3RKOF

Crystal structure of the membrane domain of respiratory complex i from e. coli at 3.0 angstrom resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-QUINONE OXIDOREDUCTASE SUBUNIT L
publication title Structure of the membrane domain of respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 55
structure length 168
sequence length 168
chains with identical sequence J
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rkoF01
3RKOF 4HEAJ 4HE8D
chains in the Genus database with same CATH superfamily
4N4WA 2R7XA 1K40A 1M57C 3W8HA 5JRAA 2AU5A 2EINC 3UNGC 4O7GA 4XPWA 1ST6A 1OW7A 2OQMA 3EGDB 3OWTA 3QVYA 4JTCB 4MTGA 1XWJA 3W2VA 4H54A 3G4ZA 4U5GA 3KH2A 4LLEA 4HFKB 2BC5A 1YYXA 3EHNA 4OINF 2J9VA 4WJ0A 4HEAJ 4FESA 3HNJA 3AG2C 1LM3B 4ONSA 3VYWA 3Q7LA 4EIYA 1TWAA 2IYLD 1BDJB 1VMAA 4CS9C 1TKNA 1M6TA 2FGYA 2YLDA 3LEOA 3ZQYA 5F5FA 4OIRF 2J9UA 5AGFA 5KYXA 4CBEA 3RKOF 1LIHA 2EIKC 4XTKA 3CEXA 5FZTA 4IRUA 4O79A 4C3EA 3MYIA 1R4TA 4MTFA 3EG9A 3A11A 1JPJA 3U9JA 1QZXA 2Y3HA 3HLZA 3QTHA 1LE2A 3Q7GA 1D1CA 4GQHA 3T6GB 4W8KA 4CDVA 1UG7A 1U6HA 1L3PA 3K1IA 3SXZA 5KYWB 1YDIA 4AL1A 2HUJA 4M63A 4A4AA 2KGOA 2Q9CA 1FNTc 1Z5ZA 3EGDA 1T9KA 5CI8A 3L1MA 3S29A 4XLPF 1O5HA 2WZFA 1ZHTA 2R7VA 1OW8A 3LNMB 3H2VA 4HE8D 3FHDA 5FCLA 2ZXRA 4RDAA 3HJCA 1H7IA 3WHNA 4YK5A 1YAUO 4YT4A 1TWCA 4PFPA 4G7OF 2G62A 3ABMC 3GORA 1SZIA 3UGPA 2R7UA 2DYRC 2R7WA 1YYJA 2P61A 2XLMA 1A41A 1I4ZA 1ZU5A 4OIPF 4Q5SF 2HMZA 2YL3A 4JZAA 1Z3IX 3IQCA 2R7QA 1YVIA 2H7OA 2PX0A 3TOLA 1SF8A 3GM2A 3M4BA 3C8ZA 3AG3C 3US6A 3FOPA 1S05A 4CDAA 3ATPA 3EH2A 1E86A 3EHMA 1G8XA 3FMSA 1T5OA 1V74B 1QQ3A 3G50A 4U5CE 1MNDA 2J9BA 4MTOA 3ZIBA 1IZMA 3AQBA 2DGJA 1VOMA 3SEOA 3B0UX 5KYWA 1ORYA 1QSPA 2XM4A 3KYJA 5A6AA 2LSEA 4DVYP 2A1DD 3KKBA 1CPQA 4C3DA 4GYTA 2G3VA 3JT1A 5DS6A 2F22A 3DXJF 2Q9BA 1Z6AA 2CNWD 2B0HA 1HMOA 1YA9A 2Q4FA 2XLVA 2YHSA 3S27A 2IXMA 3ZC4A 4BJ6A 4ZLDA 2A0UA 3IPMO 1OKKD 4NY3A 4XWJA 4Z9HA 1OQCA 1JMWA 2RSEB 2WZGA 3H2UA 3SXKA 3SYNA 1MNEA 2XS1A 4BJ5C 2VB6A 2QTVA 1VYIA 3EH1A 256BA 2HV6A 3DJUB 4PFOA 1QPUA 2B0JA 2XLOA 3N2ZB 1M2VB 3U0CA 2R7RA 1D0ZA 1A0BA 5COGA 2L6GA 2H8AA 4E17A 1ZZPA 4ULVA 4JC7A 2Q9AA 4JCHA 4I1OB 4X0RA 3IQ5A 3RF3A 4EWCA 3FAJA 3LAYA 4OIOF 4DOZA 2KC3A 5KYYB 4CSAC 1C02A 3GM3A 2QE9A 1ORJA 4AK9A 3K66A 5A6JA 1GS9A 2GAQA 4YJWA 2YLGA 2HS5A 5JLIA 1Q0KA 2EPMX 1A7DA 1GM5A 4IB4A 4MVZA 1GQAA 4P6IC 2TMVP 2YRFA 5A6BD 2LP4A 2P1AA 3MLGA 4ZLCA 3K6BA 3AOUA 4WGZA 4ULWA 3IQTA 4JKVA 4JJFA 4O6YA 3RQEA 1YA7O 3EGXB 4JEAA 4OD4A 2J8WA 2GA0A 2H7VC 2XL6A 1MMNA 4P9FA 5T3TA 5B3IA 3AGUA 1NZEA 3DJNB 1OXBA 4LDKA 5GPGB 2EIJC 4LLCA 2JPUA 3DAFA 2R7OA 3E70C 3FVYA 3B29A 2DYSC 2HV7A 2KSFA 4XPXA 2KJGA 4BG0A 4CX9A 2OJED 3AGTA 3JRTA 1WTYA 2NPUA 1M2VA 2AWCA 2EIMC 3T9OA 1BZ4A 1SR2A 2NSFA 2KNHA 1GGQA 4WGYA 1ZVZA 4I44A 2OCCC 3MYFA 2G3KA 2VCAA 1A7EA 1UFBA 4U5DE 4RBNA 3AQCA 3S28A 5KYYA 2A0BA 3CAXA 4N6CA 1I4YA 2CDQA 3DAGA 2D5RB 1YARO 3NRHA 5L0IA 1ZHYA 4CS8A 3C18A 1WATA 1EI7A 1XZQA 1T6QA 1K05A 4MVMA 4NTAA 3WODF 2M4EA 2L6FA 3O39A 4JTAB 1TR2A 5L0CA 3JZ0A 4JE9A 2V3CC 1OCCC 3ABKC 3GWNA 4MVQA 4DRIB 5L0GA 3Q6MA 3ASNC 1RMVA 5JS5A 1AEPA 1V4AA 2A6HF 3DMDA 3K7DA 5E3CA 3ZQVA 2MHRA 3VRCA 1A7VA 1SYQA 4H4KC 1TWGA 4E0HA 2L7AA 3DE8A 1Z7Qc 4J30B 1Q0DA 1OCOC 2MWQA 2YL1A 2LIGA 4MVOA 5E3AA 3I5PA 2J45A 3R7CA 2HSBA 3GWLA 2Q00A 3ZTZA 4FAPB 3H65A 1TQGA 2XM0A 4PACA 5B1AC 3UMHA 4NCQA 2WVOA 3SZRA 2HJMA 3WAQA 1Q0FA 2PF4E 4BJTA 2IXOA 3EQLF 2NUPB 4U5FE 3RVZA 2CCYA 4PR9A 2XLHA 1VTMP 1FR0A 4NTFA 4CJGA 2ZXPA 4CS7A 2H7BA 1RJ9B 4A2NB 1NG1A 2EPOA 4XEKA 4GEHA 4J32B 2LCHA 3EFOB 3A9CA 5F28E 4O6NA 3RFYA 4NQFA 4ANJA 1E83A 3CQZA 3MX3A 3Q6NA 1YLMA 1Z23A 3AG4C 3O6XA 2R9RB 4EBKA 2L9JA 5E2QA 2YL7A 1MQVA 4AE4B 4KNVA 1WOLA 3EPVA 5L0FA 4QI2A 2C03A 4OIQF 3QW0A 3C7JA 4I1MA 3HNLA 2LD6A 5T1DB 4YL1A 2YKZA 2VASA 3UMIA 2IBFA 4CIHA 1H6GA 1ZHZA 1C03A 2BL2A 4DJ9A 3F47A 3E9VA 4JVSA 4CJOA 4ER9A 5BQHA 3GEEA 3UMKA 2YZSA 4DXWA 4IARA 5AC5A 3KMIA 4EBJA 2X51A 5BQIA 3PHF2 2EPNA 4QDLA 3B71A 3K33A 3QVZA 4IJJA 3RYLA 2QNLA 1LPEA 3NG1A 1YZCA 2ZD9A 3U3FA 2XL4A 3U5SA 3LNRA 1HW2A 3LESA 2HKVA 1AVOB 2NG1A 5B3SC 1U89A 1R5ID 2KQ9A 3BRJA 4E0IA 3QZCA 3ASOC 1RKCA 5BQGA 1RJ9A 2V26A 4YT5A 3N24A 3I5QA 4HFFB 4NC3A 1CGOA 3C8GB 4IAOA 2IM8A 3W4YA 1G4WR 5AC4A 3UGOA 3TD7A 4KNWA 4K1OA 1RKEB 3SNHA 2ETSA 2L81A 3LS0A 1NFOA 3X2QC 1B68A 3GEHA 3U2MA 3DKAA 1T01A 4L6RA 4N6HA 4AE4A 2UUHA 4IAQA 4BPMA 2MYSA 1JPNA 2WB7A 3J06A 3V5XA 3FDQA 4EHPA 4E18A 1DOWA 2R7TA 3RW0A 1N1CA 2J0XA 1APCA 2P0NA 1PCXA 5L0DA 4C7OB 3TULA 4LACB 2OOCA 1OXKA 3M4CA 1RXQA 3UR3C 1HY5A 2VCCA 3CZ6A 3FAPB 1C17M 5JT4A 3F46A 4MVRA 3GEIA 3L8JA 3C8GD 3VAYA 3ZDLA 4CS9A 1M2OA 2NUTB 1E2XA 1EA8A 1K04A 4FX5A 3T6BA 4P9TA 4LERA 4CDYA 1NU9C 3IEEA 5CI9A 3ZVRA 3NMJA 2AWYA 3RQFA 3SP1A 2LFDA 3EZIA 3JCUQ 3ZSUA 3R2PA 3ZWIA 4U9DA 4KI2A 4IWBA 1CGNA 4MVUA 3S84A 3POVA 2QUPA 2HFIA 3QMKA 3K1IC 4BEJA 2HJ3A 5E33A 1KTMA 2OEVA 3DM9B 2O9XA 2XLDA 3KPHA 1RCPA 5F5HA 4U9EA 2XS8A 3K1HA 3EJNA 4JIOA 3W8IA 4G0HA 4WABA 1W2WA 3L34A 2ASRA 2CGEA 4YT2A 4JTDB 2HZ8A 1MMGA 1KU2A 3T4RA 1U0BB 1EKYA 5L0JA 5A69A 2ZXOA 3BEHA 3LEVA 4JRZA 2YL0A 4YN0B 5A6BA 2XLEA 1QKRA 2C04A 3B0VC 1OCZC 4I3MA 1ZHWA 3HTKC 4J7TA 1H9TA 1AUEA 3IHUA 4DRJB 5DS5A 2JX0A 4C7OA 3HKKA 1FAPB 1ZW2A 1YJGA 2FFHA 3RVYA 1NSGB 2J7PD 2YEVA 5JP7A 3PMRA 4W8PA 5DQTA 4LDQA 2Z15A 3T6JA 3WG7C 1FFTC 1MMDA 3NKEA 3W2WA 4YL0A 1D0YA 2Q3TA 2FAPB 3L0IA 2WL8A 2AP3A 3O10A 2I8BA 1J8MF 4AX2A 4Q4ZF 2VC9A 3SXYA 4NTBA 3PDMP 1PD0A 1EQ1A 3S0XA 3CSKA 2HSQA 3VM6A 2OG2A 2HMQA 2A6EF 4Z9IA 2LFFA 1D1BA 1VB5A 2KYHA 2Y69C 1NLXA 4U5BE 4B6IA 1LS1A 3EGXA 4K0DA 2UUIA 2W4MA 4BJ6C 2AVKA 2BE5F 2ZXWC 4IGGA 1OR3A 3JSZA 1SMYF 2KK1A 3AG1C 3LJBA 3TK0A 4F4BA 5L0HA 3B9QA 2Y39A 1Y4CA 3JYHA 3U3BA 1I5NA 2P6VA 3V5YA 3NYLA 1HMDA 1LVKA 1NFNA 1ORSC 3ITFA 2XLWA 1LI5A 4U5HA 4YL3A 1G5ZA 1VK5A 2M64A 4K7BA 1FFHA 4BJ5A 3KL4A 1NBBA 1QVXA 2YVKA 1IW7F 1LS4A 2CYDA 2YLIA 3NDBB 2ICWG 3ZTMA 3U8PA 4RD9A 4YT8A 3NMIA 1VLTA 5L3VA 3V5ZA 1JRAA 3MFNA 1MMAA 4FWVA 1WN0A 1LI7A 3EZHA 4XPYA 3LUTB 3AJMA 2JD3A 4CSAA 3OA1A 2OEXA 5DLJA 3U9MA 3V7OA 1E84A 3N0TA 4KBLA 5EHHA 3RH3A 1BR1A 2XL8A 4JEBA 3TOMA 4OD5A 4D4XA 1DOVA 1KNYA 2VCBA 3LLKA 3MBGA 4DBRA 1QLEC 1ZW3A 4MW3A 4JURI 3ZG1A 4XQ1A 4DVZA 4G7ZF 2R05A 5A6KA 4PK4A 1ZU4A 2EILC 1V54C 3TJ6A 3GODA 3X1OA 2YQYA 4G78A 1T6UA 2X0CA 2PNOA 2LK4A 2DI3A 1V55C 4MW8A 5HV9A 5JUAA 3ABLC 1O3UA 4PJMA 4MNDA 4MVSA 1FMWA 3PCVA 2XSEA 2NUPA 4XEFA 3DZAA 2A68F 3FXHA 5BUOA 1LKXA 1VLSA 5JVEA 4UDVA 3NMKA 3JSEO 3LLIA 1Z63A 3O55A 2WVNA 1TWHA 2IXNA 3KYIA 4JJGA 4PJJA 2Y3BA 4J7YA 3EFOA 5HSWA 3OEOA 4DRHB 2DB4A 2QY9A 2R02A 4Q7CA 4E7SA 2KW3C 4CS8C 2E87A 5D91A 5COFA 1D0XA 3DE9A 1WGWA 3NYMA 4XLNF 2W45A 3DI5A 3GM1A 2GWWA 4YWQA 1WASA 2CW0F 3C63A 4AL0A 4CIPA 5K0IA 1CPRA 2D4UA 5B1BC 2IXPA 5DVWA 2J0WA 3M15A 1JR8A 3B0PA 4EKWA 1HE1A 2CNWA 5COMA 3DWWA 2OU6A 3G4XA 3LS1A 1OKKA 1M56C 1ZHXA 4PJLA 4C3BA 3ECSA 4EBBA 4JCZA 3NKDA 1HE9A 4U5EE 5DS4A 2PBEA 1BBHA 1Y6DA 4BEMJ 3QW1A 4QI0A 2GDCA 4MS2A 2P7VA 4EUKB 4E7ZA 2XRHA 3DM5A 4N06A 2Y3GA 3VF0A 5IY5C 2W9YA 2W4BA 1PD1A 5T3WA 5JSLA 4BJ1A 5KYNA 2A69F 1FMVA 1JAFA 2I15A 1YZAA 4G7HF 3L8IA 3C8GA 5L3QA 3U2LA 2WZLA 2IOQA 5CIVA 3TJ5A 1F1MA 1FTSA 3NYJA 5EGYA 2XXAB 1BR4A 1RKEA 4JW1A 2R25A 1BR2A 1L7CA 1OR2A 2EPKX 3C62A 3FOOA 4R32A 5KYUB 1TFKB 2L6HA 3RIPA 1XZPA 1H9GA 1D1AA 2EPLX 5D92A 3RQGA 3HNKA 1Q0MA 2Y3DA 3IQ6A 1S7ZA 1Q0GA 4KC9A 2Q7RA 3S9OA 3TQOA 3U8VA 1ZYRF 2PX3A 1E85A 4DBQA 4Z9JA 1O87A 1OCRC 1NU7D 1HW1A 5EK0A 2QLAA 2WVQA 2J46A 1PV3A 2LQGA 3I4UA 1JOGA 2GFHA 3JTLO 2OKUA 4LDRA 4O6MA 4XEVA 3JYYA 5TJ5E 2NUTA 1G4US 1VYKA 5DQZA 2R7SA 1LE4A 5KYXB 1J8YF 2PP4A 1T6IA 2VH3A 3GANA 3M79A 2OJQA 2YWAA 3SXMA 4D4NA 2J7PA 2J9WA 3M1CB 3JRMO 2NSGA 3EG9B 1OW6A 3S90A 2XXAA 4MQ9F 3DD7A 4PJNA 2RD9A 2R03A 5KYUA 3HNIA 2ZPAA 1TFOB 1WWPA 2PFDA 1CGME
chains in the Genus database with same CATH topology
2R7XA 1M57C 3W8HA 2EINC 3UNGC 4O7GA 1ST6A 3EGDB 3OWTA 3W2VA 4U5GA 3KH2A 4LLEA 4HFKB 3EHNA 4OINF 2J9VA 4WJ0A 4HEAJ 4FESA 3AG2C 3VYWA 3Q7LA 1TWAA 2IYLD 1VMAA 4CS9C 1TKNA 2FGYA 5F5FA 4OIRF 2J9UA 5KYXA 4CBEA 3RKOF 2EIKC 4XTKA 4IRUA 4O79A 4C3EA 3EG9A 1JPJA 1QZXA 2Y3HA 3HLZA 3Q7GA 1D1CA 4W8KA 5KYWB 4M63A 2KGOA 2Q9CA 1Z5ZA 3EGDA 5CI8A 3S29A 4XLPF 1O5HA 2WZFA 1ZHTA 2R7VA 4HE8D 3FHDA 5FCLA 2ZXRA 4RDAA 3HJCA 4G7OF 4YT4A 1TWCA 4PFPA 2G62A 3ABMC 1SZIA 3UGPA 2R7UA 2DYRC 2R7WA 1ZU5A 4OIPF 4Q5SF 4JZAA 1Z3IX 2R7QA 2H7OA 2PX0A 1SF8A 3AG3C 3EH2A 3EHMA 1G8XA 4U5CE 1MNDA 3ZIBA 1IZMA 3AQBA 2DGJA 1VOMA 3SEOA 3B0UX 5KYWA 2LSEA 4DVYP 2A1DD 3KKBA 4C3DA 4GYTA 2G3VA 3JT1A 5DS6A 3DXJF 2Q9BA 1Z6AA 2CNWD 3S27A 3ZC4A 2YHSA 4BJ6A 4ZLDA 2IXMA 1OKKD 4NY3A 4XWJA 2WZGA 3SYNA 1MNEA 4BJ5C 2VB6A 2QTVA 1VYIA 3EH1A 2HV6A 3DJUB 4PFOA 2B0JA 3N2ZB 1M2VB 2R7RA 1D0ZA 4X0RA 2Q9AA 4JCHA 4I1OB 4EWCA 3FAJA 3LAYA 4DOZA 5KYYB 4CSAC 3K66A 4YJWA 4P6IC 3MLGA 4ZLCA 3K6BA 4ULWA 4O6YA 4JJFA 3EGXB 4OD4A 2H7VC 1MMNA 5T3TA 1NZEA 3DJNB 2EIJC 4LLCA 3DAFA 2R7OA 3E70C 3FVYA 2DYSC 2HV7A 4BG0A 2KJGA 3JRTA 1M2VA 2EIMC 2KNHA 4I44A 2OCCC 2G3KA 4U5DE 4RBNA 3AQCA 3S28A 5KYYA 3DAGA 2CDQA 2D5RB 3NRHA 1ZHYA 4CS8A 3WODF 2M4EA 3O39A 1TR2A 2V3CC 1OCCC 3ABKC 3Q6MA 3ASNC 3DMDA 2A6HF 5E3CA 3K7DA 4H4KC 1TWGA 4J30B 1OCOC 2MWQA 5E3AA 3I5PA 2J45A 3H65A 3UMHA 5B1AC 2WVOA 3SZRA 2PF4E 4BJTA 2IXOA 3EQLF 2NUPB 4U5FE 2ZXPA 4CS7A 2H7BA 1RJ9B 4A2NB 1NG1A 4GEHA 4J32B 3EFOB 3RFYA 4ANJA 4O6NA 3CQZA 3MX3A 3Q6NA 1Z23A 3AG4C 3O6XA 2L9JA 5E2QA 4AE4B 4KNVA 3EPVA 4QI2A 2C03A 4OIQF 4I1MA 5T1DB 2VASA 3UMIA 4CIHA 1ZHZA 3F47A 3E9VA 4JVSA 3UMKA 2YZSA 3KMIA 2X51A 3PHF2 4QDLA 3K33A 4IJJA 3RYLA 3NG1A 2XL4A 3LNRA 3LESA 2NG1A 5B3SC 2KQ9A 3QZCA 3ASOC 1RJ9A 2V26A 4YT5A 3N24A 3I5QA 4HFFB 4IAOA 3UGOA 3TD7A 4KNWA 3SNHA 3X2QC 2L81A 3LS0A 4AE4A 2MYSA 1JPNA 2WB7A 3FDQA 2R7TA 1N1CA 2J0XA 1PCXA 4C7OB 4LACB 3UR3C 3CZ6A 3F46A 3VAYA 4CS9A 1M2OA 2NUTB 4FX5A 3T6BA 4LERA 1NU9C 3IEEA 5CI9A 3ZVRA 3SP1A 3EZIA 3JCUQ 3ZSUA 4KI2A 4IWBA 3POVA 3QMKA 3K1IC 4BEJA 5E33A 3DM9B 2O9XA 5F5HA 3K1HA 3EJNA 3W8IA 4G0HA 1W2WA 3L34A 2CGEA 4YT2A 1MMGA 1KU2A 3T4RA 2ZXOA 3LEVA 4YN0B 2C04A 3B0VC 1OCZC 4I3MA 1ZHWA 3HTKC 5DS5A 4C7OA 2FFHA 2J7PD 2YEVA 3PMRA 5DQTA 2Z15A 3T6JA 3WG7C 1FFTC 1MMDA 3NKEA 3W2WA 1D0YA 2Q3TA 3L0IA 2WL8A 2I8BA 1J8MF 4AX2A 4Q4ZF 1PD0A 3S0XA 3CSKA 2OG2A 2A6EF 4B6IA 1D1BA 2Y69C 4U5BE 1LS1A 3EGXA 4K0DA 4BJ6C 2W4MA 2BE5F 2ZXWC 3JSZA 3LJBA 1SMYF 3AG1C 4F4BA 3B9QA 2Y39A 3JYHA 4AK9A 2P6VA 3NYLA 1LVKA 3ITFA 4U5HA 1VK5A 4K7BA 1FFHA 4BJ5A 3KL4A 1IW7F 3NDBB 4RD9A 4YT8A 5L3VA 1MMAA 4FWVA 3EZHA 4CSAA 2JD3A 3OA1A 5DLJA 3V7OA 3N0TA 4KBLA 5EHHA 3RH3A 1BR1A 4OD5A 3LLKA 4DBRA 1QLEC 4G7ZF 4JURI 3ZG1A 4DVZA 4PK4A 1ZU4A 2EILC 1V54C 3GODA 3X1OA 1V55C 3ABLC 4PJMA 4MNDA 1FMWA 2XSEA 2NUPA 3DZAA 2A68F 5BUOA 1LKXA 1Z63A 3LLIA 2WVNA 1TWHA 2IXNA 4JJGA 4PJJA 2Y3BA 3EFOA 5HSWA 3OEOA 2QY9A 4Q7CA 4E7SA 2KW3C 4CS8C 2E87A 5D91A 1D0XA 1WGWA 3NYMA 4XLNF 2W45A 4YWQA 2CW0F 5B1BC 2IXPA 5DVWA 2J0WA 3B0PA 2CNWA 3LS1A 1OKKA 1M56C 1ZHXA 4PJLA 4C3BA 3ECSA 4EBBA 3NKDA 4U5EE 5DS4A 4QI0A 4E7ZA 2P7VA 2XRHA 3DM5A 4N06A 2Y3GA 5IY5C 2W9YA 2W4BA 1PD1A 5T3WA 4BJ1A 5KYNA 2A69F 1FMVA 4G7HF 5L3QA 2WZLA 2IOQA 5EGYA 2XXAB 1FTSA 3NYJA 1BR4A 4JW1A 5KYUB 1BR2A 4OIOF 3RIPA 1D1AA 5D92A 2Y3DA 1S7ZA 4KC9A 1ZYRF 2PX3A 4DBQA 1O87A 1OCRC 1NU7D 2WVQA 2J46A 3I4UA 2GFHA 4O6MA 2NUTA 5DQZA 1VYKA 2R7SA 5KYXB 1J8YF 2PP4A 2VH3A 3GANA 2J7PA 2J9WA 3M1CB 3EG9B 2XXAA 4MQ9F 3DD7A 4PJNA 5KYUA 2ZPAA 2PFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HEA J;  4HE8 D; 
#chains in the Genus database with same CATH topology
 4N4W A;  2R7X A;  1K40 A;  1M57 C;  3W8H A;  5JRA A;  2AU5 A;  2EIN C;  3UNG C;  4O7G A;  4XPW A;  1ST6 A;  1OW7 A;  2OQM A;  3EGD B;  3OWT A;  3QVY A;  4JTC B;  4MTG A;  1XWJ A;  3W2V A;  4H54 A;  3G4Z A;  4U5G A;  3KH2 A;  4LLE A;  4HFK B;  2BC5 A;  1YYX A;  3EHN A;  4OIN F;  2J9V A;  4WJ0 A;  4HEA J;  4FES A;  3HNJ A;  3AG2 C;  1LM3 B;  4ONS A;  3VYW A;  3Q7L A;  4EIY A;  1TWA A;  2IYL D;  1BDJ B;  1VMA A;  4CS9 C;  1TKN A;  1M6T A;  2FGY A;  2YLD A;  3LEO A;  3ZQY A;  5F5F A;  4OIR F;  2J9U A;  5AGF A;  5KYX A;  4CBE A;  3RKO F;  1LIH A;  2EIK C;  4XTK A;  3CEX A;  5FZT A;  4IRU A;  4O79 A;  4C3E A;  3MYI A;  1R4T A;  4MTF A;  3EG9 A;  3A11 A;  1JPJ A;  3U9J A;  1QZX A;  2Y3H A;  3HLZ A;  3QTH A;  1LE2 A;  3Q7G A;  1D1C A;  4GQH A;  3T6G B;  4W8K A;  4CDV A;  1UG7 A;  1U6H A;  1L3P A;  3K1I A;  3SXZ A;  5KYW B;  1YDI A;  4AL1 A;  2HUJ A;  4M63 A;  4A4A A;  2KGO A;  2Q9C A;  1FNT c;  1Z5Z A;  3EGD A;  1T9K A;  5CI8 A;  3L1M A;  3S29 A;  4XLP F;  1O5H A;  2WZF A;  1ZHT A;  2R7V A;  1OW8 A;  3LNM B;  3H2V A;  4HE8 D;  3FHD A;  5FCL A;  2ZXR A;  4RDA A;  3HJC A;  1H7I A;  3WHN A;  4YK5 A;  1YAU O;  4YT4 A;  1TWC A;  4PFP A;  4G7O F;  2G62 A;  3ABM C;  3GOR A;  1SZI A;  3UGP A;  2R7U A;  2DYR C;  2R7W A;  1YYJ A;  2P61 A;  2XLM A;  1A41 A;  1I4Z A;  1ZU5 A;  4OIP F;  4Q5S F;  2HMZ A;  2YL3 A;  4JZA A;  1Z3I X;  3IQC A;  2R7Q A;  1YVI A;  2H7O A;  2PX0 A;  3TOL A;  1SF8 A;  3GM2 A;  3M4B A;  3C8Z A;  3AG3 C;  3US6 A;  3FOP A;  1S05 A;  4CDA A;  3ATP A;  3EH2 A;  1E86 A;  3EHM A;  1G8X A;  3FMS A;  1T5O A;  1V74 B;  1QQ3 A;  3G50 A;  4U5C E;  1MND A;  2J9B A;  4MTO A;  3ZIB A;  1IZM A;  3AQB A;  2DGJ A;  1VOM A;  3SEO A;  3B0U X;  5KYW A;  1ORY A;  1QSP A;  2XM4 A;  3KYJ A;  5A6A A;  2LSE A;  4DVY P;  2A1D D;  3KKB A;  1CPQ A;  4C3D A;  4GYT A;  2G3V A;  3JT1 A;  5DS6 A;  2F22 A;  3DXJ F;  2Q9B A;  1Z6A A;  2CNW D;  2B0H A;  1HMO A;  1YA9 A;  2Q4F A;  2XLV A;  2YHS A;  3S27 A;  2IXM A;  3ZC4 A;  4BJ6 A;  4ZLD A;  2A0U A;  3IPM O;  1OKK D;  4NY3 A;  4XWJ A;  4Z9H A;  1OQC A;  1JMW A;  2RSE B;  2WZG A;  3H2U A;  3SXK A;  3SYN A;  1MNE A;  2XS1 A;  4BJ5 C;  2VB6 A;  2QTV A;  1VYI A;  3EH1 A;  256B A;  2HV6 A;  3DJU B;  4PFO A;  1QPU A;  2B0J A;  2XLO A;  3N2Z B;  1M2V B;  3U0C A;  2R7R A;  1D0Z A;  1A0B A;  5COG A;  2L6G A;  2H8A A;  4E17 A;  1ZZP A;  4ULV A;  4JC7 A;  2Q9A A;  4JCH A;  4I1O B;  4X0R A;  3IQ5 A;  3RF3 A;  4EWC A;  3FAJ A;  3LAY A;  4OIO F;  4DOZ A;  2KC3 A;  5KYY B;  4CSA C;  1C02 A;  3GM3 A;  2QE9 A;  1ORJ A;  4AK9 A;  3K66 A;  5A6J A;  1GS9 A;  2GAQ A;  4YJW A;  2YLG A;  2HS5 A;  5JLI A;  1Q0K A;  2EPM X;  1A7D A;  1GM5 A;  4IB4 A;  4MVZ A;  1GQA A;  4P6I C;  2TMV P;  2YRF A;  5A6B D;  2LP4 A;  2P1A A;  3MLG A;  4ZLC A;  3K6B A;  3AOU A;  4WGZ A;  4ULW A;  3IQT A;  4JKV A;  4JJF A;  4O6Y A;  3RQE A;  1YA7 O;  3EGX B;  4JEA A;  4OD4 A;  2J8W A;  2GA0 A;  2H7V C;  2XL6 A;  1MMN A;  4P9F A;  5T3T A;  5B3I A;  3AGU A;  1NZE A;  3DJN B;  1OXB A;  4LDK A;  5GPG B;  2EIJ C;  4LLC A;  2JPU A;  3DAF A;  2R7O A;  3E70 C;  3FVY A;  3B29 A;  2DYS C;  2HV7 A;  2KSF A;  4XPX A;  2KJG A;  4BG0 A;  4CX9 A;  2OJE D;  3AGT A;  3JRT A;  1WTY A;  2NPU A;  1M2V A;  2AWC A;  2EIM C;  3T9O A;  1BZ4 A;  1SR2 A;  2NSF A;  2KNH A;  1GGQ A;  4WGY A;  1ZVZ A;  4I44 A;  2OCC C;  3MYF A;  2G3K A;  2VCA A;  1A7E A;  1UFB A;  4U5D E;  4RBN A;  3AQC A;  3S28 A;  5KYY A;  2A0B A;  3CAX A;  4N6C A;  1I4Y A;  2CDQ A;  3DAG A;  2D5R B;  1YAR O;  3NRH A;  5L0I A;  1ZHY A;  4CS8 A;  3C18 A;  1WAT A;  1EI7 A;  1XZQ A;  1T6Q A;  1K05 A;  4MVM A;  4NTA A;  3WOD F;  2M4E A;  2L6F A;  3O39 A;  4JTA B;  1TR2 A;  5L0C A;  3JZ0 A;  4JE9 A;  2V3C C;  1OCC C;  3ABK C;  3GWN A;  4MVQ A;  4DRI B;  5L0G A;  3Q6M A;  3ASN C;  1RMV A;  5JS5 A;  1AEP A;  1V4A A;  2A6H F;  3DMD A;  3K7D A;  5E3C A;  3ZQV A;  2MHR A;  3VRC A;  1A7V A;  1SYQ A;  4H4K C;  1TWG A;  4E0H A;  2L7A A;  3DE8 A;  1Z7Q c;  4J30 B;  1Q0D A;  1OCO C;  2MWQ A;  2YL1 A;  2LIG A;  4MVO A;  5E3A A;  3I5P A;  2J45 A;  3R7C A;  2HSB A;  3GWL A;  2Q00 A;  3ZTZ A;  4FAP B;  3H65 A;  1TQG A;  2XM0 A;  4PAC A;  5B1A C;  3UMH A;  4NCQ A;  2WVO A;  3SZR A;  2HJM A;  3WAQ A;  1Q0F A;  2PF4 E;  4BJT A;  2IXO A;  3EQL F;  2NUP B;  4U5F E;  3RVZ A;  2CCY A;  4PR9 A;  2XLH A;  1VTM P;  1FR0 A;  4NTF A;  4CJG A;  2ZXP A;  4CS7 A;  2H7B A;  1RJ9 B;  4A2N B;  1NG1 A;  2EPO A;  4XEK A;  4GEH A;  4J32 B;  2LCH A;  3EFO B;  3A9C A;  5F28 E;  4O6N A;  3RFY A;  4NQF A;  4ANJ A;  1E83 A;  3CQZ A;  3MX3 A;  3Q6N A;  1YLM A;  1Z23 A;  3AG4 C;  3O6X A;  2R9R B;  4EBK A;  2L9J A;  5E2Q A;  2YL7 A;  1MQV A;  4AE4 B;  4KNV A;  1WOL A;  3EPV A;  5L0F A;  4QI2 A;  2C03 A;  4OIQ F;  3QW0 A;  3C7J A;  4I1M A;  3HNL A;  2LD6 A;  5T1D B;  4YL1 A;  2YKZ A;  2VAS A;  3UMI A;  2IBF A;  4CIH A;  1H6G A;  1ZHZ A;  1C03 A;  2BL2 A;  4DJ9 A;  3F47 A;  3E9V A;  4JVS A;  4CJO A;  4ER9 A;  5BQH A;  3GEE A;  3UMK A;  2YZS A;  4DXW A;  4IAR A;  5AC5 A;  3KMI A;  4EBJ A;  2X51 A;  5BQI A;  3PHF 2;  2EPN A;  4QDL A;  3B71 A;  3K33 A;  3QVZ A;  4IJJ A;  3RYL A;  2QNL A;  1LPE A;  3NG1 A;  1YZC A;  2ZD9 A;  3U3F A;  2XL4 A;  3U5S A;  3LNR A;  1HW2 A;  3LES A;  2HKV A;  1AVO B;  2NG1 A;  5B3S C;  1U89 A;  1R5I D;  2KQ9 A;  3BRJ A;  4E0I A;  3QZC A;  3ASO C;  1RKC A;  5BQG A;  1RJ9 A;  2V26 A;  4YT5 A;  3N24 A;  3I5Q A;  4HFF B;  4NC3 A;  1CGO A;  3C8G B;  4IAO A;  2IM8 A;  3W4Y A;  1G4W R;  5AC4 A;  3UGO A;  3TD7 A;  4KNW A;  4K1O A;  1RKE B;  3SNH A;  2ETS A;  2L81 A;  3LS0 A;  1NFO A;  3X2Q C;  1B68 A;  3GEH A;  3U2M A;  3DKA A;  1T01 A;  4L6R A;  4N6H A;  4AE4 A;  2UUH A;  4IAQ A;  4BPM A;  2MYS A;  1JPN A;  2WB7 A;  3J06 A;  3V5X A;  3FDQ A;  4EHP A;  4E18 A;  1DOW A;  2R7T A;  3RW0 A;  1N1C A;  2J0X A;  1APC A;  2P0N A;  1PCX A;  5L0D A;  4C7O B;  3TUL A;  4LAC B;  2OOC A;  1OXK A;  3M4C A;  1RXQ A;  3UR3 C;  1HY5 A;  2VCC A;  3CZ6 A;  3FAP B;  1C17 M;  5JT4 A;  3F46 A;  4MVR A;  3GEI A;  3L8J A;  3C8G D;  3VAY A;  3ZDL A;  4CS9 A;  1M2O A;  2NUT B;  1E2X A;  1EA8 A;  1K04 A;  4FX5 A;  3T6B A;  4P9T A;  4LER A;  4CDY A;  1NU9 C;  3IEE A;  5CI9 A;  3ZVR A;  3NMJ A;  2AWY A;  3RQF A;  3SP1 A;  2LFD A;  3EZI A;  3JCU Q;  3ZSU A;  3R2P A;  3ZWI A;  4U9D A;  4KI2 A;  4IWB A;  1CGN A;  4MVU A;  3S84 A;  3POV A;  2QUP A;  2HFI A;  3QMK A;  3K1I C;  4BEJ A;  2HJ3 A;  5E33 A;  1KTM A;  2OEV A;  3DM9 B;  2O9X A;  2XLD A;  3KPH A;  1RCP A;  5F5H A;  4U9E A;  2XS8 A;  3K1H A;  3EJN A;  4JIO A;  3W8I A;  4G0H A;  4WAB A;  1W2W A;  3L34 A;  2ASR A;  2CGE A;  4YT2 A;  4JTD B;  2HZ8 A;  1MMG A;  1KU2 A;  3T4R A;  1U0B B;  1EKY A;  5L0J A;  5A69 A;  2ZXO A;  3BEH A;  3LEV A;  4JRZ A;  2YL0 A;  4YN0 B;  5A6B A;  2XLE A;  1QKR A;  2C04 A;  3B0V C;  1OCZ C;  4I3M A;  1ZHW A;  3HTK C;  4J7T A;  1H9T A;  1AUE A;  3IHU A;  4DRJ B;  5DS5 A;  2JX0 A;  4C7O A;  3HKK A;  1FAP B;  1ZW2 A;  1YJG A;  2FFH A;  3RVY A;  1NSG B;  2J7P D;  2YEV A;  5JP7 A;  3PMR A;  4W8P A;  5DQT A;  4LDQ A;  2Z15 A;  3T6J A;  3WG7 C;  1FFT C;  1MMD A;  3NKE A;  3W2W A;  4YL0 A;  1D0Y A;  2Q3T A;  2FAP B;  3L0I A;  2WL8 A;  2AP3 A;  3O10 A;  2I8B A;  1J8M F;  4AX2 A;  4Q4Z F;  2VC9 A;  3SXY A;  4NTB A;  3PDM P;  1PD0 A;  1EQ1 A;  3S0X A;  3CSK A;  2HSQ A;  3VM6 A;  2OG2 A;  2HMQ A;  2A6E F;  4Z9I A;  2LFF A;  1D1B A;  1VB5 A;  2KYH A;  2Y69 C;  1NLX A;  4U5B E;  4B6I A;  1LS1 A;  3EGX A;  4K0D A;  2UUI A;  2W4M A;  4BJ6 C;  2AVK A;  2BE5 F;  2ZXW C;  4IGG A;  1OR3 A;  3JSZ A;  1SMY F;  2KK1 A;  3AG1 C;  3LJB A;  3TK0 A;  4F4B A;  5L0H A;  3B9Q A;  2Y39 A;  1Y4C A;  3JYH A;  3U3B A;  1I5N A;  2P6V A;  3V5Y A;  3NYL A;  1HMD A;  1LVK A;  1NFN A;  1ORS C;  3ITF A;  2XLW A;  1LI5 A;  4U5H A;  4YL3 A;  1G5Z A;  1VK5 A;  2M64 A;  4K7B A;  1FFH A;  4BJ5 A;  3KL4 A;  1NBB A;  1QVX A;  2YVK A;  1IW7 F;  1LS4 A;  2CYD A;  2YLI A;  3NDB B;  2ICW G;  3ZTM A;  3U8P A;  4RD9 A;  4YT8 A;  3NMI A;  1VLT A;  5L3V A;  3V5Z A;  1JRA A;  3MFN A;  1MMA A;  4FWV A;  1WN0 A;  1LI7 A;  3EZH A;  4XPY A;  3LUT B;  3AJM A;  2JD3 A;  4CSA A;  3OA1 A;  2OEX A;  5DLJ A;  3U9M A;  3V7O A;  1E84 A;  3N0T A;  4KBL A;  5EHH A;  3RH3 A;  1BR1 A;  2XL8 A;  4JEB A;  3TOM A;  4OD5 A;  4D4X A;  1DOV A;  1KNY A;  2VCB A;  3LLK A;  3MBG A;  4DBR A;  1QLE C;  1ZW3 A;  4MW3 A;  4JUR I;  3ZG1 A;  4XQ1 A;  4DVZ A;  4G7Z F;  2R05 A;  5A6K A;  4PK4 A;  1ZU4 A;  2EIL C;  1V54 C;  3TJ6 A;  3GOD A;  3X1O A;  2YQY A;  4G78 A;  1T6U A;  2X0C A;  2PNO A;  2LK4 A;  2DI3 A;  1V55 C;  4MW8 A;  5HV9 A;  5JUA A;  3ABL C;  1O3U A;  4PJM A;  4MND A;  4MVS A;  1FMW A;  3PCV A;  2XSE A;  2NUP A;  4XEF A;  3DZA A;  2A68 F;  3FXH A;  5BUO A;  1LKX A;  1VLS A;  5JVE A;  4UDV A;  3NMK A;  3JSE O;  3LLI A;  1Z63 A;  3O55 A;  2WVN A;  1TWH A;  2IXN A;  3KYI A;  4JJG A;  4PJJ A;  2Y3B A;  4J7Y A;  3EFO A;  5HSW A;  3OEO A;  4DRH B;  2DB4 A;  2QY9 A;  2R02 A;  4Q7C A;  4E7S A;  2KW3 C;  4CS8 C;  2E87 A;  5D91 A;  5COF A;  1D0X A;  3DE9 A;  1WGW A;  3NYM A;  4XLN F;  2W45 A;  3DI5 A;  3GM1 A;  2GWW A;  4YWQ A;  1WAS A;  2CW0 F;  3C63 A;  4AL0 A;  4CIP A;  5K0I A;  1CPR A;  2D4U A;  5B1B C;  2IXP A;  5DVW A;  2J0W A;  3M15 A;  1JR8 A;  3B0P A;  4EKW A;  1HE1 A;  2CNW A;  5COM A;  3DWW A;  2OU6 A;  3G4X A;  3LS1 A;  1OKK A;  1M56 C;  1ZHX A;  4PJL A;  4C3B A;  3ECS A;  4EBB A;  4JCZ A;  3NKD A;  1HE9 A;  4U5E E;  5DS4 A;  2PBE A;  1BBH A;  1Y6D A;  4BEM J;  3QW1 A;  4QI0 A;  2GDC A;  4MS2 A;  2P7V A;  4EUK B;  4E7Z A;  2XRH A;  3DM5 A;  4N06 A;  2Y3G A;  3VF0 A;  5IY5 C;  2W9Y A;  2W4B A;  1PD1 A;  5T3W A;  5JSL A;  4BJ1 A;  5KYN A;  2A69 F;  1FMV A;  1JAF A;  2I15 A;  1YZA A;  4G7H F;  3L8I A;  3C8G A;  5L3Q A;  3U2L A;  2WZL A;  2IOQ A;  5CIV A;  3TJ5 A;  1F1M A;  1FTS A;  3NYJ A;  5EGY A;  2XXA B;  1BR4 A;  1RKE A;  4JW1 A;  2R25 A;  1BR2 A;  1L7C A;  1OR2 A;  2EPK X;  3C62 A;  3FOO A;  4R32 A;  5KYU B;  1TFK B;  2L6H A;  3RIP A;  1XZP A;  1H9G A;  1D1A A;  2EPL X;  5D92 A;  3RQG A;  3HNK A;  1Q0M A;  2Y3D A;  3IQ6 A;  1S7Z A;  1Q0G A;  4KC9 A;  2Q7R A;  3S9O A;  3TQO A;  3U8V A;  1ZYR F;  2PX3 A;  1E85 A;  4DBQ A;  4Z9J A;  1O87 A;  1OCR C;  1NU7 D;  1HW1 A;  5EK0 A;  2QLA A;  2WVQ A;  2J46 A;  1PV3 A;  2LQG A;  3I4U A;  1JOG A;  2GFH A;  3JTL O;  2OKU A;  4LDR A;  4O6M A;  4XEV A;  3JYY A;  5TJ5 E;  2NUT A;  1G4U S;  1VYK A;  5DQZ A;  2R7S A;  1LE4 A;  5KYX B;  1J8Y F;  2PP4 A;  1T6I A;  2VH3 A;  3GAN A;  3M79 A;  2OJQ A;  2YWA A;  3SXM A;  4D4N A;  2J7P A;  2J9W A;  3M1C B;  3JRM O;  2NSG A;  3EG9 B;  1OW6 A;  3S90 A;  2XXA A;  4MQ9 F;  3DD7 A;  4PJN A;  2RD9 A;  2R03 A;  5KYU A;  3HNI A;  2ZPA A;  1TFO B;  1WWP A;  2PFD A;  1CGM E; 
#chains in the Genus database with same CATH homology
 2R7X A;  1M57 C;  3W8H A;  2EIN C;  3UNG C;  4O7G A;  1ST6 A;  3EGD B;  3OWT A;  3W2V A;  4U5G A;  3KH2 A;  4LLE A;  4HFK B;  3EHN A;  4OIN F;  2J9V A;  4WJ0 A;  4HEA J;  4FES A;  3AG2 C;  3VYW A;  3Q7L A;  1TWA A;  2IYL D;  1VMA A;  4CS9 C;  1TKN A;  2FGY A;  5F5F A;  4OIR F;  2J9U A;  5KYX A;  4CBE A;  3RKO F;  2EIK C;  4XTK A;  4IRU A;  4O79 A;  4C3E A;  3EG9 A;  1JPJ A;  1QZX A;  2Y3H A;  3HLZ A;  3Q7G A;  1D1C A;  4W8K A;  5KYW B;  4M63 A;  2KGO A;  2Q9C A;  1Z5Z A;  3EGD A;  5CI8 A;  3S29 A;  4XLP F;  1O5H A;  2WZF A;  1ZHT A;  2R7V A;  4HE8 D;  3FHD A;  5FCL A;  2ZXR A;  4RDA A;  3HJC A;  4G7O F;  4YT4 A;  1TWC A;  4PFP A;  2G62 A;  3ABM C;  1SZI A;  3UGP A;  2R7U A;  2DYR C;  2R7W A;  1ZU5 A;  4OIP F;  4Q5S F;  4JZA A;  1Z3I X;  2R7Q A;  2H7O A;  2PX0 A;  1SF8 A;  3AG3 C;  3EH2 A;  3EHM A;  1G8X A;  4U5C E;  1MND A;  3ZIB A;  1IZM A;  3AQB A;  2DGJ A;  1VOM A;  3SEO A;  3B0U X;  5KYW A;  2LSE A;  4DVY P;  2A1D D;  3KKB A;  4C3D A;  4GYT A;  2G3V A;  3JT1 A;  5DS6 A;  3DXJ F;  2Q9B A;  1Z6A A;  2CNW D;  3S27 A;  3ZC4 A;  2YHS A;  4BJ6 A;  4ZLD A;  2IXM A;  1OKK D;  4NY3 A;  4XWJ A;  2WZG A;  3SYN A;  1MNE A;  4BJ5 C;  2VB6 A;  2QTV A;  1VYI A;  3EH1 A;  2HV6 A;  3DJU B;  4PFO A;  2B0J A;  3N2Z B;  1M2V B;  2R7R A;  1D0Z A;  4X0R A;  2Q9A A;  4JCH A;  4I1O B;  4EWC A;  3FAJ A;  3LAY A;  4DOZ A;  5KYY B;  4CSA C;  3K66 A;  4YJW A;  4P6I C;  3MLG A;  4ZLC A;  3K6B A;  4ULW A;  4O6Y A;  4JJF A;  3EGX B;  4OD4 A;  2H7V C;  1MMN A;  5T3T A;  1NZE A;  3DJN B;  2EIJ C;  4LLC A;  3DAF A;  2R7O A;  3E70 C;  3FVY A;  2DYS C;  2HV7 A;  4BG0 A;  2KJG A;  3JRT A;  1M2V A;  2EIM C;  2KNH A;  4I44 A;  2OCC C;  2G3K A;  4U5D E;  4RBN A;  3AQC A;  3S28 A;  5KYY A;  3DAG A;  2CDQ A;  2D5R B;  3NRH A;  1ZHY A;  4CS8 A;  3WOD F;  2M4E A;  3O39 A;  1TR2 A;  2V3C C;  1OCC C;  3ABK C;  3Q6M A;  3ASN C;  3DMD A;  2A6H F;  5E3C A;  3K7D A;  4H4K C;  1TWG A;  4J30 B;  1OCO C;  2MWQ A;  5E3A A;  3I5P A;  2J45 A;  3H65 A;  3UMH A;  5B1A C;  2WVO A;  3SZR A;  2PF4 E;  4BJT A;  2IXO A;  3EQL F;  2NUP B;  4U5F E;  2ZXP A;  4CS7 A;  2H7B A;  1RJ9 B;  4A2N B;  1NG1 A;  4GEH A;  4J32 B;  3EFO B;  3RFY A;  4ANJ A;  4O6N A;  3CQZ A;  3MX3 A;  3Q6N A;  1Z23 A;  3AG4 C;  3O6X A;  2L9J A;  5E2Q A;  4AE4 B;  4KNV A;  3EPV A;  4QI2 A;  2C03 A;  4OIQ F;  4I1M A;  5T1D B;  2VAS A;  3UMI A;  4CIH A;  1ZHZ A;  3F47 A;  3E9V A;  4JVS A;  3UMK A;  2YZS A;  3KMI A;  2X51 A;  3PHF 2;  4QDL A;  3K33 A;  4IJJ A;  3RYL A;  3NG1 A;  2XL4 A;  3LNR A;  3LES A;  2NG1 A;  5B3S C;  2KQ9 A;  3QZC A;  3ASO C;  1RJ9 A;  2V26 A;  4YT5 A;  3N24 A;  3I5Q A;  4HFF B;  4IAO A;  3UGO A;  3TD7 A;  4KNW A;  3SNH A;  3X2Q C;  2L81 A;  3LS0 A;  4AE4 A;  2MYS A;  1JPN A;  2WB7 A;  3FDQ A;  2R7T A;  1N1C A;  2J0X A;  1PCX A;  4C7O B;  4LAC B;  3UR3 C;  3CZ6 A;  3F46 A;  3VAY A;  4CS9 A;  1M2O A;  2NUT B;  4FX5 A;  3T6B A;  4LER A;  1NU9 C;  3IEE A;  5CI9 A;  3ZVR A;  3SP1 A;  3EZI A;  3JCU Q;  3ZSU A;  4KI2 A;  4IWB A;  3POV A;  3QMK A;  3K1I C;  4BEJ A;  5E33 A;  3DM9 B;  2O9X A;  5F5H A;  3K1H A;  3EJN A;  3W8I A;  4G0H A;  1W2W A;  3L34 A;  2CGE A;  4YT2 A;  1MMG A;  1KU2 A;  3T4R A;  2ZXO A;  3LEV A;  4YN0 B;  2C04 A;  3B0V C;  1OCZ C;  4I3M A;  1ZHW A;  3HTK C;  5DS5 A;  4C7O A;  2FFH A;  2J7P D;  2YEV A;  3PMR A;  5DQT A;  2Z15 A;  3T6J A;  3WG7 C;  1FFT C;  1MMD A;  3NKE A;  3W2W A;  1D0Y A;  2Q3T A;  3L0I A;  2WL8 A;  2I8B A;  1J8M F;  4AX2 A;  4Q4Z F;  1PD0 A;  3S0X A;  3CSK A;  2OG2 A;  2A6E F;  4B6I A;  1D1B A;  2Y69 C;  4U5B E;  1LS1 A;  3EGX A;  4K0D A;  4BJ6 C;  2W4M A;  2BE5 F;  2ZXW C;  3JSZ A;  3LJB A;  1SMY F;  3AG1 C;  4F4B A;  3B9Q A;  2Y39 A;  3JYH A;  4AK9 A;  2P6V A;  3NYL A;  1LVK A;  3ITF A;  4U5H A;  1VK5 A;  4K7B A;  1FFH A;  4BJ5 A;  3KL4 A;  1IW7 F;  3NDB B;  4RD9 A;  4YT8 A;  5L3V A;  1MMA A;  4FWV A;  3EZH A;  4CSA A;  2JD3 A;  3OA1 A;  5DLJ A;  3V7O A;  3N0T A;  4KBL A;  5EHH A;  3RH3 A;  1BR1 A;  4OD5 A;  3LLK A;  4DBR A;  1QLE C;  4G7Z F;  4JUR I;  3ZG1 A;  4DVZ A;  4PK4 A;  1ZU4 A;  2EIL C;  1V54 C;  3GOD A;  3X1O A;  1V55 C;  3ABL C;  4PJM A;  4MND A;  1FMW A;  2XSE A;  2NUP A;  3DZA A;  2A68 F;  5BUO A;  1LKX A;  1Z63 A;  3LLI A;  2WVN A;  1TWH A;  2IXN A;  4JJG A;  4PJJ A;  2Y3B A;  3EFO A;  5HSW A;  3OEO A;  2QY9 A;  4Q7C A;  4E7S A;  2KW3 C;  4CS8 C;  2E87 A;  5D91 A;  1D0X A;  1WGW A;  3NYM A;  4XLN F;  2W45 A;  4YWQ A;  2CW0 F;  5B1B C;  2IXP A;  5DVW A;  2J0W A;  3B0P A;  2CNW A;  3LS1 A;  1OKK A;  1M56 C;  1ZHX A;  4PJL A;  4C3B A;  3ECS A;  4EBB A;  3NKD A;  4U5E E;  5DS4 A;  4QI0 A;  4E7Z A;  2P7V A;  2XRH A;  3DM5 A;  4N06 A;  2Y3G A;  5IY5 C;  2W9Y A;  2W4B A;  1PD1 A;  5T3W A;  4BJ1 A;  5KYN A;  2A69 F;  1FMV A;  4G7H F;  5L3Q A;  2WZL A;  2IOQ A;  5EGY A;  2XXA B;  1FTS A;  3NYJ A;  1BR4 A;  4JW1 A;  5KYU B;  1BR2 A;  4OIO F;  3RIP A;  1D1A A;  5D92 A;  2Y3D A;  1S7Z A;  4KC9 A;  1ZYR F;  2PX3 A;  4DBQ A;  1O87 A;  1OCR C;  1NU7 D;  2WVQ A;  2J46 A;  3I4U A;  2GFH A;  4O6M A;  2NUT A;  5DQZ A;  1VYK A;  2R7S A;  5KYX B;  1J8Y F;  2PP4 A;  2VH3 A;  3GAN A;  2J7P A;  2J9W A;  3M1C B;  3EG9 B;  2XXA A;  4MQ9 F;  3DD7 A;  4PJN A;  5KYU A;  2ZPA A;  2PFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...