3RKDD

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYSPALKSRLTISKDTSSSQLFLKIASVDTADTATYYCARIKSVITTGDYALDYWGQGTSVAVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the neutralization and genotype specificity of hepatitis E virus
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immune system
molecule keywords Capsid protein
total genus 47
structure length 218
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rkdD01
3N1GC 2P5EB 3TJHD 3KHQA 1FPTH 2BXZA 3RUGB 2HVJA 5D8JL 2Y1VA 4ODSL 2V5RA 4XTRC 1EH9A 4M1DL 2VABA 5E8OA 1CFQB 2APVA 4PP1D 4NO0A 4YO0B 5D2NC 1MY7A 3GGWB 3QG7H 4X4ME 3QI9B 3PHQB 4U6VL 1FFPB 1S7UA 5IFAH 4PRPB 1PY9A 4O2FA 1GYAA 4LSTH 1I8IA 5DD0L 1FZJB 5EIIB 3DO7A 5DMJB 4MA3A 3GBNL 3WNOA 3P73A 4OZIF 2FR4B 1E6OH 4CDHA 5DGRA 1M71A 5D2LA 1WEJH 3TH2T 4YE4L 3VW3H 1D9KB 1IKNA 4NJAL 2I9TA 2DKUA 1ZK9A 3O11A 2ADFH 4PJGE 1JGDA 1WEJL 4DCQA 4R7NA 3TNNA 4O02L 4QLRA 3IFNL 3VFRB 3VXQA 4KJYA 3QQ4A 4KKNA 5IMMB 1UZ8A 5KJRH 3N06B 4HFWB 3RPIA 3NCJH 4LLMA 4Z7UE 3WIIL 5DURB 5I17B 3MODH 3WKML 1AHWA 2VXUH 3OJVC 4F9LA 3H9SE 2K7QA 3QG6B 4WFHD 1CT8A 2X4SA 3EFDL 2OXHA 2X09A 5DVOA 3ULUF 3TP4A 3N0PB 4P23A 4MDJA 4PG9B 2DQJL 5LVEA 4OCWL 1OSPL 4X8JA 3FOLA 4ETYA 4O2CB 3WV0A 2F5BH 1M7IB 4PR5A 1HCFX 3O2DL 1JWMA 5DC4B 3MREA 3CX5K 3JSSA 5E24E 4LASH 3U4BH 5DJ6B 4ZXBC 2PF6A 1KN4L 2XQYK 4YFLF 1IAIH 1UXSB 5KOMC 2ZKHL 5EU3A 4XVUC 3H9HB 1JRHL 1IM9B 1HWHB 3K4ZA 4EXKA 1FQ9C 3S88L 1S9YA 5FYJD 1MIML 4LHUB 1SJHB 4CN4A 5CEXA 4HG4J 1JV5B 5J1SC 2AJ3A 4G5ZL 4P4KA 5ADPL 2R0KH 1IKFH 4JKLA 4N0UE 4JFOA 3A6BL 4ZUVB 3UTPE 2WNGA 4PLKD 1BECA 1XZ0B 3UAJC 3SE9L 1R3JA 4IRJC 4CVZB 3MOAH 5C0NC 2CDFB 1I9RL 3VD7A 2QSCH 3BH9A 4HWUA 4MAUL 4JRYD 1E4XI 3ARBB 4ZTOH 1F3JB 1KTKE 2J8UF 3LMJH 1RK1B 3MBEC 3CCHB 4X4YA 4FFYH 3R06A 1FVDB 2EYTB 4XP5L 3G9VA 3EYUL 5AAWA 3AROA 2QR0A 2R69H 1TJGL 2XQBH 3NGBC 5DA4A 3FN0L 2ENYA 1PLGH 4K7PL 2FJGB 1OP3H 2HLFD 3LV3B 5FGRA 3DUSB 1QR1B 2YPVL 3QEQA 2X1XR 4ZPTA 4A6YA 4MVBD 2Z91B 1EBPA 4XCYA 1G1YA 4R6UA 4U7KA 3SO3C 2Y06L 4W81A 4K8RL 3BVNB 3ZTJG 3IF1B 4RDQG 3FTGA 3O0RL 4XMKL 4HAFA 3ARFB 3KJ6H 4AL8L 3E8UH 2FX9L 1P84K 1L0XA 1UVQA 4MJ5B 4JRYE 5I1DB 4YDVB 5FYJU 3L3HB 4OLYL 1CCZA 5ITFB 3LH2L 3TBYB 3KYOA 4N9GB 5KZCB 1CICC 3OKOB 2A83A 4OKDA 3RWIB 1KPUA 3D3VD 4OFPA 1MFAH 1YY8B 4QRTA 3OGCA 1JZ4A 1HXYB 4PGBA 4TSAL 3QXDA 4Y5VB 3WS3B 1G9ML 3AREA 4WWKB 4NYLA 2B8OT 2FJFA 4GKNB 3QUYB 5D2NE 2Y36L 3ALXA 4ZO8A 1ND0A 1FCGA 4QO1A 3V7MA 2AAVA 5DHYA 3C5SA 3QIUA 1CU4L 4WFED 5EZIL 5ITBL 1S7SA 4JDZB 4LBEA 5E1HB 1IFHH 1U93A 3G04B 4GQ9H 1U8LA 4GW5B 4KQ4H 5J6HA 1RURL 1FP5A 2CGRH 1PY4A 1Q9WA 1RZJL 1II4E 1DBML 2A77H 1NFIB 1KIRA 3MV9B 1C5DB 2RHEA 3NN8A 1WTGT 3KLAA 3MJGX 3ET9F 1INQA 1J1PL 2VR4A 3TBSB 1A6WL 3SGEH 2MFNA 4Q9RH 3JXAA 2UUDH 1NFIA 4QHNA 5INDA 3FAWA 5CS7A 2FCBA 1T22A 1YMHA 1CFSB 3MV7A 3H9ZA 1XF3B 4QHLA 1AQDA 4PTUB 4BH8B 3QYCA 1GZPA 4CVXA 3O2WH 5I75C 5DRWB 3BSZL 3IDJA 4WENB 3QRGL 5HJ3A 4FABL 5I19L 1D5MA 4G6MH 3MRLB 2PTUA 4IRJD 5BW7C 4Z7QF 5I1LB 4M7ZC 5C8JB 1A3RL 4PRID 1VFOA 5F7UA 2IJ0C 4ZAKC 4OT1L 3JTTB 1G7PB 4NT6A 4PRHE 2C4FT 4Q97A 1FGNH 3KVQA 3SJVB 3J7HA 4WW2A 4YWGH 3D39D 2GSIA 3E3QE 5GRXG 2PETA 4GSDH 2XZAH 1U8NB 2QSCL 1YPZF 3C09C 1QFPA 5F6IB 2FO4B 4KI5D 1F00I 5KAQG 5M95B 4LARL 4KKCD 2ARWA 1C5BH 3EO0B 1QLFA 2CR3A 1QFUH 3CFDA 4ZFFA 4L3CB 3H0TA 4OFKA 3VG9C 4X9HA 3DX8B 2ADIB 3QO0B 5TQ2H 5IB1A 4APQB 4WFHE 2BOBB 2E8YA 3CZJA 2ZNWA 4NO2B 5EO0B 1IGJA 4R3SA 1OAQL 2EDXA 3EOBA 2UWEB 2IG2L 3SKMB 1AGCB 2DBLL 3ARTA 1MWAB 4D9RD 4GQ9L 2YD2A 4N8PA 3QDJD 1IAIL 4Z78A 4NKOA 2Z8WC 2AP2A 4E41A 5I1AA 1SYVA 3WMSA 2XI9A 5J56B 4JKKA 3S35H 4OIIL 3UPCA 2VNCA 3TBWB 2JIXB 1UZ8B 2F54E 4JFXA 5I1KH 4ZD3H 1I7ZB 1H3VA 3QEGL 2EIZB 1E27A 4O58L 4LFHD 2CDGB 3SE8L 4RGNE 1RIUL 4X6EB 3V0WL 4HLZH 1AE6L 1K8DB 4OCNC 1PKOA 3VXOB 3S97C 5DT1H 4NCDA 4WI8A 4AK1A 1JGUL 5C2BL 1R3LB 4W4OC 4Y5VC 4OD1L 1OAUL 5DMKA 5ISZB 3GM0A 2M8XA 3NZHH 1A3RH 5DHXB 1JGLL 4RGMC 4LSQH 1JWSB 3IKCB 1WIOA 4HC1L 2CQVA 2O5ZH 1SVCP 4DOHB 3D0VA 4NJAH 5ISZA 5DMKB 2XPGB 1JPGB 1FYHB 2GY5A 4MJ2A 3O6FC 3MLTA 2AJSH 2NY1B 1IGMH 2VXVL 1JI1A 3UJTL 2YPKB 2HVKA 3CPLB 3GMPA 4DZBB 2MKLC 5DJYB 4KTDH 4NRYB 4XVTH 4PJIF 2BFVL 1AXIB 5HI4C 3NIFE 1PYWB 1S5HA 4XVTL 4LKXA 4LHQB 4X5XB 4PS4H 5CEZD 2EKSA 1JTTA 4Q9BA 4MD0A 2DD8H 1AFVL 3U79A 3R1GL 3E3QC 1M7DA 3LKSA 4N0UB 3VMPA 3IXAA 3MZGB 4KK8D 4LCWD 5BQ7A 2V2XB 4YLQT 4GRLD 4MXVE 4QHUB 1LE9A 3JV5A 4PJEA 2HG5A 2B1HL 3CFKA 3MMEA 4YX2H 1MFEH 4H8WH 3TEUA 5I76A 4OCSL 4ZMAT 5K9OA 2P8LB 2X4RA 4IMKA 2YC1A 3QIUC 3DECA 5F7DA 2B5IB 3ILQD 4HUXB 5HHOB 5GRVK 3QQ3A 3DO3A 1UWEH 1NFDF 4Y19A 5CZVL 5A2FA 4OM1H 3N1MC 1FYTB 2FX9H 3OJ2C 1VEOA 4HGWB 4LQFL 5DMGD 2XWBB 3AUVA 2PYFB 3CLFL 4RMQA 4YHPB 3GNML 5DQJA 1XCTA 3ZDZF 3EYSH 5F7FA 4NDMB 5I1CL 1N5AA 1S9WB 1NBYA 1P2CA 2EKJA 5CJQH 3SKNB 3P2TA 1FO0B 4ODHL 1RJZB 2NR6C 2J1KA 3X3GH 1XF4A 1W0WB 2NY5H 4GKNA 3TBYA 2MSPA 3AAZB 3WN5A 3IRZA 3C6LC 2KZ1B 2VN4A 4NQDA 5JQ6H 3TIDB 4XNYH 4JO2L 1FG2A 1HEZB 1CXIA 4K3EH 5D6CA 1KCKA 5MEPA 4Y4KC 1CFTA 1TTGA 3P0YH 2FX7L 2BMKA 2OJZH 3U48A 3B8YA 3BJLA 4WI6A 4MZ3A 1FZMA 4E9LA 1FG2B 1HEZA 4UIMB 2IBGA 1BFOA 3BP6A 2ZG2A 3PNWA 3WUWA 3B9KB 5BXFA 1N59A 1I7UB 4I48A 3CZFB 2A6KB 5FYJH 3DX9A 4O5LL 3RVVD 2ATPB 1RUPH 5IFJA 1UWEL 4KKCC 5HVHC 2CIKA 4QRSB 1P4BH 2V7NB 2OSLA 1T1XB 4ZFOL 5KVGL 3BRGC 5C2UB 3TLRA 1BBDL 4XMPH 3HZMA 3ES6B 2W0FB 1JCKA 4U6YB 4TVPH 3VGBA 4MB4A 4AQ1B 3MNWA 4NQCD 1UM6H 2EIEA 4TSCL 4YBLC 3ARGA 3RWDA 4F3FA 1G9NL 3OAZH 1BJ1H 1EGJH 1YNTA 3KPLA 3DIFA 4TOYH 3P4LA 5ESQA 5IUSA 5AZEH 1F4XL 2XXCB 3JWDL 4CUCA 3MCKA 2YPVH 4P5MA 1B6UA 4LLWA 3BP4A 3D6GA 4A2MA 3KXFB 4PJHF 1G7PA 4NT6B 3HE7B 1G6RH 3O4LE 1T1ZA 3MNZA 4IOFD 3EFDH 1DQLH 3W9EB 2X4UB 1M71B 3HMXL 1W72H 2XNAB 3MOBL 4NJ9H 4MX7A 3FB5A 4EIZC 5DQ9A 4N0YH 4ZSOE 1YEFH 1F3RB 4IOIB 3QDGE 4XP6H 1DBAL 1A8JH 4YGVB 1RULH 4AM0B 2D3VA 4LK4A 4O4YH 1F3DH 1BMGA 4GRMA 4YHZL 3CH1B 2BOBA 1NANH 1MFDL 3W39A 4GAGL 4Z7VB 4I1NB 4YHYC 1JN6B 3BPNB 4JM4H 1RV6X 4OT1H 1WZMA 4HIXL 3X12B 1AXTH 3WFDH 1I4FA 5K9JH 4KKAC 3T0AA 3QEQD 5GGVH 3FOLB 1G7QA 1YC7A 3LZFL 3RP1A 3LQAL 3R06B 1I8KB 4EQ3A 1CDCA 1MQ8A 2C3VA 3K80A 4IDJH 3VDCA 1GZQB 3QDME 1QA9A 1ZHKB 2Z31C 3O4LA 2OK0H 5FA3B 1OCWL 4AT6B 1R3HA 5T3XD 5JIKA 2RAMA 1DL7L 2NX5A 1NBQA 4MXWL 4XCYB 3LEYH 3BQUD 2NW2B 1OSPH 5E8EB 1G9NH 1ZLSH 4LIQL 3KPRB 2PW2A 4FQHA 5TDOA 4EBQL 1SYSA 3KPTA 4MNQA 1KULA 4AYFA 2A38A 3PDOA 2DBLH 2OR9L 3UTTB 1JWUB 2IG2H 4KWUA 5GJTL 5IGXH 1MCQA 4L4TB 1DTUA 1I8LC 3D5OF 5FK9B 4EDWL 5EBMA 1ZGLA 3GZKA 2R2HA 3SO3B 5C0BD 3LSOB 4YHNA 5E6IC 3UTQB 1OTTC 1M7XA 4HBCL 2EC8A 2BOCB 4U3HA 1YEKL 2E9JA 4ERSL 2ED7A 5DJZA 2YPLD 2CK2A 4Y4KD 1Q72L 3FRUA 5IG7B 4K3HA 4KK9C 3LH2H 3L95B 5DO2C 2J8UA 1C08A 4JPVH 4L8SC 4CMMA 3OBAA 5L0QB 3TO4D 2V6HA 1L9NA 1JGEB 3RDTD 1X9QA 2VUYA 1LP9A 3MRQB 5EG6C 3OJMB 2HTLC 1JHKH 4KVCL 1O0VA 1PQZA 2ZCHL 3FTGB 3MV9D 1MREH 1NCAH 4P2QA 1DLHA 5D5MF 4Q9QL 4OB5L 5IP4A 2PXYA 1PEWA 3QRFM 1UVQB 3GMOB 2DS4A 1MCPL 1NCAL 2AK1H 3F7QA 2O5YH 3PWPD 5DTFB 2CKBB 4EI6B 12E8L 2HH0H 4H8WC 4GBXA 4Y2DD 4RMRA 4P2QB 2YD8A 3FZUC 2G9HB 1NEZG 1I1AB 3LMJL 1NBYB 5FO8B 5KSAC 2BY3A 4HV8B 5DTFA 1T0PB 5HHOE 3WNPA 4GFTB 3P4NB 2Q76A 2G2RA 4I18C 3QZWA 4IRJB 5SV3A 3VFSA 5C7XL 1CE1H 5E4EC 4O4YL 4HWBH 3SDAB 1S7SB 3O81A 5EWIL 1D5ZB 4PLKC 3SJVA 1NC2A 4JO1L 5FGCE 5DWUH 2CKBL 3KPPB 3EJYC 4X4MA 4NQEA 1TQCC 2PO6C 3LKNA 4P46C 4GKZB 3ZTJH 1G7HA 2B0SL 1LO0H 4OLZH 5IKCB 4M5ZL 4ODXA 5K9QG 1T21A 2VDLH 3IDXH 1ZV5A 3LKPA 1TVDA 3G6DH 4L8CA 3TN0B 5E1AB 4X6FB 4D0CB 4D3CL 1QNZH 4JPWL 4Y5YA 2OR9H 3OR7B 3HLAA 4EOWL 3QUMB 1HDMA 3NFSH 3GBLA 1S9XB 3B9KA 4GW4A 2NW3B 4LPUA 5FGSA 1T2QL 2RCSL 2EIBA 1N7ML 3HNTH 4YHMH 1CXLA 5DUML 4NQDE 4D0CA 1UZ6F 5K9QI 2GCYB 3MGAA 2ORBH 1LWRA 2R0WL 5F1KC 3ZYOA 1AP2A 2BK8A 5EOCJ 4PRDB 2OSLB 1JTPA 4DFHA 1OARL 1Q0XH 1U0QA 4XBPA 3BO8B 4RX4A 4GRWB 4UU9A 4U6YA 3GRWL 4OZ4A 4C58B 3VFMA 2UV3A 1SJXA 2NY2D 1OP5K 3R8QA 4ELKB 2YD5A 4QGTA 3S96B 1MHCA 5JHDB 5HI3D 1C5CL 4LDEB 5D7JB 3HC3L 5TFSH 2VXTH 1RIUH 1F4WH 3VFMB 3SGEI 2H26A 5HHXL 3PP4H 4WFFD 4Z7QE 5JW5B 2CK0H 1F42A 4LF3A 2GQHA 3O41B 1NPUA 4H0GA 3VXPB 2IADA 1QTYT 4XPTL 3LS5L 3RWFA 3IDNA 2IWGA 3ARBA 3K2MC 5GS0C 1T89A 3JWOH 1TQBB 4KXZH 3MUZ1 4I9WE 5EO9A 4OD2A 3W11D 4I3RH 3HC4L 3QUMH 1VPOH 1XR9B 2UYLA 3FL7A 3WE6B 5CEZH 1NGPL 2NZIA 1ERNA 4PY8I 3BEVB 1OAYH 5EBGA 1DQDL 1ORQA 3TO4C 1NMCC 3KYMA 1XR9A 2UUDK 4Y2OA 4JY6B 1P9MA 3O9WD 1GGCH 3BWAB 2HKFH 2ERJB 2W60A 3RX5A 3QCVL 3ZDXE 3IFLL 4PTTA 2EEDA 3ZHLA 4QHMB 2CJUL 5TGBB 3QCTH 6FABH 3MCLL 5E2TL 5E8EA 1R5VA 3UTSB 3RTQC 1ZA6A 5IW3A 4O2CA 1N26A 2KQNA 3LEXB 4AEHH 1MY5A 3BRFA 1T5XB 4YNYB 2B1HH 1D5IH 2EYSA 1BPVA 5D71L 3LQZA 3O8XC 4GMTL 5D2LE 2R4SL 2OTUB 2M1KA 4X5WA 1IAOB 3B43A 4NZRL 1MIEL 1UXWA 1YJDL 2HVKB 2PW2B 5HHME 5TDOB 4HUUA 3BKJL 1FHGA 2EYSB 4WUKL 5D7KD 2R2CA 5I1HL 1NDMB 3HAEG 1ZTXL 3ROLA 2F15A 3HRZA 3FT3A 4JN1H 4L9DA 1Y6KR 5F7EL 2BNRA 3MRCA 4R9HA 4UV7H 4ZNCD 5LXGH 1UYWH 2Z35B 1ED3B 3RZCA 2HLFC 1U3HB 1J5OH 3VDAA 3S4SG 1WWAX 1OVZA 4PJCB 1FFRA 5EN2B 3RGVC 4PP2A 3KHOA 1FSKC 1EGJA 1C1EH 4XBGB 5D5ME 5KOVC 4KVNH 3SO5A 2LAAA 1YN7A 3RDTC 5JQHC 4KK9D 2LTQB 5GS2D 3FN3A 4Y4FC 1YY9D 2P5WB 3LIZH 1XFPA 4J1UA 4GUPA 32C2B 3T04D 4M1CD 2X1WL 3VH8A 2EE2A 4PLOB 2DIAA 3GSWA 1IGYB 4XI5D 1C7SA 3TCLB 4O51B 2VITA 3BW9A 1DE4B 3KWWB 2FHCA 5DK2B 3WUWG 4GKSB 4HJJL 1NSNL 5ACMA 1JPTL 1ZLUK 1WC7A 3B9KD 4N0RA 5DJDA 4ZTPH 4HHAB 5D70H 1A1NA 1ZHNA 5DLML 3V5DB 1RZ7H 2X4TB 5DEFB 4X0KA 1PSKH 3NPZB 5E94A 1HYSC 1MEXH 2BSTB 1H8SA 1TZHB 3OX8A 5HGAA 1RZFH 4BSVA 4TNWF 1P7QA 4OF3A 1CFVL 1NUGA 1QFWI 4KROD 3UEZA 3MBEA 1XF4B 3MGOB 3QZWG 1KELH 3HI5L 4K94L 5KS9A 4W68A 4HKZB 3U9UB 5JW4R 4IOSD 4ZFOA 4PREA 1WTLA 5KW9H 1FC2D 1KLFA 4NP4L 3SKJH 4LVNB 1NMCB 3ROOA 4I3SL 4NO5B 3TVMB 1RZKL 1Y18B 3DJ9A 5I74C 1C12B 4LRIC 3GDBA 4XC3L 5CFHA 5CD5D 4JB9H 3EJYD 4GAFB 4N1HB 5ADOH 4OLWH 5F7HA 3C08L 1Q9LB 5CJOH 2Y7QA 1FH5L 1JNLL 4N8CL 3VFGH 1OTSC 3EYSL 3ARUA 4NBZB 4QRSA 3GJFK 4NCC1 4NN5B 4ZQKA 3FRPG 4PP1C 1NDGA 4Q6YA 3EOAA 4JO4L 3MV9A 4Z7VA 5FA4A 3UTZB 1EO8H 2UWEE 2BCKA 1BIIA 3VFRA 3VXQB 4LEOB 3PNWB 4JQIL 4MJ6B 3WFCL 4AEHL 2DMBA 3RY6C 2LABA 1AD9A 3QUZB 3IDJB 2X05A 1CFBA 43CAB 4P23C 3GHBL 3HNSH 1CLCA 4MDIA 1SEQH 1F58H 1FNFA 1FZKB 3ZL4H 4YX2L 1N64L 4OLEA 2VAAA 3L3KB 1TZGL 1BOGB 1I9JH 4DVBB 4Q0XH 1CBVL 1A6TB 5I1EH 1UWGL 3V5HA 2L4OA 4F80A 1JI2A 4ZO7A 3SCMB 4CJ0A 2DYPD 5CBEA 1RPQA 1T2JA 1HSAB 5T1KB 3CVHA 3C6LB 2FO4A 3TT3L 4KKLC 2MQ3A 1CI5A 3N1FC 1UM5L 3KPLB 2CGRL 3L6FB 1JGVH 4KH2A 4WFGD 2XA8H 3OHXA 4Y4FB 2FATH 3MODL 2BVPB 3G08B 4F33B 2DL9A 4Y19D 5CINL 4C83A 3QIUD 3OHXB 2R1XB 3KPNB 3D69B 3O6MH 5ICXA 4ETQB 1MRDH 5CINH 2ZNXA 1EHXA 4JO2H 4XVUD 1IQWH 4ISVB 4RISL 4JY5H 4LLMB 2BJML 5IR1B 2GJZA 1ORQB 3MV8B 1WIUA 3WFHB 1ZXQA 4HKBA 4Y2DC 5IVOA 2XN9A 3RWCA 2MOVA 1M05B 4N9OB 4UOW0 5IG7A 1T7XA 1K5NA 5DD0H 1A6AA 4LVHB 3LOWA 5BVPH 5TF1H 1NGXB 2BSSB 4FZEH 4P3DB 5IFHL 3FFCB 2IFFH 4L4VB 2YMXL 3CSYB 4M6OH 4ZAKA 2GT9A 4PV8A 3H3PL 4JGJA 3NCCB 2QV2A 5EUOF 1A7PH 1HNFA 1TCRB 2NLJA 3RVUC 4PGZA 4PBVC 1PKQB 4I5BA 5F7LB 2FSEA 4KRMB 3OKDA 1KTLB 4Z95L 4JPIB 1A7RL 2BC4A 1P7HL 1WUNT 4FP8L 4QTHB 5EBMB 4N5UA 1N7MH 2LE9A 5B4MD 4R90L 4WNQB 1UH4A 3IJSA 1ZLUH 2X89A 2V7HB 5EC1B 2ZSWB 3PXHA 5C09B 2VC2H 1AGEA 4H1LB 4U1IA 4IBLT 4F7TB 3QUXA 3MACL 4DZBA 3MRRB 3SE4C 3Q6GL 3OKKB 3FRUB 4RNRB 5IBUB 1VADB 1I9RH 3MLTB 1IC4H 1F3JA 4P5TA 5DJCB 1G9EA 3C8HA 5EN2A 3VI4F 1VGEH 1KN2H 2R23A 4LLDB 5IW1A 1D5ZA 3QEHA 4FQLH 1FVEA 4ONGH 1MCIA 4MA1C 1XGRA 5KVFL 2PN5A 1H0DB 2BNQD 43C9A 2Q20A 4ZUUA 4NQCE 2RFXB 1UT9A 3AMLA 5I1IH 1BM3H 1YQVH 1V7NL 1K4CB 4D0DB 5DYOB 5CGYC 3LS5H 1T83A 2V5MA 3LKPB 5C0RL 2ARJQ 4YUEH 1KIRB 1LP9F 1CBVH 3P30L 4P46B 1J0IA 4HCRA 1IC7H 2O5ZL 1SY6A 5TDNB 4XWOD 5TH2A 3U1SH 5JIHA 4CMHB 4XT1C 5DEFA 3GKWH 5KVEL 2NXYC 5DS8B 3VGAC 2MPAH 1RIHH 3BKYL 4F3FB 1CXKA 4QYOB 3BZEA 4ZXBB 2IALA 2ZOKA 4U05A 2ADGA 4WDIB 1CD9B 1ZS8A 3QFJD 2A1WL 2R9HC 4BH8A 5L8JB 5ETUB 2RJMA 1NJ9B 1CK0H 3I85A 1PLGL 4NDMA 1H8OA 5EOCL 4KZDL 3HE7A 2VABB 1MCBA 1I3RA 4ZYKB 2DTSA 1E4KA 1QOKA 4JLRA 1RURH 3BN9C 3D25B 1EZVX 3QI9C 1INDH 3GGWA 2DQHH 3FQWA 1M1SA 4FFYL 5FUCE 3B4NA 2K9UA 2OMNA 3VXTA 3DXAB 3BIKB 3RY6A 3TO4A 2MQ0A 4X5LA 2RQ8A 1G7MB 3LIZL 1QR4A 5EUOB 1HHIA 5I30H 2A9NH 2UWEF 2AABL 5C92A 1H3GA 1B2WL 2LVCA 3MV01 3QZWB 2AJYL 4IRJA 3LHPL 4LEXL 1WFOA 3LPWA 2J8OA 5MI0B 2A6JA 2WUBH 5J3HC 1HDMB 1X5AA 2W1NA 2JB6A 3FFDB 3GEWB 4GJTB 2R8SH 5BS0B 4WW2F 1A47A 4Q2ZB 4OI7A 5EO9B 1ACYH 5FO9A 5I17A 3GJFA 2JJSC 4S0TD 2WV3A 4R7NB 3TNNB 5J7CC 1T6VN 1O7SA 4LSSH 1YZZA 2XT1B 5EU5A 1F4WL 3WUWB 2O5XL 4NNPH 1NDGB 4HWBL 2B4CL 4Z6AT 4NWUH 4JQVA 1W8OA 2IPKB 4HMCA 1YEJH 4JJHA 3PL6B 5IBLC 4F7CB 1QACA 1BD2E 4YDKH 3BDBA 3T0EB 3EYVB 4MAYD 3R0MA 4JY6A 4N90E 1B4RA 2P24A 3RNKB 2Y5TA 1H3PH 1UB5B 1A6TA 2NY3C 2OXGA 4ODVH 3IKKA 3DV6A 3SDYH 4JANA 4MMXC 3L5HA 3INUL 1U8NA 2D9QB 1OPGL 2VB5A 4YBLB 3QCVH 4UIKL 4V1DB 4JANB 4XPHL 4ESKA 1T2QH 4MQ7B 1XGPB 3OAUH 4FQIH 5LGHH 1Q1JL 3MCKB 3MRFB 1A6WH 1ZHBB 5CGYD 1IGCH 4IS6A 2BDNL 1PZ5B 4Z77A 3DMMB 4EI5B 4HIEA 1MAML 4HUUB 1BZ9A 5ESAB 2Y07H 1HHKB 1H3WM 4N0FA 1QLRB 3OKNB 2N56A 1BM3L 4IMLA 1WV7T 4MB5A 4BELD 5AD0A 2JJUA 3H6JA 5IR1A 2JJVA 4JZOA 1C16B 4LPTA 4M3KB 4EN3A 4BQBA 1HIML 1QLRA 3OKNA 3D69A 4TSAH 2XWTB 3O6FD 3QXTA 2W9EL 1CXFA 4XCCH 1U3HD 1HHGA 1X5KA 1EJOL 2NXZB 2GYSA 2WWKO 1I4FB 5J13B 1U3HC 1S5IH 1LDPH 2YZ8A 4QRUA 1NGQL 3G6JF 5INCB 4AENB 3GI9H 2CRIA 3A67L 4OCRL 2YZ1A 3VXSB 3EYOB 1ZLWH 5F9JA 2Z91A 2YWYA 3I6LD 4G8GB 4QRQB 3VMOA 1JNNH 1EEYA 3VI3E 5BZDA 2BSED 3HUJF 1A9EA 3MNVB 4IRZL 4PIRF 3OF6A 3QDGA 5KVMC 5HI3C 2X44D 5JNYB 1KC5L 2P5ED 3K4DA 2BY2A 4Y5YC 3D18B 4AIOA 3Q5OA 2L7JA 4MD4B 3WL9B 2PNDA 2B4CC 4MJ5A 4G6KH 5C0AE 2JJTC 2DM7A 4NNPL 3HTLX 3AMKA 2J6EH 1ED3A 4R8WL 5EU3B 1WZLA 3KS0J 3KYOB 1TQBC 5DJ0B 5T1DL 2A6IB 3CLEL 3MGTA 3JWOL 2KUTA 5TE4H 4P2RE 1QSVA 3S37X 5E00B 3SBWC 1AXTL 2EDDA 3WFDL 5JW3H 2H32A 1EJ6A 4LGSB 5GGTL 4JFPB 3AAZA 3PGFL 1HSBB 4MVBC 1TXKA 3FB8A 3DRQB 5HGBB 1HOCA 1VHPA 3QPQD 4LU5L 1CFNB 3QP3A 4N8VB 1E4KC 4K94C 4YFLI 3VXUA 4M6AA 3MMEB 3EYQD 4GW4B 3THMH 2XZQL 1Q9WB 5IIEA 5BW7A 1R3IL 3E6FA 3RAJL 4BQ6A 4D9QE 3OPZL 4JFYB 5H2BA 4JRXB 5CJXA 4I4WA 3QQ3B 1DVFD 3GMRB 4XNXL 1X7QB 3V0AC 1UM5H 5ALCH 5MEND 2KPNA 4OFYD 4WU7A 3LN5A 4BQCA 1A0QL 3I2CL 4TRPH 2Q3ZA 1T22B 1GGCL 2EH8L 2IFGA 1GRWA 5C09E 1EHLL 4G42B 1P4LA 5D9SA 5MHSD 3HZYA 4PJ9B 2AK1L 3TA3A 2IALB 2X6MA 2X1QA 3KGRA 3VWJC 3KPQB 4LKCB 1YQ2A 3IFPA 4ODWA 5DK3A 3BPLB 3OB8A 5ETUA 2DQDL 2AEPL 5DD6A 1EAPA 2AI0H 1ZHLA 3BPOB 5FO8A 2FGZA 1Y18A 1IL1B 4CN1A 3KJ4B 5L6YL 5I1DA 3PGFH 5JPNB 3HR6A 3BH8B 1YC8A 4J23A 1V7NH 1F4HA 1RUPL 1QFOA 3KLHC 4NC1C 4OM0H 4R97C 1CYGA 5TPWH 4M1GL 1OGAB 1VEMA 4NKDA 1ZA3B 1KG0A 4JFZL 5JPNA 2YEZB 4GRLA 2Z93A 4G7VH 2VOTA 2QJDA 3DX6B 4P2OA 1KPRA 2FHBA 5A3ID 1JZ2A 2WBJA 1DQMH 1KNOB 2AJZB 5EUOE 1SM3H 4YDJB 4XC3H 4POZD 1IEBB 2I27N 3MTRA 5TQ0H 1HKFA 5C86A 2QADC 1KTDB 4O9HH 3ZTNH 1JGDB 2Y7QB 4GLRH 1HZHL 2XV6B 3QHFL 3VWKD 1CDJA 3TBTB 1JZ8A 4ZFZB 4UBDD 2CR6A 2B20A 2ENSA 5HYJD 4AEIL 2I07B 3T77B 3ZDXF 1GCFA 1R5VB 3UTSA 2WBKA 5D7KE 3RBSA 5C08B 3ULVC 2WIIA 4HEPG 3LEYL 4S1RH 3OSKA 1BIIB 3UTOA 1DANU 2QQKH 1I9IH 3EFFA 5EC2A 2NCMA 4EDXA 1OGTA 4JFFD 1WBXB 5FCUL 1EX0A 5FM5O 3IU4L 3WHXB 3BGMB 2QBWA 4JAMB 3WXWH 1N64H 1E4XL 2H32H 4XHJC 4JHAH 4B50A 2H2SC 1JE6A 3K8KA 5IW6A 3P9WB 4PJAB 3WHXA 3U7WH 1INEL 1AC6A 1J0HA 5EZJB 5BO1L 4HF5L 5ICZA 1KT2A 1ES0B 3MZTA 2ITDB 4LF3B 4F7TA 1LK3H 1TZIA 1T1WB 5FHBH 3LSOA 2A73B 2X70A 1VADA 1UQSB 1YEDB 3WD5L 3CFEB 4OV5A 4GAJH 4DN4H 4PJBF 3G08A 4Y2DA 1DFBL 2ARJA 5TE7L 4TUKH 5DRZB 1RUKL 1BD2B 2OZ4A 1AHWB 1YPZA 4NJ9L 5IROC 1L7TH 2W9DL 2O61B 2DTMH 3BH9B 2X2YA 3QUZC 3CNKA 1WZ1L 3P3YA 3SDDB 2DYPA 3DI2B 5EIVA 5L2KE 3SOBL 2D4DA 1WBYA 5F7NC 5HYSB 4I0CC 1R3HB 4N0CC 1NLDH 2O61A 4UB0H 1FDLH 4JPIA 4W6XB 2F8XC 1M6OA 3RA7H 5E5MB 4JFXB 1MIEH 1YJDH 3HCVB 1EEYB 5BZDB 4DKFL 3VRLE 4V1DE 1CLYL 3GMLA 3RA7L 5AWNH 4NHCL 5KZCD 3VXRD 3PGCA 3L3DA 4OZFG 1SBSH 3LQZB 4HZAA 3LQAH 5KSBF 2GJ6D 4OI9A 4NQEE 1SEQL 2FBOJ 3F6LA 2PXYB 5J3HD 2HN7A 3VFWB 4PRIB 4YUEL 5DT1L 3GO1H 2NY6C 3SKNA 4D9RE 4NZJA 4F7MA 3OJDB 1BQHB 4OF5A 3CFJB 4KJQD 3O2VH 1DSFH 3PWNB 3C8KB 3HR5B 2AKRA 4H25B 3HRZB 1F4YL 4YIQA 4JJ5A 3PGDA 4K9EC 2EDWA 4NZTL 4IEFB 4ZUSA 3NCYS 5DJZB 5ISZE 2Z35A 2AGJL 5E2VL 3WLWC 3FT2B 5MEPB 2VDPH 4P4RA 3MA7B 5JOPD 3PWPE 2VZOA 3FT3B 2Y25A 3ZSSA 3VFSB 1PG7L 4F58H 1FAIH 3MACH 3TIDA 5DHVB 4P23D 4MAYC 4XPGH 5L7XH 4QRTB 5IHUL 5IESH 1ITCA 2F19H 1R24B 2YD4A 4ALAL 4DUWA 4Z0XB 2ZSVB 5GS1A 1VKXA 5FYLD 3OXSB 1WFTA 4HJ0C 4TQEH 4GAYB 5HVHB 3QI9D 3CVIH 1BF2A 4LLQA 3CFBA 1N59B 3MYJB 4X99B 2IC2A 3PQYA 1BWMA 3RNQA 3PDGA 4PJAF 3O6KH 4QYOA 5JXAH 3BZEB 1S7QB 4RAVB 5FCSH 3CSBA 1I75A 2R4SH 3CXDH 3REVA 3GSQA 4P59L 4WO4A 2J6EL 3MYJA 4X99A 4P57B 1JVKA 2OP4H 1T1XA 1NAKH 1V7MH 4UT6L 2BNRE 5FXCH 3QDAA 2Y23A 2FIRT 1TPXB 3T65A 3HB3C 3T4YB 1PSKL 3H3PH 4Z0BH 3IDGA 4MJIE 3P11H 1U9KA 3V5DA 4LCIH 5JUEH 4HK3N 4Y19E 2G75A 1FV1B 1U95B 4HLJA 4YGAB 4D8PA 4O58H 2BSTA 1KGCD 1XCQA 5DZOA 3C6SB 4LL9A 4OCXH 3MNZB 3OZ9L 3DYOA 4LRNL 1N2RB 3BP4B 4K9EH 5DQ9B 1E6JL 3P9MA 3S36X 5F71A 5CD3A 2NY1D 4PLJC 3RVVC 3G6AB 3QXUA 1J1PH 2YBRB 1EK3A 1V3JA 4GRWF 5JW5A 4NBXB 4PRPA 1MCRA 3DMMA 3U30C 4RGNC 3MV8A 3TH3T 3GSNA 5C3TA 2C9AA 2AEQL 3C60A 4IOIA 4AJ0A 2X7LA 3AM8A 4MYWB 5HHNA 4JRXE 3JWDH 4OSUH 4IMLB 2Q8AL 1J8HA 3O3BA 1EO5A 1DUZA 3CH1A 3OTTA 2GUOA 3CLEH 2XQYG 1OGAE 1NCWL 3PDDA 1AKJD 1JFQL 1AGFB 3FFCA 3JV4B 4L4VA 4ZAKB 4R96B 3D3VE 2R1YA 2XWTA 3TPKA 2XFXB 2Z31B 3L3GA 5AWNL 1WQVT 3WJLA 4RZCB 1TCRA 4MCZA 3D48R 2OR8A 4WO4D 1OSZA 1OTTD 4CU6A 3S35X 3L7EB 5DZNA 5JUEL 1F4AA 5AG9A 5BV7L 4NC2B 4J6RH 2QQKL 2VQ1A 1XMWA 1OHQA 1QA9B 3EOTH 1WVZA 3ILQC 4IIQA 1NAKL 1S7TA 1V7ML 2HT2C 3RX8A 2KDGA 4KTYA 2V9QA 1KB9K 1NCCH 1QKZH 1FYTD 1WAAF 2Y5TB 5B3JF 3VFVA 3ZE2F 5C0DB 3GUTB 4P9ML 4UUJB 4HKJA 2H1PH 4PJDB 5DJ6A 1YPZE 1T0MA 1JUFA 5EO1B 2O93L 4TVSa 5E2UL 1YNKH 1IM9A 1IGTB 1UJ3C 1YEJL 1P4IL 4K71B 5JDSB 3BPCA 3OG6B 3FJTA 4XCEB 3ZKND 3B5TA 3CXHK 3T3ME 1MHHA 2EZ0C 5FDWB 4XX1G 4NGHL 2DKMA 1AI1H 3NFPB 1JF6A 4F7EB 1OAQH 4ISVA 4L8SB 3OR6A 3QUKA 3KXFE 5TE6H 1KB5B 3BEWA 1C08B 4TULH 5DRZA 5IB4B 1M05A 3MLWL 3W9DA 4R8WH 1MFNA 2HRPH 5L6YH 4IMKC 2QL1A 3U7YH 2D7QA 2NNAA 4RRPA 2EKSB 4EN3B 3BHBA 4BZ2H 1I9JL 1G7JA 4OD3L 3LS4L 4RGMB 4LHUG 1A1MA 3IETB 3IVKB 3HC3H 5TFSL 5CKGA 2R0LH 3PWLB 3GBML 5F1IB 1XIWA 2JK5B 3OG4B 5EBWA 3IF1A 3CFKB 4XPBH 4JFYA 3MPCA 4X6DF 4WU7B 5JOPE 1TTUA 4GOSA 4HV8A 1OTUD 1FJ1B 5T3ZD 1LNUA 5I73C 2OCFD 4IIQC 1X5ZA 2DOCA 1P4LB 2VLKD 4GQPH 4M43L 2OTWA 1E28A 3LKRB 1EVUA 4GMSL 3V79C 2HLAB 5DUPH 1LNUB 2VAJA 1LEGB 1MJUH 1JYNA 2UZYB 2HT3C 2N7AA 4LMQI 4H20L 3AS1A 1BX2B 3TO2A 4LKXB 4NQEB 1IGFH 2A0LD 2HJLB 3QUXB 1KPUB 1JYVA 2NPLX 5KJRL 1RZJH 2VQTA 3F58L 5GIRB 1JNHB 1KJ2L 1NC2B 1IC5L 5HVWA 3GHEL 5BRZB 1LDSA 5A2LH 5GPRA 3MRMA 3SJVD 5I2IB 3UXFA 1H9VA 1MLCA 5BQ7B 4U0QB 3K2UL 5C0AA 3V2AR 3QEHB 3PWUB 1VFBB 5A43C 1OTUC 3OKYA 2ERJC 3P0VH 4X7CC 4EUPA 1FE8L 3DVIA 4JFPA 1INEH 4G6KL 1CGXA 3QNXB 3S4SB 5IJVA 4CVWA 3N50A 1NFDE 2BHYA 2OL3A 3QG7L 4PJ7B 4OQTH 1A1NB 1ZHNB 5F7DB 1CTOA 2XXMB 4XNZC 2AK4B 4ACPA 1D6EA 4PJ5E 4KPHH 3GSXA 5CD5C 2ATPA 4P4KC 3QDJB 4WUUA 2D03L 4K3GA 5T3XH 5BMFL 2NXYB 5EORL 1KLUB 5GJSH 4WHYG 3T65B 3JWDC 3DURA 4AEFA 4Z76B 1WF5A 5T1LB 5LAXA 1QSFA 3W0WA 1N2RA 5JW4N 1OLLA 2B1AL 5ANMA 2EDTA 4G8IA 3L1OH 1A6UH 3ZKMD 2NR6D 2AJVL 3DIFB 3C6SA 4TNVK 1A14H 5EIIA 4F57H 3FCTA 1QPXA 2DQCL 1YQVL 2H26B 4LHJB 4DJMA 1EAPB 2UVFA 3HUJA 2DLFH 3F7VA 5ILTL 5GGQH 1U8KB 4WGVB 1B2WH 4JN2A 3STLA 3KDMB 4J3XA 4CDGC 3BKJH 2X4OB 3EUUA 4YC2C 2YPLB 1CICB 4ODTL 1UG9A 1MI5B 2NY4C 1NBVH 4GXUN 4M62H 5FGCB 1W72L 3W2DH 4YPGA 1AGCA 4HBCH 1C5CH 1F45A 3K46A 2IF7A 3DTXB 4WFGE 1AGBA 2E6JA 4KUZL 4PJGF 3GFUA 1BBJB 4HS6A 4H20H 3MNWB 3K81A 3EDEA 1T80A 3MJ7B 2I60L 3RPKA 4UNUA 3A6OA 2OMBA 1YEEL 2APWA 3FQRB 3HE7C 3MLVL 2Y6SD 1T83C 5CJQL 4LVOB 3VWJB 4NKQB 4KXZI 1R5WB 3V7AG 4AIZA 1CG9A 3MRGA 4LCCC 4WV1B 3GSRB 4XZUA 5HVFB 2R1WB 3BGFB 2Q6WA 4LLYA 5HGHB 1S9YB 4XBPB 2FGWL 3LPFA 1JF5A 5F72S 2NY3B 4P2QD 3LEXA 3GSVB 2OQJB 5I6XC 5EFIB 4WHTB 3N85L 4U1GB 1ROWA 4UILL 2LV4A 1Y6MR 4YFDB 2R8SL 4HCRH 2P8MA 3BZDA 2ZSWA 4GO6B 4ZODA 3IFNH 2Y07L 3SDAD 3SQBA 3QULB 4ERSH 3Q3GA 4NFBA 4QF1B 1A21A 3SEPA 3CPLA 3CDCA 3A6BH 3GMPB 3KLDA 2V2TA 1BD2A 1ZANL 4MNGE 2NTFA 3G5ZB 3WFHA 3RDTB 3DMMC 3RL1B 4RCAA 1NCUA 4MQXC 4U6TA 4KRLB 1ES0A 5D2NA 4GBXC 4E42B 3KLSA 4D9LH 1LO5A 2VR5A 1LE9B 4XP1H 5HYQA 1JPFB 2FJGA 2Z9TA 3FO2A 2K3TA 1J1XL 5H2BB 3IETA 1N6QH 2W0KA 1NC4A 4P23B 3U36B 4DVRH 4R90H 5EOTB 4LIQH 1AR2A 1WT5C 4K7PY 3ARGD 2VLKE 3QFDB 2HT4D 1MF2H 3G9AB 5DYOA 3UX9B 4YXLH 2YXMA 2H6PA 4H26A 3MJ6A 5IEKB 3WJJC 1MCPH 4K7PH 2WW8A 4Y4HB 3ZDYF 1F02I 4J4PC 1L0YA 5E6IB 1U8JA 1U8PA 1K4DB 3SN6N 9CGTA 5HXMA 3GSNH 1MCCA 4FXLA 3VXNA 1HHHB 5KSVB 1TVHB 2XG5A 1IQDA 1OF2B 1BHGA 2YK1L 4IJ3C 1I3GL 5JXAL 5DUBB 1IBGL 3S34L 4Y1AB 2HLAA 2AXFB 3S7GA 4JQIH 5JHLH 5I1IL 3DYMA 3TO2B 1UCBH 1ZANH 1OB1B 2DRUA 1MFDH 4RWYL 5A2JH 5AG8A 4L8BB 5D7IF 1XCQB 4K55A 5L0QC 1TJHH 4U1KA 1RULL 5D6CB 2B39A 1BFTA 3CFJA 5E5RB 3GBNH 2CKBH 3FQWB 4YK4C 4YHOL 3CC5A 3RVUD 5I2IA 4XX1E 3VXRE 3HG1B 5LGKA 2P43B 5CCKH 3HB3D 1VB9A 2QQLH 3MYZA 4EUPG 3WS3A 5BXFB 4Y7MA 1T3FB 2YBRA 3QJFA 1TDQA 3T0XA 3CVHH 4XNQB 3L9RB 4U6XA 1DZBA 1U58B 4B53A 5GS0L 5SX4I 3Q5TA 5JORA 3ZT7A 1R24A 3ARFC 3O2VL 1VFBA 2GI7A 4LEOA 4MJ6A 3T2PA 2ESVD 3ABZA 4XRCB 5DC9B 1ZLSL 1QVOB 4EBQH 3RZCD 2GUOB 1A3QA 4JRYA 2HYMA 1A7QL 5IMOA 4UOJA 2NY2B 2OZ4H 3FOMB 5IOPA 1EHAA 1A6PA 1WITA 4G7YH 4PV9A 5GXBB 4K7FA 1Y0LB 1FRGL 1P5VA 3QA3A 4PB9L 4X4XB 5EIQA 4OZHB 2BNUB 5SWZA 3V5HB 3QEUA 4XP9H 3RL2A 2HJKA 2CMRL 1RZ7L 4OGZA 1A2YB 2PO6B 3IDMA 3RIAF 5D9SB 5IQ7L 4PJ5B 1BVZA 4GAGH 5C07B 3WO3B 5DI8B 3QEGH 1QLFB 2EYRA 1NUDA 2XNAA 4PJIE 5HY9A 3H9SD 5C0DA 4HUVA 4UTAL 3DX8A 4PLNC 3LKNB 4G8IB 4CJ1A 4MA1B 1P6FA 1T1ZB 1I8IB 3ZKNC 5GSVB 2EC9T 4OGAC 3T2NH 3F5WB 4DEPB 1MCNA 5DD1H 5DRXB 4FQXB 2DQTL 5KN5B 1QLEL 2E9IA 3NVQA 3QDMA 4JZNA 4Z7UB 1C5DA 3QHZL 3GMQA 4FQCH 5TQ2L 1XEDA 1CVRA 3I50H 5CBAA 4L4TD 5AZ2L 1ZT7A 3D0LB 4Y4HC 5J06A 2JCCF 2UY6A 2QQLL 1GGBH 4F7EA 2XFXA 4XPGL 5C0BE 3LN4B 2I9TB 5D96B 4OD2B 4W4NA 2VXVH 4M7ZB 5DFVC 3EOBB 3W9DB 3MRPB 1QFWM 4H5SA 4S1QL 4EKXA 1XGUA 3V6BR 1J8HB 2QSQA 3MLUH 2CDEA 4YHIB 2QKIA 4Y4KB 2YPLE 4HAGA 5CIPA 1KTDA 1TPXC 3VFPA 1WZKA 1MI5E 4UNVA 1K6QH 2HT3D 1BBJA 1R5WA 3OXRB 2VLRD 3MFFB 3P9LB 2VMFA 4S1RL 4PJIA 4EN3D 2NW2A 4G80A 4X9GA 1I9EA 4ODUA 3J8F7 4F15B 4I3GA 3RGVD 2CO6B 4FABH 5EUKA 4OZFH 1FCCA 1T0MB 3L5IA 3MRIB 3QXAB 5BV7H 3AU1B 3VGDA 4APQC 2VAAB 3L3KA 5CZXD 1KLGB 5LG1A 5JDSA 1VFAA 2FWOA 5FB8A 2VDOL 3VE0B 2FX7H 5GISL 1PW3A 3JWOC 3QIBA 1EIBA 4WNQA 1GGYA 1CL7H 1RQ5A 2YUZA 4G6FD 1A6VL 4M00A 2DWDA 5FOBA 3HPLB 1NCDL 3EDDA 4QHKI 3O4OC 5HDQH 2UZIH 5FUCC 5BVJA 4I2XA 1JYWA 3BDYH 4CVZA 2WBJC 5DR5H 4S11A 3TV3H 1GGBL 4YHNB 5GS0D 1M7DB 3B83A 3LKSB 3HPJB 4KTDL 1QNZL 4JPWH 4NN6C 43C9B 4EJ1C 3T0DA 2BVQB 3DUUA 1RK1A 2LU4A 4PJFB 2DLEA 5IEHA 3KPSD 2V9TA 3DGGA 4HK0B 3T3PE 3MLXH 5MEQB 2Z8SA 3OQ3B 1PYWA 1S5HB 3FQXB 5DJAA 1UKSA 1LO5B 1OTSD 3IT8D 4AENA 2CRZA 2XKNB 4RWYH 5SX5K 4HKBB 1OAZH 1GOFA 1BFVH 3DGGB 1MJ7L 3O9WC 4QXGL 3MLPA 4Y5XB 4POUB 4D0BA 3BP5B 2EE9A 5IIEB 4J1UB 2AV7B 5BOPA 1T7VA 3BOVA 1TNMA 3TCLA 1TVHA 4H26B 2VLLB 4J8RA 4HFUL 1P7QD 3EJZD 1KJ2A 4D94A 2IQAB 1I85C 1EEZA 1VENA 4ZD3L 5IHZB 5DJDB 1X5IA 4JFFA 4HS8L 4OAWB 4XP4H 5GSRA 5KG9B 3TVMD 4PJXE 3WIHA 1FO0L 5ERWA 2FH6A 2EDFA 2BNRB 3ARWA 2QTEA 1NEUA 5IHZA 1VFMA 1VGKA 2GAZA 1KXVC 3C6LD 3MJ8B 4R0LA 1HI6B 3HAEB 4M7JL 1N3NB 2NXYD 3QIBC 35C8H 3AY4C 3CC5B 1OAXL 1J1XH 3TESA 2VQUA 2YN3A 3NAAL 4FQCL 5MI0C 3P4OB 5ANME 4TUKL 2XQBL 2XACC 2BRQA 5I1GH 2A6JB 1GHFL 4Y1AE 4F7PB 5T1LD 3PHOB 4L9LA 4V2CB 3OGCB 1YNKL 3G5YA 1J11A 2Y6SC 3TN0C 5J89A 2ZJSH 3RU8L 3MA7A 1WFUA 2EE3A 2IBZX 5IHUH 5FHAL 3QT2A 3E2HB 3QIUB 4EN3C 1UB6A 1ZLVK 5DD5L 5EBLB 4KHXH 3OR7A 3RY4A 5GRVL 2X10A 1CD1B 4YH6A 3M1BA 2DQIH 2FBJH 1BF8A 4GXUM 1X7QA 2VXQH 4J3SA 1FFNA 2J8UE 3S88H 1WC7B 1KC5H 4TTDC 4RBPH 1S7VB 5DFTA 4HFUH 5F9DC 4PUBL 1CDGA 4TYUA 1GZPB 1BJ1J 4I9WD 4EEEA 4PJXA 4CN6A 4LSRL 1RUML 4ZTPL 1PG7X 1KB5L 2E3VA 4JGMA 5GJTH 4OCSH 3FQTA 2CIKB 2W9LA 4K3JL 1U41A 4CVXB 4BK5A 3RUGA 1GAFL 4M6MH 4PV9B 1ZSDB 1T1YA 3KPSA 1NCWH 4KDWA 5HYIA 3MXWH 1D5MB 5JDJA 3ISWA 2HJKB 1QBBA 2Z8RA 2VDMH 4ZPVB 2A9MH 1DQQB 1EXUB 4JM2F 5KTEL 5GS0H 1C1EL 1FL5B 2VL5A 4LAQH 3NCJL 3RRQA 4I18A 1QQDA 3CVHL 4IDJL 3EO0A 4Z9KB 4POZC 1FZJA 5HGDB 4MQ7A 4HQQL 4A6YL 3OPZH 4NUJB 1X6LA 1IT9H 3HC4H 4I3RL 3NA4A 2F53A 2EEBA 5C0CA 2QQNL 1CICA 4LIQE 3U7AA 5T5NG 3F7YA 1MQKL 1IEAA 2V5SA 3I6LE 5HI4D 5J12C 3S37H 3IJYA 3KPMB 5CBAB 3X11A 5CEXB 3ULVL 4PBXA 4P9HC 2WIMA 4PJEF 4LAJH 4JDTH 1LEIA 5KN5A 3MLSL 4NCC2 2C5DC 1FFQA 2ZG3A 3ARFD 1ZGLM 2BNQB 3U0PB 3HFMH 2APFA 5LGHL 5LJYH 4YGVA 1U8HB 2CMRH 2VLJE 1G7LB 5C0GA 1FL6B 3RIFK 4QRUB 5F89B 5D1ZA 3U0TB 5I8EB 3U46A 5HGGS 5T1DH 5DVNA 4HUNB 4QTIH 5HYQB 1JN6A 2AI0L 4JY4A 4ODSH 3HI5H 2V17L 3ARDB 4IOFC 1MCWM 2NX5E 4I13B 2YUVA 1GPOL 4P46D 4WV1A 4E5XB 1UCTA 1KN4H 3C5ZB 2APBA 1LK2A 4DTGL 4ODUB 5INCA 5EORH 5FCUH 4UZGA 5ESQB 3SGDH 1FJ1A 2VJXA 2JCCB 3MRHB 4ZPTB 3KYNA 4P5MB 2J5LB 1HQRB 1OCWH 1GIGH 3QFJB 4FXKB 5CJXC 3WBDA 4MD5B 3O3EA 1QSEB 2L7UA 5D1QD 3ZDZE 4XP5H 3K7UA 3GSOB 1OQXA 2PTTA 4P5TC 1YEHL 3I50L 5E6ID 3GM8A 1YYLL 4RQQA 3GUTA 4NQCA 5ACZB 4XNMB 1A7OL 2J7LA 1VFAB 3ZTNL 4HIJB 3BPNC 4M3JA 3G6DL 5JW4M 3WDJA 3GB7B 3ZHKA 4FQ1L 1XGPA 4X6DE 4BZ1L 4KTEL 4BZYA 4TUJA 5H35A 1HSBA 4MXQC 1FG9C 1S7WB 2WK2A 3K2UH 4Z77B 4ODTH 1EUTA 1I8LA 4JVUA 5FDWA 5HHXH 5ADPH 4QY8B 2EO1A 2P4AB 2P5WA 2BY1A 1IBGH 1TTFA 5J1AA 3FT4B 1CR9L 1NGXA 4P3DA 1K2DB 3N85H 1EDQA 3SDXE 2E8ZA 1U2HA 3SGKA 4MQTB 1DEDA 1BZQK 1KCUL 1QYGH 5BCAA 2B7DT 5SX4H 4P2YA 4KJWD 3CJJA 4KK5C 4GUPB 2DQGL 4GAYA 3DPBA 5E9DA 5I71C 3PQYB 2JJWA 5DURD 3HZYB 1QHPA 3IXTB 5F1NB 4R7DB 5L9DL 1BVKA 4WIQA 2RBLA 5F1IA 1KCSL 5ESVA 3CDGA 4HGWA 1MREL 2ZUQB 3BMVA 2I60H 1N0XL 4Q7DA 5C0FA 5MENA 4LP5A 1UJ3A 2AK4E 1DQJA 3OKOA 4EOWH 1FBIL 1HILB 1IM3A 2X1OA 4FS0A 3BVNA 1CLZL 1XGQB 5I66A 5C8JA 5K59E 3UTQA 4OF6A 5IK3A 2Q8BL 4QXTB 4O02H 4IRSD 1EERB 4C56E 1I3RB 4ZYKA 4N0CD 7CGTA 5IBUG 1C8PA 4XXDB 3VFNB 4HLZG 2PO6D 1QRND 3L3HA 5ENWA 4EUPH 4QXGH 3B2UD 3TNMB 2YOCA 1OAZL 3D3VA 4XP6L 1I1CA 3IDYC 4H1LG 4MWFB 5IQ9A 3V7AE 4CBPA 2OBGA 4FOMA 2Q8AH 3Q48A 5ENWB 5E9DE 1K4CA 4BUHA 2YEZA 4D0DA 5A3IC 5JW3L 5E99H 5KS9E 4I77L 3RNQB 1NAMH 4HG4K 3VFUA 3NPSB 1NUNB 1NL0L 3WIHL 2YD7A 3OL2A 3PP4L 4AL8H 4LRIA 1CDHA 1T3FA 4OZIE 2DDQH 3TV3L 1AD9B 2EO9A 1RY7B 3EO1B 4ZQKB 3QIWC 4I0PB 3TN0A 5C0BA 5KSAB 3H7BB 1CGWA 4MXVF 4PB0L 4M61A 5CSGA 5FA4B 3UTZA 1A7RH 3QUMA 2JTDA 2ZCLH 1INDL 1QD0A 3L7FB 5F7WC 5SWSE 2ZUTA 3MCG1 3M45A 4PJXB 3MV8D 1DQTA 3B9VA 1R0AL 5C08A 3GIZL 3OXRA 5D96C 1CK0L 2Q86A 2HRLA 3EYUH 5EFIA 1F90L 1DLFH 2NY0C 3TBVA 3WKMH 4EI5D 1JK8B 5ANMB 4G80B 2VLRB 5IT2L 5D1XA 4YK4B 4P3CL 3W9EA 3BFOA 5T5NF 2X9WA 3BIAX 4Z7NF 4XAWH 4WGWB 1S7RA 1UACL 3IJHB 3O6KL 4ZS6D 5EO0A 4MQSB 1AO7E 3IJYB 3KPMA 3L3JB 5GRJH 3STLB 2X7LB 2Z4QA 4L8CB 2ITDA 3U82B 1KENH 2BSRA 4WCYH 1MRCL 4KMQA 4WWKD 3MRJB 2BNQA 3RWFB 1B0GA 4W70A 3ZYZA 4BM7A 1YYMH 1MAMH 3QDMB 3BKCH 4KMTL 3I3EA 1IGJB 1JJUA 2JLLA 3CSYA 4P49A 1ZT7B 1A6VH 4M8VA 3TPUA 2GJJA 5E2VH 5IEKA 3AS2A 3IFOA 4M7KL 5I8KH 2GFBA 1RUQH 4U1NB 2P5EE 4JREB 4XWGL 2JCCA 4IRSA 3QG6A 3NBNA 1JRHI 4IDLA 2X4PB 2PKDA 5GZNC 3VRIA 5IT2H 5C0CE 4ZSOA 3VWJA 1CD8A 1PKQA 4FQ2L 4PTTB 2VXSL 1FLTX 1UXSA 1KIQA 1RZKC 3GSOA 3PV6A 1VERA 1FFOA 4OF8A 4PGDB 2NX5B 2GHWB 4JQXA 1ONQB 4LCCB 4WW2C 2D0HA 1MFBH 4CAGA 2ZPKH 1ORSB 1YECH 3OMZA 1U92A 4MNQB 4JAMA 2Q7YA 5KAQF 4S1QH 4FQXC 3CXDL 3DETC 3RVTD 2XRAL 1FH5H 1JNLH 4PRAA 3BPLC 5TF1L 5IFHH 4PPTA 5ID1B 3RHWK 1XZ0A 3NZ8B 4OGXL 2IAMB 3G5VA 3MJ8A 4ONOA 4KZEL 2VDQH 4G3YH 1N6QL 1JV5A 3HA0A 3CVIL 4L8DA 5FF6A 3IU3B 2FDBP 3TFKC 1NL0H 2XN9D 3QULA 3WIHH 2EDBA 2RIKA 4OCYL 3ZO0A 3BDYL 2AVGA 3REWB 4AMKL 1KJVB 3FHAA 4PJAE 5KTEH 3V4PH 2A73A 2X70B 4Q6IC 4KQ4L 5BRZA 4XP4L 4M7JH 4L8DB 2CO7B 5FF6B 2HAZA 4U1MB 4ZOEA 4PJ7F 3U36A 4JM2D 3D9AH 3L95A 4LSDA 3TZVB 4QXWA 1LP9B 3MRQA 5I1CH 5EB9A 5J1AB 4P9MH 3VA2C 1E6JH 1H15B 2Y36H 2BXYA 2G5BB 4YHOH 3IS1X 1L7IL 2GTZB 3O8XB 4PRPD 4B5EA 3O4LD 2AGJH 1FNGB 1UM6L 4KJQC 1QSFE 1AY1L 1PFCA 3L5XH 4P57A 5L2KA 1U3JA 2BNUA 5SWZB 3VWKB 1RJYB 5D7JC 1ZS8B 3CGTA 1OM3L 1E4XH 3TH4T 1OOAA 4QWWC 1OM3H 3MRKA 1UA6H 4MQXD 3KG5A 1WICA 3CMGA 4KY1H 1E28B 3LKRA 3MSPA 4N5EC 4UT6H 5CJBA 2V9RA 1A7PL 4IHOA 3F62A 1SBSL 1HHHA 1JIBA 3O4OB 5DVLA 2EECA 2EDKA 5HI5D 1MJ8L 4R4FH 5EU4B 3EDKA 4Z7OF 3HMWL 1PGRB 3VXUD 2ILLA 3JV6A 3KPPA 5AYUL 5DRXA 2OJEB 3DOSA 4XB8A 5AAMA 3MUY1 3GSNB 4NO0B 3UZQA 3SDXB 1T6WA 4HDIA 4KFZC 1NBVL 1MJUL 1IFHL 5D7SH 2MJWA 3V8CA 4DQOH 1FFNB 1FAIL 3V6ZB 1NLBL 4JB9L 2AJSL 4N5ED 3G5YB 3QJFB 5C08D 1FN4B 2HFGH 2ZPKL 1JGVL 4HUWA 1BREA 2IPKA 1G6RL 2OS7A 3DX6A 5IMLA 5HD8C 2FB4H 3SDDD 3QDJA 4GRWE 2UVEA 3L7FA 3EYFA 5E03A 4OIBA 3MR9A 3RJDA 4TVPD 1A22B 1BOGA 3BISA 2A6KA 5ISZD 5C0BB 5KSAA 3L5WA 4U3CA 1S9VA 1UKTA 3QXVA 2EDLA 1TZHA 5HGAB 3PL6A 3QCTL 4WHCA 4JRYB 2CUIA 5JO5A 1AE6H 2NY1C 3ARXA 4PLJD 5AYQA 4HIHA 1P53A 1CLOL 4ZFZA 5TJWK 4K7PX 1EXUA 3LS4H 3C8DA 1F58L 3TFKD 5JOFB 3SGDI 3NIGE 4BQ9A 1BQUA 2VL5B 2E7LA 3JTSA 3BO8A 3QIBB 4JKPL 1F6AA 4X7EC 4MCYB 2VKWA 3C5ZD 5JIIA 3MRFA 3BZFB 1CL7I 1FV1A 5IVNA 1N8ZB 3C5JB 4MNHA 5JPMB 2EDNA 4X6CF 4HIEB 4GXVL 3L5XL 1N5YL 2X4NB 3BZ4A 3UBXA 5IVXA 2WANA 3ZKQD 4OF0A 1CDUA 4OQTL 4PY8J 5E08H 3C2AL 4OBRA 3T3MF 2X4OA 4HUVB 1NLBH 1ZOXA 1N8ZA 1R3IH 5KVDL 2H8PB 1UEMA 3MV9E 1KENL 3IJHA 4PJAA 4K9EL 3O45A 5GGSY 2IH3B 2UYLB 2VSDA 2X1PA 4G7VL 5GSVA 3RTQD 4ELMF 3QDHA 4LCWB 3WD5H 2HP4A 4CNIA 2Z8VC 4N1EA 3C9NA 5DSCB 1Z5LB 1AGBB 3D85A 3RVXD 2D7TH 2X9XA 2B5IC 2OLDA 1NQBA 3QWQB 2YUXA 4CADB 2NY5L 1I8KA 3ULVH 1ETZB 4HH9A 4YWGL 2IBBA 2XTLA 1CD0A 2W60B 1TMCB 4PJGA 2Q87A 2NNAB 3L3IA 3QUYD 3H3BC 4OFDA 1TETL 4G9FA 3UPAA 3WLBA 1HXMB 4HQQH 2AEPH 2PXYD 3UBXG 4Y16D 5EC2B 2FNBA 3LEVL 4EXPX 2VLMD 3G6JA 1UZ6E 2MMXA 2DLIA 4N68A 1FRGH 3KNBA 4JFQB 1X4YA 1LHZA 4RIRB 5D2LF 1D5IL 2PYEB 3O3DA 4YQXL 1BFSA 3ZL4L 2EEAA 1AD0A 4CGTA 3UO1H 2NLJB 1E4WH 3D18A 4E0RB 3SPVA 1U8OA 1GAFH 1YEEH 1DUYA 3NTCH 1RAMA 5C0FB 5MENB 2GK2A 1H3TA 5DJ8A 5HHPA 3QUXC 4FXKA 2G9HA 5DRNB 4PJDA 4XGZB 4GH7B 2V2TB 2GITA 2XPGA 2Q7YB 3FQUA 4NHUB 4ELMA 3UTTA 3H7LA 3Q6GH 1HOCB 1SVZA 4I2XB 2DLGA 1BQLH 4OLWL 3ELAT 1W8NA 1WLHA 2XZQH 3A6CH 1BIHA 1JL8A 1MHHB 5GIRA 3HRPA 4JG1L 2M26A 4NYLB 4J3VA 3TF7C 4NKIL 3C60D 1IVLA 1T20B 3QNXA 5IJVB 4NKMA 4PRBA 4JDZA 3VGEA 4GW1B 4M6NL 4OCLC 4XNZB 4HD9A 4MD0B 4RGNB 1FL3B 4XPFH 1F90H 3WFZA 4LCYB 1MWAL 5I9QC 4ZOCA 5TDPA 2PCPB 1XT5A 3ALPA 3KWWA 5DK2A 5I1GL 1NBZA 4LASL 2V2XA 4B7IA 1TQCB 1F5WA 3DVGB 4RGOH 3VH8B 3BSZH 4PJ8C 1TITA 2GTZA 3O8XA 4LCYA 4FQQA 4P59H 1G6VK 4XPHH 5E8DH 2IFFL 4M6OL 4NN7B 5FECA 1OAUH 2EC9U 2ZUXA 3ECBA 5JXEC 1LP9E 4LQ1A 4LGRB 4H88H 5CSZB 2NQCA 3OAYK 5EPMB 4HHAA 1NMBH 2JK5A 5TDNA 2SEBA 4ZPVA 1OP3K 5LWYH 1RIVL 3MO1B 3PWNA 1NKRA 1Z0NA 2ITCB 5IM7B 5J9PA 3WXVL 3SE8H 5E94B 3VXTB 1GXEA 1IL1A 2JIXD 3BRDA 4XXDA 3X13B 3T0VA 4J6RL 4JPKL 4G8EB 4EQ2A 1I8MB 1JK8A 4JPVL 3P4OA 2F53B 4DGVH 5FHBL 4X6CB 5DUMH 5IF0B 1N6VA 4F37F 3UTTD 4G43B 25C8H 1H3UA 4R0LB 4L3ED 4M03A 4C4KO 2VLME 5F96L 1CFTB 2NTSP 3T8XA 1RJLA 1RVFL 3NH7H 3TYGH 5D6DC 1U58A 5IF0A 4WCYL 4G6AC 2IADB 1JPSH 4UNTA 1AQKL 5F1SA 2AJZA 1F11B 3P73B 5EU5B 2FR4A 1U8HA 2CIIB 1KJ2H 3VGHA 3VXRA 2HA1A 4I0PA 1CLZH 1W72A 3H9YA 1LO0L 1SJVA 1A6UL 1IZKA 4OLZL 3DV4B 3E1F1 3BQUC 4RAVA 3GMQB 1XAUA 3I6GA 3V6FA 2DJSA 3BD5A 1PD6A 3MUGB 1CFSA 1CD1A 5DVKA 2C3HA 4XMKH 4LPCA 2VDNL 4CU7A 2VLJA 5CP3A 3FQRA 4A2LA 5SWQA 5EU6B 1SYVB 3HNSL 1FYTE 3LQMA 3KPOA 1B4JL 5J6GB 1G9NC 1UM4L 3B2UC 4Y16A 3V6FB 1PJ9A 3RKDC 4G6JH 4HWEH 4KQ3H 3LKQA 3VRJA 5D71H 2NW3A 3RUGE 1JWMB 2VLJB 5K59F 1XGUB 1U3YA 3HE6A 5DK0A 4BYHA 1AC0A 4X8JB 5I19H 4MDIB 1AP2B 1MSPA 3L7EA 1F6AB 3HZKA 4PJ7E 4DGIL 5FYLE 4HJGB 3MJ9A 4P2RD 2PTTB 1W0YT 1NMBL 1DQML 1MCKA 4ODVL 1AR1D 4PRPE 1NGQH 2VDRL 3QDJE 3VXPA 3PJSB 1RHHA 1OWWA 3C2SA 5T1LA 4RGOL 1HWGB 3W82A 1MHCB 1DBMH 3NOIA 5JHDA 1XIWC 3RDTA 5FGBA 4NQDD 4CNIB 4YO0A 5E2JA 5GRZA 1KT2B 1MQKH 1A14L 2BVPA 4GRMB 4S0SD 1DUZB 2DLFL 3TYGL 3WNMA 4R2GD 1K3ZA 3T4AB 3PWVB 3BXNB 4MNGA 5EWIH 4B0MM 3B6SA 4JO3H 1B0WA 3V8OA 3MRJA 5D5MA 5FKAB 5DD1L 5HYJA 5D8JH 3CU1A 3ZKXB 2XN9B 5FYLL 4U1JB 1JHLL 1WBZB 1M6OB 3DGCR 4WI2A 1A64A 3H42H 32C2A 3WJLC 2H1PL 4J4PD 4JY4B 2NY0B 1OF2A 1KPVA 1AKJA 4LLUB 3V52L 4UQ2B 2WBJD 3GI9L 5D1XD 3S9DB 3BJ91 3L3OA 5DJXB 3O8XD 5A40E 2FLRT 3O4LB 4Y1AA 3GKWL 5KVEH 1T7YA 1ZHBA 3ZKSD 4RQQB 4QRQA 2R0WH 4DKFH 1Q9KB 2HFFA 4D2NA 2A83B 3FN0H 2ESVE 4PB9H 4NQXA 1BGXL 5DJYA 4JFEE 4DWHA 3QDGB 3RUGF 3VG9B 2PYEE 3MLWH 3S3SA 3AXLB 3LZFH 5CIPH 5HD8D 4HXAL 2DI8A 3GI8L 4NQCB 3G6JE 2DQFA 3P0YL 4LPWA 4XBGA 3TN0D 5J1TC 2PTVA 4ZS7H 1XGRB 1A9BA 4WI4A 4RNRA 3AXLA 3UDWC 1EAJA 3NCYP 3MA9H 4N0UA 2A6DB 4GMSH 3GMNB 4QF1A 4JDTL 1QZ1A 4DK3A 4TPRL 2HTKC 1DBJH 1YEGL 4LLQB 2M2DA 3RQ3A 4AIXA 1LE5B 4G5ZH 1CXHA 2C4FU 3DNKA 4JO1H 5F21B 1BLNB 1OP5H 4XNUL 4U1HB 5IB5B 1VKXB 2EDHA 4XAKE 4YR6B 2ZZUT 4DGVL 3TVMC 4QOKD 3FOMA 5E9DB 1Q94B 3TBSA 1K8IB 1NC4B 1A5FL 6CGTA 1BLNA 1VEPA 3D39E 4G8GA 2RB8A 1JP5A 2FZ3A 4QHNB 5INDB 1RZIB 1H3PL 4OZFB 4XNXH 3NABH 1BVLB 4R26H 3REVB 2D9CA 5CILH 1I7RB 3VWJD 3UTTE 1YUHA 1QFWL 3JTTA 4TOYL 1I1FB 3HNVL 43CAA 3M17B 3VWKA 1DQDH 1ZHLB 3U9PH 1EFXD 3LD8C 4NRXA 1FZKA 2EYRB 1XF5A 1ZSDA 1I1FA 5KSUB 5C1MB 1OY3B 4TULL 1EMTH 5D7IA 1OGAA 1T66D 1YDPA 2HRPL 4JZJA 3AREB 2DD8L 4Y0GA 4QXTA 4ONHB 4XAKD 1X5YA 1SEBA 1NH6A 4XC1L 4HXAH 4HZLA 3V6OA 3OB0K 4OV6F 2J6EA 5LQBL 3TZVC 2FJFB 4PBWD 2FL5A 1CGSL 5MEOB 1Z9LA 2GJ6A 4LBEB 4R3SB 3DO7B 5IMKA 1P9MC 2F58L 2G60L 3BX7C 3T0WA 3P4MA 2ATKB 3D0LA 2R1YB 1XGTA 4FZ8H 4XNQA 4Y8DC 1I7ZA 4MJ4A 4Q2ZA 3UTSE 5KVDH 5EOCH 4PRNA 3HZMB 2F74B 3FB6A 5D6DA 3KLAB 3GK8H 1ULVA 3V52H 2QADD 3P9LA 4B41A 5IJKC 2HFEA 3ARGB 2OL3L 4EDXB 1MHEA 4R4ND 5D1ZB 3U0TA 4EVNB 5D7IE 3QIWB 4I0PC 4HIIB 4Q58C 1MUJB 1J05B 2F9BT 3KPOB 3OKMA 4YHKH 5HHMB 3VFPB 3K8MA 2P5EA 4YDLB 1T5WB 4KRNA 1MCOH 1HINH 3RWHB 5LAXB 3CFCH 3SGKC 2HJFA 5D1QA 2W59A 3N1QC 1UB5A 2EDRA 3UJIL 3CFCL 1UFUA 3P77B 4MS8D 1QUNA 1CLOH 1KCLA 2CXKA 3BMWA 5FOBB 1FSKB 3VFVB 2I24N 4FZEL 4IJ3B 5C0CB 5BVPL 3NZ8A 4PJHB 3AGVA 3QNYA 2VXQL 4LSUH 5JMOC 2P7TB 3PJSA 5E8NB 3L3JA 1HH9A 2HT4C 3SE4A 1AGDA 4H1LA 1IGIL 4KI5F 3HPLA 4URTB 1U3ZA 4X98B 2FIKA 2P45B 5HDQL 3TC9A 2B2XL 2X9YA 5I1JH 5EZJA 2XA3A 3MRDB 2VO5A 4KC3B 1X5XA 4WWKC 3FQNB 2ADIA 4E41B 5I1AB 1BOYA 3AY4A 2BRRL 4OI8A 2W0LA 4GRWH 1MCWW 4NP4H 3SKMA 1RMFH 2XIDA 2WLYA 4PJ9C 3QUXD 5GS3A 5BO1H 1Q9OA 4DGIH 4I3SH 2J4WH 4MJID 5BRZD 1FC1A 3HZVA 4BSWB 1RUAH 4Q9QH 4WWID 1K2DA 2W92A 1DN0A 4S1SH 4XHQA 1F8TL 4KHTH 5GHWL 4Y89A 2X4PA 5JMRA 2PYEA 4PJ8D 1YN6B 5FEBA 2BC4B 4OLVL 5HVGB 4OLUL 1MFBL 1Q0YL 4WEBH 2F5AH 4KROB 1K6QL 1WBXA 1E27B 1V5JA 5JHDE 2YC1B 3KR3L 3GSVA 1KXQE 1G0XA 3LCYA 4WEMB 5FECB 3CUPA 3WJJA 2H41A 1U6AL 5DDHA 3MC0A 3GJFH 5CWSA 2YA0A 3TJHC 1J88A 5D70L 3L5JA 2WUBL 3EIFA 3FO9A 4NN7C 3U2SB 1KXTB 4GAJL 3S3PA 2HKFL 2KZWA 3TIEA 4HH8A 3JUZA 3RL1A 4UAOB 2G60H 3P4NA 1F3DJ 3RAJH 5I18L 5JXED 4G9FD 5F9AC 4M93B 4P4KD 1JZ3A 4PP2B 4RRPG 3T0ED 4XGZA 1UB6B 2ESVB 3QAZC 5IHLB 4FFWD 1FE8H 1ZEAH 3ULVE 1BEYL 2IPTH 3IDIB 3RZCB 4YFEA 3CFIC 1EA9C 1A3LL 5DHYB 4KZDH 3OV6A 3QPQC 2XICA 4QCIB 5HYSA 2CUHA 4NNXA 2OI9C 5CP7B 5FYKL 3E6HB 1U8LB 4U2ZA 3BP6B 4QEGA 3W81A 4M48H 3BKMH 4XTRD 1TCMA 5E5MA 4X6FA 3IXTA 5F1NA 4K2UL 3I6KA 5HPMA 4OZFA 1ZTXH 1I1YB 3F12B 2AEIT 2VKXA 1INQB 4HGKC 1J8KA 1ODAA 1K8IA 2DAVA 3BW9B 4JKWA 4PJFF 2ZUUA 3GHBH 4XXCA 4Z7VF 3R4DA 2AV7A 2E6QA 3DX7B 5EOQL 3X13A 1WCQA 1BQHA 3H9SB 4FFWC 4HXBL 3NCFB 1A1OA 4HIXH 2FH8A 1U8QA 5IVXF 4LNRB 1KEML 2G2RB 2E9WA 4TUOB 5IB2A 5F88B 4I8DA 3UCRA 2AQ2A 3UZVB 2IANB 4QRPB 5I8OL 4YBHA 3DUHA 4OQTA 4KV5E 2V2WA 5I1JL 4PJ5A 4WI7A 5J12B 5F97E 2FEEL 4HT1L 5C09D 1ZVSA 2IANA 1VGKB 2GAZB 3MLYL 3D9AL 2GK0A 1JHLH 1RHHB 2FATL 1F11A 2ZG1A 1CDYA 2EDJA 3MJ9H 5J6HB 4TTGA 1URLA 3BH8A 4FQPA 4XMLL 5A2IH 2AEWA 3QUML 4YHLL 1MI5A 3PABA 1NAML 4RAHA 1NGYB 1BJ8A 1YYML 4X7DC 3ARPA 3SKJL 1C12A 3SQOL 5T3ZL 3WNLA 4DCQB 3TT3H 1J8HD 1MCFA 1KUMA 1A6ZB 4HF5H 3FZUD 5EZLB 1HH6A 1RU9L 1FNEB 5EZIH 2QEJA 1OSZB 4HMDA 4DAGH 4WUUD 1CDBA 2VQ1B 3M1BB 1AO7D 5ID0A 5I8EA 1SQ2N 4HULB 1J1OH 5I16A 4G9FE 3MRPA 3TYFB 1GGUA 1I9IL 3CX2A 4JDVA 2Z0BA 4UI2A 3SDCD 4PUBH 4QRRA 5ALCL 1JGUH 3LDBB 4G9DA 5A16A 1G7IA 4OLXL 2FD6L 1BQSA 4P2OC 1H5BB 5DMIL 4GG8A 5B8CC 4QT5B 2AJUH 4ZXBD 3VXSA 1EEUA 2HWZH 2N1KA 1KPVB 2ZCLL 3F8UB 1ZAGA 3KAAA 2NY6D 3GMMA 1RK0A 3DROA 4M02A 3VXMA 5IVZA 4DN4L 3RZCC 2ZUYA 2RGSA 1KBGH 1WFNA 3R0NA 1SM3L 1RZGB 3H9HA 1IAMA 1RZ8A 4WW1A 1R3JB 1LK3L 3KPRE 4WU5B 3VE0A 5C0RH 3IAGC 2AJXH 3T4AA 5FFLA 5E08L 2R1XA 3KPNA 4ZS7L 5ICXB 4ETQA 5MENE 4Y4FA 2H2PC 4NKOB 1L6XA 4NZDA 1L4IA 4OM0L 3OGOE 4PJHE 2IAMA 3VJ6A 4FFZH 1YEIL 4KDVA 2DQCH 1FVCB 4JM2A 4UT9H 1G7JB 2ZCKH 2HKHH 5T3ZH 5GRJL 2EXWC 5D2NB 2FGWH 2A6DA 4F15C 3QUKB 3OR6B 4BH7B 1PX3A 3UJIH 3GJEB 5D93B 1CE1L 1CFNA 1IC4L 3BXNA 1JPFA 3ZYIA 3JUYA 5DWUL 5ICYA 4FQ1H 2XZCH 5F9JB 3MLYH 5DJAB 4ZS6C 4UILH 4LVHC 3GMOA 1DVFC 1D9KC 3VXME 3HC0A 5KANI 2BSSA 1JF1A 4WI3A 2ITCA 1UJ3B 3FB7A 4NQVB 5GZND 4X5WB 3PWLA 4MXQD 3EDFA 1KIPA 1Q0XL 5E9DD 3H42L 3HCVA 4JFHD 4JM2C 4M7KH 2FWOB 3CDGB 4FZ8L 3QRGH 1NEZA 1JF1B 1MCDA 3AM8C 3VD4A 5JLZA 3THML 1YA5A 2WZPD 3C8KA 3S5LB 5DZLA 3WNKA 3BWUC 4KVNL 4U1IB 1KJ3H 3L3OB 1ZMYA 2DLHA 3FO9B 4BKLA 3BKCL 1K3IA 3SHSA 4LKCA 4DVRL 5I66B 3TNMA 5H37H 5CEZL 3HI1A 5DQJB 1B88A 5GZOD 1VPOL 1FNAA 3ULUC 3Q6FA 3HI6H 3G5XB 4UTBL 4L8SA 4QWWD 5LGJA 4PRHB 1IM9D 4UINH 1FVEB 4UBDC 1D9KD 3UDWA 1MWAH 3UYPA 3BN3B 2GKIA 3HFML 3SCMD 5C0ND 4BFIA 1T03H 2CIIA 4ONHA 5AUMA 2AJXL 3QUYA 3HUJE 5HYSG 3KYAA 3GI8H 4NO5A 4P2RA 3ARED 5JORB 1IZJA 3MUGA 5KS9F 2BY0A 5CZKA 1J10A 1A9BB 2Z93B 4P3CH 3LDBC 3FB8B 4KDTA 4P2OB 1KCRH 1NCTA 5C7XH 6FABL 2QLVB 1Q8MA 4OJFH 1BFOB 1A7NH 5IROA 2AV1A 5IV2A 2VZSA 4Y19B 3CSPA 4ZXBA 1NAMA 4Z18A 1NSNH 3EAKA 5D1XC 4YXKL 2VWEE 2R56H 3WYRA 4POYA 4TN9A 3TBTA 1D5XB 5C71A 3EHBD 5IM7A 2YXFA 3F6IA 3GMRA 4RDQF 1U95A 3MXWL 4XCCL 1OAYL 3JWNC 5T3XL 5BMFH 3ZKMC 1D5XA 4ZO9A 1TIUA 8CGTA 3LKOB 5D1ZD 2ZCHH 1NJ9A 3QIWD 1QSED 3MX0A 3O6LH 2G75B 2OK0L 4D3CH 2UZXB 1Q0YH 4WEBL 1ZVSB 3BAEL 5J11C 4PYGA 5D1ZC 2WWKT 3DURB 3ILPB 5B22A 3WO4C 5KSBA 4K23H 5FV2A 1VCAA 2P42B 2V2WB 3TT1L 1QFUL 1YEIH 5I0DA 1GOHA 2YKLH 2C1OB 1GH7A 1Z2KA 1G7MA 2EDQA 4XAWL 3HI6L 2AABH 3AB0B 2W9DH 2X4UA 3D3VB 4DKDC 1P7KB 1IEBA 3T8XB 1W72B 4ZUWA 4X6BA 5HHOD 1OD7A 1VGEL 1ZWIA 4U6VH 5DFWH 2OL3B 5IQ7H 2CRYA 3KDMA 3VXSE 4ONFH 3GHEH 4MHHG 5HHNB 3CFEA 4OV5B 3MV7D 1A4KB 2VH5H 3MBED 4RFNB 4BFEA 4JREC 4RAUA 2WM0A 4WRLA 1LD9A 2AXGB 1CG9B 3MRGB 3V4UH 3X12A 4QHKJ 1ETZA 2BVTA 1PZUB 3UMTA 4DW2H 4DVBA 4YHIA 5D1QB 4LAQL 5F89A 3U46B 1JHTB 1CQKA 4PB0H 4PJDE 4M5YH 2IANE 3PQYD 2B4CH 2EIDA 4JHAL 2XN9E 4OZ4B 3RVXC 1DL7H 1IAKA 3U1SL 4DFIA 1YN6A 3NFSL 5JR1L 4WHTA 3JV0A 2R56L 1MHEB 4S10A 4WTXA 1QRNA 3QWOB 5LKNA 1UXWB 4PJHA 4KMTH 3KNBB 5CZVH 1LO3H 3AREC 1JPGA 1T5WA 5HDOA 1MLBB 3MRNA 3B3IA 4JGUA 5F3HB 2NY4B 4LCCA 1RK0B 4HJJH 5EA0H 1LVEA 2EZ0D 1G0DA 2VWEC 4ONGL 3EKCA 5D2LB 5IW6B 5FYKE 1YEKH 3REWA 4JR9L 1RHFA 1UACH 5GRWA 3TIEB 5IVXE 2BNRD 2XYCA 2F58H 2VXTL 1K5NB 2VTFA 4OLYH 2BVUA 3STZA 3RPIB 3CXHJ 1D6VH 2MHAB 1OPGH 1ZT4A 3BHBB 5LQBH 4LLVB 4JFFE 3EZJB 4G9FB 3H3KA 4JG0L 3VMNA 4UMGA 2LVEA 1F97A 3QISA 5DMIH 3TA3C 5F7KC 4PJCE 2C3WA 2EXWD 3C5ZA 1OAKL 2IBZY 3QJHA 3BD3A 3K4AA 1PX4A 4I5BB 1NCDH 5D5MB 4NNXB 4C57C 4LCIL 2MPAL 4I0PD 4U49A 3TA3D 35C8L 3P11L 4Z0BL 3HE7D 1KB9J 4G6JL 1GVIA 3BWAA 1RD6A 2NXZC 2MWCA 4LMQE 3KJ4C 1S7QA 3O3EB 5BS0D 2R69L 4RMSA 1SMOA 1F8TH 3EYOA 4LQFH 1AR1C 4LLUA 3D39B 4S1DD 5F3BA 4JVPA 3U9UA 1X6NA 4K2UH 3MRRA 1A9EB 2D0GA 1QEWA 2HTKD 5CEZE 4GBXB 3WFCH 3PV7A 5T33H 3QQ9D 1G9MC 1LMKA 3LAFA 2H45A 3QR2A 1YMMD 1S9WA 1IQWL 3EDJA 4Z7OE 1GGIH 1RVFH 3DRTA 4ALAH 2K7PA 1U93B 1HI6A 3HAEA 1LEKB 3VFTA 1VESA 5E5UB 1G84A 4W6WB 5IBLD 1S78C 2YD9A 1O7VA 4OGYH 4IM8A 4U31A 2HJLA 4NUGH 2GEEA 4R2GC 5DA0B 3PF2A 1LO4H 3V6ZA 4AQOA 5AEAA 3DRTB 1NFDB 3FONB 4MNQE 4C59B 3ARSA 5D1QC 1DBJL 3IU3A 5SWSD 3PWPA 2YN5A 5T3XE 5EOTA 4H1LH 3U4BL 1EO7A 3ZDYE 3TJEL 3UO1L 2F8OA 3EYFB 2AXJA 4FQQB 2HFEB 4KJWC 2AK4A 3IB4A 4DZ8B 4G8GE 4TSBH 3I02B 4OFVA 1R5IB 1OL0A 4NN6B 2GTWA 5CSZA 1MCOL 5F6HI 5GISH 4TVPL 2IQ9L 1JHKL 4KVCH 5J9PB 2HJFB 4P48A 2IH1B 4X7TA 4GKSA 1RZIA 1V3KA 4LOUC 2DM4A 2W0FA 1YMHB 5KBNC 3LKOA 1MJJB 4DN3L 5T1KA 1QSFB 1K85A 4XP9L 3RWDB 3C5JA 5D7IB 3OX8B 1N4XL 3SCMA 1KLUA 4AZ8A 5I1KL 2P7TA 1T4KB 3ZE0F 2E6PA 4MCYA 1U8QB 3FMGL 5ALBH 3CVHB 3CU7A 4D9QD 2ORBL 3HUJB 3NPSC 2IGFH 1AHWC 4F9LC 4NM4L 2YD1A 4HZLB 1EEQA 4C83B 1K9TA 1JUFB 4UOW1 3QDMD 4NUJA 3ALWA 1EZVY 4LPYA 5CSBA 3BPCB 2OI9B 1Z9SA 2Z92B 5DVMA 3SGJA 1CQYA 5FO9B 3U4EA 3F7YB 1OAXH 4JHWH 2R4RH 1CIDA