3RKDD

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYSPALKSRLTISKDTSSSQLFLKIASVDTADTATYYCARIKSVITTGDYALDYWGQGTSVAVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural basis for the neutralization and genotype specificity of hepatitis E virus
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immune system
total genus 47
structure length 218
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdD01
4P9ML 4YBLB 2DDQH 3UTQA 4DVBA 3VD9A 2C3XA 4AG4L 1XGRA 2EEBA 1QNZL 4PIRF 4Y2DB 4BFBD 1G6RH 4PJFF 3BUYA 4PRIB 2EDFA 3HZKB 3LS5H 1RK1B 1A9BB 3IXAA 1HCFX 5GRZA 3P4NB 4POYA 1DQJA 4XI5C 3GJFH 2EYSB 4NNPH 5DK3A 1IQWL 3QCUH 3QDJA 3ZE2E 4LCIL 4KGJA 1DN0B 3NA9L 4D0DB 1BZQK 5HYSG 3U30B 4DUXA 2JJSA 5IJKC 1Q1JL 4NGHL 2G60H 3RP1A 1NBZB 4JFOB 5JPMB 5D7KE 1HSAB 4M7LT 1TJGH 4JG0L 4HPYL 2Z92B 1W72L 4LLAA 4TSCL 2XQBH 4ELKB 5KVFL 1PDKA 5DR5L 5GHWL 3ZKND 4OZFH 4C83A 5FDWA 2D7PA 3VGAC 4R3SA 1I1FB 1FIGL 2BVQA 5D1QB 3SDXB 2UUDK 1KIRA 2VXQL 1G6RB 2OZ4L 4M7LL 3U0PA 3TJHC 1RZJH 3W11C 4X6BB 4FQ1H 1YEEL 3O45A 3OKKB 1CE6B 4R97C 3GJFB 5I19H 3MRRA 1G9MC 4R2GC 4OTXH 2J8UA 3ZMRA 2JB6A 1FNLA 2XWBA 4CN1A 1A3RH 4R96B 2XQYG 1M05A 4U1HA 1FL6A 1TTFA 1WC7B 3DGGB 2D0HA 3QFJB 1ZT7B 2CGRL 5DSCB 2ICWJ 5AD0B 5INCB 3VXPB 3VGEA 4UOW1 5A2IH 1R5WB 4P3WA 4TRPH 4P48A 3LPWA 3QG7L 3DETD 4YDVA 3EUUA 4OZFB 1QSFD 2D9CA 4D94A 1A6UL 4KU1A 4FFVD 1T0NA 1I1AB 5IFJA 4LP4A 4ELMA 4CMHB 3GMPB 3R8BB 1SJXA 1AE6H 3WUWG 1KJ2H 4XPFH 25C8L 3G5VA 3ZSSA 3V5HB 2VDKL 1FFNA 3CLEH 4PBVC 5C07D 4GW1B 5ANMB 3QIUA 4KMLB 3QDMB 3CX2A 1LEKB 4KK6D 5GRUL 2A6JA 4OZGA 4X80H 5KOMC 5D6CB 5DRZB 3CDGA 4YXKH 3FRUB 4X6DF 1A1OA 4OGYL 3E2HB 3RHWK 1TFHA 4DQOH 5E8NA 2CIIA 2RB8A 4PGJA 3LSOB 5I18L 1K5NB 3V4VL 3UBXG 2VXSL 1JBJA 3FFCD 4DOHB 4IRJB 2LVCA 3PV7A 1NANH 4XBPA 3RU8H 1BAFH 4QKXB 5C9JA 1NCDH 1A7QL 4QRRA 4W6XB 1BF2A 4K2UH 1KJ2B 2H2SD 5H94B 3X12B 3GSNL 3RVTD 3FQNA 1TJIH 3KYAA 5F9AC 4K8RC 3D18B 1P4LB 3WJLA 3DTXB 3NFPB 3STZB 3KPLA 1D5BB 2P49B 4HS3B 5F93C 3P9MA 1QSEB 3MRCB 4L4TA 2ZG1A 2DQDL 4GAYA 3Q1SL 4WIQA 4D9QE 2Y07H 1XGPA 3ROOB 1ZLWK 4G6FD 1PY9A 3QYCA 3SDCB 2AJYL 1NFDA 1U3JA 3BD4A 3VFOB 2NTFA 4N0UA 1VGEL 5ICXA 1MJ8H 4AK1A 4KKCD 1P1ZB 3IJHA 1YECH 5DVOA 3VXRB 5TF0A 3MRBA 4NCC1 3RWDB 4EI5B 1DN2A 1TVBB 3VWKA 3V7AG 3B2UC 4XAWH 3O6KL 1ULVA 3OZ9H 3TCLA 5SX5H 4BZ1H 1MHEA 4KVCH 4KTYA 3L3GA 2Z31C 3AU1B 4JJ5B 3ZDZF 4LIQL 1DVFD 2H45A 3O4LD 2XT1B 2IAMC 4XVUD 4YDJB 3GDBA 3I2CH 1DUZA 1B6UA 5HI3D 5JLZB 3VGDA 5DF0A 1U93A 1Z9MA 1TTUA 1HSBA 3PIQB 5J56B 1KN4H 5GGTH 1T20A 3C6LA 4J1UB 4LQ1A 4LVEA 3X14A 1T1ZA 5LCVH 5C0GA 4QHLA 1H15B 1WT5A 2AJUH 2R15A 4LSPL 1ZVYA 3MBEB 1I7TB 4ORGA 1QO3B 1A1NA 2XWJA 3FN0L 2WAHA 4F9LA 4XC3H 4UNTA 3ARDC 4LNRA 4QYOB 5CGTA 1HH9B 3BWAA 3UTSE 2LTQB 4Y5YB 1CGSH 1G7MA 2B0SL 4NYLB 2J12B 3DURB 5JO5A 4P49A 1DBML 2IQ9L 3FQTA 1OAUH 2F9BT 3U4AA 3WEXA 5E70A 3O2VL 1TZHB 2PW2A 3HRZA 4IDLA 1E4WH 1DVFB 2Y36H 3O4LB 4P5TD 1IC7H 4PRDA 4BQBA 1PFCA 3GSUA 3VRJB 5IB2A 2FGWH 1I9IH 3N85H 1I1YB 3RZCD 3EJZD 3KXFE 2AGJL 4P4RB 1T21B 1BD2B 1W0VB 1PG7L 3KPRE 4L4VE 4PJXA 3WE6B 5KS9E 4A2LA 2ADJB 2VUYA 2Q20A 4OZ4A 3C5SA 4M48L 2OSLB 2GQHA 5DQDL 4R0LA 5K9QG 1CGVA 2K3TA 2P48B 4I5BB 5F6HJ 5C09E 5GS1A 3H3PH 4PG9B 3K1DA 3OTTA 5E2WH 2NY0D 4QXUH 4XBEH 3QRGL 2NX5A 1JYNA 3EZJB 4RX4D 5I1AB 4U4BA 2GEEA 1GGUA 2MNUA 2MHAA 5J9PB 1YY8B 4GS7B 1VESA 4CNIB 3RWFB 1XGQA 4LSTH 1W0WA 3DUUB 5T5NF 1FL5B 3PHOA 3V5KA 3WL9A 2ICWB 4Z78A 4LRIC 5I6XC 5TQ0H 1GAFH 4MCYA 3JSSA 1U3HA 4P3DA 4WI2A 4F7CA 4HLJA 3QZWB 3RTQC 3S3SA 1IFHH 3GMOB 4Z7VB 2YD8A 1CD0A 4QRSA 3MJ7B 3QO0A 1BF8A 1U9KA 1FNAA 4NCDA 1DQQB 5I1JL 4F57H 3VRLE 5A3ID 2VKXA 4I9WE 5KVGL 1F6AA 1TENA 3AC0A 1A64A 3CZFA 4BH7B 5T5FL 1QLRB 1PVHA 2DKMA 2OJEB 3WNKA 4WFFD 1QBLH 3SKOB 2O5YL 5EC1A 5HHXH 2HFFA 1NPUA 2YHGA 4MNQA 4IOFC 4XZUB 5A2JH 5T3ZE 3THMH 4DZ8B 1BVKB 4JY4A 3X17A 4Y4KA 1N64L 3PV6A 1L0XA 1FFQA 1U8QA 3LRGA 3OX8B 2YA2A 4XCYB 5DS8B 5TDOA 4KDWA 4OLUL 4PTUB 1QFPA 1CFTA 3TIEA 2R8SL 2NY3D 5D4QA 3BISA 1ITCA 2HKFH 5E8OB 5E2JA 4JHWL 2OXHA 3IRPX 1UACH 2A6DB 1LO5B 4LDOB 1OD9A 3JV4A 3BZEB 3LN5B 1ED3B 2DJSA 3GRWL 4LQFH 5C08B 1LE9A 3GMLA 3MACL 5KANG 2B1AL 4ZUVB 4YJZL 1PG7W 4KI5D 4PJFA 3RWJA 3D85A 3F8UB 1MREL 4H20L 2G2RB 4KRPC 3G6JE 4M1GH 2F54B 5F1IA 5I16A 3P0GB 3ARGC 4KUCD 5HI4D 2YA1A 1IGCL 1CFBA 5ESAA 4NQTA 2I9TB 2EDNA 3FT4A 1EFQA 2GCYA 1AKJA 2BDNH 1O7VA 1XR9A 2VQUA 2QSCL 5DUBA 2KQNA 1ZLSH 2O5XL 3MLVH 3LD8B 3T0EE 1YEGL 1YEJH 4OD1L 4ONFH 2PNDA 3BGMA 2EIZB 2I5YH 3QXTA 5DA4A 1QUNA 3HE6D 4HGWB 2C1OA 3MOBH 3P11L 3A6BL 2AEPH 4PB0H 1CXLA 4RISL 1G7QA 5SWZD 4NQEE 2BSSA 4R7NB 4JO1H 1OLLA 1S7XB 3VI4F 4GH7B 4JFDD 4RGNC 2OTUA 1B0GB 3DUHA 3V8OA 5CINL 4UT7H 3ARFD 1MNUH 2IPUK 3HPLB 1IM9A 2MTPA 5DO2C 4KH2A 5E1HB 1UWGL 3V0WH 4OGZA 1A4JA 3GSWA 3ZDXE 1JGLL 4OGAD 3MLZH 3FO2A 1NANI 2QHRL 4XRCB 1VFAA 4EOWL 1DEEB 5DYOB 3UYRH 4N0RA 1JL8A 3SY0A 1AGBB 3MRJA 4P5KA 1V3MA 3QIBA 4KJQC 4KVNL 4MVBD 3O3BA 1Q38A 2GJ6B 2Z91B 2NZ9D 3QEHA 2P8LB 3IU3A 4KKLD 1NAML 2IPKA 2QSQA 3ULSA 1KXVC 3VD5A 4ZYKB 4X6CF 2AK4E 2D31A 4PTTB 3JV6B 3MO1A 3WDHA 5I1GL 5I15L 4G8GE 3NTCH 5FGBC 5IBUG 1PLGL 4JR9H 5EC2B 4P5MB 4MA7L 5E6YA 4HQQL 2Z93A 4OFKA 3WLBB 4DVRL 5HGDA 3LKPA 3OL2A 3MRGA 4X6DA 1E27B 3U36B 4Z0BH 3ARFB 5KN5B 3MLXH 5F3HB 4HKJA 2E3VA 4S1QH 1F4YH 4I18A 3O11B 4RFOL 1OPGL 1XF2A 4HMDA 1DBJH 4Z8FL 1ITBB 1X5FA 4KROC 4U1NB 4WO4C 4G7YH 3TNNA 1XF3A 3GSOA 4YE4L 5HD8C 4DN4H 4LASL 3C60B 2WUBH 3D9AL 4KAQH 2BRRH 4ZQKB 3PP3H 4FQXA 1QKZL 4APQD 4YQXL 4QLRA 4FFZL 4HUVB 1RIUH 2WWMC 1CIUA 4HHAB 1V7ML 1V7NL 1D5MB 3CSBA 1QBMH 1KXQE 3QEUB 4WJ5A 2VIRA 3H9SE 4M00A 1KXTB 3ULVD 4LKXA 5IFHL 1CF8H 4X7SH 4CW1A 2VLLA 2PXYA 1PKQA 3PL6B 5EU4A 2X44D 3ULVH 1A0QL 2P46B 5GZNC 3TNMA 1ZMYA 3WSQL 1FSKB 1KPRA 5BW7C 3TYFA 3NH7H 2ICEB 5I2IA 1C5BL 2HT3C 4DJMA 1AJ7L 1XF4A 3IETB 5DVKA 2IG2H 4NHUA 4NOFA 3QEQB 5CJOH 4K9EH 1R3KA 1Y6NR 1RZIB 3U6RA 1MY5A 2ZCKL 3S5LG 1PYWB 5KVEH 4KGLA 4LSQH 2PYEA 4WI3A 5GSRB 5CJ5A 1H0DB 2NY6D 2X89A 1BECA 3SE8H 2ICWI 4K3DL 5ALBH 1R0AH 4NCC2 1G7JB 1EXUB 3T8XA 2NY1B 1BEYH 5HHVH 5DJ0B 3OGCB 2P42B 2VZSA 5EZJB 4AIOA 4NWUH 5B39A 4WU7B 5I17A 3RIFF 4DKEL 4YC2C 2GJZA 3UYOD 3TO2A 3GSRA 5F7EH 3OGOE 3HRPA 3HR5A 1QACA 4YGVA 4NRYA 5DD3H 4Y7MA 4YAQB 4H0HB 3BEWB 3D87B 4RRPG 3CDFA 3OG4B 5BXFB 4O2FA 4J23A 3UTQB 2FX7L 3LQAC 3RNKA 3EYFA 4F7PA 1TQBB 4DVBB 5I8CB 5D1ZA 3HE7A 1XGRB 5F89A 4CVUA 1J0JA 1KPVA 2QLVB 3BUYB 4PJAE 1BOGA 1VFUA 1KC5H 4Y16C 1A6AA 2O5ZH 3MRFA 1WZ1H 3IXAB 3UTSA 4AYFA 3IFPA 4M5YL 1WUNT 3QDJB 3IFOA 4QHMB 4X9BA 2BNRA 2YPVH 5DZLA 5GGQL 4QOKE 4KQ3L 4ZO8A 1CXHA 4L5FL 3V4PL 1DSFH 3BJLA 3TN0C 3VFNA 2CJUL 1TQCB 4MB4A 5TFSL 4NQUA 2JJTA 3KHOA 3AS2A 1FFOB 4GRLD 1J9CT 3WO4C 5T3XL 5C0RH 4O9HH 3TIDA 2F19H 1CXEA 3AM8C 4L4VA 4AENB 2BSED 3SDDC 4G6AC 4OCRL 4NT6B 1YJDH 1AO7D 2BVQB 3ZL4H 5JW5A 3QWRD 4AL8L 5F7YC 35C8H 2Q87A 4U0RB 5EU3A 5DEFA 3VH8G 3U0PB 5C09A 2HFEA 2CMRH 4NKIH 5GISH 1P6AB 1CE1H 4JFED 3QUYA 2W60B 1NGPL 1A14H 2JB6B 1LP9F 4UINL 4XPAL 2X4QB 3OB8A 3S3PA 5IJVA 1DQLH 1DQMH 2QQQA 3Q5TA 1M05B 4U1HB 5TE4L 5KBNC 4OJFL 5FM5M 2FEDC 4CVZA 1EDQA 4O02L 1G84A 1X44A 5D6DA 5D71H 4E42B 4KMQA 5K9JL 1AHWA 2A2QT 3ULUD 5GS0C 4UV7L 4LVNC 3AGVA 3O6FC 3U48A 1ZANL 4JREC 4I1NB 3TT3L 2A73A 3CK0H 5LVEA 1T0NB 3VGFA 2ZOLA 1HNGA 4NBXB 5E1AA 5FKAA 4ELMB 1FE8H 2K7QA 1OTUD 3FQUB 4YXHL 1QLFA 3G5VB 3U9PL 5IK3A 1FFNB 5K93A 4NQCD 3QIUB 5E08L 4RWHA 5HJ3B 3MJ9L 4JO4L 1IMHC 1JWMA 4TPRH 5J11C 5EWIL 4U0QB 3O2WL 2P47B 2DYPA 1A1OB 1RHHA 1ZOXA 1D9KA 4HK0A 4XPBH 5E8NB 5I8EA 2CIIB 1MPAH 4TOYL 3TPUA 5JW4R 1KEGL 4HLZH 3GSVB 1D5XA 5JOPE 1IAIH 4HT1H 4MZ2A 1UEMA 3DSNA 3GMMA 4XBPB 4DGYL 3HNVL 5DFVC 1XMWA 1JNNH 4QRRB 3HZMB 2CK0H 1WZKA 4Y5VB 3UMTA 4XCNB 4IS6A 1C5CH 3FQNB 1B2WH 3LH2H 5AYUL 3KPLB 3KPQB 4JGMA 4WI7A 4C54A 3RY6A 3ZT7A 3G6JA 3P9MB 4L4TB 2B5IC 1CD8A 3QPQD 5HXMA 1BZ9A 1XGPB 4CGTA 4XMPH 2VLKB 4YBLC 1NFDB 4Y2DC 2NTFB 4N0UB 3OB0H 3T2PA 3WXVH 3WFCH 5ICXB 1T04A 1CDIA 1VACA 5B4MC 1I9RL 4X9FA 3MRBB 3X3GL 3RKPA 1NFIA 3N1FC 3QULA 4PJHE 5C6TL 3MA7A 3VWKB 5IVOA 1N59B 3LN9A 3T0EA 4LFHD 4PGBA 1NMBH 4K7FA 5L8LB 4KKBC 1MHEB 5KAQG 2ADGA 1BQHB 3ARXA 3U30C 5FYKL 4U49A 2R39A 2VLME 3GSXA 4NRZA 4XAKD 5DHXB 3MYJA 1MEXL 3V6FA 1J1OH 1G7LA 2BNQE 4R9HA 3I6LE 2Q7YA 4ALAL 5GGSA 4M7JH 4C4KT 4QT5A 3ILQD 1MH5A 1MF2H 1U93B 3LKSB 4WWKB 4Z77A 4NQEA 1HSBB 1FFPA 3MPCA 2Y72A 4UQ2A 1T20B 3C6LB 4GKNA 1OD7A 5ACLA 3X14B 2OL3L 5F7FA 5D1QC 4QHLB 4NIKB 4PFEA 4F2MA 4ORGB 5IT2H 4BKLB 4OQTL 1A1NB 2XWJB 2V6HA 2QADD 1CL7H 4W4OA 4I8DA 4LNRB 4HWEH 5IFAH 1K6QH 2M1KA 3BWAB 4ODHL 3ZE0F 4K3JH 5B22A 4WUKH 3T2NH 4X6CA 3H2WA 3QQ9D 3ZYOA 1G7MB 4Y4HA 2BY2A 3DV4A 3IDYB 1IARB 3QQNA 4U05A 3LRHA 3WEXB 1J8HE 4E5XA 3DX8A 1LO2H 2R69H 2PW2B 1OP5K 1VKXA 3HRZB 2WLZA 1YNLH 3FO1A 3GSUB 4G8GA 4NC1C 3F7VA 3V52H 5IB2B 5BOZG 4HPOL 5EORL 3MODL 2J88H 4ODTL 2X42A 2ZOKA 1I1AC 3P77B 4H25A 3EYQC 2I26N 4L3CB 4CMHC 3D3VE 2C5DC 2AEQL 2ZPKL 4ZDHA 4PJXB 5GGRA 2X05A 5BV7L 1RZJC 2FO4A 2DIBA 4OZ4B 3C5SB 2XOTA 4ZPTA 2DOCA 4JY5L 4R0LB 1ZHKA 2HMID 2BXZA 4QXGL 4R4FH 5GS1B 2EE9A 1P7QD 3QXWA 4MMZC 4MNQD 3EAKA 1UYWH 1JHTB 3E6FA 4P2QB 3E2HC 4JDZA 2NX5B 3WDIA 1R5VA 4ERSH 2BJMH 4MA1B 4Z7NF 4U1GB 3IFNL 5J4MA 2QTEA 1E6OL 3X3FH 4L8BA 2HLAA 4AT6B 1UB6A 2GIYA 4HUKB 4NKOB 5EOCL 1W0WB 4IRJC 1S5HA 4Z0XA 5IQ9A 3V5KB 3PHOB 4D3CH 3H9ZA 4OLXH 5DT1H 3H9SA 1P9MC 4M62L 2AABL 1GGYA 1U3HB 2BCKA 4P3DB 5BZWA 2ZCHL 3ZE1F 3DNKA 1OAKH 4QRSB 3QO0B 5HDQH 1RUML 5IMOA 4CN4A 1FRGH 3TZVD 4U6VH 4Y1AB 4QF1A 4YHLL 1TCMA 3MX0A 3D85D 2UZIH 2EICA 1F6AB 1WFTA 4Z7WE 5HHOD 1OSZA 3VXUB 5J0BA 2Y9RT 3CZFB 5TGBA 4KK6C 3S37L 5FB8A 5EC1B 3SDCC 4G8FA 1T0PB 4J4PA 4MNQB 3K0WA 4MCZA 4M7ZC 4L8SB 4GJTB 3KDMB 1AKJD 4UILH 3S97C 4JY4B 2MKLC 2NW3A 2DJ4A 3N1PC 3TV3H 4TUKH 2C3GA 3KLSA 4Y4KB 3PV6B 5F70A 3RVWC 3MXVL 1U8QB 4JFXA 1QHOA 3VG9B 4EI5C 5DDHA 3G5ZB 4N8CL 3GGWA 4ONGH 5A16B 2W9DH 1CFTB 5D7KD 3TIEB 2ORBH 4X4XA 4ODBD 4G8IA 3L6FA 5ICYA 1N6QH 1K85A 1SBSH 4RDQG 3MV8A 3JV4B 1CGYA 4I48A 4NHCL 1JUFB 3MRQA 3GMLB 3BKML 3WFDH 4PJFB 3UDWA 1EGJA 1I8LC 3E0GA 4HWBL 4I0PA 3DXAD 4KDTC 3MBEC 2C3HA 3DYOA 4HGKC 3SDAA 5I16B 3GBMH 3LVEA 3WNOA 1GGCH 2KUTA 4LEXL 3HG1E 3NCBB 5ESAB 1IM9D 3SE3A 1A1MA 2DIAA 4PJAA 1KEML 2DQUH 3EFFA 1AGDA 3ISWA 3HA0A 2AXHA 3HMXL 5DEZA 1XR9B 3E8UL 4YWGL 3PJSA 3LN4A 2Q6WA 3NAAH 4Y5YC 1A02N 1ZV5A 4O2CA 3WBDA 4QOKA 3A0OA 5LQBH 5FM5O 3PXJA 4L1DA 2KQMA 4GBXA 3QIBD 3T0VA 3TWCH 1MCEA 3GI9H 1WCBA 4OZFG 1DVFC 3MRMA 3BGMB 2HRLA 1A21A 4XVUC 2C1OB 2PTTB 3G08B 4R8WL 4JCMA 4E0RA 5EU6B 3DO3A 1CZ8H 1G7QB 3QIWA 4K3HA 3MNWA 1IGML 3RGVD 3VA2C 4EKXA 1N26A 2BSSB 4X98A 3OPZH 1EBPA 2DQFA 4EZMA 1JPGA 3H42H 2CUIA 2N56A 2OTUB 4EUPA 5GGTL 2WBKA 2JELH 2DJUA 2RCSH 4UQ3A 3QUMA 2IANE 4HAFA 4LHUA 1WZMA 3I3BA 2Q8AL 5DK2A 3IB4A 1A4JB 3GSWB 1IAII 1AXTH 2YUWA 3TA3A 1VFAB 1UH3A 2WBWB 1MCHA 1JHKH 2X4OB 4PLJD 3RA7H 3DBXA 1CGXA 3DMMB 2CO7B 4LVOB 3QIBB 1GOFA 1UGNA 3UAJD 4GS7C 1IAIM 4HZAA 4MXVE 3WFEL 3O3BB 2EC8A 1OT2A 3QEHB 4LCWE 2IPKB 3ULSB 2R0ZL 3MO1B 1MLCA 5DJXA 5GJTH 1MHPH 1F3RB 4QNPE 2PXYD 3NACL 3OHXA 5M94B 1T7YA 3N85L 5D93B 5IIEA 1CN4A 4FG6D 4JPIA 2Z93B 3FJTA 3H3BC 4PGZA 2F58H 1EHLH 5HGDB 3CPLB 4MSWA 3LKPB 3MRGB 4X6DB 3ZKMD 4LSSH 1R3IL 2DRUA 1FNHA 2WWKO 4AH2B 3W39A 4HKJB 1IILE 4D9QD 4F7MA 1ZT4B 4I18B 5IW6B 4S1RH 2I27N 4QRPE 3TNNB 4PB9L 3GSOB 1U0QA 3LHPH 4PLKC 1OAQL 4KQ4H 2YC1A 1KTRL 1IL1A 2LU7A 4WTZA 2B20A 3P40A 2XA8L 4FQXB 2AQ2A 5J1AB 2X89D 1B0RA 1UWEL 3KYKL 3QISA 2DQEL 1HWHB 1JRHH 5AG8A 1K9TA 2VIRB 2J4WL 3JVGC 3BP5A 4KUZH 4LKXB 4JPVL 4CW1B 4O4YH 1EEZA 1UKTA 2PXYB 5I8KH 4OI8A 1PKQB 4UB0L 3TNMB 1T4KA 2YK1L 4AQOA 2CKBA 2EKJA 4JFPA 1CL7I 1JMXA 3BUTA 4IRZL 1CK0L 3ILPA 1CDGA 4GXVL 4O2EB 4IMKA 4URTB 1FIEA 2VNCA 3LKQA 5EO9A 3BRDA 5KG9A 5IQ7L 1JFQH 4BELD 5I2IB 3CX5J 3GHEL 2R29L 1JWUA 1G0DA 4FZ8L 4NQDE 3QUZA 1XF4B 1QYGL 4NHUB 4CUCA 4YEFA 1DBKH 5D1ZD 3IDMB 3ESVF 2XKNA 4JHAH 3TVMB 1R3KB 1RIVH 4GRWF 4I3SL 4U1SA 4GQPH 1I7ZA 3EFDL 1F4WL 2ZSVA 4MQTB 3UTSD 4JVUA 4PJHA 4ODSL 1EIBA 2PYEB 4HF5L 4GMTH 3O3DA 4FQ2L 5KOVC 3LD8C 5A40E 3H7BB 4OBSA 4G9DA 4LPVA 5CUSH 2AAVA 2XQYK 4HX1B 3T8XB 4TVPE 3ZYJA 3SJVE 4IRSA 1MWAA 4MXQD 1S8DA 5I74B 1ZS8A 4NZRH 5B39B 4MYWB 5I17B 3KPOA 4V1DE 3QXAB 3KXFD 5JIKA 1WIPA 4QHUA 4YBHA 3KPRD 1HKLH 3SE4C 4BQCA 3HR5B 4YGVB 1DEDA 4NRYB 1KJVA 4NDMA 1U3ZA 5HSFA 3U4BL 4HS8L 1T80A 4KPHH 5TE6L 2R56L 4JAMA 2A9ML 2ADIB 5C09D 4F7PB 3EYFB 4ZD3L 4HFUH 3HE7B 5F89B 3UEZA 2CUMA 1EHXA 1KPVB 3PUCA 4HXAL 1NC4B 3T0WA 1BOGB 3QUYD 1A6AB 1T2QL 3HC3H 3MRFB 2VERN 3VD4A 3MJ8A 5FYKU 4OFPA 1INDH 4LVHB 3IFOB 2HT4D 4HJGA 2NY4D 2BNRB 3TJEL 1OQXA 5GS2D 1UCBH 4XNMA 2A83B 5DEGB 3BYTA 4R90L 4G6ML 1KIQA 3VFNB 3NZ8A 1T2XA 3L3OA 3NBNA 5DD0H 1OM3H 3CAFA 1Q9KA 1T89C 4Z7OF 4ZS6D 3QZWG 2VMFA 2I60H 2I9LB 5D1XA 4HIHA 3D3VA 5FUOL 5TJWK 4L4VB 3TH4T 3UC0H 1LK2A 4WUUD 1I3RA 5I1CH 4LDEB 2BSRA 5JW5B 4I9WD 3ARFC 1NCCH 3CIQA 1HILA 1JTTA 1W72A 4YEEA 1E4JA 2HH0L 5DEFB 5EU3B 4DTGH 2JLLA 2ED7A 4EXKA 3IGAB 5IVXF 3I6KB 1XT5A 4K71B 3MA9L 4TSBL 4DN3H 3GIZL 4PY8J 2NLJA 1N8ZB 3PGDA 1H3PL 2B8OT 4D0CA 1OGAE 2ZJSL 4UIMA 3UJJL 2W9EL 1KN2L 3IDUA 5I71B 4WCYL 1NCBL 4WEBH 3C60C 4UT6H 2OZ4A 4Q9RL 5T3ZH 1FPTH 4CVZB 1DZBA 1CI5A 3LRSA 4LU5L 1MQKL 2NZ9C 4PLOB 3LEYL 5CCKH 5IR1A 4TSAH 5DVMA 1FZKB 4KKLC 4RQQA 1T7WA 1CDCA 3NGBB 2A73B 5ITBH 1GRWA 3R8QA 3VXOB 4KZDH 1GOHA 2ZOLB 4JRYE 2FECL 4XP9L 2Q86A 4FQIL 5FHAL 43C9A 3CFEA 5LXGH 4KC3B 1FSKC 5IK3B 5MEOB 1ZSDA 1HQ4B 4KHTL 5C71A 1X5AA 2YD9A 3I50H 3BRGC 4X4ME 3C5ZD 2ZUQB 3EIFA 5B38B 1GPOL 2QV2A 4OLVH 3SE9H 3EO1A 3UJIH 4ODXB 3KYOA 5E9DE 1MCPL 1FO0L 3SCMA 4JDVA 4CL7A 2DYPB 3D25A 4MAUH 1RHHB 4XXCC 4HG4J 3EYUH 1D9KB 3CXDL 4HK0B 5H8DA 5MI0B 4FQPA 3TPUB 1NBVL 1HHKA 1YEIL 1YMME 5F7UA 3L95A 5I73B 3MLSL 5CJXC 4DN4L 1A7NL 3NABH 3T0ED 1QRNB 2AJ3B 1KCVL 1P4IL 4IEFB 4FS0A 1OCWL 3KHQA 1NEZG 3TP4A 5CBEA 3GMMB 2NY1C 5I1KH 3KWWB 4ZUUA 5GGVH 3ULVC 3L7EA 1JGVL 4IS6B 3UTTE 4KJWC 1CFQA 4S0TD 3WNPA 3OKMB 1RVFH 1R3JB 1FAIH 2IQAA 3UPRA 5ILTH 1OTTC 4NQED 3OAZK 4O51A 1GOGA 4XWGL 1K8DA 3AFLA 3VXSD 3FB8A 1BZ9B 1IM3B 3CDCA 5E2TH 1J1XL 4K9EC 3J8F7 2MQ0A 4UZGA 1YYLL 2P5EE 3GSNA 3HG1A 2WIMA 1XIWA 1LO3L 2HVJA 2WZPD 1TQBC 3DSFH 4B7LA 5GRVK 3VG0L 1T04B 4PRHE 2BXYA 3OKNA 3C5JA 4KV5F 1R3LB 3DVGA 3LZFH 3VFUB 1NFIB 1OAYH 2NY6C 4PGBB 2EXWD 4K7FB 2W0KA 3R0MA 5EO0B 4DGIL 2ADGB 8CGTA 4P23A 3UTZA 5DD1L 2AV7A 4G80A 2ZUUA 5MP6L 4NRZB 1DDHA 3MYJB 5EA0L 1G7LB 1MAJA 2X70A 1OW0A 4UDTA 2AK4D 2VXVH 5JXAH 5GGSB 1KLUB 1YMHA 1RV6X 5IMKB 3DHJA 4XWOC 4QT5B 3GKWL 1MH5B 3F62A 4J8RB 2GY5A 4OI9A 5JNYA 3TH3T 5SWQA 4UQ2B 2JB5L 4PJDF 3O6LH 1YUHA 2KBGA 2VDQL 2A77L 2Y4SA 1GIGH 4F2MB 3V0AC 5FK9A 2L4OA 5EPMB 5CILL 2XV6B 1J0KA 2VO5A 3M17A 4K94L 1FDLL 1D6VH 4UV4L 1S3KL 4PGDB 4X6CB 1JRHI 2J7LA 4M43H 4Y4HB 4WEMB 3CFCL 3DV4B 5JIPA 3GFUA 4CDGC 5JTWA 1J05A 4E5XB 1TNNA 2BC4B 5CP7A 4LCWA 4QWWD 1OARL 1FZOB 3FO1B 4G8GB 5KSBE 3F7VB 5K59E 3WFHA 1WFNA 1JZ8A 4M7KL 3TPKA 4PRPB 2YPLE 4KZEH 4H25B 1YJDC 5C1MB 3IJYB 4LPUA 3VFRA 1G7HA 5L0QB 1S7QA 4MA8H 5GGRB 3G6AA 4HKBA 2FO4B 4LL9A 4MLSA 1BBDH 4ZPTB 2W92A 3T3MF 3QIUC 5BRZB 4GMSH 5EZIH 1ZHKB 5JUEL 3HCVA 3QDGE 4MHHI 4LK4A 5T3XE 3HNSL 3O9WA 1IGIH 1AI1H 1BQLH 3S88H 4QRPA 4J4PD 3L5WA 5LBSL 4U3CA 2UYLB 1MCCA 3E6FB 4Z76B 4JDZB 4OUUB 5FA4B 1GXEA 1NGXA 5E0QA 2J3SA 1IVLA 1I8KB 1M7IA 2J2ZA 5HDBE 2H6PA 1E4KA 2HLAB 4LLMA 1UB6B 4BZ2H 5T1DL 4DKFH 1S5HB 5IQ9B 4YBQC 1ADQL 2HTLC 3H9SB 3SOBL 4UU9A 4LCYB 4G3YH 2A74B 1RMFL 1WQVT 5BZWB 2UY7A 3W2DH 1CDUA 3P0VH 3SQOH 1MCOH 1MCBA 3OAYH 1K8IB 5IB3A 5IMOB 3TLRA 3WJLC 2BOBB 4JRWA 5K9KA 4QF1B 3DX6A 1L7IH 5DLML 1RUPH 2C9AA 1ZTXH 1OSZB 1MI5E 3AMKA 5TGBB 4NQDA 4XPTL 1CWVA 4N1HB 4Z9KB 5GRYA 1EGJH 1EEYB 1KPUB 1YN7A 1RHFA 1S9YB 2OBGA 5GSVA 4G8FB 4UBDC 4XPGL 3IDJA 4MCZB 1UM6L 3WN5A 1GHFL 2Y7QA 3SO3B 4G8EB 1MFDH 2XN9B 2NW3B 4E41D 3VWKC 3CSYA 4M8QB 3F12A 3TBTB 4GBXD 3P73A 4IOIA 5H35A 6FABH 3D6GA 3ZKSD 1F2QA 4X4XB 4G8IB 2Q8BH 8FABB 4HXBL 4DZBA 4V1DA 3VFMA 1DBBL 3PWJB 3MV8B 3QPXL 5JW3H 1G7IA 4WWKC 3QIWD 5DMIH 5L6YH 3C6LC 4KK5D 4KTDH 2HTKC 4UIKH 2K9UA 4S2SA 2P24A 4OCSH 3QHFH 2GHWB 4L3EE 4I0PB 1IT9H 2WUCL 3BMVA 1WT5C 2HG5A 3IDNA 3SDAB 3QUXB 1FYTE 2C4FU 2B2XL 4R4ND 3GRWA 1Q0YL 1KENL 4EUPH 1TVHA 4YFDB 3BQUD 4PJAB 4ZSOB 2YPKA 3QUMH 4JVWA 3DUSA 1AGDB 2ILLA 4OCWL 4WDIA 5AZEH 1I3VA 3PJSB 3LN4B 5DHVA 5FM4A 2Q6WB 1Q9WA 2Q1EA 2FBJL 4QOKB 2I25N 3SKJL 3IDGA 3K80A 4ODVL 3B9KA 3IDYC 1N0LA 1YNKL 5GJSH 4CADB 4FP8H 4MS8D 4PV8A 1FH5L 4MDJB 2VXUH 1WCBB 3HMWH 5HI5C 3MRMB 3NIDF 5MEPA 4U1LA 3QEGH 1UQSA 5T33H 2DQCH 5CZVL 4XP6L 2P8MA 3ILQC 5IVXA 5IESL 3PHSA 3NFSH 3MNWB 2GTWA 2DQFB 5EUOF 5FYKE 3V2AR 1LP9B 1DANT 1JPGB 3R06A 1BGXH 2CO6B 2EH8L 2ZG3A 1FCCA 1HYSC 4F8QA 1MJJB 1MCLA 5E4IA 1KFAH 3MFFB 4R0LC 4CBPA 4UQ3B 3QUMB 3LPGA 3RBSA 2A9NL 1Q9LA 1BM3L 5GS1C 5DXWA 4LHUB 1RZGA 1PZ5A 1LVEA 3RWEA 5DK2B 1OGAA 3O2DL 3G5YA 3GHBH 1M7DA 2ZUTA 1FBIH 3TA3B 3MLYH 2IFFH 4IDJH 3BKYL 4MA1C 2V7NB 4U1GC 3MV7A 3DBXB 5JOPD 4LLVB 2XACC 2A38A 2NYYD 1CXFA 1NLDH 2QR0A 4NQSA 3MBXL 2XZQH 4YHOL 2EXYD 1VPOH 4RRPA 2R0LL 3P9WB 1U3HC 5IB5A 5DJXB 1F11A 4JRYA 5C0ND 1F8TL 2EE2A 1HXYA 3QG6A 5HHNA 3OHXB 5IIEB 1R24A 4JPIB 1QFWL 4MSWB 4YUEL 1U2HA 3QHZH 1MRFL 4YNYB 1NL0L 1NAMA 4GOSA 5D2LE 1AGCA 4X4MA 2RQ8A 5I1IL 2CKBH 3K3QA 2RR3A 3QFJE 4F7MB 1A3LH 1K2DA 3HNTH 3JWDH 4NO0D 1U8IA 4LSUH 5E9DA 1YPZF 1WWCA 3QUZD 4PRBB 1RUKH 4G6KL 4HLZG 1ZGLA 1MQ8A 3SGEH 1WTLA 2VH5H 4Z7UF 3BYYA 3PHQA 2YC1B 1CD9B 4NC1E 3TESA 5FAAA 3OG6B 1YMMA 1IL1B 3CSPA 4Y4KC 2L7JA 4WGVB 3VG9C 4FQJL 1MHCA 3WD5L 4RZCB 1C12B 3BE1L 4P2OA 5F88A 4IJ3B 3EOAA 4HWUA 4FFYL 1B0RB 4HC1L 2EYRB 1RULH 3RVVC 5TQ2H 1KT2A 1U8MB 4LSRL 5TE7L 5ANME 5DWUL 4OD3H 1F97A 1MFAL 4IRSD 2BNQD 3BJ91 3I6LD 4KXZH 3UTTA 2IH3B 2B4CL 4XVTL 5F7WC 1CU4H 1M7XA 1E4XH 4MDIB 3CDYA 4L29A 1LDSA 1MWAH 1TZIA 4ORZC 1T4KB 2CKBB 1V3LA 4HUWA 1DLFL 3L5XL 3VWJA 3KYNB 5EO9B 3LIZH 4U1MA 5KG9B 3NCCB 2QEJA 2P5EA 3ZSTA 1JWUB 2FBOJ 5E56A 3MLUL 4L9LA 3GM0A 4ODWA 4WTWA 2H32A 4PRHA 4DOHE 4NC0B 1F90L 5AZ2H 4XT1C 4U1SB 3BP4A 2KZWA 4O58L 4LRNL 3TO4B 2ZSVB 3S4SB 1MJUL 3AS3A 4LFHG 1S7TA 4PJHB 2CDGA 3SBWA 2X4PA 3IFLL 3QQ4B 4UOJA 4X7EC 3O3DB 4XTRD 3N1MC 2W38A 5ENWA 2HVKA 4G9DB 3OR7A 1J8HD 3BZFA 4FABH 2O61A 4WV1A 3FOLA 3ES6B 2VC2L 4GKZA 4P9MH 4KK9D 5IW1B 1MWAB 1S8DB 4N5UA 1ZS8B 1QOKA 4AG4H 1QNZH 3W0WD 3KPOB 1L9NA 5DFTA 4BQ6A 1CVRA 5LG1A 4F15B 3SKNA 5GGRY 4PRAA 3ZZ1A 2F5BL 4QHUB 3D3VD 1IQWH 1HOCB 4LCIH 4JQIL 1KJVB 3NA9H 4NDMB 1J86A 3WFDL 3VXRE 4S1DC 4XI5D 4LBEB 3VXMD 1Q1JH 4JAMB 1R5IB 4NGHH 3JV5A 5DMKA 1IGYA 1G7PA 4H5SB 1BJ1J 4JG0H 4HPYH 1M4KA 4NFCA 1JWSB 5D72L 1W72H 4TSCH 4ZAKA 1GGCL 5KVFH 5DR5H 1HH6A 2BNUA 5IG7B 1GC1L 1QBBA 5GHWH 5DJ6A 3MJ8B 4YFEA 3VMPA 5EBLA 1UEYA 1JPTL 3QUKA 3TCXA 4Q6IB 1FNEA 5C0BE 1VB9A 4IMLA 4ZOAA 1DE4A 3ARPA 3K74B 1QPPA 4XNMB 4MLIA 1FIGH 4PJBF 3QCVL 4LVOC 2CK2A 3QIBC 4WY7L 1KIQB 5F7NC 5HDOA 2VXQH 2OZ4H 3B6SA 4M7LH 1OB1A 4LCCA 1N6UA 3L3OB 1KB5L 3FRPA 1YEEH 3V95A 5KSBA 4JY6A 3M45A 4ZNCD 4I77L 3FHAA 4OF0A 2V7HA 2YPLA 3TJHD 3DVIA 3W11D 4KKAC 4LLDA 2HJFA 5D1XB 4HIHB 3O41A 1XCTA 5D93C 4LLWB 3L3IA 2XA3A 1OGTA 4R2GD 2CGRH 1I3RB 3BGFB 3TH2T 2AP2A 2FL5B 2CLRB 2BSRB 1FG2A 2AKRA 1HILB 3LEVL 1W72B 3QDGA 3GZKA 4I18C 2AS5M 3RUGF 3RX7A 1YNTA 3QG7H 5HHPA 5DRNA 3H0TA 4OF5A 5ELIA 1KG0B 3BMWA 1L9MA 1A6UH 3PGDB 4D0CB 4UIMB 4ZO9A 3RWGA 4ZUWA 1PX3A 4PJ5A 4ZO7A 2FD6L 1ONQA 25C8H 3C8DA 5IF0B 4Y19A 4PRNB 2FLBT 4FQXC 3AM8A 2VDKH 3BW9A 3WMSA 4TNVK 4ZO6A 1BD2E 3BPCB 1A6ZA 5GRUH 3BIBX 3FB6A 1CICB 4RQQB 2BY1A 1HKFA 3QAZC 1TZGL 2PXYC 2VWEC 3BIAX 4HIXL 4OGYH 2Q86B 1JK8A 3HUJE 43C9B 4C56B 4M6NL 3CFEB 4LF3B 5I18H 2QBWA 3V4VH 2H41A 1ZSDB 1MI5A 2VXSH 2F58L 3LCYA 1KUMA 1Y0LB 5SV3A 4Z7QF 2DTML 3S98A 2XXCB 2YR3A 4BZYA 3EO1B 3CMGA 3H6JA 1A7QH 3HG1D 3KYOB 3QNYA 1X7QA 3ECBB 3NPSB 3SCMB 4JDVB 3D25B 2ATPA 4ZS7L 4D2NA 3TVMC 3GSNH 4XNUL 1ZHBA 3Q5YA 2WLYA 1F6FB 3MJ9A 1HHKB 2V5YA 1OAZL 3L95B 3U7WL 1EA9C 4GW5A 4K8RD 2X1OA 3MRKB 2DQDH 3U83A 4Y89A 1U8HA 1Z3GL 3Q1SH 2OTWB 4DCQA 5CBEB 1IAOA 4ZUUB 3DWTA 1ZLVK 5BZDA 2AJYH 5I66B 5I74C 2QQKL 2PCPA 1BBJB 3L7EB 4H0GA 5HGAA 1VGEH 5C0JA 3HLAA 1CFQB 4PUBL 4X7DC 3EHBC 2FX9L 2W0LA 2WP3O 5KZCB 1M6OB 1YEHL 4L3EA 1NGQL 5FYJL 3O6KH 4P57B 1FGVL 4PJ8A 1AXSA 4LPXA 4RBPK 3IKKA 3B2UD 1XIWB 2HVJB 2IAND 1FJ1B 2QSVA 3IAGC 1RZKL 3HE7C 4LIQH 4P46A 4Z18A 2Z31D 3OKNB 3C5JB 2YRZA 3DRQA 4QHKJ 5ID1B 1Z9LA 2IAMD 4LVHC 3LDBB 1UG9A 5C08E 4I2XA 2J5LB 1BJ1H 4B53A 1NMAL 1QFOA 4LSPH 1AXIB 4P23B 2H1PL 3UTZB 2AJZA 2AV7B 2HJLB 4G80B 4N9OB 3FN0H 5C0AB 3LB6C 3KLAA 2JJTC 1DDHB 1IBGL 1TIUA 3NCEB 4LCWD 2V2TA 4UDTB 1JTOA 1NBYB 2X4RA 5JDJA 1TCRA 1YMHB 2BMKA 2KKQA 4MGXA 2CIKA 3JUZA 5C0CB 4TYUA 3ARDD 5JNYB 3MUJA 3LQZA 1NC2A 2B0SH 3HZKA 5LGJA 5SWQB 5JXEC 3DVNB 5E8PA 1DBMH 2ED8A 1YUHB 2IQ9H 3RWCB 2EYSA 1MELA 5E7BA 3CNKA 3MR9B 3SGEI 1A7PL 1CLZL 3O2VH 5FK9B 3DV6A 3ZHLA 1OP3K 2OTPA 1WWBX 4K71C 2HLFC 2FHFA 2IBBA 3P3YA 1NBZA 3QUYC 4JFOA 3OXSB 4MJID 2AGJH 5F8RC 5B21A 4I3RL 2OL3A 2Z92A 2FHCA 2HT4C 3CFDA 4W70A 1PG7H 2NY2B 4KXZI 4MX7B 3VXQA 5D6DC 1H8NA 3EDKA 2YD3A 1E4XI 2DLFL 1AHWC 4M48H 1J05B 1X4ZA 2Y5TB 5DQDH 3QWOB 3Q2CA 4H0IA 5D1QA 4EXPX 2XG5A 2PTVA 1P5UA 2HYMA 1ND0A 3NGBC 4TQEL 3WFHB 4M02A 4QRQB 3Q5OA 3QRGH 2MSPA 3CVIL 3VFRB 1VSCA 5I75C 4PPTA 3X13A 5F96L 4HKBB 1JV5A 4EJ1C 3VMNA 5INDA 4DW2L 5D2LA 4F80A 4YFLF 4FMKA 2AV1A 4B0MM 4G6JL 4EBQL 5C8JA 2R1YA 5AD0A 3HCVB 5INCA 4NQDD 2X4TB 5L2KD 1R5WA 1DANU 3O9WB 3T2OA 4QRPB 2FRGP 2GJ6E 3L5WB 1S9KC 2EDKA 5JW4M 3Q3GA 4MZ3A 5DC9B 5CKGA 1D9KC 3IYLW 2ITCB 5MI0C 2XZAL 3GJFK 1S78D 5DMGC 1I1AA 5IHBA 5I1JH 1KULA 2VAAA 5KVGH 1MAML 2AEIT 4W6YB 3V5HA 5T5FH 5ANMA 4TVPD 3SJVD 2O5YH 4UU9B 5CGMA 5B39G 4JRXB 5D6CA 3DIFB 4M5ZL 5HYJA 5IB3B 4LPYA 4BSWA 1OHQA 2R2HB 1H3VA 2QHLA 1RFDL 5F1SA 3RY6C 1N64H 5K9KB 3DX6B 1H3GA 4QRTB 3T3PE 5CD3A 3PG2A 4M3KB 2G5BA 5DURD 1BQUA 4OLUH 2GT9A 5MENE 1YN7B 4U31A 2IH1A 5GSVB 1U42A 4MHHG 2ZUYA 3VXNA 4IRJA 1F13A 4JHWH 3IDJB 5L7XL 2VABB 1P9MA 2V9QA 3GRWH 5DUML 3MACH 4JM2F 1T3FB 1RK0A 4OSUL 3B5HA 2B1AH 1NGWB 4JG1L 2FYYA 4YO0B 1MREH 4NBZB 1P4LA 4H20H 1HXMB 1CGUA 3CU7A 5DHVH 4HS3A 3F12B 4KMTL 5D5MF 1SJVA 3GKZA 4OKDA 1KTKE 3MRCA 4IOIB 3RGHA 4OV6F 4ZTOL 4KRPD 1NCWL 1MFBL 1IGCH 2FB4L 3GM8A 1K4CB 4DZBB 5BVPL 4V1DB 3VFMB 3SDCA 3ARGD 5F9OL 4ZUSB 1HK6A 4KKNA 2QSCH 1EUUA 3GIVA 1ZE3C 2R2EA 1J1PL 1OF2A 2O5XH 4S2SB 5DJ2A 2P24B 4FFWC 3KPMA 1AQDA 3CVHL 5GGUB 2HG5B 1JZ7A 1UZ6F 1YEGH 4EI5A 3O6ML 4OD1H 4Y5XA 4HCRL 2NPLX 4NUJB 1RPQA 1TVHB 4W4OC 4YX2L 3P11H 3DUSB 3A6BH 4MAYA 4WDIB 2WW8A 4RISH 3WIHL 5DHVB 4HWBA 4MJ5B 5C0BA 2FR4A 1Q9WB 2OR8A 1A6WL 2X4NA 1EFXA 4Y4HC 4YDJA 3RVXD 4U1JA 5JLZA 3IDGB 3B9KB 1KLGA 4LHJB 5CINH 1L7TL 1T6WA 3HMXA 3MBEA 4RGND 5MEPB 4U1LB 1QO3A 2H26B 5E7FA 4MQXC 1UWGH 3PWNA 2P8MB 1MCWM 3V5DB 3VGGA 1LDPL 1JGLH 1WICA 4BUGA 5IVXB 4JRYD 4AIZA 4QYOA 5DO2D 3BI9X 2QHRH 2GTWB 1HH9A 5L0QC 4EOWH 4C58B 1NKRA 5AWNL 3R06B 4KVNH 4NYLA 4OLEA 5B38G 3OAUL 4JFHE 1CQKA 1Q9LB 5CEXA 1X5HA 2Z4QB 4AEIL 4KJQD 1NAMH 2R0KL 1RZGB 1PZ5B 1J8KA 5I15H 4WI5A 5I1GH 5E9DD 1OGAB 3UTPE 3G5YB 4PS4L 1M7DB 2YRPA 3T2QA 4PV9A 4YXLL 1PLGH 3ETBF 4XXDA 1KTDB 5D7LA 4MA7H 4HJ0C 4HQQH 5GGTA 4DVRH 1TLKA 2XKUA 4P4RA 1HI6B 3MV7B 3RPKA 1YMMD 4F9PA 5SX5K 1BD2A 1W0VA 3WE6A 3HPJA 4OI7A 4JN1L 4JO3L 1KACB 1QPXA 1U41A 5D7IF 2QR0B 4RFOH 1OPGH 3MOQA 2OSLA 3WUZA 4ODUA 4OCYL 5F8QC 4OT1L 4NJ9L 4Z8FH 1F11B 3UTTD 5CEZL 4OF8A 4YE4H 2WANA 3HUJA 4PD4J 1HXYB 2IADA 4KTEL 4PG9A 4N9GB 1R24B 5FIEA 4WFED 4LASH 2Y23A 5EZLB 4KROD 4RNRB 4WO4D 2BX5A 15C8L 4JVPA 4OIBA 3D9AH 5HD8D 3WFZA 2E9WA 3KS0J 1G0XA 1LILA 2MKWA 1CCZA 1QKZH 5DZNA 1NFKA 4YQXH 2VLJD 1NAMB 4FFZH 4P59L 4MJ2A 3VWJD 1V7MH 1V7NH 4QTHB 3B83A 5J9PA 1YY8A 2P5ED 5EBMB 1U8IB 2LAGB 1LHZA 3DUUA 2PTUA 1ZGLB 1FL5A 1PY4A 5IFHH 1OVZA 3QQ3A 4PRHD 4PJ9A 1CFNA 5DGRA 3SO3C 1A0QH 2V5TA 2H32H 3WSQH 3QZWA 4FQLL 3B2VL 3E3QE 3MJ7A 1BFSA 1CTNA 3MROB 4NM4L 4PJGF 4ELME 4P2OB 5F88B 5GZND 1DQQA 4ZXBA 4LLUA 1FG9C 1C5BH 1AJ7H 1OOAA 3P30L 4BH7A 5T1KA 1TNMA 2Z35A 4KRMB 1QLRA 3UTTB 5F7HA 2OJEA 3BFOA 2HT3D 3KLDA 5FECB 4XC1L 2ZCKH 1TZIB 1OTSC 1TITA 1LMKA 3UDWC 1BVKA 3JZ7A 2YD4A 4I0PC 4OZIE 3ARTA 4K3DH 4U1MB 1CVSC 3SDAC 3OX8A 4WGWB 4XCYA 1UB5B 3WHE0 4L9LB 3RX5A 2VSDA 4ODWB 3SE3C 2H32B 5IB4A 1T1XA 3C87A 5F21B 1YEDA 1LEGB 1RZ7L 3BP4B 2BHUA 4DKEH 4TTDD 4NWTL 4QRRE 5ISZD 1S7TB 4U2ZA 3T04D 4G7VL 5EIVA 5ADOL 1LO5A 2BFVL 1ED3A 5C08A 5HYIA 1WBXA 1SMAA 4ZUVA 1AY1L 3KPNA 3BZFB 4POUB 5CWSB 4WV1B 4GKZB 3P9LB 2FX7H 1I3UA 4XBGA 5FYJU 4XP5L 4NZDA 1VHPA 2VLKE 2YPLD 4QY8A 4NZUL 2R4RL 4M5YH 2I9TA 4N0UE 2F8OA 4XX1E 4Y16D 5GGQH 4KQ3H 5CMAA 2Q76B 2BY3A 4L5FH 1OWWA 1BFVL 1X9QA 3V4PH 3FMGL 5DMKB 2CJUH 3QDGD 5TFSH 1G7PB 4IOSD 5T3XD 5B3JE 2AJXL 3EDEA 4ZAKB 3TN0D 5FHBL 1X5IA 5T3XH 5DJ6B 3TA3C 4MNGA 1ZGLP 5EBLB 3GNML 1KYOJ 3QUKB 4X8JB 1FNEB 4DK6A 4IMLB 1DE4B 4OCRH 2MCG1 4HDIB 4MA3A 4NNYB 1ZLUH 4AL8H 3EOYG 1X5KA 1OB1B 4LCCB 3FO9B 4G6AD 4FQCL 1U36A 3HC0A 2ZUWA 4JY6B 1YC8A 3EOBA 1G9NL 5T1LB 2AQ3A 3HPLA 1NGPH 5CLWA 4LLDB 2HJFB 2CPCA 4KJPC 4XPAH 4UINH 2JJUA 4HJJL 3O41B 1XCTB 3O3AA 4EI6B 3L3IB 3ZHDA 3BO8A 5TE4H 4OJFH 1OGTB 1JNHB 1DBAL 4O02H 5E4EB 2DQGL 3B5GA 5K9JH 3S37X 1MI5D 2AKRB 2AEWA 3MGOB 4UV7H 3NIFE 2IMMA 3DHMA 1YNTB 5HHPB 5DRNB 1KELL 3H0TB 4YHML 4XGZA 1P53A 5GS0D 2Z91A 3TT3H 4H1LA 4OAWA 3O6FD 2E9IA 3RDTB 3VD7A 4ZYKA 4PTTA 4PJ5B 1NDGB 5C70A 1QFUL 4YXHH 4Q0XL 4QHKI 3RFZC 1ONQB 3U9PH 4OBRA 4Y19B 2GITB 3BW9B 4GUPA 1EJOL 4M6ML 2XTJB 3MUGA 4IJ3C 3MLPA 5E08H 2XI9A 4PJCF 5I1HL 1IC5L 3MJ9H 2EH7L 4JO4H 3U36A 4DK3A 2D7QA 2VLRE 3SGJA 3FB6B 2XKSA 5EWIH 1KB9J 2X1PA 4DWHA 3O2WH 5EOCJ 3MLRL 3T0DA 2IBZX 4OIIL 1DQDL 2YBRA 4U1NA 4J6RL 5CLTA 5DJZB 4TOYH 5DD5L 1KEGH 3JWDC 3S35X 1N5YL 4P2QE 1SY6L 1IC1A 2E7CA 3C60A 4IMKC 4OCNC 1JPFA 4TNVF 5MENA 4GQ9L 4PJ8D 5LJYH 4KI1A 1FYTD 4DGYH 3HNVH 1V8HA 3QUZC 1A5FL 4LARL 4XVJL 3PWPD 1D5MA 4XMKL 5D5MA 3I85A 3N9GL 2ATPB 4P46D 5KAQF 2XYCA 1ZHBB 5HYEA 2GAZA 4CKVX 3S6CA 4G42A 5AYUH 4F3FA 4JE4B 3CFBA 3PL6A 5CJ8A 5LGHL 1MFNA 3ULUL 1D5ZA 2VL5B 4DCQB 2IGFL 4Y1AE 1FO0A 3I3EA 1WV7T 3BPOB 5ACZB 1DUYB 1CDYA 4IRSC 1E28B 5BZDB 2PCPB 3VXUE 2ENSA 2ICEA 2RFXA 4OD2A 3TYGL 2VDOL 5HGAB 5IBLC 5C0JB 2XTLA 1EAPA 3IETA 4XHJD 2BHYA 4YPGB 1I9RH 1ORQA 4Y2DD 2D9QB 3X3GH 2VDNH 1EEQA 4Y4FA 5C6TH 1MRCL 4PRID 4L3EB 4EUPG 5B4MD 2ERJB 4KY1L 4PJ8B 5BS0B 1AXSB 5FYKH 3BXNA 1MCKA 1FC1A 4XNYL 3MGTA 1H0DA 2F53B 1J10A 1NBQA 4LHUG 5DRXA 4KKBD 1QLEL 1MEXH 1G7JA 4ALAH 1WEJL 2DQIL 3RJDA 3DRQB 5EIIA 5C0IB 5EZJA 2COQA 1ZGLM 1T66C 3DARA 4Q6IC 4WVRA 5LGKA 4XTRC 5A1AA 3PP3K 4I2XB 5IMMB 2OL3H 3FT3B 1X4XA 4EN3A 3GUTA 4KDVA 3WIIL 2AJZB 5BJTA 5EUOB 2V2XA 4OQTH 3KLAB 2FX8L 5CD5C 2OK0L 5D1QD 2V2TB 1TCRB 4RAHA 2BMKB 5M95B 4ODHH 1XCQB 2IFGA 5I8CA 2CIKB 5D1XC 5CKAA 5FO9B 3PE9A 3D2UB 3H9HB 3CFJA 5J3HC 3R0NA 3LQZB 1NC2B 1WZLA 5LGJB 4TUJA 5EN2A 3BGFC 5E8PB 4N5EC 5LWYL 4OLYL 4QHMA 2EIEA 1L6XA 5DA0B 3QFJD 1ZA6A 3DV6B 2JK5A 1MCIA 2APXA 4OZHF 3VFVA 3MJGX 3FO0L 4LAQL 4HPOH 5EORH 3MODH 4ODTH 4D9RE 4BFIB 5D7IA 4A6YL 2OL3B 1FFOA 3NIGF 5EOTB 3CFDB 4WTZG 2AEQH 1Q94A 2ZPKH 5FCSH 5BV7H 1CR9L 5EU6E 1I1AD 4FTVE 2DN7A 3EYQD 3VXQB 4AENA 1BJ8A 1N0XL 1H8OA 4JY5H 4NT6A 2NQCA 4QXGH 1JYXA 1CICC 1ND0B 3QDMD 1CS6A 5E6IA 3C09B 4PGEA 5JHDB 2I24N 2W60A 2HKHL 4NJAL 4FA8A 3X13B 2WBJA 3IFNH 2X4QA 1JV5B 4DKDC 1ZEAL 5INDB 5KVMC 1E6OH 5D2LB 4LEOA 4LGPB 2AV1B 5C8JB 5EOCH 2R1YB 1NUFA 3U0TA 3N1GC 4E42A 3RL2B 4B7IA 4M62H 4PGCA 2AABH 3EJYD 5L8JB 3NPSC 4IRJD 3SCMC 2ZCHH 5BV7B 2XNAA 3Q3GB 4U7MA 2DMKA 3HFML 1XGTA 3ARVA 1EAJA 1RUMH 3F7RA 4YHLH 3BKJL 3CLFL 3RI5K 3FQUA 2VAAB 2NTSP 3TFKC 1KBGL 4OB5L 4RDQF 5JDSA 3S37H 3C9NB 3NPZB 4X6DE 2XY1A 4GKSA 1QSED 3C6SB 5HJ3A 2Y6SD 1ZXQA 4XH2A 2FJHA 5J13B 1FNGA 5HYJB 4JM4L 3SDCD 4BSWB 4RMWA 3UROR 5E8EA 3ARBA 1KF9B 2JCCE 3MXVH 4PBXA 5CD3B 3PQYB 3MV11 4OZIA 2G5BB 4N8CH 3VXRD 3MV9B 3IVKB 3G6DL 1UC6A 1IZJA 3GSVA 3RVWD 2GT9B 2X4UA 4XCCL 4EI5D 1KJ3H 2IH1B 1XIWC 2IMNA 4JKPL 3WV0A 2E27L 3VXNB 4AEFA 2HT2D 2JCCF 4W4NA 4UAOB 2AI0L 4JGUA 4JFFE 2CRYA 4NHCH 2DB8A 3HZMA 4Y5VA 1RK0B 4XCNA 3BKMH 4G5ZL 2FYYB 1P4BL 3LDBC 1GYAA 2VWEE 1PKQE 3FB5B 2YA0A 3KPQA 2V9RA 4HWBH 3VDAA 3AS0A 5A43C 4P23C 4ZFOB 2YMXL 2JE8A 3BSZL 3HTLX 4LEXH 2C3WA 1OW0C 1HN1A 3WKNA 3MBED 1NJ9A 3K4AA 2LFGA 2VQ1B 1KEMH 1KNOB 1IAKB 2VLKA 1U95B 3HI6L 2MPAL 3HMXH 1IQDB 3E8UH 5D7JA 4YWGH 3ZDYF 4PLNC 3GIVB 2R2EB 2LAAA 1OF2B 2E9BA 3SQBA 3ZDZE 5DJ2B 3T0BA 1G6VK 1MCNA 3KPMB 1AQDB 2E6JA 5E5UB 1PZUB 1N59A 2PYEE 3VGBA 1NQBA 4Y5XB 1BQHA 2RAMA 2OJZL 3WNMA 1WWAX 3HI1A 3GK8L 1JI2A 4R8WH 3MXWL 4MAYB 3FZUC 4NKMA 4BUHA 5FYJE 1XF1A 5C07E 5C0BB 2FR4B 1IGMH 2X4NB 1EFXB 2VDPL 4U1JB 2NY2C 3WHXB 2B7DT 2FATL 3LKSA 1KLGB 4WWKA 1B0WA 4UDUB 1YQVL 3T1FA 1BD2D 2YRLA 3OJVC 4PR5B 4ZG1A 4N0FA 4M03A 1KCLA 4OFYD 2E7MA 5FUCC 1GGTA 4XNXL 5DVNA 4BKLA 2Q8AH 3PWNB 5HHMB 1J0ZA 4AIZB 3BT2H 1HHIA 3RIAK 5CHNB 3UBXB 1LO4L 1MCWW 3QA3A 4M1DL 5BCAA 1S9VA 3EBAA 1BX2A 4R26L 4ZOEA 4WEUD 4F7TA 4X99A 3O8XA 1FNFA 3WFEH 3QB7C 4JZNB 2BNRE 1F3DH 5CEXB 2UWEF 1J5OL 5DUPL 1FN4B 3JWOL 3O9WC 2R0ZH 3PNWA 1F3JB 3OB0K 4NC2B 3ALWA 4PV9B 2VQTA 3AUVA 2C7UB 4XXDB 3NACH 5D7LB 3FQRA 2BSTB 3P77A 4I0CC 1R3IH 1TDQA 4L3CA 1E4KC 1YC7A 3HPJB 4QGYA 4HBCL 2VLRA 3O2DA 3NN8A 3IF1A 1QTYT 3QI9B 4ODUB 3MUHL 2YN3A 1TTGA 4JFZL 1RURL 1KCSL 3KPPA 4PB9H 3HUJB 3D39B 1BFOA 2IADB 4YHNA 1P6FA 1OAQH 1KOAA 3OXRA 1CFVL 1JHTA 3IJSB 4P2QA 4J12A 2XA8H 3QO1B 4PLKD 3VW3L 4FZEL 4GG8A 2PW1A 3PGFL 3UJTL 4S1SL 1A4KB 1UWEH 3KYKH 2DQEH 4CN6A 5D70L 4AT6A 5F9WB 4ZUTB 4NKOA 3AREA 3B4NA 5F3BB 2J4WH 4HBQA 5B3NA 3QQ3B 4JPVH 4PJ9B 3WN5C 3ZTNL 1OWRM 1CFNB 4UB0H 1S78C 1RUQL 4QCIB 2YK1H 5L2JB 1FAKT 2CRZA 4IRZH 4OM0L 1CK0H 2VKWA 4KWUA 1PAMA 5C08D 4GXVH 2JTDA 3Q0HA 4PJ7E 4ZXBB 5I8OL 4Y1AA 2BZDA 5IQ7H 2X9XA 4LLUB 5DC0A 3GHEH 2R29H 4FZ8H 1PGRB 3MLWL 1AR2A 3VXUA 5ADPL 1QYGH 2FLRT 5T1KB 5K9OB 2Z35B 3OSKA 2F54D 2N4IA 3S8WA 3WDJA 2IJ0C 4I3SH 4AMKL 4PJ7F 3EFDH 1F4WH 4XCFL 2HRPL 4L8SA 4ODSH 4DEPB 2F5AL 3B9DA 3KDMA 4HC1A 4HF5H 4FQ2H 3KPSA 4J3WA 3ZKXB 1J11A 1AFVL 5ITFB 3G5ZA 1FNSL 4RGMB 3ZYIA 1QRNE 4E9LA 1L6ZA 5A16A 3VFGL 5IB4B 1T1XB 4P3CL 1YEDB 4M6AA 4I13B 1AH1A 1PQZA 3F7PC 2VDRL 1I7RB 5I0DA 3DPBA 1JUFA 1WBXB 4K3EL 3IU4L 3B9KC 3U4BH 4Z7VF 3HN3A 4HS8H 3KPNB 1IE5A 5DJ8B 5IVZB 5TE6H 2R56H 4Q2ZA 3AAZB 2A9MH 4XBGB 4ZD3H 2WINA 1P7HL 6CGTA 4HXAH 5KSAA 2DD8L 4QY8B 1T2QH 1QSVA 2E8ZA 3JXAA 1VFOA 3NA4A 4RFEA 1H5BA 4EVNA 1CYGA 3TJEH 1FORL 5CMAB 5I1DB 1I85C 5E8DL 4JO2L 4MJ6B 4R90H 4G6MH 3PXHA 4HZLB 3VA6A 1FYHB 2XZZA 1KV3A 4LDLB 4N0YL 5F7DB 1L4IA 2P5WB 2GJ6D 3I75B 2DQJL 3VI4E 3HHRB 4WFHD 3RVXC 5FUOH 4MNGB 2PTTA 3G08A 2ZZUT 4H1LH 5EU6A 4RMTA 4FTVA 3NCYS 4HUUA 4MA3B 4YDIL 3BPLB 1X6LA 2NXZB 3CC5A 4JQXA 2HH0H 1S5IL 1QP1A 5BVJA 3HC0B 3FTGA 3MA9H 3EOBB 5E2VL 4TSBH 3GIZH 3WNLA 3L3JA 1U8OB 4JFQA 5EOQL 4U6YA 1H3PH 4WENB 2ZJSH 3UJJH 2W9EH 1KN2H 3O3AB 4HW6A 3STLA 4WCYH 1NCBH 3BO8B 4IHOA 4Q9RH 1KB5A 3OF6D 4X6CE 4LU5H 1MQKH 2X4OA 3C60D 3LEYH 3DMMA 3ABZA 4X9IA 3D0VA 4J3TA 5L88L 3QT2A 4XGZB 4H1LB 1DJSA 4OAWB 3REVA 1HHHB 1PW3A 2AK1L 2NY5L 3I02A 4FQIH 3QJHA 4XP9H 5FHAH 3PGCA 1HWGB 2VJXA 5C2BL 2ITDA 2N1KA 3W9DA 2OLDA 4PRPE 3QP3A 1UWXH 3PL6D 2NR6D 1YDPA 1Q9OB 4GUPB 3UZVB 4P2OC 3CFKB 3MUGB 5EIQA 3CPLA 4KHTH 3VFPA 4M9OA 4KI5F 1ZVSA 1UXWB 4KK8C 2P1YA 1GPOH 2KL6A 4AH2A 3LKNB 4HS6B 5BRZE 5MERA 5C7XL 1ZT4A 1MCPH 1FO0H 1H9VA 5IW6A 3M1BA 4KUCF 3UBXI 3CXDH 2YBRB 4RIRA 5GXBB 2J8OA 1IEAB 4AEHL 3QEQD 3O4OB 4RGOL 2JCCA 4TNWK 1NBVH 1YEIH 3UPAA 1CFSB 5ALCL 3MLSH 1WSST 1A7NH 3VWJC 4JM2B 1KCVH 1JPFB 5MENB 1P4IH 4KJYA 1OCWH 2IBZY 4XB7A 5J1AA 5FYLL 5I1LA 4L9LC 4YHKL 1C7SA 5IROA 5CEZE 2Z8SA 2YSSB 5D5MB 1JGVH 4JFFA 4EDXB 3W81A 3QNZA 1RQ5A 2NY1D 2BVPA 1EBAA 2QSTA 2GAZB 4JFDE 4G42B 4F3FB 4NFDA 3SBWC 3CFBB 5I1EL 2JIXB 1ZWIA 2W1NA 4FHBD 4KJWD 4XWGH 3H3KA 2A0LC 1D5ZB 1J1XH 1FO0B 1OTTD 4WV1C 4TUOA 1YYLH 2XICA 4O2EA 1LO3H 5F7MC 2FHBA 2IALB 4LKCB 2RFXB 4OD2B 3UO1L 3NMEA 5F1OB 3VG0H 4JEGB 1EAPB 1JF6A 1CBVL 1ORQB 3FOMA 3IDMA 1WIUA 3TVMA 4Y4FB 2W07A 3BDXA 3S34L 1P5VA 1UM4L 2XN9E 1HINL 1QSFA 4N1CA 4NO5B 4DGIH 3BXNB 3QDJD 2B39A 5DD1H 3MGTB 2BVOA 5MP6H 3H7BA 5DRXB 3RTQB 3K8MA 4P2RB 5EA0H 4HX1A 4ZAKC 3DROA 1N7ML 3UTPD 4YDLB 4TTDC 4PJEF 2YUXA 2PR4L 5EIIB 5C07A 3GKWH 3PWLA 3JTSB 5BMFL 1C8PA 2VXTL 4YPJA 3QXAA 4K55A 5ICZB 4ONHB 2JB5H 3MV8E 2CKNA 4XWOD 5IHZA 5JZ7D 4YZFF 3K7UA 5D8JL 5C86A 2VDQH 2W9LA 2A77H 3G9AB 1A3QA 3GBLA 5AUMA 4EN3B 1I75A 3GUTB 3MLTA 3QDHA 4LCCC 5BJTB 1O0VA 2V2XB 4QGTA 5EBGA 4HV8A 4PJIF 5CILH 1IEBA 2ADIA 4K94H 4M9PA 1FDLH 3RRQA 4X0KB 2UWEA 1DFBL 1JPSL 5E6ID 1BJMA 4GAJL 4UV4H 1S3KH 3FFCA 1NC4A 2I07A 3CFJB 1AC0A 1A47A 4ZSOE 4TUJB 5EN2B 3CFCH 2CSPA 3B9VA 5E4EC 2DTSA 2PUQT 1ZA6B 2JK5B 2A83A 3BEVA 4R6UA 5DEGA 2R2CA 1XGUA 1RUAL 1OARH 4U6XB 1J87A 3VFVB 4WW2F 2D7OA 1WAAE 4I3GA 4M7KH 2OMNA 5D7IB 2EC9T 4Q9QL 4HAGA 3ULVF 3R1GL 1Q94B 2I9LA 4X6FA 3ME0A 4CU6A 1Z0MA 1JZ4A 4HFWA 1T1YA 1WAAF 1X6NA 2DI9A 2XTJC 7FABL 3L5HA 1NAKL 4LLYA 5JXEA 2Y1VA 5JUEH 1U6AL 1LP9E 5IW3A 3STBA 3FKUS 3QIUD 3HNSH 2ZSWB 4C4KO 3IGAA 5C6WH 5E6IB 3I6KA 5LBSH 1HIML 1S7WA 4D9LL 3R4DA 4PGEB 1N8ZA 2CDEB 4DKAA 4HK3N 5DGQA 2WBJB 5C2UB 4X7FC 5T1MA 5CAYB 2ICES 1S9WA 4LEOB 4LP5A 1UJ3A 1JGDB 1DQTA 2F74A 2ZCLL 5T1DH 3U0TB 1ADQH 2MQ3A 1GGIL 4PJGB 3SOBH 1X5GA 4PGCB 5DVLA 1RMFH 1FZKA 4YBQD 2XNAB 4AM0A 2HTLD 2RJMA 4N8VA 5DI8B 2R0WL 3W9EB 1XGTB 5HGBA 3N1QC 2BRQA 4QRRD 1UVQB 3C2AL 3VXOA 2CLVB 4HIJA 5DLMH 2Y25A 4PJ7A 2GK0B 1O5DT 2DS4A 3DI3B 5JDSB 5MEOA 4XPTH 4YFLI 4TULL 4GKSB 1HQ4A 4L4TD 1KJMA 1WF5A 5GRJL 4XPGH 4XH2B 2FJHB 5B38A 4Z6AT 1O7SA 1FNGB 1UM6H 2VLKD 4GSDL 1GHFH 4CU7A 5BQ7A 1JIBA 2DQHL 4ODXA 4UBDD 5E8EB 4LSVL 3ARBB 5JOFA 4JPKL 2J8UF 3OJDA 4P5TA 2RGSA 4NP4L 4OZIB 3RI5F 43CAB 3BAEL 2ERJC 4PJ8C 4P9HL 4OCXL 2X4UB 3VWKD 5EB9A 4HWZA 4U1KB 1QRNA 2AJ3A 5MHSE 4BK5A 1YQ2A 3GMRB 3PWVA 4OCLC 12E8L 4HXBH 4P46C 3QSKB 4NM8L 1DBBH 3KWWA 1HQRA 3U7YL 2YZ1A 3QPXH 4ETYA 2RBLA 4XPHL 4FXGB 4Q58C 3OKMA 3MRIA 3RHWF 1R3JA 3VH8B 1NSNL 1CLYL 2XZCL 2WUCH 4WWKD 5BOPA 3FRPG 1FV1A 4JFEE 3LKRB 3X11A 2DICA 3C6LD 4LPTA 2HTKD 2B2XH 4EDWL 2AVGA 1IM3A 1Q0YH 1KENH 3M8OL 1NJ9B 4XHJC 5TDNB 4JQVA 1RD6A 4OCWH 4OZGF 3EYVA 5D7JB 1AGEB 2IPTL 1MCJA 4J3VA 4P4KB 4Z95L 2FBJH 1JYVA 3SKJH 1UXSA 4NNXA 4ODVH 3UZQA 4DUWA 1R3LA 3VFUA 1YNKH 2VDNL 1FH5H 2FECI 2YD5A 2V2WA 4HULB 5FCUL 5HVHB 3WFBH 5EO0A 1WK0A 1J0YA 2CRMA 3ULUF 3HI1B 1YEFL 2DKSA 1HNFA 5F9DC 1AR1C 2VE6B 4XP6H 5CZVH 4EEEA 1XF5B 5HI5D 5IESH 4NKMB 4P2CG 1MFCL 3CVHA 1KLUA 4GKOA 1PD6A 1C7TA 5IMKA 3CX5K 1HE7A 1WGOA 4J8RA 2OMBA 3PP4L 2EH8H 3V4UL 1ZA3A 4FXKA 3T1FB 2OQJA 4N0FB 2A9NH 1BM3H 3ZE0E 2HWZL 2VLRD 1WWWX 3WIHA 1HYSD 2PN5A 1U8NA 1RZ8A 3O2DH 5EPMA 5IB1A 1BVLA 4IIQA 2GFBB 4X83A 1HHIB 3BKYH 3QA3B 1NFDF 1MCDA 1S9VB 3WKMH 1BX2B 3GMQB 4P2QD 4PGDA 4F7TB 4WNQA 4X99B 2NX5D 3O8XB 1MCRA 3L5JA 3MBXH 4GAGL 2H2PC 1QD0A 4YHOH 1W8OA 3PNWB 2ADFL 4YC2B 2BC4A 2R0LH 5BV7C 1Y18A 1OLZA 1F8TH 1FZOA 3FQRB 4YLQT 1QFWH 1U3HD 3RIAF 4PRPA 4YUEH 3SHSA 3IJYA 1RZFL 1MRFH 1UENA 5FUZL 1NL0H 3PABB 4M4RA 5I1IH 3GSQB 2VLRB 4Y1AD 3NN8B 1VCAA 3IF1B 3WYRA 1IGJB 2J6EL 5BRZA 1CLOL 2WK2A 3VXUD 4G6KH 4Z7NE 3KPPB 2QJDA 5J13C 3EO0A 5A2LH 1BFOB 1S7UB 4YHNB 3VI3E 1B4RA 5E95B 5IV2B 1RJYA 3OXRB 1RJCA 2UYLA 4BQ8A 4Z76A 1BOYA 5E2UL 5FA3A 5FA4A 4OUUA 1SJEB 4FQJH 3WD5H 3BE1H 1D5IL 4XAKE 5SV4A 4GG8B 2PW1B 5HVWA 1I8KA 4Y4KD 3ZE1E 4FFYH 2X9WA 1HDMB 2BHZA 4HC1H 3VI3F 3EJYC 1FLRL 4LSRH 3AREB 5SWZA 5DWUH 5TE7H 1MFAH 3UXFA 3DOSA 2B4CH 4XVTH 5GIRA 4UAOC 3SDDB 3D48R 3RVVD 5H37H 4JFDA 4LCYA 4RMRA 2A74A 3LV3A 4ZTPL 3HC4L 5FV2A 3T65B 1V05A 3P0YL 1K8IA 4OM1L 5IGXL 2BOBA 4C56E 1DLFH 3L5XH 3LOWA 5IHUL 3LQMA 3VXTA 4P0DA 1JHLL 3MLUH 4M3JA 2Y6SC 1EEYA 1KPUA 1S9YA 5DK0A 1F90H 2VITA 3HKFA 1INEL 4O58H 4LRNH 3QDAA 2CRIA 2EDTA 2XXMB 2FCBA 4ZFOL 1MJUH 5DRWB 1T03L 3BDBA 3IFLH 5DJAA 5C3TA 4G8EA 1QA9A 2XN9A 4OLZL 3KPSB 1JNJA 1INQA 4H8WL 5KSVB 2XWTA 3OR6A 4K7PL 3B8YA 1FVCB 2EDJA 2VC2H 4M8QA 4Y5XC 3ZT5A 2HT2C 3TBTA 4YHIA 1KJ3L 1S7VA 1VEMA 4MD5B 3RVUC 4J2XA 3GBNL 2NXYB 4D9RD 1PQZB 4MAYC 4U6TA 8FABA 4BSJA 2F5BH 2E6PA 3PWJA 3FB7A 4H88L 1QQDA 2LABA 2G75A 4JQIH 5EU6D 2YS4A 4CMMB 1HHJB 1P84J 3ARYA 4WHYH 1U8KA 3RIFK 4Q2ZB 4HG4K 3S35L 1F00I 4NFBA 1IGFL 2WINB 4S1DD 1UFUA 1A7OL 3QUXA 5D72H 3BVNA 5SWSB 2V17L 2Y06L 3GB7A 3OKLA 5KSAB 4APQA 1GC1H 3OAYK 2DQTL 5TPWL 2QQLL 2R2BB 3EO9L 1H5BB 4RFEB 5I9QB 1U58A 4ZSOA 5IBTL 1JPTH 4WW2A 1UM5L 4EVNB 5IWLA 1V3KA 1X5XA 3U1SL 5IEHA 1JP5A 2LTQC 1VGKA 3QCVH 4CJ1A 4S0SD 4WY7H 3MRHB 2GUOA 3GI8L 3LY6A 1SHMA 1RJZA 1KB5H 4CADA 4GRMB 3DMMD 2EIDA 4MDJA 4I77H 2VR5A 1WAAA 3IDIA 2APWA 5LKNA 4X7TA 5C0AE 3VGHA 1EV2E 3ZKQD 2D4DA 4XP4L 3VFWB 4FTVB 4F9PC 1C16A 4KKAD 1NCUA 1B9ZA 4HUUB 5C0CE 1MVFA 1NCAL 2ZKHL 3S3JA 1SJHA 3CC5B 3LEVH 4GG6F 1LP9A 5BVJB 1M1SA 1X5ZA 4YIQA 1MJJA 3FTGB 4LIQE 3QI9C 3DYMA 2PO6B 3MFFA 4FQHA 4M1CC 2ENYA 3L3JB 1TJHL 4JFQB 4U6YB 1PKOA 4UT9L 3V8CA 1WLHA 1A9EB 3STLB 1OSPL 2NMSA 3D0LB 5FOBB 4IHOB 4PG2A 2FD6H 2RHEA 3BT2L 1KB5B 4LGRB 4U3XA 1I8IA 4L1HA 3MCLL 1LK3L 2V7NA 1R3HA 1RU9L 4OF3A 1NLBL 3ZE2F 4U33A 2YKLL 3INUL 5JHLL 4FQXD 2C26A 3D0VB 4NKDB 5F9WC 4LLVA 2O26U 3KR3L 5CZXC 5GZOC 4WTXA 4PJ9C 4JFFD 1TZGH 5C0FA 3REVB 5J7CC 5FUCE 3B9AA 3I02B 4HIXH 3QJHB 1FL3A 3IDXL 3KJ6L 3PGCB 1CG9B 4M6NH 3DXAE 2ITDB 3W9DB 1S9XA 4N1EA 3HZYB 2C1PA 1CTOA 1F58L 5F6IB 1YDPB 4ZXBC 3VFPB 2ID5A 2EC9U 1ZVSB 2DTMH 4YNYA 3TBWA 5JQ6L 4ENEC 1KCKA 5MERB 3M1BB 4ZS7H 3SGDH 3U2SA 4XNUH 4PRBA 4RIRB 1G9ML 3MRDB 3MOAL 2JCCB 4DEPC 4RFNB 1OAZH 1SM3L 3TVMD 3CH8A 3U7WH 5B8CA 5I30L 3IXTB 5CJQL 3ZKXC 3L1OL 1Z3GH 4ZFFA 4KJYB 3S96A 4GRLA 3DX9A 5HVFB 2PYED 4RZCA 1C12A 4GW4B 4RGMC 5I1LB 1OAXL 4FOMA 5DZOA 2QQKH 4NN5B 3BZDA 4JFFB 4K23L 2EYRA 4UTBL 3O3EA 3QNZB 1U8MA 2WSKA 4S11A 1AO7A 1SY6A 2BVPB 2DBJA 3QWRA 2IH3A 4JRXE 4PUBH 5FYJD 1IGTA 2FX9H 4HSQA 4CDHA 3KJ4B 4MDIA 3EOTL 2ATKA 4TNWF 1ZWIB 1YEHH 2EDOA 5FYJH 1NGQH 1DCLA 1FVEA 1W2KT 1XR8B 2FIKA 2VDML 2YUVA 1UADC 3EHBD 4JFEA 1FGVH 2BVTA 1V5JA 1EPFA 4TUOB 1QG3A 4GRWE 4ISVA 5EULV 5J1SC 3KYNA 1JGUL 4PREA 1RZKH 3B5TA 5GRVL 2R9HD 4MD4A 3P4MB 3UYPA 4OV5B 3HE7D 3FOMB 4MD0A 4B41A 4HH9A 1IKFL 1NC4D 2DI7A 3TO4A 3S4SA 3ARZA 5CJBA 1QSFB 1NMAH 3MRLB 3QQ4A 2H1PH 4MWFB 2BNRD 4HUXA 1QFWI 4NZTL 2BVOB 1TMCB 3BIKA 1IBGH 4XMLL 4G9FE 2CQVA 3DROB 3ES6A 5ETUA 5IW1A 3SN6N 3EJJX 4MNHA 4UTAL 3LB6D 5C07B 4GFTB 4NQCA 3PWLB 5CSGA 1NUDA 1QFWM 2NY7L 3FT2A 3REWA 5KVDL 3B3IB 5IHZB 2R4SL 1SYVA 4K8RL 1LO0L 3BESR 3Q48A 4J7RA 2C4XA 1H3TA 2DBLL 5AUMB 4L4VD 3BPLC 1HOCA 3S36L 2NXZC 3MLTB 1A7PH 1CLZH 4X5XA 3QXDA 5JXED 4HV8B 4M7ZB 2AJSL 1C1EL 4LBEA 4ZPVB 3TBYB 2UV3A 1R5IA 1IEBB 2F8XC 5CBAB 1LQSR 2UWEB 4H5SA 1T1WA 4I3RH 2HLFD 1JWSA 4XHQA 3FFCB 4TVSa 5F44A 2I07B 3TT1L 5IG7A 1NEUA 3TBSB 5H2BA 4Q6IA 2DLFH 4Z7OE 2DI8A 5DJDA 3BEVB 3G04B 1XGUB 3FCTA 1B90A 3U46B 1XZ0A 4H26A 4TQEH 3LMJL 3CVIH 1SMOA 4LOUC 4DGVL 5JORA 5ESQB 5I0ZA 5FO8A 3DRTA 2PKDA 4X6FB 5DTFA 2YZ8A 5F96H 4G6FB 5IVXE 4HFWB 1T1YB 1WCQA 3T0XA 3NZHL 4LLWA 3T4YB 4DW2H 1G9EA 4G6JH 4LLYB 4EBQH 5F9JB 1SEBA 2FL5A 2CLRA 5EUKB 3SGJC 4A6YA 2X2YA 5MEQA 1Z9SA 1A7BA 3LS4L 1MSPA 4NKQB 1I1RA 5L9DL 1S7WB 5JR1L 1KG0A 1QBAA 5HYQB 2XZAH 2FH6A 3O4OC 5T3ZD 2A6IA 5T1MB 5HPMB 2DYPD 4RWYL 3JBG7 1S9WB 1JNLL 1D9KD 1UJ3B 4JM2C 4DAGL 1MAMH 5IF0A 1FZJA 2F74B 1VENA 3FONA 4PRNA 5DMGD 5JA8B 3MV7E 4N0CC 2R23B 1SYSA 1Z9OA 1QRND 1E6JL 3HZVA 3BPCA 4O5LL 2P44B 5FGSA 1CICA 4RA3A 4AM0B 4N8VB 3OJ2C 5FO7B 4M5ZH 3WS6A 4YHPB 4JFYA 5HGBB 3V6BR 5D7SL 1RFDH 5ID0A 3VFSA 2KPNA 2DLTA 2NR6C 3PL6C 2FNBA 4HIJB 4C56A 4PJ7B 1OP9A 1FLTX 4LF3A 5DQ9A 4NZJA 5KS9F 5J6GB 3U4EA 1KJMB 4QXTB 1Y0LA 3AXLA 4BH8B 3OQ3B 3VFTB 5L7XH 1UH4A 3L3HB 4NUGL 5BQ7B 3ECBA 5DUMH 3D69B 3ESUF 4OSUH 3DO7B 2ESVE 4Y4FC 4JG1H 3RAJL 5IKCA 5JOFB 2AJVL 3OJDB 4P5TB 4L3AA 4TTGA 2ICCA 1YN6B 4KMTH 4X4YB 3RZCB 3CFIC 3MNZA 4HWZB 3MRKA 5EZOL 4ZTOH 1NCWH 2OTWA 5HDLA 1MFBH 3PWVB 2FB4H 5BVPH 2EIBA 4WUUE 4YDLC 1HQRB 5I66A 3H7LA 5F9OH 4WHCA 4M61B 1BBJA 1JZ3A 4MQSB 2UVFA 2APFA 4JKWA 3PDOA 4UOW0 1J1PH 3MRIB 1U8PB 5FYLE 1P7QA 3CVHH 2D03L 4EN3C 1FV1B 4B5EA 1M6OA 3X11B 4F58L 2NY0B 3O6MH 4TVPL 4KV5E 3VRLF 4P57A 1AGFB 4HCRH 4FFWD 3CXHJ 3BX7C 3FQXB 1E0OB 4YX2H 1SEQL 1RJLB 2D2OA 1FJ1A 1MLBA 2P8PB 3TF7C 2EEDA 1JVKA 2WQRA 3F5WB 3EYVB 3WIHH 3N06B 4C59B 4X9GA 3DX7A 1A6WH 32C2A 4MB3A 1B3JA 1PEZA 3VU2A 1UXSB 4NNXB 2H3NA 3TBVA 5ID1A 3EDDA 1QHPA 2W65A 1CDJA 2V2WB 4Y4HD 1L7TH 1XGYL 2OS7A 1J12A 5IOPB 4H1LG 5C6PB 1DL7L 4JZOB 3TZVA 2N7AA 2HJLA 1TQCC 4GG6A 5C0AA 3NFNB 4PJDE 3CGTA 1LDPH 5HHOA 5K33A 1NBYA 1HHGB 4G8GD 3CVHB 4MQXD 5JZ7C 1R6VA 5C0CA 4PRPD 2CXKA 5AWNH 3SGDI 3OKYA 1ZA3B 4FXKB 5FOJA 2GW5A 3DVNA 3OAUH 2OQJB 3Q6FB 4K94C 3RWCA 5F1NB 4BA8A 3MR9A 4AEIH 3G6JF 4U0RC 2R0KH 3CMOL 5BRZD 2E7LA 1U8NB 1RZ8B 3T0AA 4YHZL 4NBYB 5E6IC 4PS4H 4WHDA 2VB5A 5IB1B 1BVLB 4YXLH 3W5MA 4IIQB 4HUNB 4MQ7A 4BFEA 3OXSA 2WBJC 3FAWA 4WNQB 2NY3B 3HI5L