W6A A;  4GDO A;  3K5B A;  5C39 A;  2L91 A;  1GMJ A;  2WTY A;  3L72 D;  3GF3 A;  3A2A A;  1HJ0 A;  5K5G B;  3L72 J;  5AVR B;  1SQV K;  5KAI E;  4IOI H;  5B5E E;  1L0L G;  3AE3 C;  1BE3 J;  1M1K Q;  2D2C B;  1YHQ P;  2B88 A;  3VP9 A;  1YJN P;  1FZG A;  2FBW C;  3V4W A;  1JCC A;  2KI7 B;  3G9R A;  3CCS P;  5APW A;  2FYU G;  3TNU B;  1OX3 A;  1FOS F;  2QJK B;  4U7J A;  1KIL C;  1KC8 Q;  1AVY A;  4DZO A;  4O9B A;  5CJ4 A;  1L0L D;  3GHG C;  1JY3 O;  4K3A A;  2B9B A;  1PPJ D;  2K9J A;  1CSB A;  1N73 A;  2A45 G;  2E76 D;  2XZR A; 
#chains in the Genus database with same CATH homology
 1OMI A;  3AE6 C;  3GF7 A;  3IAO A;  4PV1 D;  3D6Z A;  2FYN C;  4KT0 J;  2K9Y A;  3B71 A;  4OGQ B;  4Y28 J;  5KKZ C;  4YXD C;  2BEQ D;  2QJY C;  2D2C C;  1RQU A;  3H25 A;  3AEF C;  1JB0 J;  1KTM A;  3C8V A;  2WSF J;  4H13 D;  3LW5 J;  1TU3 F;  2JP3 A;  3AE1 C;  2YIU C;  1ZP0 C;  1S1C X;  1OW7 A;  1YQ4 C;  1ZRT E;  4H44 D;  1OW6 A;  4Z1M H;  3FGA D;  3IN6 A;  3Q5S A;  4I7Z B;  1RQV A;  1EXJ A;  4H13 B;  4IL6 X;  2QJK C;  2QJP C;  2MKV A;  1WMK A;  3AEE C;  5KLI C;  1ZME C;  3Q1M A;  2E75 D;  2E76 C;  1KMI Z;  3RL0 g;  1KQF B;  4H44 B;  3D6Y A;  1VF5 B;  2G3A A;  2ZT9 C;  3RK3 E;  1NYH A;  4GDO A;  4PV1 C;  1K05 A;  2H88 C;  4XFJ A;  2E75 B;  1AJY A;  4RKU J;  3AE9 C;  4H0L D;  1DD3 A;  3Q5P A;  2FXP A;  3Q5R A;  1R8E A;  3AED C;  2WQY C;  3AEC C;  1GMJ A;  2YMK A;  2E74 C;  1VF5 D;  3Q3D A;  1UIX A;  3SFE C;  3GF3 A;  3AE4 C;  1K04 A;  1YQ3 C;  4H0L B;  2D2C D;  2NZ2 A;  4OGQ C;  1KQG B;  1HJ0 A;  1U57 A;  3AEB C;  4R4M A;  2V7Q J;  5L8R J;  1MKM A;  3AE3 C;  2J5U A;  1KIL E;  1VL2 A;  2D2C B;  3S9O A;  2WSC J;  3AE5 C;  2FBW C;  3ABV C;  3AEA C;  3EWK A;  3SFD C;  1FDO A;  3D71 A;  4I7Z C;  4H13 C;  3G9R A;  1Q90 D;  1FDI A;  1PL5 A;  2QIW A;  3GLM A;  2ZT9 D;  3GMA A;  1NGM B;  1DIP A;  4H44 C;  1DD4 A;  1VF5 C;  3D70 A;  3R4Y A;  3AE7 C;  2OQQ A;  2WSE J;  4U7J A;  2IDB A;  1Y9B A;  2E76 B;  3AE2 C;  1IK7 A;  3T97 B;  4R4L A;  1HF9 A;  1KOR A;  3O6Q A;  2E75 C;  2ZT9 B;  2P10 A;  4PV1 B;  4YTP C;  2E74 D;  2QSI A;  3Q2Y A;  2WPV B;  1PIX A;  2O01 J;  3AEG C;  1PV3 A;  4OGQ D;  1EXI A;  4TT3 H;  3AE8 C;  5M1B A;  2G8Y A;  2BEZ F;  1ZOY C;  2E76 D;  4H0L C;  1OW8 A;  2E74 B;  1S5L X;  2H89 C;  2JO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...