3RKQA

Nkx2.5 homeodomain dimer bound to anf-242 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human NKX2.5 homeodomain in complex with DNA target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Homeobox protein Nkx-2.5
total genus 21
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rkqA00
4MFEA 5EGOB 2XRLA 1UG2A 4JX4A 4FISA 5F0FA 1BA5A 5F04A 1ZR2A 3O8GA 1T33A 4AC0A 2DA1A 3ZQHA 4EEFG 3JRGA 2DN0A 4B4CA 1IJWC 2H8RA 4A3KJ 5BNGA 1OCPA 2LR8A 3BTIA 4IHVA 3JRIA 3S15J 2CJJA 5EZHA 5IYCJ 4AUXA 1ZQ3P 3SFIA 4D5FA 2CQQA 3GTPJ 3HOWJ 2MG4A 4S0HB 2R5ZB 2KDZA 2L7MP 4JYKA 3BR6A 4B3AA 4A3MJ 2FD5A 1ITYA 2DA3A 2R5YB 4XIDA 3JRAA 2NS7A 5FKNA 2E2JJ 2Y2ZA 3BR3A 5C44J 2VUMJ 2Y31A 2HI3A 5F0CA 4DW6A 4XICA 1A5JA 1IGNA 3B6AA 1IC8A 2LFBA 5IP9J 1LFUP 1YRNA 2NVXJ 2Y9ZA 3CCYA 2R5ZA 4V2FA 4A3BJ 3H3VK 1ZR4A 4UUSA 1APLC 2EQRA 2L7FP 3LOCA 4RBOA 3HKZN 3PO2J 3FKIJ 2E2IJ 3QQAA 1QPIA 1JTXA 2FQ4A 3HGGA 5FKOA 1FIAA 1MH4A 3FK7A 1AKHA 3JRBA 2LK2A 4BY1J 2IAIA 3OSGA 2GBYA 3Q0VA 5JLWA 3RKQA 2EZLA 5K7ZA 5IP7J 3JRCA 5J3LA 2WV1A 2R92J 1BL0A 3MKLA 3ZQCA 1W0TA 3S2DJ 2DA6A 2DA2A 4ABZA 5EEAA 3GTQJ 1HF0A 3E7LA 1JJ8C 2XPUA 4LOCA 2VKEA 5F0HA 1VFCA 3TEDA 4XK4A 2HOSA 5M3FJ 4C2MJ 2MGQA 1U9NA 5E3LA 4JX6A 3LSRA 2IEKA 4I76A 5IPAA 3NARA 1B72B 2XGCA 3JRFA 1JUMA 5EF6A 4MO7A 3RQIA 1POGA 3IH2A 3LSJA 1ETQA 4BBSJ 5M5YJ 1ZK8A 1GDTA 2R5YA 4X1EA 4XRSG 1H89C 1X2MA 3S14J 2K40A 3NAUA 1FTZA 3SDGA 3FIWA 1ETVA 3A01B 2HXOA 2KT0A 2LLKA 4RDUA 2JA5J 4MLOA 2DMPA 1T56A 1ENHA 3G1LA 1FIPA 1YRNB 4JX5A 2Y30A 1FEXA 1GV5A 1RKWA 5C4JJ 2JWTA 4NDLA 1MSEC 3O8HA 2M8GX 1I50J 4QTRA 3BQYA 3JRDA 2DA5A 1IUFA 1RPWA 1UMQA 3A01A 1WPKA 3S2HJ 1TWFJ 3QPLA 1OCTC 2NVYJ 5EG0B 1SANA 1JUSA 3S17J 4D7NA 3HDDA 2HYJA 4G12A 1RR7A 2HOAA 3TW6A 5E3MA 3HOYJ 2XSDC 1HDPA 3JRHA 2DA7A 3L1PA 1JGGA 4Y52J 3BT9A 4FCYA 4X6AJ 5IOYA 4D7MA 2DMNA 2XB0X 1GV2A 2CUFA 3OOUA 5IYBJ 3HB9A 3MN2A 2FJ1A 2R7ZJ 1Y1WJ 4A3LJ 1QRYA 1B8IB 4A3FJ 5E3OA 5EDNA 1F36A 3Q0UA 2L7ZA 1D5YA 2X9DA 1X58A 3DCFA 1VF9A 1Z77A 2M34A 2VKVA 3OIOA 1MBJA 1JUPA 3K2AA 5J1UA 3BQZA 2CRGA 2DTZA 2ID6A 3BR1A 3B6CA 1GT0C 1P7JA 2Y9YA 4DZPA 2D5VA 1WCMJ 2RAEA 2VPRA 4M3EA 3LSPA 3I4NJ 4V2GA 2XGEA 1I6HJ 2Y0SN 1W0UA 1JT6A 4IEJA 2MW8A 2AO9A 4B1RA 1K61A 1ZGWA 2YS9A 3GTGJ 2CU7A 2JA6J 2OF7A 1IV6A 3CQZJ 1QVUA 1BW6A 5F08A 4A3GJ 2NVQJ 3F0CA 1UHSA 4FE7A 4CYCA 3HM5A 2JA8J 2HDDA 1VNDA 1U78A 2EBIA 2X6OA 1JJ6C 2JA7J 3GBGA 2ME6A 2LVSA 3D1NI 3CMYA 1K83J 2M9HA 1FJLA 1VI0A 4L5EA 2NS8A 2OPTA 1H8AC 2LY9A 2I10A 3BG5A 4AYBN 2O8KA 5F27A 3HBLA 4M6VA 4A3CJ 2AHQA 3TP0A 1O4XA 4J19A 2GLOA 1HOMA 2CUEA 4M3BA 1MBHA 1JKPC 2K9NA 2ECBA 2JN6A 3M3YJ 4C3IJ 4CYCB 3S16J 1U9OA 4UUTA 1MNMC 2E1OA 1JKOC 2YUSA 5EYRA 1HDDC 4GFBA 4UUSB 2G0EA 1HLVA 2NVTJ 1B8IA 4BY7J 1ZKGA 5EZGA 4I6ZA 1AU7A 5IYDJ 5F1JA 4DZJA 1BJZA 1U8BA 5FKMA 3BG3A 4Y7NJ 4A3IJ 1WI3A 1JTYA 3BR5A 1TWGJ 2ZB9A 4FE4A 5DTDA 3IH4A 3RZDJ 2XPVA 2B63J 2M2EA 3DEWA 5FLVA 4JP0A 3ZQFA 5IOZA 5M3MJ 2R0QC 2K9QA 4A69C 2N8GA 1JKRC 2YU9J 1JKQC 3S1QJ 1HCRA 1ETXA 1G2HA 5EG0A 1LE8B 3GTLJ 2HQ5A 4C3JJ 1JT0A 1S7EA 1NK2P 2QCOA 2FX0A 2EZIA 1LFBA 3GTOJ 3HOVJ 1IG7A 2COBA 5FKKA 1TWCJ 4W97A 4BXXJ 1PUFA 5EGOA 1RESA 4IHYA 4XRSA 2H1KA 1Y1VJ 3BTLA 3I4MJ 1ETOA 2DMQA 1F43A 3BTJA 5C4XJ 3JR9A 2XB5A 3ZQLA 3M4OJ 2ME0A 4DYRA 2LD5A 3BR2A 1E3OC 1I3QJ 2E19A 2X48A 4XRMA 1AKHB 1BW5A 1QVTA 1LE8A 2HXIA 3K7AJ 2WAQN 3HOXJ 3TP3A 3LSGA 5FJ8J 2QF7A 5FLMJ 1XG1A 1NTCA 1GVDA 1OFCX 1IDZA 1ETKA 4A3EJ 2CQXA 1WH7A 5C3EJ 3IV5A 3W6VA 2HOTA 3S1NJ 2DJNA 1A6IA 2EZHA 1TWAJ 3H0GJ 3C2BA 5FKLA 2K9SA 3BG9A 4BBRJ 2P81A 1P7IA 2LP0A 3ZOBA 3IH3A 1SFOJ 3HOUJ 4MIMA 5M5WJ 1H88C 3SJMA 3GTMJ 2WB1N 3A03A 3VPRA 2EH3A 2DMTA 2E2HJ 3QPSA 2DA4A 4BKXA 4HNVA 1B72A 4A93J 1MBEA 4MFDA 2JJ7A 3FISA 4M3FA 4D5CA 2L9RA 3S1MJ 3PM1A 5JLXA 9ANTA 5GPAA 2NOGA 4QSHA 5GPCA 1Q1VA 2IBDA 1DU6A 3PO3J 4M3DA 2O9LA 1AHDP 2R93J 5K7FA 2O7OA 3G1OA 4QIWN 5J1YA 5GP9A 3UKGA 1R9TJ 2XGDA 1RKTA 3Q0WA 2TRTA 3RZOJ 1Z0XA 3Q3SA 3JREA 2LTPA 5K7HA 5J1RA 3HGYA 1MBKA 2PMZN 1IDYA 1EF4A 1MH3A 4W1UA 1MBGA 1XC5A 3FK6A 4A3JJ 1FTTA 2JK3A 1WH5A 1IRZA 2DMUA 2M0CA 3GTJJ 2EZKA 4A3DJ 1TC3C 2L0KA 4M3GA 3OSFA 1XS9A 1ETWA 1NK3P 1MBFA 1ZTRA 2XPWA 3G1MA 2JMWA 3HEFA 3WHBA 4IHWA 3HOZJ 3WHCA 3TW7A 1OJLA 2ELKA 1X2NA 3CDLA 3S1RJ 1ORKA 1RETA 5DS9A 5IP6A 3A02A 2TCTA 1GUUA 2VI6A 3ZQIA 5M5XJ 3MVPA 1ETYA 2ECCA 5E3NA 1TWHJ 4IHXA 4C3HJ 1WGXA 2MSYA 2ID3A 4DYCA 1PUFB 3LNQA 3BR0A 2W48A 3ZQGA 2LKXA 3BTCA 1DU0A 2GM4A 1CQTA 4DYQA 5HODA 1MSFC 4FTHA 3GTKJ
chains in the Genus database with same CATH superfamily
4MFEA 1MMSA 5EGOB 2ZSIB 3HYIA 3OV8A 5D5VB 2DTRA 3EUAA 1V5GA 2ISYA 5F0FA 5F04A 2XAHA 4ZYEA 1T33A 4M6YA 2CSOA 2ZFUA 3LSHA 3KCCA 4XNFA 1LNWA 5K5RA 1IJWC 2ZJQF 4EM0B 1ZELA 3BTIA 2KPMA 3TO7A 3I59B 5IYCJ 3OOPA 4A12A 2GIZA 3CF2A 2I5UA 2LOOA 3HOWJ 1UZCA 1O3SA 4A2UA 4DNCA 4BH9A 2W4SA 4A3MJ 2WAEA 1ITYA 5FB2A 2E2JJ 1U6GA 1DGRM 2K86A 5C44J 4HLXA 3ASOH 2O03A 1WJCA 3HUGB 4BACA 4U0YA 5HOOA 4ITVA 2IGMA 5E1WA 2VPLA 1XB4A 1IC8A 4DQ2A 2NVXJ 3MAJA 5LHHA 4PJJA 3I55I 3F21A 4A3BJ 3RSNA 4IL6C 3K70D 1ZR4A 3H3VK 4R8HA 4L9JA 3E6MA 4WX9A 3I0TA 3K2ZA 2CQKA 2BV6A 1T0FA 2L7FP 2Q1ZB 3CDIA 3RKWA 2MLKA 4CCJA 2F5CA 3EYYA 2E2IJ 2K27A 3QQAA 1Z05A 3S3NA 4F91B 1JTXA 3I53A 4HSTA 2DK8A 1QZEA 3CCJI 1G8XA 3M8JA 3BZKA 1D8KA 1ZGJA 2H1LA 2CW8A 3DTKA 3RPUA 5LEKA 3OYJA 2IAIA 3WTYC 3RYRA 3Q0VA 2X1CA 2EZLA 2COMA 3JRCA 1N75A 1Y6IA 2LC2A 1F5TA 1FLIA 4NHJA 4XORA 3ZQCA 2DA2A 1ZGAA 4ABZA 1ZAOA 1A04A 4LOCA 2VKEA 2X85A 3BZCA 3TEDA 2LY1A 1GHCA 3IWFA 1LVKA 2XV4S 2VKDA 3K1PA 3LA7A 3NARA 4A6EA 4RGSA 5FD6A 3DLLF 1YW9A 3T0YA 4AVPA 4ANJA 5B1AH 5CLSA 3IH2A 4ZDPA 2PX9A 5HLHA 2VE9A 2IGKA 4BBSJ 3FXJA 1HKQA 1GVJA 2E7WA 2LSOA 1ZK8A 4K2EA 3OYEA 5GAHJ 4O6JA 4LB5A 2RDPA 3DTIA 4CCKA 4NB5A 4AU7A 3K4LA 2V26A 3RCOA 4RDUA 4OAZA 4BS9A 1VQ8I 2JA5J 3SFZA 2K3PA 1OLTA 3AKZA 1ENHA 2MFZA 1YRNB 1BR1A 3L9FA 4JX5A 3K70C 3F6VA 4C30A 4E7HA 3ABLH 5LRSA 1RKWA 4UVCA 3PSFA 2L2OA 1MSEC 1WVRA 4Y15A 1I50J 4QTRA 2V9PA 4Q48A 1IUFA 3A4CA 2KISA 1KU3A 1U3EM 1RPWA 2IW5A 3S2HJ 1X1AA 2OTJI 1OCTC 3H92A 5J4YA 1OYWA 5TISC 3TDUC 1XSVA 2BW3B 3TW6A 1X1BA 4LLGF 2DYRH 2XSDC 1ZREA 1RC9A 4ZH4F 3PJRA 3E6DA 1KA8A 1R4MB 3JRHA 4LJZF 3BT9A 4L5IA 4L0YB 3OL3A 5IOYA 2M7AA 5DD4A 2DMNA 2XB0X 4ZDLA 1GV2A 2GIVA 3M8EA 1UELB 5ERIA 3RKYA 2FJ1A 4D9JA 2STTA 1S72I 4P1WA 2VT3A 4P55A 3PSIA 4XOPA 4DBRA 2QEXI 1K78A 4A3LJ 1F36A 2L7ZA 3OYNA 2X9DA 2GWRA 2WV0A 3TKYA 2M34A 2VKVA 3GX4X 1TNSA 4EGYA 2XRNA 3EUKL 4OOIA 3L00A 3BQZA 4H4KC 4F7ZA 2DTZA 3CCMI 2QKMB 4LIVA 4RMNA 1GT0C 4KDPA 1MNDA 4OIPF 1UHWA 3P9KA 1G3TA 1YLFA 5E8GA 4AIJA 3W2VA 4ZDOA 4I01A 3OYIA 1T2KA 1E0EA 4PCQA 5AONA 1XMAA 2KRCA 2EILH 4GGGA 2IS2A 2AO9A 3L2WA 1QU3A 1ZGWA 4XKVA 1A35A 1VQ5I 4GXOA 1LPQA 4KIBA 3IUOA 4XBFA 2DPDA 3AG4H 2FNAA 1QVUA 3CQZJ 2OZ6A 4DIQA 5ILSA 4KMUX 1H9GA 1FPQA 2DAOA 2KKOA 2GA2A 1W36D 5LRRA 2LH9A 3C2GA 2V6CA 3R0AA 2W82A 4RM2A 3I5UA 2XHKA 1YQAA 5F64A 3SZPA 2ME6A 5J47A 3W2AA 3SZTA 3D1NI 4XKWA 4IOAF 3GFLA 2V9VA 1QNTA 1FJLA 2NS8A 2Q0OA 4LMYA 2OPTA 2F5VA 1ZRFA 2I10A 2OV7A 3CC7I 1BOBA 4AYBN 1AWCA 2R7OA 2BHYA 1KU7A 3RKXA 2GLOA 1REPC 4QWQA 2CUEA 4UUVA 3FXMA 4BJTA 4G7OF 4P5OA 2IP2A 1JKPC 3CDHA 3MZYA 3GLXA 1SFXA 4C3IJ 1HW2A 2Y0SA 4N9IA 4CYCB 3T8TA 1KU9A 2R4GA 4UUTA 4ZYGA 1UG0A 2HYGD 2EV0A 2PJRA 2FBHA 1OCOH 2VXZA 4PK4A 4KFCA 1VTNC 4PDKA 1WJ5A 1P6RA 1X3WB 1SD5A 2MLGA 4I6ZA 1SVMA 3JTGA 1GLNA 4LB6B 1U8BA 5FKMA 4Y7NJ 4A3IJ 2CGPA 4FETA 4DBQA 5DTDA 3IH4A 3RZDJ 1R36A 2XPVA 4HDUA 2VONA 3V8JA 2B63J 4LG0B 4JP0A 5IOZA 1BJAA 1BN5A 5M3MJ 2FNPA 2R0QC 1SC7A 2K9QA 1G59A 3WGIA 2N8GA 2DW4A 3GYHX 1ETXA 1G2HA 3ESWB 5EG0A 1G4DA 2HQ5A 2CFOA 1T6SA 2R7SA 1KONA 1NH3A 1FNNA 2QCOA 3N97A 1USSA 1V5FA 2FX0A 3ROUA 1U8RA 4R79A 2BY1A 2NRAC 2F5EA 3GTOJ 2OA4A 2HEOA 2COBA 2WA0A 4W97A 3FKJA 1PUFA 3NEUA 2QGUA 2K9MA 4YIRX 3AFHA 1G6NA 2KRFA 2QSFX 3BTJA 5TGTA 3MWMA 4XN3A 1QGPA 2ME0A 4DYRA 2D45A 3AL0B 1I3QJ 1ZARA 3F8CA 1LVAA 4ZYHA 1PDNC 2BOLA 3P9CA 4X0GA 1LE8A 3TOBA 2WAQN 3M1CA 4BQAA 5D5WB 3WTVC 1R00A 4RLQA 2QF7A 5FLMJ 3OYFA 1JHFA 3ABUA 2OCEA 1NTCA 3OIQA 1K6YA 5LEJA 2RV8A 2XC7A 4XRFA 3F8NA 1ETKA 2XAQA 4OIQF 3HXLA 3F23A 2CQXA 1XCVA 1WH7A 5C3EJ 3HHHA 3M07A 3CCEI 1VQ6I 2HOTA 2HZTA 2DJNA 2W57A 2EZHA 2VLAA 3H3UA 3C2HA 3BG9A 3OR1C 4BBRJ 1OPCA 2VB6A 1T0FC 1KGSA 4S04A 3E97A 3HOUJ 4MIMA 2Z5UA 1ZYRF 3IKTA 2HNHA 1OYIA 2DMTA 2ZXHA 3QPSA 1KU2A 2UZKA 2DA4A 3KZYA 4BKXA 4A93J 1MBEA 4G9YA 2PQ8A 5CQEA 2AQFA 1XDSA 3DPLC 4PFPA 4M3FA 4D1QA 4D5CA 4PJLA 3DLAA 5KK1A 3S1MJ 2JQ7A 1VZ0A 3UNGC 4I2OA 2KP6A 3GLLA 1S7AA 3JAMZ 2ZMEB 5GPAA 1VQ9I 4LFUA 1FSEA 4XONA 2G7UA 4WXCA 3FHZA 1A31A 3VODA 5GPCA 1FBQA 1XCBA 2VXDA 3E5UA 1DU6A 3DEUA 1P4XA 2E71A 2OU2A 2RN7A 3N05A 3OYMA 4BAYA 4M73A 4NUBA 2LMDA 2QLZA 3UKGA 2ESHA 2XF5A 2XGDA 3BCAA 1J0RA 2ZJRF 3CUQA 1Z0XA 3CCRI 5K7HA 3FXLA 1IN6A 4OAYA 2BYVE 1HSJA 6PAXA 3RPQA 1MIJA 3KP6A 2P5KA 4A5MA 4W1UA 1PP7U 3VOEA 2HGCA 1FTTA 1ODDA 4EV0A 1IRZA 2EZKA 3LA2A 1H0MA 4L0ZB 3L09A 2OBPA 2WBMA 3BLYA 3Q9SA 4HG2A 5CKTA 2KZVA 1KQ8A 2A69F 4RLFA 3HEFA 1YTYA 4I98B 4LG0A 1T95A 3HOZJ 1RNLA 4ZTJA 4WK8F 1XMKA 4HW0A 2Z3YA 3S1RJ 2EIJH 3GXOA 3MEXA 1GUUA 2E35A 3PFYA 3MVPA 4F52A 4RAZA 1QA6A 1WGXA 2ID3A 4DYCA 1DP7P 1YYVA 4Q5SF 3FM3A 1XX5A 3BTCA 4OU0A 2GM4A 2MH2A 4DYQA 2V9KA 2HKOA 1U2WA 3CO6C 4NNJA 4FTHA 4EJUA 3U9GA 3HL2A 2VC0A 1WKMA 1ZG3A 4OIOF 2ZKZA 3LA3A 4FX4A 3CLOA 3L2QA 3LAJA 3JRGA 2EFPA 4E7KA 2XAJA 1W5CC 2DN0A 1XSDA 5ICCA 1MDMB 5GTHC 2H8RA 1M1EB 1YIOA 2E1MC 3BPVA 4CXFA 2LR8A 3U1KA 1UB9A 3OMYA 5EZHA 3W6KB 4MTEA 4M71A 4D5FA 2CQQA 1OQYA 2K7LA 2P6SA 3RPUD 3GTPJ 2PN6A 2MG4A 3CJTB 3O6BB 4XLEA 4S0HB 3COAC 2QQ9A 4G6TB 2XF6A 4L18B 1ZG1A 2R5YB 4XIDA 2NS7A 5FKNA 2RREA 3H9JA 4XLFA 3ZCOA 2Y2ZA 4YG2F 3QAHA 2XASA 3KYDB 3G71I 4DW6A 2HI3A 2FOWA 2BVMA 1S6LA 3CD6I 4ENNA 4I02A 3WTZA 4XKCA 3T1BA 2R7DA 2H8WA 2HZDA 4HX4A 2O0YA 2W85A 3CCYA 2P6TA 1PP8F 4V2FA 4UUSA 3DTEA 3I64A 2FMYA 2HOEA 2EQRA 4GCVA 3I59A 4YFNF 1O57A 2F4MB 3BROA 1T98A 2KIFA 1BC8C 3HKZN 2E36A 5JVTA 3KIOA 3FKIJ 3KP7A 2A07F 2JRMA 1S9HA 1V55H 3H0DA 3DPUA 1LDDA 3QPHA 1IXCA 3H36A 4RGXA 1FIAA 2M0MA 5B1BH 2HPIA 1MH4A 3FK7A 1AKHA 2LK2A 3FMSA 1B6AA 1TNTA 1Z21A 3RKQA 3KLOA 4IXAA 5F6FA 5IP7J 2K02A 4ETSA 1YOVB 3CP8A 2WV1A 4CSWA 4ZC3A 1BL0A 4EM2A 2CMPA 2DA6A 1T39A 1LB2A 1LEBA 2E5NA 1HF0A 3GTQJ 1IUYA 2V6EA 4XLHA 2GOMA 3K69A 2XPUA 3PNYA 2LF7A 1W7PD 2HOSA 4XK4A 2RQQA 4C2MJ 4JX6A 4PGGA 4XSXF 2IRFG 3GF2A 3W3CA 2FSWA 4E7ZA 3KE2A 3JRFA 2RKHA 5EF6A 1XD7A 1RI7A 2CUZA 1ZN2A 3LSJA 1ETQA 3CJQB 5M5YJ 4XRSG 1X3ZB 3S14J 3OYBA 1FTZA 3GFMA 3SDGA 1BI0A 1ETVA 4AIDA 3A01B 5IT9Z 2EK5A 5LFAA 4MLOA 5GAGJ 4ESFA 4HRIA 2P4WA 1T56A 1IZ1A 4AIKA 1FIPA 3WE3A 2L5QA 3RTRA 1ZLJA 1OYYA 2Y30A 3ASNH 2JWTA 3K4JA 3H9QA 2PEXA 5TRDA 1ERDA 2O8XA 4LLNA 1XGMA 3BQYA 3LQQA 4Y4RA 1I1GA 2EV5A 2NYXA 3A01A 1VQNI 1IRFA 1TWFJ 3QPLA 2H6BA 4B3XA 2FBIA 4NQWB 4RB1A 3DWLE 2H6CA 3HOTA 2R7FA 2HYJA 4G12A 2HOAA 1VQLI 4MNUA 5LHGA 2IXSA 3HIFA 2HTJA 1LQ1A 3AG2H 2FRHA 3L1PA 1JGGA 3AAFA 4Y52J 5HS7A 2MC3A 1XGNA 3K4MA 4D7MA 3WU1B 3MMYB 5IYBJ 2CUFA 3IRRA 1HXDA 3J81Z 3E0JB 2VOPA 2QM3A 2CW7A 2L9SA 2R7ZJ 4G7HF 1QRYA 1YHQI 4A3FJ 3FXKA 1X4OA 3RYPA 4Y33A 3ZR8X 5CVJA 3CCUI 5CVVA 1Z67A 1Z77A 1WZ2A 2UV1A 2DO7A 1TTYA 1JUPA 1Z3XA 4LGWA 2GXGA 4JBAA 1R1UA 1KYZA 3WTXC 1HA8A 1TQMA 1O3TA 1DPRA 5CYVA 3BPXA 2UXNA 1P7JA 2L4AA 4WXHA 4DZPA 1WCMJ 1EH7A 2RAEA 4G8XA 2VPRA 4M3EA 1KQ9A 2K9LA 4ON0A 3CJNA 4FASD 2XGEA 1HW5A 2JA2A 5EEGA 5FO5A 1JT6A 1U5TB 3MD2A 4B1RA 2QKLB 3WU2C 2BXYA 3GTGJ 3AG1H 4P9UA 3CF5F 2JA6J 2OF7A 1MMDA 4LITA 4HOBA 2STWA 2BGCA 5F08A 4KA4A 2L9NA 1MJAA 3WGGA 1HKSA 2PBIA 2JA8J 1Y0NA 4BDYA 1RUOA 2XF7A 1JJ6C 1HSTA 3I58A 3CMYA 1VQ4I 1K83J 2M9HA 1U5TA 1X3UA 4E4HA 2E1CA 4LG3A 1H8AC 1S5LC 1Z7UA 2LY9A 3QP5A 3MZHA 2EV6A 2IS6A 2DK5A 4M6VA 1R71A 4A3CJ 2AHQA 2JPCA 1N25A 2DPUA 3ECOA 2K5CA 3VYSB 1P92A 4C9YA 4M3BA 4A0XA 3K4KA 1MBHA 5LGNA 2QZ8A 1ONVA 1U0JA 5KVRA 1D0XA 4DGWB 4UY8I 2CQNA 4XLAA 1K78B 1JKOC 1G3WA 2M30A 3LSMA 3ERED 2JVGA 5CVUA 4G94A 4GFBA 4BDZA 3KP4A 4G7ZF 1MMNA 2W7NA 2HQNA 3SEQA 1HLVA 2NVTJ 2WY7Q 1SD4A 1B8IA 4IO9F 1ZKGA 3IC7A 5EZGA 4RGUA 3QWLA 5IYDJ 2VBXA 4II2A 4E7SA 4CZCA 1PUEE 5IY5H 3BG3A 1LUJB 3J81K 1WI3A 4HDVA 1JTYA 2ZXIA 3CMMA 1A6QA 2QVOA 2ZB9A 4FE4A 4XOTA 1LKXA 2ZO4A 3DEWA 2MD0A 4ESBA 4RGRA 2CO5A 1CF7A 4BYYA 2DFEA 1MMGA 1UAAA 3PQJA 4CH7A 2L02A 3OR2C 1NHAA 2XKPA 5KCMA 1JKQC 4EMSA 2ZMEC 1HCRA 1S29A 3GTLJ 4EJTA 2F4OB 4BE0A 4C3JJ 2JTVA 1NK2P 1SFEA 3CTAA 4PJMA 5FFXA 1VQOI 3QYEA 2KMUA 2DLLA 3I56I 1HW1A 1TWCJ 1JGSA 2E1MB 4BXXJ 2H94A 2PFBA 1Y8RB 4U0VA 1VQKI 4R1HA 3HZJA 1ETOA 3A0BC 4EJOA 5H6QA 2XB5A 3M4OJ 2VQCA 1W7PB 1E3OC 2LD5A 3BR2A 4UV8A 2P0WA 2KFDA 3V8LA 3WTUC 2LKSA 1TBXA 2HXIA 2ISZA 2O6GE 1LDKB 1IW7F 1TP4A 3LSGA 1X19A 3CMEI 3KLNA 1GVDA 4OINF 4ENKA 2Z1DA 4A3EJ 4PJNA 1TZLA 3GZ6A 2BXZA 2VKHA 1O3QA 3H0GJ 5L3FA 3C2BA 3WG9A 2XAGA 1ZRCA 1WRJA 2XVCA 5LGTA 1MJ9A 1DP3A 2LP0A 3ZOBA 5M5WJ 3EETA 5CVIA 1J2XA 2I8DA 4BHCA 3GTMJ 1FMVA 1BI1A 2WB1N 5JI6A 3OS1A 3CUQC 3A03A 3VPRA 3SHFA 4UB8C 4HF1A 1UJ8A 2OQRA 2NXNB 3ZMSA 4MFDA 1MJBA 2CV0A 4ENJA 1X1CA 5KAIC 3SYTA 2BY0A 5B66C 3JAMK 3GCMA 3S2WA 1SMTA 5B5EC 4WWCA 1W4MA 5E20A 1BI2A 4IHSA 1FMWA 2DQRA 2FXAA 4HF2A 1XPXA 1Q1VA 4Z2YA 3K4CA 3R4KA 2JPBA 4HSRA 3PO3J 1L0OC 5D5UB 2O9LA 1P2FA 1IXSB 2A61A 2QQAA 3HRTA 3LQRA 1R5HA 1IRXA 1LJ9A 3G3ZA 4YIIA 4ENMA 4ZJZA 1XDUA 4GYIA 4RB2C 2RNGA 5GP9A 1YW7A 2ZFWA 3K9TA 3H5NA 4UV9A 1RKTA 3F6OA 3Q0WA 3O3KA 2VOOA 2GXBA 2Y48A 4HNTA 5FD5A 2L7KA 1QPMA 2LY2A 1RIOH 1SFUA 3OYDA 1V3FA 2LF8A 4MHGA 4HEA2 1KZHA 4F93B 1IN5A 1XC5A 5J4VA 1R6RA 5HLIA 2JK3A 4FX0A 3OIPA 4MEXF 5FGMA 2JUCA 1D1BA 3R6SA 2Y69H 2BVLA 3RJPA 4HZFA 4EM1A 3IRQA 1XS9A 4UXNA 2Z9OA 2DFFA 2KQRA 1NK3P 1MBFA 4FQGA 2BZTA 2EJRA 3CC4I 2M8EA 3FF5A 3M1EA 5A2QZ 1FYKA 2VBZA 4ZYAA 3EUHA 2XGXA 4Q4ZF 3WHCA 2P5VA 5K5OA 1ZLKA 4XLPF 3VYRB 3BCBA 3FDYA 2ELKA 1X2NA 2K4JA 2M87A 2M4GA 1QBJA 3LSTA 2GQQA 1RETA 2EFOA 3D5LA 5IP6A 2TCTA 3QP6A 4IQJA 1FWZA 4CCLA 1YJNI 2ECCA 5E3NA 1TWHJ 2FEZA 2VT2A 4F3QA 4IHXA 3FX3A 4KITB 3B73A 3P5JA 4V19K 3LNQA 2LYCA 2W48A 4HQMA 3REOA 1LEAA 4A0ZA 1CQTA 5E1XA 4BUPA 5HODA 3DU5A 3W6JB 2Y75A 1TLHB 2WTEA 2OQGA 2HWVA 2FOKA 3GTKJ 1BBYA 1UG2A 2XRLA 4JOMA 4GRIA 2UXXA 5JHFA 1E3HA 1ZR2A 5D6EA 3O8GA 4AC0A 3J7AY 2W00A 3ZQHA 4EEFG 2OCCH 4F55A 3JSPA 4EJWA 4BXFA 4ASNA 1P4AA 4OMYA 4A3KJ 4CCMA 5DM7F 1OCPA 1FX7A 4IHVA 3HSRA 2HYFA 2QYOA 1FP1D 2CJJA 2FE3A 3S8PA 1A36A 3J80Z 2VBYA 2WAQA 3FBNB 2ETHA 2R7UA 3FXOA 2AXTC 2L7MP 1YG2A 3BR6A 3K4NA 1Y39A 2DA3A 4CCNA 3JRAA 4DJAA 2ZJ2A 2E34A 3P7NA 5H2FC 5DDGA 4EVIA 4RB3C 5A2QK 1ZRDA 1DPUA 2EFNA 2F48A 4MEYF 3CCSI 1K79A 3LFUA 4BEHB 4XSZF 1MMAA 1ULYA 1P4WA 2DT6A 3E5XA 2LFBA 2A3SA 1LFUP 1EKEA 1TQPA 1YRNA 4PZJA 2IS4A 5HNFA 4RB0A 3HHGA 2Y9ZA 2R5ZA 1J09A 3C1DA 3ISPA 2DBBA 1APLC 1RZ4A 3GWZA 2VQLA 3LOCA 3T5XA 3VSLA 2YX7A 1Y8QB 1BR2A 1R22A 1KQ0A 4M6XA 3PO2J 3BG6A 5F1RA 2YSRA 4HAMA 4M9SA 1QPIA 3H1CA 3ABTA 2QQBA 4CZZA 3LSIA 4YFKF 3F8MA 1F4KA 3L2VA 3CESA 3HGGA 5FKOA 4CO8A 3NRVA 4BY1J 1D1CA 3SDBA 5JLWA 5K7ZA 5J3LA 1U5TC 2E5ZA 1N77A 2KZGA 4G6DA 1IO2A 3S2DJ 1AOYA 2OUMA 5EEAA 2DXIA 1WJEA 1Z7LA 3E7LA 3H5RA 4TV7A 5HLGA 3CUQB 5F0HA 4XMYA 5H6RA 4D0PA 1ZHFA 3HSFA 3LSRA 3KFWX 4BQOA 2F5FA 1Z1DA 2EIMH 4I76A 3ZMZA 4N9HA 2XGCA 3OYCA 2F2EA 2HPMA 1QZYA 3PUBA 3RQIA 2KHMA 3E6CC 1YO5C 3N4MA 4I09A 2R5YA 4X1EA 3BWGA 4Y17A 1WWXA 3NAUA 4QLCU 4ZYDA 1LDJA 2CW0F 3FIWA 4PUSA 1D1AA 1V5EA 3PNVA 3WE2A 1G3SA 4KT6A 2IT0A 4B47A 1R23A 3OYKA 4NDLA 4Z6YA 1R1TA 4MQVA 2XKOA 2ZBKA 3O8HA 2M8GX 1UCRA 3AL0C 3JRDA 2DA5A 3KP2A 3TQNA 1WPKA 3OYHA 2RVCA 4M9ZA 2D2WA 2LRDA 1FP2A 2M4KA 4D7NA 3HDDA 5GAEJ 2K3FA 3TBIA 2LKPA 1YW8A 2X1EA 5LGUA 3S3MA 2QBYA 2HTSA 3TO9A 2UWMA 1Z91A 2DA7A 3V42A 3ZRGA 4XQFA 1EJ9A 3CCQI 4X6AJ 1JHHA 2X51A 3OS0A 2MBFA 2QENA 3HB9A 3OYGA 4IRGA 2Z33A 2Q8KA 1L3LA 1Y1WJ 3CMAI 2ZC2A 1B8IB 4G6QA 1WJAA 5EDNA 2X6YA 1FYMA 2AQEA 2FMLA 2L4MA 2HQRA 1R1VA 1VF9A 3FWEA 3OIOA 3CO7C 1MBJA 1QZZA 3VB2A 5HDGA 4B48A 2HVRA 5J1UA 2CRGA 1SVOA 2ID6A 2ZJPF 3BR1A 3B6CA 4CHUA 1NG6A 1XGOA 4I0BA 5JFRA 1HQCA 3I4NJ 4QPOA 2XSJC 1D5VA 1W0UA 2P8TA 4IEJA 2A68F 2DCEA 2MW8A 2WADA 1E3PA 1K61A 1SAUA 2YS9A 2V7FA 2F5DA 1FC3A 2ZNZA 5BMZA 2CU7A 2MH9A 1XTAA 3VSKA 2VBWA 3BZ6A 3CLQA 1CGPA 4A3GJ 1BW6A 3HRSA 2X1DA 2NVQJ 1FY7A 2RNJA 3SXYA 1BM9A 5BOXA 2HDDA 1TL8A 2WWYA 3J7AO 2DT5A 2JA7J 2X6OA 2O3FA 3GBGA 1IN8A 4ZTFA 4EGZA 4HQEA 5LHIA 3KEOA 1YS7A 1VI0A 4L5EA 2Z99A 2MYSA 1NG7A 1W7PA 1X1DA 2HQAA 2IJLA 5LD2C 4L5JA 3PIOF 1R58A 5J8CA 3PIPF 3KYLA 4BE1A 3HBLA 3TP0A 3T8RA 4H0EA 2V79A 4J19A 2W24A 2B7EA 1HOMA 3X2QH 3IAM2 2JSPA 3HOSA 4UB6C 1R49A 2ECBA 2NAZA 2DOEA 4AIHA 1C0WA 3EQLF 2XAUA 2TDXA 3ZQQA 3ZPLA 5HS9A 2PMHA 1IN7A 1MNMC 3ZP5A 2QSHX 3IHUA 5EYRA 2KRHA 2HDWA 1HDDC 2EINH 4HPQA 5D5XB 5BS6A 1WJFA 3MQ0A 4UUSB 3S32A 2A6TA 1KYWA 3KYCB 4BY7J 2R7RA 1FOWA 1BJZA 3OWTA 2Z16A 1P9QC 3RQ4A 1TWGJ 4IZZA 1B9MA 2ZSHB 4YIFA 4RS8A 4KNYA 5DCMA 2DYSH 5HDNA 5DM6F 1DGWY 4A69C 2NNYA 2A05A 3S1QJ 1Z6TA 4PFOA 4XN0A 5D4RA 4IJAA 3QODA 1LE8B 2DU9A 1STZA 3TMOA 2ZMEA 1N78A 1JT0A 1S7EA 2HFHA 2DJIA 1BOAA 3F3XA 3K1MA 1V54H 2EFQA 3DQVC 1EH6A 1R4NB 1Z9CA 1S3JA 2C6YA 3IAS2 1I6XA 4EQQA 1ZH5A 1Y0UA 4IQ4A 5E17F 1RESA 5E79C 4IHYA 4XRSA 2H1KA 4OMZA 2DMQA 3GEZA 2HVQA 1W5TA 2VJIA 4KMFA 5H20A 2YR2A 4UNOA 3G73A 2LBFB 3BC8A 3L2UA 5HVQC 2X48A 3HRUA 4XRMA 1BW5A 3K7AJ 4N4NB 3DKYA 3HOXJ 1EH8A 4IKFA 1K4TA 1XG1A 3KEQA 5DYMA 2PMUA 3DV8A 3UR3C 2GAUA 1DQUA 2V1NA 2MA3A 4U0WA 3BDDA 1I39A 4S05A 5FRMA 1IF1A 1D3YA 3W6VA 1PJRA 3SEZA 1WFXA 2VQGA 5JVGF 2IA0A 1TWAJ 5FKLA 2K9SA 3FBIB 3DEEA 2P81A 2ZXWH 1DDNA 2BE5F 1XGSA 3E1SA 1K6OA 3H9GA 1H88C 3SJMA 5JR3A 4BEHA 1R5ID 2V1DA 2X6XA 2JZYA 4HBLA 2E2HJ 1TT5B 2EH3A 1RUNA 5LLQA 3K0LA 3D5RC 1OR7C 2EIKH 4NC7A 2M3AA 3ZMTA 4KISA 1YI2I 3F8FA 4LK1F 1B1BA 2BBYA 3K1NA 3BOQA 4UVBA 4U88A 3PM1A 3TOAA 5JLXA 3V8KA 9ANTA 3CCVI 3GUDA 2X0LA 3IKVA 1MDMA 5KHDA 2WAFA 4II3A 3DF8A 1YITI 2VC1A 3HRMA 4M3DA 2GZWA 5KAFC 2OJED 4B09A 1AHDP 1GXQA 1B9NA 4BJ6C 2A5WA 5K7FA 2O7OA 2D1VA 3G1OA 1OCZH 3NQOA 4QIWN 5J1YA 3ML6A 2IS1A 2R7XA 3HPHA 2LNBA 2UUZA 3HG9A 2TRTA 1ACIA 3RZOJ 2LG4A 3JREA 2XAFA 2LTPA 5J1RA 4CDGA 2OTLI 3HGYA 1MBKA 2PMZN 2G9WA 4E70A 4YEJA 1MH3A 3FK6A 4A3JJ 4Y3OA 1O3RA 2IGOA 2PMZA 1XMXA 1SMYF 1QHGA 2M0CA 3GTJJ 3PUFA 4U7BA 2L01A 5CPRB 2FBKA 1TC3C 2L0KA 4A3DJ 2B0LA 3L7WA 2FUG2 2JRTA 4KIFA 2NS0A 3RI4A 2VQHA 3OYLA 2OZUA 2XPWA 3MCZA 3MKWB 1FYLA 3WHBA 4DOZA 1MZBA 4N0BA 4KT5C 4BE2A 3TW7A 3IP4B 1DUXC 3DFGA 3CDLA 3E3VA 3DPTA 5DS9A 4OWRB 2VI6A 1WI9A 3KP5A 4YELA 4BHBA 2Y0MA 3GZ5A 3BJAA 4C3HJ 2E1NA 3QPTA 1BC7C 4GYGA 3ZQGA 1IV8A 2W25A 4KICA 1DU0A 2PLYA 2EWNA 2R3SA 3NWSA 4LK0F 2NVUB 1H9TA 3HSEA 1AU7A 4O3MA 1BIAA 3CP2A 2M7BA 1SD7A 4MTDA 4JX4A 4FISA 4IX7A 5CJ9A 5HNHA 3ZQ7A 1BA5A 2WY8Q 3K4BA 4A0YA 2DA1A 2PG4A 1OR7A 3CJRB 4CUGA 4C2TA 4B4CA 2LREA 5BNGA 2QBYB 2IGNA 2V1UA 3JRIA 2CG4A 2PJPA 5DCMB 3S15J 1S7OA 2ELJA 3WG7H 1USTA 3BJOA 1B4AA 2WC2A 4AUXA 1J75A 1ZQ3P 1OCCH 3SFIA 1J9IA 2R5ZB 2KDZA 3ZMDA 4IVNA 4JYKA 1Z6RA 4B3AA 5E18F 2DQLA 1QQIA 2FD5A 2K85A 4UHTA 5L3DA 5J6XA 1VQPI 2XUBA 3BR3A 1FSHA 3E5QA 2VUMJ 2Y31A 1FOYA 5F0CA 4BGDA 4XICA 3WTSC 4HA8A 1OMIA 2DT7B 2KL4A 1IGNA 1A5JA 4EJVA 1J7KA 3PL8A 3B6AA 3Q9VA 5IP9J 2L9VA 2QQ8A 3M7GA 5TJJA 4PSWA 3QYFA 4XM3A 3ZN1A 4M72A 2BEOA 3R60A 3G2BA 3MZ8A 3IL2A 3S93A 4HYEA 1FOKA 4P9FA 5E1ZB 1IRGA 5ICGA 1F1ZA 4ZZLA 3H3ZA 1YJWI 1WHUA 3M8FA 3WU0A 4F92B 4RBOA 4M74A 3PQKA 3HJEA 4HV6A 4J01A 3HUGA 2VJ4A 3A0HC 3EPZA 3B02A 5J8FA 2W84A 3ULQB 1Z3YA 3DP7A 1G3YA 1XN7A 2JT1A 1W36C 2FQ4A 2ZXJA 4U7DA 2NOJB 2OD5A 4L9NA 4FHTA 4CCOA 1IXRC 1QHHD 2IA1A 1E17A 3JRBA 3OSGA 4PJ0C 2GBYA 2QA4I 4AYBA 1VQMI 2A6HF 3QOPA 2CV1A 5FFZA 2DODA 2R92J 3SZGA 3MKLA 1YJ9I 2ICWG 1W0TA 2KDOA 3TGNA 3J7ZI 1UFMA 1I5ZA 3Q5FA 1YS6A 5KNLA 4NC8A 1JJ8C 1VFCA 5K5QA 3A1YA 2CQ7A 1XSXA 5M3FJ 3PNTA 2H27A 2IA2A 2MGQA 1U9NA 5E3LA 3KZIC 1Y56A 3HTUA 2IEKA 5IPAA 3QRFF 3CCLI 2CH0A 1B72B 1WJBA 3DBHB 3H5AA 3KEYA 1JUMA 4XR6A 2W1OA 4MO7A 1D8JA 2EA2A 1TW3A 1POGA 2DFHA 4MQ9F 3TL4X 1HBXG 1HC8A 3KZZA 3F8BA 4CYDA 2AXLA 4L9VA 1GDTA 1H89C 3FXQA 1X2MA 2O61A 2K40A 2VN2A 1Q1HA 3CUOA 4WF2A 5IT9K 2HXOA 2KT0A 2D1HA 2LLKA 1EA3A 3WTWC 1TW2A 4BHPA 2DMPA 4B8XA 3G1LA 3OY9A 2NNNA 3TDZC 4E7IA 4RA2A 3JW4A 5HLTA 1JE8A 1J59A 1FEXA 1GV5A 5C4JJ 4C2UA 2B9SA 2IVMA 2EPFA 3V4GA 3ZGKA 4HLYA 1UMQA 3CC2I 3LSKA 2VODA 2NVYJ 5EG0B 2QSGX 4PSXA 1SANA 1JUSA 5AIQA 4A5NA 3S17J 1K4SA 2J5PA 1WQ2A 1RR7A 5JHUA 5E3MA 5E8IA 3HOYJ 4ZZDA 1I3AA 5BPIA 1HDPA 5CVRA 4GO1A 2LDUA 4U87A 3LL7A 4IF4A 3LMMA 4FCYA 5EEHA 4IOCF 3E6BA 1FBSA 3HC7A 2DI3A 5L3EA 3OOUA 2AS5F 4RM3A 4MGRA 1MKMA 3F9KA 3I4PA 3MN2A 1K7AA 3WTTC 3F72A 2G7HA 2DOAA 3DKXA 5E3OA 4I99C 3Q0UA 4AD9A 1D5YA 2FU4A 1X58A 3DCFA 4QPQA 3J7YJ 2DDBA 2ZNYA 3K2AA 3DBRB 3H35A 1RR8C 3C3WA 1AA7A 2LBFA 2K4BA 3L2RA 1GXPA 2DFIA 4GDFA 4O5VA 2F6CA 2Y9YA 3F22A 2D5VA 1MNEA 4HX8A 2BY2A 3ERMA 3FMQA 1EV7A 2M1BA 2VJ5A 1FT9A 2HKXA 3ZMVA 3LSPA 2ZCWA 3EYIA 5FROA 3LWFA 3JCUC 4V2GA 3I9V2 1SD6A 2Y0SN 3ABMH 4XLCA 1I6HJ 1T08B 4BNCA 2XDVA 4HNUA 3GW2A 5FLXK 4B44A 1HKTA 4BL0B 3A2KA 2HS5A 2CWEA 4PGHA 1IV6A 5DUKA 1J5YA 2JSCA 5HDKA 5J40A 5B3SH 2FQ3A 5D4SA 3F0CA 1JXSA 1UHSA 2RQPA 4FE7A 3HM5A 4B43A 4CYCA 4OIRF 2Z2SB 3DXJF 4M9XA 4HV5A 4LD5A 2J5OA 2RGVA 4P96A 5ILUA 2P5LC 4IHTA 4Q47A 1VNDA 3BJ6A 2EBIA 1U78A 3FXUA 2LVSA 2ESNA 4IRHA 2V4JC 5LBQA 2JVHA 3JTHA 3GFJA 5BPDA 4J00A 3EUHC 1OISA 3ZN0A 3DU6A 3BG5A 4AVZA 3V7CA 3VWBA 2O8KA 3PFIA 3QU3A 5F27A 3GZNB 5FRNA 1FOXA 2QWWA 3ECHA 5ED4A 4JK1X 1O4XA 3IWZA 4E7JA 2IPQX 3FXRA 1SEUA 3LFKA 5L3CA 5L3BA 3ONQA 1S8NA 4UVAA 2K9NA 3DKWA 2JN6A 1RRJA 3M3YJ 2HR3A 3S16J 1U9OA 1PVEA 1IN4A 3ABKH 2OC6A 4KYWA 2E1OA 2YUSA 3V7SA 3RIRA 1ZG5A 2CV2A 1D0YA 1BIBA 2KLOA 2XROA 2G0EA 2JUGA 5L3GA 4KN4X 3GFIA 4KJZA 3U1DA 1E2XA 2KJCA 1OCRH 4A6DA 4RAGA 2R7VA 5F1JA 5ILVA 2R7WA 4DZJA 4IRIA 1YX5A 3OL4A 2MD5A 3KPHA 4AWXB 3BR5A 3RDIA 2MC4A 4EATA 1PYVA 1FZPB 3P9IA 2Q2EA 2VIXA 2M2EA 3SQNA 2L54A 2EA4A 2VE8A 5FLVA 3ZQFA 1YE9A 1ON2A 2ACJA 1JKRC 2YU9J 4FT8A 5ICEA 3HKZA 3HTSB 4RAFA 4I0AA 1B59A 2CS3A 1TT0A 3K6GA 2Q2EB 4N4OB 2EZIA 2E60A 1LFBA 4HF0A 2P7VB 3HOVJ 1IG7A 2HU9A 1TQIA 5FLXZ 2VL8A 5FKKA 3J80K 5EGOA 2P7CB 2HVSA 1MGTA 1D0ZA 3VDXA 4KUMA 1Y1VJ 3BTLA 3I4MJ 3I71A 3R0JA 1F43A 2GOXB 3VYTB 2KIQA 3JR9A 5C4XJ 3ZQLA 3GMEA 1LFPA 3C18A 3HPGA 2EB7A 2E19A 3NWTA 3VEPA 1AKHB 2RC4A 1QVTA 1WJDA 3DBLB 2ELHA 3K10A 1W1WE 2KIMA 2X6WA 3AG3H 3TP3A 5FJ8J 2YU3A 3S3OA 4CICA 4CGZA 2FA5A 1OFCX 2M45A 1IDZA 2O5RA 2BHZA 2VASA 1SVLA 2PI0A 2BW3A 4YRVA 3IV5A 2M5WA 3MKZA 2R7TA 3S1NJ 1I1SA 1A6IA 2F4IA 5DD8A 3I3LA 4NQWA 1YIJI 2A5YB 4XL9A 1P7IA 4YFXF 4L9TA 4RAYA 5EJCA 2V1XA 4E7LA 4BQNA 2A6EF 3IH3A 5IT3A 1SFOJ 3WODF 5AIPA 1MW7A 2YPRA 3KX2A 2R7QA 1O7LA 5ICFA 3WGHA 1JI8A 1CF7B 4HNVA 1B72A 1VQ7I 1R7JA 2KJBA 2JJ7A 3W2WA 4ESJA 4BU2A 5DUIA 3FISA 2CYYA 3BG7A 4NBQA 4XLNF 5CQGA 5HS8A 2L9RA 1MD0A 2GXAA 4CA0A 3VFZA 1X1PA 3FHNA 3M9AA 1T38A 2NOGA 4QSHA 2DDAA 3ELKA 3FMRA 3U21A 3U2RA 2MABA 3V7RA 2X4HA 3QU6A 4E6KG 2IBDA 3D5SC 1I27A 1W5SA 1QO0D 5DV5A 1T8IA 5D8LB 3OS2A 1YFHA 4WCGA 2R93J 2PJRB 3KETA 3JSOA 5D8KB 5D6FA 3L2CA 1R9TJ 3QYBA 1F9NA 1ON1A 3CZ6A 5DEQA 4Y13A 1BI3A 3G6EI 3Q3SA 2QUFA 2YX4A 1YX3A 2H09A 1IDYA 3C7JA 1EF4A 2EFWA 2WB1A 5DCFA 5K1YA 1SFKA 4KN7X 1MBGA 4JQFA 3QOEA 3TO6A 4HX7A 1WH5A 4BQQA 2DMUA 4LLLA 3GO5A 3MKYB 3ZMUA 2DOFA 4AM3A 4M3GA 4WXDA 3OYAA 1O7FA 2CFXA 3OSFA 1ETWA 2KIUA 3D0SA 1FBUA 2FF4A 3GVAA 3G4SI 1BR4A 1ZTRA 3G1MA 2VJJA 3FM5A 2JMWA 4NC6A 3EDPA 4IHWA 1IAWA 1WSUA 1SAXA 4XKBA 2ADUA 3BP8A 2CUJA 2E7XA 3O2PE 1OJLA 3KP3A 3LAPA 4LIUA 3VYUB 1R5GA 1V4RA 3I54A 1ORKA 5BQTA 3A02A 5M5XJ 3ZQIA 3MFKA 4IPAA 1ETYA 4KIGA 2L3DA 5GADJ 2BY3A 3R61A 1OKRA 4BJ5C 2MSYA 1PUFB 3BR0A 2XIGA 2LKXA 2OAZA 4BXUA 1X4PA 2HDCA 2GA1A 1UHMA 3FZVA 1MSFC 3ZXSA 5GTIC 3BY6A 4I7HA
chains in the Genus database with same CATH topology
4MFEA 5EGOB 2XRLA 1UG2A 4JX4A 4FISA 5F0FA 1BA5A 5F04A 1ZR2A 3O8GA 1T33A 4AC0A 2DA1A 3ZQHA 4EEFG 3JRGA 2DN0A 4B4CA 1IJWC 2H8RA 4A3KJ 5BNGA 1OCPA 2LR8A 3BTIA 4IHVA 3JRIA 3S15J 2CJJA 5EZHA 5IYCJ 4AUXA 1ZQ3P 3SFIA 4D5FA 2CQQA 3GTPJ 3HOWJ 2MG4A 4S0HB 2R5ZB 2KDZA 2L7MP 4JYKA 3BR6A 4B3AA 4A3MJ 2FD5A 1ITYA 2DA3A 2R5YB 4XIDA 3JRAA 2NS7A 5FKNA 2E2JJ 2Y2ZA 3BR3A 5C44J 2VUMJ 2Y31A 2HI3A 5F0CA 4DW6A 4XICA 1A5JA 1IGNA 3B6AA 1IC8A 2LFBA 5IP9J 1LFUP 1YRNA 2NVXJ 2Y9ZA 3CCYA 2R5ZA 4V2FA 4A3BJ 3H3VK 1ZR4A 4UUSA 1APLC 2EQRA 2L7FP 3LOCA 4RBOA 3HKZN 3PO2J 3FKIJ 2E2IJ 3QQAA 1QPIA 1JTXA 2FQ4A 3HGGA 5FKOA 1FIAA 1MH4A 3FK7A 1AKHA 3JRBA 2LK2A 4BY1J 2IAIA 3OSGA 2GBYA 3Q0VA 5JLWA 3RKQA 2EZLA 5K7ZA 5IP7J 3JRCA 5J3LA 2WV1A 2R92J 1BL0A 3MKLA 3ZQCA 1W0TA 3S2DJ 2DA6A 2DA2A 4ABZA 5EEAA 3GTQJ 1HF0A 3E7LA 1JJ8C 2XPUA 4LOCA 2VKEA 5F0HA 1VFCA 3TEDA 4XK4A 2HOSA 5M3FJ 4C2MJ 2MGQA 1U9NA 5E3LA 4JX6A 3LSRA 2IEKA 4I76A 5IPAA 3NARA 1B72B 2XGCA 3JRFA 1JUMA 5EF6A 4MO7A 3RQIA 1POGA 3IH2A 3LSJA 1ETQA 4BBSJ 5M5YJ 1ZK8A 1GDTA 2R5YA 4X1EA 4XRSG 1H89C 1X2MA 3S14J 2K40A 3NAUA 1FTZA 3SDGA 3FIWA 1ETVA 3A01B 2HXOA 2KT0A 2LLKA 4RDUA 2JA5J 4MLOA 2DMPA 1T56A 1ENHA 3G1LA 1FIPA 1YRNB 4JX5A 2Y30A 1FEXA 1GV5A 1RKWA 5C4JJ 2JWTA 4NDLA 1MSEC 3O8HA 2M8GX 1I50J 4QTRA 3BQYA 3JRDA 2DA5A 1IUFA 1RPWA 1UMQA 3A01A 1WPKA 3S2HJ 1TWFJ 3QPLA 1OCTC 2NVYJ 5EG0B 1SANA 1JUSA 3S17J 4D7NA 3HDDA 2HYJA 4G12A 1RR7A 2HOAA 3TW6A 5E3MA 3HOYJ 2XSDC 1HDPA 3JRHA 2DA7A 3L1PA 1JGGA 4Y52J 3BT9A 4FCYA 4X6AJ 5IOYA 4D7MA 2DMNA 2XB0X 1GV2A 2CUFA 3OOUA 5IYBJ 3HB9A 3MN2A 2FJ1A 2R7ZJ 1Y1WJ 4A3LJ 1QRYA 1B8IB 4A3FJ 5E3OA 5EDNA 1F36A 3Q0UA 2L7ZA 1D5YA 2X9DA 1X58A 3DCFA 1VF9A 1Z77A 2M34A 2VKVA 3OIOA 1MBJA 1JUPA 3K2AA 5J1UA 3BQZA 2CRGA 2DTZA 2ID6A 3BR1A 3B6CA 1GT0C 1P7JA 2Y9YA 4DZPA 2D5VA 1WCMJ 2RAEA 2VPRA 4M3EA 3LSPA 3I4NJ 4V2GA 2XGEA 1I6HJ 2Y0SN 1W0UA 1JT6A 4IEJA 2MW8A 2AO9A 4B1RA 1K61A 1ZGWA 2YS9A 3GTGJ 2CU7A 2JA6J 2OF7A 1IV6A 3CQZJ 1QVUA 1BW6A 5F08A 4A3GJ 2NVQJ 3F0CA 1UHSA 4FE7A 4CYCA 3HM5A 2JA8J 2HDDA 1VNDA 1U78A 2EBIA 2X6OA 1JJ6C 2JA7J 3GBGA 2ME6A 2LVSA 3D1NI 3CMYA 1K83J 2M9HA 1FJLA 1VI0A 4L5EA 2NS8A 2OPTA 1H8AC 2LY9A 2I10A 3BG5A 4AYBN 2O8KA 5F27A 3HBLA 4M6VA 4A3CJ 2AHQA 3TP0A 1O4XA 4J19A 2GLOA 1HOMA 2CUEA 4M3BA 1MBHA 1JKPC 2K9NA 2ECBA 2JN6A 3M3YJ 4C3IJ 4CYCB 3S16J 1U9OA 4UUTA 1MNMC 2E1OA 1JKOC 2YUSA 5EYRA 1HDDC 4GFBA 4UUSB 2G0EA 1HLVA 2NVTJ 1B8IA 4BY7J 1ZKGA 5EZGA 4I6ZA 1AU7A 5IYDJ 5F1JA 4DZJA 1BJZA 1U8BA 5FKMA 3BG3A 4Y7NJ 4A3IJ 1WI3A 1JTYA 3BR5A 1TWGJ 2ZB9A 4FE4A 5DTDA 3IH4A 3RZDJ 2XPVA 2B63J 2M2EA 3DEWA 5FLVA 4JP0A 3ZQFA 5IOZA 5M3MJ 2R0QC 2K9QA 4A69C 2N8GA 1JKRC 2YU9J 1JKQC 3S1QJ 1HCRA 1ETXA 1G2HA 5EG0A 1LE8B 3GTLJ 2HQ5A 4C3JJ 1JT0A 1S7EA 1NK2P 2QCOA 2FX0A 2EZIA 1LFBA 3GTOJ 3HOVJ 1IG7A 2COBA 5FKKA 1TWCJ 4W97A 4BXXJ 1PUFA 5EGOA 1RESA 4IHYA 4XRSA 2H1KA 1Y1VJ 3BTLA 3I4MJ 1ETOA 2DMQA 1F43A 3BTJA 5C4XJ 3JR9A 2XB5A 3ZQLA 3M4OJ 2ME0A 4DYRA 2LD5A 3BR2A 1E3OC 1I3QJ 2E19A 2X48A 4XRMA 1AKHB 1BW5A 1QVTA 1LE8A 2HXIA 3K7AJ 2WAQN 3HOXJ 3TP3A 3LSGA 5FJ8J 2QF7A 5FLMJ 1XG1A 1NTCA 1GVDA 1OFCX 1IDZA 1ETKA 4A3EJ 2CQXA 1WH7A 5C3EJ 3IV5A 3W6VA 2HOTA 3S1NJ 2DJNA 1A6IA 2EZHA 1TWAJ 3H0GJ 3C2BA 5FKLA 2K9SA 3BG9A 4BBRJ 2P81A 1P7IA 2LP0A 3ZOBA 3IH3A 1SFOJ 3HOUJ 4MIMA 5M5WJ 1H88C 3SJMA 3GTMJ 2WB1N 3A03A 3VPRA 2EH3A 2DMTA 2E2HJ 3QPSA 2DA4A 4BKXA 4HNVA 1B72A 4A93J 1MBEA 4MFDA 2JJ7A 3FISA 4M3FA 4D5CA 2L9RA 3S1MJ 3PM1A 5JLXA 9ANTA 5GPAA 2NOGA 4QSHA 5GPCA 1Q1VA 2IBDA 1DU6A 3PO3J 4M3DA 2O9LA 1AHDP 2R93J 5K7FA 2O7OA 3G1OA 4QIWN 5J1YA 5GP9A 3UKGA 1R9TJ 2XGDA 1RKTA 3Q0WA 2TRTA 3RZOJ 1Z0XA 3Q3SA 3JREA 2LTPA 5K7HA 5J1RA 3HGYA 1MBKA 2PMZN 1IDYA 1EF4A 1MH3A 4W1UA 1MBGA 1XC5A 3FK6A 4A3JJ 1FTTA 2JK3A 1WH5A 1IRZA 2DMUA 2M0CA 3GTJJ 2EZKA 4A3DJ 1TC3C 2L0KA 4M3GA 3OSFA 1XS9A 1ETWA 1NK3P 1MBFA 1ZTRA 2XPWA 3G1MA 2JMWA 3HEFA 3WHBA 4IHWA 3HOZJ 3WHCA 3TW7A 1OJLA 2ELKA 1X2NA 3CDLA 3S1RJ 1ORKA 1RETA 5DS9A 5IP6A 3A02A 2TCTA 1GUUA 2VI6A 3ZQIA 5M5XJ 3MVPA 1ETYA 2ECCA 5E3NA 1TWHJ 4IHXA 4C3HJ 1WGXA 2MSYA 2ID3A 4DYCA 1PUFB 3LNQA 3BR0A 2W48A 3ZQGA 2LKXA 3BTCA 1DU0A 2GM4A 1CQTA 4DYQA 5HODA 1MSFC 4FTHA 3GTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFE A;  5EGO B;  2XRL A;  1UG2 A;  4JX4 A;  4FIS A;  5F0F A;  1BA5 A;  5F04 A;  1ZR2 A;  3O8G A;  1T33 A;  4AC0 A;  2DA1 A;  3ZQH A;  4EEF G;  3JRG A;  2DN0 A;  4B4C A;  1IJW C;  2H8R A;  4A3K J;  5BNG A;  1OCP A;  2LR8 A;  3BTI A;  4IHV A;  3JRI A;  3S15 J;  2CJJ A;  5EZH A;  5IYC J;  4AUX A;  1ZQ3 P;  3SFI A;  4D5F A;  2CQQ A;  3GTP J;  3HOW J;  2MG4 A;  4S0H B;  2R5Z B;  2KDZ A;  2L7M P;  4JYK A;  3BR6 A;  4B3A A;  4A3M J;  2FD5 A;  1ITY A;  2DA3 A;  2R5Y B;  4XID A;  3JRA A;  2NS7 A;  5FKN A;  2E2J J;  2Y2Z A;  3BR3 A;  5C44 J;  2VUM J;  2Y31 A;  2HI3 A;  5F0C A;  4DW6 A;  4XIC A;  1A5J A;  1IGN A;  3B6A A;  1IC8 A;  2LFB A;  5IP9 J;  1LFU P;  1YRN A;  2NVX J;  2Y9Z A;  3CCY A;  2R5Z A;  4V2F A;  4A3B J;  3H3V K;  1ZR4 A;  4UUS A;  1APL C;  2EQR A;  2L7F P;  3LOC A;  4RBO A;  3HKZ N;  3PO2 J;  3FKI J;  2E2I J;  3QQA A;  1QPI A;  1JTX A;  2FQ4 A;  3HGG A;  5FKO A;  1FIA A;  1MH4 A;  3FK7 A;  1AKH A;  3JRB A;  2LK2 A;  4BY1 J;  2IAI A;  3OSG A;  2GBY A;  3Q0V A;  5JLW A;  3RKQ A;  2EZL A;  5K7Z A;  5IP7 J;  3JRC A;  5J3L A;  2WV1 A;  2R92 J;  1BL0 A;  3MKL A;  3ZQC A;  1W0T A;  3S2D J;  2DA6 A;  2DA2 A;  4ABZ A;  5EEA A;  3GTQ J;  1HF0 A;  3E7L A;  1JJ8 C;  2XPU A;  4LOC A;  2VKE A;  5F0H A;  1VFC A;  3TED A;  4XK4 A;  2HOS A;  5M3F J;  4C2M J;  2MGQ A;  1U9N A;  5E3L A;  4JX6 A;  3LSR A;  2IEK A;  4I76 A;  5IPA A;  3NAR A;  1B72 B;  2XGC A;  3JRF A;  1JUM A;  5EF6 A;  4MO7 A;  3RQI A;  1POG A;  3IH2 A;  3LSJ A;  1ETQ A;  4BBS J;  5M5Y J;  1ZK8 A;  1GDT A;  2R5Y A;  4X1E A;  4XRS G;  1H89 C;  1X2M A;  3S14 J;  2K40 A;  3NAU A;  1FTZ A;  3SDG A;  3FIW A;  1ETV A;  3A01 B;  2HXO A;  2KT0 A;  2LLK A;  4RDU A;  2JA5 J;  4MLO A;  2DMP A;  1T56 A;  1ENH A;  3G1L A;  1FIP A;  1YRN B;  4JX5 A;  2Y30 A;  1FEX A;  1GV5 A;  1RKW A;  5C4J J;  2JWT A;  4NDL A;  1MSE C;  3O8H A;  2M8G X;  1I50 J;  4QTR A;  3BQY A;  3JRD A;  2DA5 A;  1IUF A;  1RPW A;  1UMQ A;  3A01 A;  1WPK A;  3S2H J;  1TWF J;  3QPL A;  1OCT C;  2NVY J;  5EG0 B;  1SAN A;  1JUS A;  3S17 J;  4D7N A;  3HDD A;  2HYJ A;  4G12 A;  1RR7 A;  2HOA A;  3TW6 A;  5E3M A;  3HOY J;  2XSD C;  1HDP A;  3JRH A;  2DA7 A;  3L1P A;  1JGG A;  4Y52 J;  3BT9 A;  4FCY A;  4X6A J;  5IOY A;  4D7M A;  2DMN A;  2XB0 X;  1GV2 A;  2CUF A;  3OOU A;  5IYB J;  3HB9 A;  3MN2 A;  2FJ1 A;  2R7Z J;  1Y1W J;  4A3L J;  1QRY A;  1B8I B;  4A3F J;  5E3O A;  5EDN A;  1F36 A;  3Q0U A;  2L7Z A;  1D5Y A;  2X9D A;  1X58 A;  3DCF A;  1VF9 A;  1Z77 A;  2M34 A;  2VKV A;  3OIO A;  1MBJ A;  1JUP A;  3K2A A;  5J1U A;  3BQZ A;  2CRG A;  2DTZ A;  2ID6 A;  3BR1 A;  3B6C A;  1GT0 C;  1P7J A;  2Y9Y A;  4DZP A;  2D5V A;  1WCM J;  2RAE A;  2VPR A;  4M3E A;  3LSP A;  3I4N J;  4V2G A;  2XGE A;  1I6H J;  2Y0S N;  1W0U A;  1JT6 A;  4IEJ A;  2MW8 A;  2AO9 A;  4B1R A;  1K61 A;  1ZGW A;  2YS9 A;  3GTG J;  2CU7 A;  2JA6 J;  2OF7 A;  1IV6 A;  3CQZ J;  1QVU A;  1BW6 A;  5F08 A;  4A3G J;  2NVQ J;  3F0C A;  1UHS A;  4FE7 A;  4CYC A;  3HM5 A;  2JA8 J;  2HDD A;  1VND A;  1U78 A;  2EBI A;  2X6O A;  1JJ6 C;  2JA7 J;  3GBG A;  2ME6 A;  2LVS A;  3D1N I;  3CMY A;  1K83 J;  2M9H A;  1FJL A;  1VI0 A;  4L5E A;  2NS8 A;  2OPT A;  1H8A C;  2LY9 A;  2I10 A;  3BG5 A;  4AYB N;  2O8K A;  5F27 A;  3HBL A;  4M6V A;  4A3C J;  2AHQ A;  3TP0 A;  1O4X A;  4J19 A;  2GLO A;  1HOM A;  2CUE A;  4M3B A;  1MBH A;  1JKP C;  2K9N A;  2ECB A;  2JN6 A;  3M3Y J;  4C3I J;  4CYC B;  3S16 J;  1U9O A;  4UUT A;  1MNM C;  2E1O A;  1JKO C;  2YUS A;  5EYR A;  1HDD C;  4GFB A;  4UUS B;  2G0E A;  1HLV A;  2NVT J;  1B8I A;  4BY7 J;  1ZKG A;  5EZG A;  4I6Z A;  1AU7 A;  5IYD J;  5F1J A;  4DZJ A;  1BJZ A;  1U8B A;  5FKM A;  3BG3 A;  4Y7N J;  4A3I J;  1WI3 A;  1JTY A;  3BR5 A;  1TWG J;  2ZB9 A;  4FE4 A;  5DTD A;  3IH4 A;  3RZD J;  2XPV A;  2B63 J;  2M2E A;  3DEW A;  5FLV A;  4JP0 A;  3ZQF A;  5IOZ A;  5M3M J;  2R0Q C;  2K9Q A;  4A69 C;  2N8G A;  1JKR C;  2YU9 J;  1JKQ C;  3S1Q J;  1HCR A;  1ETX A;  1G2H A;  5EG0 A;  1LE8 B;  3GTL J;  2HQ5 A;  4C3J J;  1JT0 A;  1S7E A;  1NK2 P;  2QCO A;  2FX0 A;  2EZI A;  1LFB A;  3GTO J;  3HOV J;  1IG7 A;  2COB A;  5FKK A;  1TWC J;  4W97 A;  4BXX J;  1PUF A;  5EGO A;  1RES A;  4IHY A;  4XRS A;  2H1K A;  1Y1V J;  3BTL A;  3I4M J;  1ETO A;  2DMQ A;  1F43 A;  3BTJ A;  5C4X J;  3JR9 A;  2XB5 A;  3ZQL A;  3M4O J;  2ME0 A;  4DYR A;  2LD5 A;  3BR2 A;  1E3O C;  1I3Q J;  2E19 A;  2X48 A;  4XRM A;  1AKH B;  1BW5 A;  1QVT A;  1LE8 A;  2HXI A;  3K7A J;  2WAQ N;  3HOX J;  3TP3 A;  3LSG A;  5FJ8 J;  2QF7 A;  5FLM J;  1XG1 A;  1NTC A;  1GVD A;  1OFC X;  1IDZ A;  1ETK A;  4A3E J;  2CQX A;  1WH7 A;  5C3E J;  3IV5 A;  3W6V A;  2HOT A;  3S1N J;  2DJN A;  1A6I A;  2EZH A;  1TWA J;  3H0G J;  3C2B A;  5FKL A;  2K9S A;  3BG9 A;  4BBR J;  2P81 A;  1P7I A;  2LP0 A;  3ZOB A;  3IH3 A;  1SFO J;  3HOU J;  4MIM A;  5M5W J;  1H88 C;  3SJM A;  3GTM J;  2WB1 N;  3A03 A;  3VPR A;  2EH3 A;  2DMT A;  2E2H J;  3QPS A;  2DA4 A;  4BKX A;  4HNV A;  1B72 A;  4A93 J;  1MBE A;  4MFD A;  2JJ7 A;  3FIS A;  4M3F A;  4D5C A;  2L9R A;  3S1M J;  3PM1 A;  5JLX A;  9ANT A;  5GPA A;  2NOG A;  4QSH A;  5GPC A;  1Q1V A;  2IBD A;  1DU6 A;  3PO3 J;  4M3D A;  2O9L A;  1AHD P;  2R93 J;  5K7F A;  2O7O A;  3G1O A;  4QIW N;  5J1Y A;  5GP9 A;  3UKG A;  1R9T J;  2XGD A;  1RKT A;  3Q0W A;  2TRT A;  3RZO J;  1Z0X A;  3Q3S A;  3JRE A;  2LTP A;  5K7H A;  5J1R A;  3HGY A;  1MBK A;  2PMZ N;  1IDY A;  1EF4 A;  1MH3 A;  4W1U A;  1MBG A;  1XC5 A;  3FK6 A;  4A3J J;  1FTT A;  2JK3 A;  1WH5 A;  1IRZ A;  2DMU A;  2M0C A;  3GTJ J;  2EZK A;  4A3D J;  1TC3 C;  2L0K A;  4M3G A;  3OSF A;  1XS9 A;  1ETW A;  1NK3 P;  1MBF A;  1ZTR A;  2XPW A;  3G1M A;  2JMW A;  3HEF A;  3WHB A;  4IHW A;  3HOZ J;  3WHC A;  3TW7 A;  1OJL A;  2ELK A;  1X2N A;  3CDL A;  3S1R J;  1ORK A;  1RET A;  5DS9 A;  5IP6 A;  3A02 A;  2TCT A;  1GUU A;  2VI6 A;  3ZQI A;  5M5X J;  3MVP A;  1ETY A;  2ECC A;  5E3N A;  1TWH J;  4IHX A;  4C3H J;  1WGX A;  2MSY A;  2ID3 A;  4DYC A;  1PUF B;  3LNQ A;  3BR0 A;  2W48 A;  3ZQG A;  2LKX A;  3BTC A;  1DU0 A;  2GM4 A;  1CQT A;  4DYQ A;  5HOD A;  1MSF C;  4FTH A;  3GTK J; 
#chains in the Genus database with same CATH topology
 4MFE A;  1MMS A;  5EGO B;  2ZSI B;  3HYI A;  3OV8 A;  5D5V B;  2DTR A;  3EUA A;  1V5G A;  2ISY A;  5F0F A;  5F04 A;  2XAH A;  4ZYE A;  1T33 A;  4M6Y A;  2CSO A;  2ZFU A;  3LSH A;  3KCC A;  4XNF A;  1LNW A;  5K5R A;  1IJW C;  2ZJQ F;  4EM0 B;  1ZEL A;  3BTI A;  2KPM A;  3TO7 A;  3I59 B;  5IYC J;  3OOP A;  4A12 A;  2GIZ A;  3CF2 A;  2I5U A;  2LOO A;  3HOW J;  1UZC A;  1O3S A;  4A2U A;  4DNC A;  4BH9 A;  2W4S A;  4A3M J;  2WAE A;  1ITY A;  5FB2 A;  2E2J J;  1U6G A;  1DGR M;  2K86 A;  5C44 J;  4HLX A;  3ASO H;  2O03 A;  1WJC A;  3HUG B;  4BAC A;  4U0Y A;  5HOO A;  4ITV A;  2IGM A;  5E1W A;  2VPL A;  1XB4 A;  1IC8 A;  4DQ2 A;  2NVX J;  3MAJ A;  5LHH A;  4PJJ A;  3I55 I;  3F21 A;  4A3B J;  3RSN A;  4IL6 C;  3K70 D;  1ZR4 A;  3H3V K;  4R8H A;  4L9J A;  3E6M A;  4WX9 A;  3I0T A;  3K2Z A;  2CQK A;  2BV6 A;  1T0F A;  2L7F P;  2Q1Z B;  3CDI A;  3RKW A;  2MLK A;  4CCJ A;  2F5C A;  3EYY A;  2E2I J;  2K27 A;  3QQA A;  1Z05 A;  3S3N A;  4F91 B;  1JTX A;  3I53 A;  4HST A;  2DK8 A;  1QZE A;  3CCJ I;  1G8X A;  3M8J A;  3BZK A;  1D8K A;  1ZGJ A;  2H1L A;  2CW8 A;  3DTK A;  3RPU A;  5LEK A;  3OYJ A;  2IAI A;  3WTY C;  3RYR A;  3Q0V A;  2X1C A;  2EZL A;  2COM A;  3JRC A;  1N75 A;  1Y6I A;  2LC2 A;  1F5T A;  1FLI A;  4NHJ A;  4XOR A;  3ZQC A;  2DA2 A;  1ZGA A;  4ABZ A;  1ZAO A;  1A04 A;  4LOC A;  2VKE A;  2X85 A;  3BZC A;  3TED A;  2LY1 A;  1GHC A;  3IWF A;  1LVK A;  2XV4 S;  2VKD A;  3K1P A;  3LA7 A;  3NAR A;  4A6E A;  4RGS A;  5FD6 A;  3DLL F;  1YW9 A;  3T0Y A;  4AVP A;  4ANJ A;  5B1A H;  5CLS A;  3IH2 A;  4ZDP A;  2PX9 A;  5HLH A;  2VE9 A;  2IGK A;  4BBS J;  3FXJ A;  1HKQ A;  1GVJ A;  2E7W A;  2LSO A;  1ZK8 A;  4K2E A;  3OYE A;  5GAH J;  4O6J A;  4LB5 A;  2RDP A;  3DTI A;  4CCK A;  4NB5 A;  4AU7 A;  3K4L A;  2V26 A;  3RCO A;  4RDU A;  4OAZ A;  4BS9 A;  1VQ8 I;  2JA5 J;  3SFZ A;  2K3P A;  1OLT A;  3AKZ A;  1ENH A;  2MFZ A;  1YRN B;  1BR1 A;  3L9F A;  4JX5 A;  3K70 C;  3F6V A;  4C30 A;  4E7H A;  3ABL H;  5LRS A;  1RKW A;  4UVC A;  3PSF A;  2L2O A;  1MSE C;  1WVR A;  4Y15 A;  1I50 J;  4QTR A;  2V9P A;  4Q48 A;  1IUF A;  3A4C A;  2KIS A;  1KU3 A;  1U3E M;  1RPW A;  2IW5 A;  3S2H J;  1X1A A;  2OTJ I;  1OCT C;  3H92 A;  5J4Y A;  1OYW A;  5TIS C;  3TDU C;  1XSV A;  2BW3 B;  3TW6 A;  1X1B A;  4LLG F;  2DYR H;  2XSD C;  1ZRE A;  1RC9 A;  4ZH4 F;  3PJR A;  3E6D A;  1KA8 A;  1R4M B;  3JRH A;  4LJZ F;  3BT9 A;  4L5I A;  4L0Y B;  3OL3 A;  5IOY A;  2M7A A;  5DD4 A;  2DMN A;  2XB0 X;  4ZDL A;  1GV2 A;  2GIV A;  3M8E A;  1UEL B;  5ERI A;  3RKY A;  2FJ1 A;  4D9J A;  2STT A;  1S72 I;  4P1W A;  2VT3 A;  4P55 A;  3PSI A;  4XOP A;  4DBR A;  2QEX I;  1K78 A;  4A3L J;  1F36 A;  2L7Z A;  3OYN A;  2X9D A;  2GWR A;  2WV0 A;  3TKY A;  2M34 A;  2VKV A;  3GX4 X;  1TNS A;  4EGY A;  2XRN A;  3EUK L;  4OOI A;  3L00 A;  3BQZ A;  4H4K C;  4F7Z A;  2DTZ A;  3CCM I;  2QKM B;  4LIV A;  4RMN A;  1GT0 C;  4KDP A;  1MND A;  4OIP F;  1UHW A;  3P9K A;  1G3T A;  1YLF A;  5E8G A;  4AIJ A;  3W2V A;  4ZDO A;  4I01 A;  3OYI A;  1T2K A;  1E0E A;  4PCQ A;  5AON A;  1XMA A;  2KRC A;  2EIL H;  4GGG A;  2IS2 A;  2AO9 A;  3L2W A;  1QU3 A;  1ZGW A;  4XKV A;  1A35 A;  1VQ5 I;  4GXO A;  1LPQ A;  4KIB A;  3IUO A;  4XBF A;  2DPD A;  3AG4 H;  2FNA A;  1QVU A;  3CQZ J;  2OZ6 A;  4DIQ A;  5ILS A;  4KMU X;  1H9G A;  1FPQ A;  2DAO A;  2KKO A;  2GA2 A;  1W36 D;  5LRR A;  2LH9 A;  3C2G A;  2V6C A;  3R0A A;  2W82 A;  4RM2 A;  3I5U A;  2XHK A;  1YQA A;  5F64 A;  3SZP A;  2ME6 A;  5J47 A;  3W2A A;  3SZT A;  3D1N I;  4XKW A;  4IOA F;  3GFL A;  2V9V A;  1QNT A;  1FJL A;  2NS8 A;  2Q0O A;  4LMY A;  2OPT A;  2F5V A;  1ZRF A;  2I10 A;  2OV7 A;  3CC7 I;  1BOB A;  4AYB N;  1AWC A;  2R7O A;  2BHY A;  1KU7 A;  3RKX A;  2GLO A;  1REP C;  4QWQ A;  2CUE A;  4UUV A;  3FXM A;  4BJT A;  4G7O F;  4P5O A;  2IP2 A;  1JKP C;  3CDH A;  3MZY A;  3GLX A;  1SFX A;  4C3I J;  1HW2 A;  2Y0S A;  4N9I A;  4CYC B;  3T8T A;  1KU9 A;  2R4G A;  4UUT A;  4ZYG A;  1UG0 A;  2HYG D;  2EV0 A;  2PJR A;  2FBH A;  1OCO H;  2VXZ A;  4PK4 A;  4KFC A;  1VTN C;  4PDK A;  1WJ5 A;  1P6R A;  1X3W B;  1SD5 A;  2MLG A;  4I6Z A;  1SVM A;  3JTG A;  1GLN A;  4LB6 B;  1U8B A;  5FKM A;  4Y7N J;  4A3I J;  2CGP A;  4FET A;  4DBQ A;  5DTD A;  3IH4 A;  3RZD J;  1R36 A;  2XPV A;  4HDU A;  2VON A;  3V8J A;  2B63 J;  4LG0 B;  4JP0 A;  5IOZ A;  1BJA A;  1BN5 A;  5M3M J;  2FNP A;  2R0Q C;  1SC7 A;  2K9Q A;  1G59 A;  3WGI A;  2N8G A;  2DW4 A;  3GYH X;  1ETX A;  1G2H A;  3ESW B;  5EG0 A;  1G4D A;  2HQ5 A;  2CFO A;  1T6S A;  2R7S A;  1KON A;  1NH3 A;  1FNN A;  2QCO A;  3N97 A;  1USS A;  1V5F A;  2FX0 A;  3ROU A;  1U8R A;  4R79 A;  2BY1 A;  2NRA C;  2F5E A;  3GTO J;  2OA4 A;  2HEO A;  2COB A;  2WA0 A;  4W97 A;  3FKJ A;  1PUF A;  3NEU A;  2QGU A;  2K9M A;  4YIR X;  3AFH A;  1G6N A;  2KRF A;  2QSF X;  3BTJ A;  5TGT A;  3MWM A;  4XN3 A;  1QGP A;  2ME0 A;  4DYR A;  2D45 A;  3AL0 B;  1I3Q J;  1ZAR A;  3F8C A;  1LVA A;  4ZYH A;  1PDN C;  2BOL A;  3P9C A;  4X0G A;  1LE8 A;  3TOB A;  2WAQ N;  3M1C A;  4BQA A;  5D5W B;  3WTV C;  1R00 A;  4RLQ A;  2QF7 A;  5FLM J;  3OYF A;  1JHF A;  3ABU A;  2OCE A;  1NTC A;  3OIQ A;  1K6Y A;  5LEJ A;  2RV8 A;  2XC7 A;  4XRF A;  3F8N A;  1ETK A;  2XAQ A;  4OIQ F;  3HXL A;  3F23 A;  2CQX A;  1XCV A;  1WH7 A;  5C3E J;  3HHH A;  3M07 A;  3CCE I;  1VQ6 I;  2HOT A;  2HZT A;  2DJN A;  2W57 A;  2EZH A;  2VLA A;  3H3U A;  3C2H A;  3BG9 A;  3OR1 C;  4BBR J;  1OPC A;  2VB6 A;  1T0F C;  1KGS A;  4S04 A;  3E97 A;  3HOU J;  4MIM A;  2Z5U A;  1ZYR F;  3IKT A;  2HNH A;  1OYI A;  2DMT A;  2ZXH A;  3QPS A;  1KU2 A;  2UZK A;  2DA4 A;  3KZY A;  4BKX A;  4A93 J;  1MBE A;  4G9Y A;  2PQ8 A;  5CQE A;  2AQF A;  1XDS A;  3DPL C;  4PFP A;  4M3F A;  4D1Q A;  4D5C A;  4PJL A;  3DLA A;  5KK1 A;  3S1M J;  2JQ7 A;  1VZ0 A;  3UNG C;  4I2O A;  2KP6 A;  3GLL A;  1S7A A;  3JAM Z;  2ZME B;  5GPA A;  1VQ9 I;  4LFU A;  1FSE A;  4XON A;  2G7U A;  4WXC A;  3FHZ A;  1A31 A;  3VOD A;  5GPC A;  1FBQ A;  1XCB A;  2VXD A;  3E5U A;  1DU6 A;  3DEU A;  1P4X A;  2E71 A;  2OU2 A;  2RN7 A;  3N05 A;  3OYM A;  4BAY A;  4M73 A;  4NUB A;  2LMD A;  2QLZ A;  3UKG A;  2ESH A;  2XF5 A;  2XGD A;  3BCA A;  1J0R A;  2ZJR F;  3CUQ A;  1Z0X A;  3CCR I;  5K7H A;  3FXL A;  1IN6 A;  4OAY A;  2BYV E;  1HSJ A;  6PAX A;  3RPQ A;  1MIJ A;  3KP6 A;  2P5K A;  4A5M A;  4W1U A;  1PP7 U;  3VOE A;  2HGC A;  1FTT A;  1ODD A;  4EV0 A;  1IRZ A;  2EZK A;  3LA2 A;  1H0M A;  4L0Z B;  3L09 A;  2OBP A;  2WBM A;  3BLY A;  3Q9S A;  4HG2 A;  5CKT A;  2KZV A;  1KQ8 A;  2A69 F;  4RLF A;  3HEF A;  1YTY A;  4I98 B;  4LG0 A;  1T95 A;  3HOZ J;  1RNL A;  4ZTJ A;  4WK8 F;  1XMK A;  4HW0 A;  2Z3Y A;  3S1R J;  2EIJ H;  3GXO A;  3MEX A;  1GUU A;  2E35 A;  3PFY A;  3MVP A;  4F52 A;  4RAZ A;  1QA6 A;  1WGX A;  2ID3 A;  4DYC A;  1DP7 P;  1YYV A;  4Q5S F;  3FM3 A;  1XX5 A;  3BTC A;  4OU0 A;  2GM4 A;  2MH2 A;  4DYQ A;  2V9K A;  2HKO A;  1U2W A;  3CO6 C;  4NNJ A;  4FTH A;  4EJU A;  3U9G A;  3HL2 A;  2VC0 A;  1WKM A;  1ZG3 A;  4OIO F;  2ZKZ A;  3LA3 A;  4FX4 A;  3CLO A;  3L2Q A;  3LAJ A;  3JRG A;  2EFP A;  4E7K A;  2XAJ A;  1W5C C;  2DN0 A;  1XSD A;  5ICC A;  1MDM B;  5GTH C;  2H8R A;  1M1E B;  1YIO A;  2E1M C;  3BPV A;  4CXF A;  2LR8 A;  3U1K A;  1UB9 A;  3OMY A;  5EZH A;  3W6K B;  4MTE A;  4M71 A;  4D5F A;  2CQQ A;  1OQY A;  2K7L A;  2P6S A;  3RPU D;  3GTP J;  2PN6 A;  2MG4 A;  3CJT B;  3O6B B;  4XLE A;  4S0H B;  3COA C;  2QQ9 A;  4G6T B;  2XF6 A;  4L18 B;  1ZG1 A;  2R5Y B;  4XID A;  2NS7 A;  5FKN A;  2RRE A;  3H9J A;  4XLF A;  3ZCO A;  2Y2Z A;  4YG2 F;  3QAH A;  2XAS A;  3KYD B;  3G71 I;  4DW6 A;  2HI3 A;  2FOW A;  2BVM A;  1S6L A;  3CD6 I;  4ENN A;  4I02 A;  3WTZ A;  4XKC A;  3T1B A;  2R7D A;  2H8W A;  2HZD A;  4HX4 A;  2O0Y A;  2W85 A;  3CCY A;  2P6T A;  1PP8 F;  4V2F A;  4UUS A;  3DTE A;  3I64 A;  2FMY A;  2HOE A;  2EQR A;  4GCV A;  3I59 A;  4YFN F;  1O57 A;  2F4M B;  3BRO A;  1T98 A;  2KIF A;  1BC8 C;  3HKZ N;  2E36 A;  5JVT A;  3KIO A;  3FKI J;  3KP7 A;  2A07 F;  2JRM A;  1S9H A;  1V55 H;  3H0D A;  3DPU A;  1LDD A;  3QPH A;  1IXC A;  3H36 A;  4RGX A;  1FIA A;  2M0M A;  5B1B H;  2HPI A;  1MH4 A;  3FK7 A;  1AKH A;  2LK2 A;  3FMS A;  1B6A A;  1TNT A;  1Z21 A;  3RKQ A;  3KLO A;  4IXA A;  5F6F A;  5IP7 J;  2K02 A;  4ETS A;  1YOV B;  3CP8 A;  2WV1 A;  4CSW A;  4ZC3 A;  1BL0 A;  4EM2 A;  2CMP A;  2DA6 A;  1T39 A;  1LB2 A;  1LEB A;  2E5N A;  1HF0 A;  3GTQ J;  1IUY A;  2V6E A;  4XLH A;  2GOM A;  3K69 A;  2XPU A;  3PNY A;  2LF7 A;  1W7P D;  2HOS A;  4XK4 A;  2RQQ A;  4C2M J;  4JX6 A;  4PGG A;  4XSX F;  2IRF G;  3GF2 A;  3W3C A;  2FSW A;  4E7Z A;  3KE2 A;  3JRF A;  2RKH A;  5EF6 A;  1XD7 A;  1RI7 A;  2CUZ A;  1ZN2 A;  3LSJ A;  1ETQ A;  3CJQ B;  5M5Y J;  4XRS G;  1X3Z B;  3S14 J;  3OYB A;  1FTZ A;  3GFM A;  3SDG A;  1BI0 A;  1ETV A;  4AID A;  3A01 B;  5IT9 Z;  2EK5 A;  5LFA A;  4MLO A;  5GAG J;  4ESF A;  4HRI A;  2P4W A;  1T56 A;  1IZ1 A;  4AIK A;  1FIP A;  3WE3 A;  2L5Q A;  3RTR A;  1ZLJ A;  1OYY A;  2Y30 A;  3ASN H;  2JWT A;  3K4J A;  3H9Q A;  2PEX A;  5TRD A;  1ERD A;  2O8X A;  4LLN A;  1XGM A;  3BQY A;  3LQQ A;  4Y4R A;  1I1G A;  2EV5 A;  2NYX A;  3A01 A;  1VQN I;  1IRF A;  1TWF J;  3QPL A;  2H6B A;  4B3X A;  2FBI A;  4NQW B;  4RB1 A;  3DWL E;  2H6C A;  3HOT A;  2R7F A;  2HYJ A;  4G12 A;  2HOA A;  1VQL I;  4MNU A;  5LHG A;  2IXS A;  3HIF A;  2HTJ A;  1LQ1 A;  3AG2 H;  2FRH A;  3L1P A;  1JGG A;  3AAF A;  4Y52 J;  5HS7 A;  2MC3 A;  1XGN A;  3K4M A;  4D7M A;  3WU1 B;  3MMY B;  5IYB J;  2CUF A;  3IRR A;  1HXD A;  3J81 Z;  3E0J B;  2VOP A;  2QM3 A;  2CW7 A;  2L9S A;  2R7Z J;  4G7H F;  1QRY A;  1YHQ I;  4A3F J;  3FXK A;  1X4O A;  3RYP A;  4Y33 A;  3ZR8 X;  5CVJ A;  3CCU I;  5CVV A;  1Z67 A;  1Z77 A;  1WZ2 A;  2UV1 A;  2DO7 A;  1TTY A;  1JUP A;  1Z3X A;  4LGW A;  2GXG A;  4JBA A;  1R1U A;  1KYZ A;  3WTX C;  1HA8 A;  1TQM A;  1O3T A;  1DPR A;  5CYV A;  3BPX A;  2UXN A;  1P7J A;  2L4A A;  4WXH A;  4DZP A;  1WCM J;  1EH7 A;  2RAE A;  4G8X A;  2VPR A;  4M3E A;  1KQ9 A;  2K9L A;  4ON0 A;  3CJN A;  4FAS D;  2XGE A;  1HW5 A;  2JA2 A;  5EEG A;  5FO5 A;  1JT6 A;  1U5T B;  3MD2 A;  4B1R A;  2QKL B;  3WU2 C;  2BXY A;  3GTG J;  3AG1 H;  4P9U A;  3CF5 F;  2JA6 J;  2OF7 A;  1MMD A;  4LIT A;  4HOB A;  2STW A;  2BGC A;  5F08 A;  4KA4 A;  2L9N A;  1MJA A;  3WGG A;  1HKS A;  2PBI A;  2JA8 J;  1Y0N A;  4BDY A;  1RUO A;  2XF7 A;  1JJ6 C;  1HST A;  3I58 A;  3CMY A;  1VQ4 I;  1K83 J;  2M9H A;  1U5T A;  1X3U A;  4E4H A;  2E1C A;  4LG3 A;  1H8A C;  1S5L C;  1Z7U A;  2LY9 A;  3QP5 A;  3MZH A;  2EV6 A;  2IS6 A;  2DK5 A;  4M6V A;  1R71 A;  4A3C J;  2AHQ A;  2JPC A;  1N25 A;  2DPU A;  3ECO A;  2K5C A;  3VYS B;  1P92 A;  4C9Y A;  4M3B A;  4A0X A;  3K4K A;  1MBH A;  5LGN A;  2QZ8 A;  1ONV A;  1U0J A;  5KVR A;  1D0X A;  4DGW B;  4UY8 I;  2CQN A;  4XLA A;  1K78 B;  1JKO C;  1G3W A;  2M30 A;  3LSM A;  3ERE D;  2JVG A;  5CVU A;  4G94 A;  4GFB A;  4BDZ A;  3KP4 A;  4G7Z F;  1MMN A;  2W7N A;  2HQN A;  3SEQ A;  1HLV A;  2NVT J;  2WY7 Q;  1SD4 A;  1B8I A;  4IO9 F;  1ZKG A;  3IC7 A;  5EZG A;  4RGU A;  3QWL A;  5IYD J;  2VBX A;  4II2 A;  4E7S A;  4CZC A;  1PUE E;  5IY5 H;  3BG3 A;  1LUJ B;  3J81 K;  1WI3 A;  4HDV A;  1JTY A;  2ZXI A;  3CMM A;  1A6Q A;  2QVO A;  2ZB9 A;  4FE4 A;  4XOT A;  1LKX A;  2ZO4 A;  3DEW A;  2MD0 A;  4ESB A;  4RGR A;  2CO5 A;  1CF7 A;  4BYY A;  2DFE A;  1MMG A;  1UAA A;  3PQJ A;  4CH7 A;  2L02 A;  3OR2 C;  1NHA A;  2XKP A;  5KCM A;  1JKQ C;  4EMS A;  2ZME C;  1HCR A;  1S29 A;  3GTL J;  4EJT A;  2F4O B;  4BE0 A;  4C3J J;  2JTV A;  1NK2 P;  1SFE A;  3CTA A;  4PJM A;  5FFX A;  1VQO I;  3QYE A;  2KMU A;  2DLL A;  3I56 I;  1HW1 A;  1TWC J;  1JGS A;  2E1M B;  4BXX J;  2H94 A;  2PFB A;  1Y8R B;  4U0V A;  1VQK I;  4R1H A;  3HZJ A;  1ETO A;  3A0B C;  4EJO A;  5H6Q A;  2XB5 A;  3M4O J;  2VQC A;  1W7P B;  1E3O C;  2LD5 A;  3BR2 A;  4UV8 A;  2P0W A;  2KFD A;  3V8L A;  3WTU C;  2LKS A;  1TBX A;  2HXI A;  2ISZ A;  2O6G E;  1LDK B;  1IW7 F;  1TP4 A;  3LSG A;  1X19 A;  3CME I;  3KLN A;  1GVD A;  4OIN F;  4ENK A;  2Z1D A;  4A3E J;  4PJN A;  1TZL A;  3GZ6 A;  2BXZ A;  2VKH A;  1O3Q A;  3H0G J;  5L3F A;  3C2B A;  3WG9 A;  2XAG A;  1ZRC A;  1WRJ A;  2XVC A;  5LGT A;  1MJ9 A;  1DP3 A;  2LP0 A;  3ZOB A;  5M5W J;  3EET A;  5CVI A;  1J2X A;  2I8D A;  4BHC A;  3GTM J;  1FMV A;  1BI1 A;  2WB1 N;  5JI6 A;  3OS1 A;  3CUQ C;  3A03 A;  3VPR A;  3SHF A;  4UB8 C;  4HF1 A;  1UJ8 A;  2OQR A;  2NXN B;  3ZMS A;  4MFD A;  1MJB A;  2CV0 A;  4ENJ A;  1X1C A;  5KAI C;  3SYT A;  2BY0 A;  5B66 C;  3JAM K;  3GCM A;  3S2W A;  1SMT A;  5B5E C;  4WWC A;  1W4M A;  5E20 A;  1BI2 A;  4IHS A;  1FMW A;  2DQR A;  2FXA A;  4HF2 A;  1XPX A;  1Q1V A;  4Z2Y A;  3K4C A;  3R4K A;  2JPB A;  4HSR A;  3PO3 J;  1L0O C;  5D5U B;  2O9L A;  1P2F A;  1IXS B;  2A61 A;  2QQA A;  3HRT A;  3LQR A;  1R5H A;  1IRX A;  1LJ9 A;  3G3Z A;  4YII A;  4ENM A;  4ZJZ A;  1XDU A;  4GYI A;  4RB2 C;  2RNG A;  5GP9 A;  1YW7 A;  2ZFW A;  3K9T A;  3H5N A;  4UV9 A;  1RKT A;  3F6O A;  3Q0W A;  3O3K A;  2VOO A;  2GXB A;  2Y48 A;  4HNT A;  5FD5 A;  2L7K A;  1QPM A;  2LY2 A;  1RIO H;  1SFU A;  3OYD A;  1V3F A;  2LF8 A;  4MHG A;  4HEA 2;  1KZH A;  4F93 B;  1IN5 A;  1XC5 A;  5J4V A;  1R6R A;  5HLI A;  2JK3 A;  4FX0 A;  3OIP A;  4MEX F;  5FGM A;  2JUC A;  1D1B A;  3R6S A;  2Y69 H;  2BVL A;  3RJP A;  4HZF A;  4EM1 A;  3IRQ A;  1XS9 A;  4UXN A;  2Z9O A;  2DFF A;  2KQR A;  1NK3 P;  1MBF A;  4FQG A;  2BZT A;  2EJR A;  3CC4 I;  2M8E A;  3FF5 A;  3M1E A;  5A2Q Z;  1FYK A;  2VBZ A;  4ZYA A;  3EUH A;  2XGX A;  4Q4Z F;  3WHC A;  2P5V A;  5K5O A;  1ZLK A;  4XLP F;  3VYR B;  3BCB A;  3FDY A;  2ELK A;  1X2N A;  2K4J A;  2M87 A;  2M4G A;  1QBJ A;  3LST A;  2GQQ A;  1RET A;  2EFO A;  3D5L A;  5IP6 A;  2TCT A;  3QP6 A;  4IQJ A;  1FWZ A;  4CCL A;  1YJN I;  2ECC A;  5E3N A;  1TWH J;  2FEZ A;  2VT2 A;  4F3Q A;  4IHX A;  3FX3 A;  4KIT B;  3B73 A;  3P5J A;  4V19 K;  3LNQ A;  2LYC A;  2W48 A;  4HQM A;  3REO A;  1LEA A;  4A0Z A;  1CQT A;  5E1X A;  4BUP A;  5HOD A;  3DU5 A;  3W6J B;  2Y75 A;  1TLH B;  2WTE A;  2OQG A;  2HWV A;  2FOK A;  3GTK J;  1BBY A;  1UG2 A;  2XRL A;  4JOM A;  4GRI A;  2UXX A;  5JHF A;  1E3H A;  1ZR2 A;  5D6E A;  3O8G A;  4AC0 A;  3J7A Y;  2W00 A;  3ZQH A;  4EEF G;  2OCC H;  4F55 A;  3JSP A;  4EJW A;  4BXF A;  4ASN A;  1P4A A;  4OMY A;  4A3K J;  4CCM A;  5DM7 F;  1OCP A;  1FX7 A;  4IHV A;  3HSR A;  2HYF A;  2QYO A;  1FP1 D;  2CJJ A;  2FE3 A;  3S8P A;  1A36 A;  3J80 Z;  2VBY A;  2WAQ A;  3FBN B;  2ETH A;  2R7U A;  3FXO A;  2AXT C;  2L7M P;  1YG2 A;  3BR6 A;  3K4N A;  1Y39 A;  2DA3 A;  4CCN A;  3JRA A;  4DJA A;  2ZJ2 A;  2E34 A;  3P7N A;  5H2F C;  5DDG A;  4EVI A;  4RB3 C;  5A2Q K;  1ZRD A;  1DPU A;  2EFN A;  2F48 A;  4MEY F;  3CCS I;  1K79 A;  3LFU A;  4BEH B;  4XSZ F;  1MMA A;  1ULY A;  1P4W A;  2DT6 A;  3E5X A;  2LFB A;  2A3S A;  1LFU P;  1EKE A;  1TQP A;  1YRN A;  4PZJ A;  2IS4 A;  5HNF A;  4RB0 A;  3HHG A;  2Y9Z A;  2R5Z A;  1J09 A;  3C1D A;  3ISP A;  2DBB A;  1APL C;  1RZ4 A;  3GWZ A;  2VQL A;  3LOC A;  3T5X A;  3VSL A;  2YX7 A;  1Y8Q B;  1BR2 A;  1R22 A;  1KQ0 A;  4M6X A;  3PO2 J;  3BG6 A;  5F1R A;  2YSR A;  4HAM A;  4M9S A;  1QPI A;  3H1C A;  3ABT A;  2QQB A;  4CZZ A;  3LSI A;  4YFK F;  3F8M A;  1F4K A;  3L2V A;  3CES A;  3HGG A;  5FKO A;  4CO8 A;  3NRV A;  4BY1 J;  1D1C A;  3SDB A;  5JLW A;  5K7Z A;  5J3L A;  1U5T C;  2E5Z A;  1N77 A;  2KZG A;  4G6D A;  1IO2 A;  3S2D J;  1AOY A;  2OUM A;  5EEA A;  2DXI A;  1WJE A;  1Z7L A;  3E7L A;  3H5R A;  4TV7 A;  5HLG A;  3CUQ B;  5F0H A;  4XMY A;  5H6R A;  4D0P A;  1ZHF A;  3HSF A;  3LSR A;  3KFW X;  4BQO A;  2F5F A;  1Z1D A;  2EIM H;  4I76 A;  3ZMZ A;  4N9H A;  2XGC A;  3OYC A;  2F2E A;  2HPM A;  1QZY A;  3PUB A;  3RQI A;  2KHM A;  3E6C C;  1YO5 C;  3N4M A;  4I09 A;  2R5Y A;  4X1E A;  3BWG A;  4Y17 A;  1WWX A;  3NAU A;  4QLC U;  4ZYD A;  1LDJ A;  2CW0 F;  3FIW A;  4PUS A;  1D1A A;  1V5E A;  3PNV A;  3WE2 A;  1G3S A;  4KT6 A;  2IT0 A;  4B47 A;  1R23 A;  3OYK A;  4NDL A;  4Z6Y A;  1R1T A;  4MQV A;  2XKO A;  2ZBK A;  3O8H A;  2M8G X;  1UCR A;  3AL0 C;  3JRD A;  2DA5 A;  3KP2 A;  3TQN A;  1WPK A;  3OYH A;  2RVC A;  4M9Z A;  2D2W A;  2LRD A;  1FP2 A;  2M4K A;  4D7N A;  3HDD A;  5GAE J;  2K3F A;  3TBI A;  2LKP A;  1YW8 A;  2X1E A;  5LGU A;  3S3M A;  2QBY A;  2HTS A;  3TO9 A;  2UWM A;  1Z91 A;  2DA7 A;  3V42 A;  3ZRG A;  4XQF A;  1EJ9 A;  3CCQ I;  4X6A J;  1JHH A;  2X51 A;  3OS0 A;  2MBF A;  2QEN A;  3HB9 A;  3OYG A;  4IRG A;  2Z33 A;  2Q8K A;  1L3L A;  1Y1W J;  3CMA I;  2ZC2 A;  1B8I B;  4G6Q A;  1WJA A;  5EDN A;  2X6Y A;  1FYM A;  2AQE A;  2FML A;  2L4M A;  2HQR A;  1R1V A;  1VF9 A;  3FWE A;  3OIO A;  3CO7 C;  1MBJ A;  1QZZ A;  3VB2 A;  5HDG A;  4B48 A;  2HVR A;  5J1U A;  2CRG A;  1SVO A;  2ID6 A;  2ZJP F;  3BR1 A;  3B6C A;  4CHU A;  1NG6 A;  1XGO A;  4I0B A;  5JFR A;  1HQC A;  3I4N J;  4QPO A;  2XSJ C;  1D5V A;  1W0U A;  2P8T A;  4IEJ A;  2A68 F;  2DCE A;  2MW8 A;  2WAD A;  1E3P A;  1K61 A;  1SAU A;  2YS9 A;  2V7F A;  2F5D A;  1FC3 A;  2ZNZ A;  5BMZ A;  2CU7 A;  2MH9 A;  1XTA A;  3VSK A;  2VBW A;  3BZ6 A;  3CLQ A;  1CGP A;  4A3G J;  1BW6 A;  3HRS A;  2X1D A;  2NVQ J;  1FY7 A;  2RNJ A;  3SXY A;  1BM9 A;  5BOX A;  2HDD A;  1TL8 A;  2WWY A;  3J7A O;  2DT5 A;  2JA7 J;  2X6O A;  2O3F A;  3GBG A;  1IN8 A;  4ZTF A;  4EGZ A;  4HQE A;  5LHI A;  3KEO A;  1YS7 A;  1VI0 A;  4L5E A;  2Z99 A;  2MYS A;  1NG7 A;  1W7P A;  1X1D A;  2HQA A;  2IJL A;  5LD2 C;  4L5J A;  3PIO F;  1R58 A;  5J8C A;  3PIP F;  3KYL A;  4BE1 A;  3HBL A;  3TP0 A;  3T8R A;  4H0E A;  2V79 A;  4J19 A;  2W24 A;  2B7E A;  1HOM A;  3X2Q H;  3IAM 2;  2JSP A;  3HOS A;  4UB6 C;  1R49 A;  2ECB A;  2NAZ A;  2DOE A;  4AIH A;  1C0W A;  3EQL F;  2XAU A;  2TDX A;  3ZQQ A;  3ZPL A;  5HS9 A;  2PMH A;  1IN7 A;  1MNM C;  3ZP5 A;  2QSH X;  3IHU A;  5EYR A;  2KRH A;  2HDW A;  1HDD C;  2EIN H;  4HPQ A;  5D5X B;  5BS6 A;  1WJF A;  3MQ0 A;  4UUS B;  3S32 A;  2A6T A;  1KYW A;  3KYC B;  4BY7 J;  2R7R A;  1FOW A;  1BJZ A;  3OWT A;  2Z16 A;  1P9Q C;  3RQ4 A;  1TWG J;  4IZZ A;  1B9M A;  2ZSH B;  4YIF A;  4RS8 A;  4KNY A;  5DCM A;  2DYS H;  5HDN A;  5DM6 F;  1DGW Y;  4A69 C;  2NNY A;  2A05 A;  3S1Q J;  1Z6T A;  4PFO A;  4XN0 A;  5D4R A;  4IJA A;  3QOD A;  1LE8 B;  2DU9 A;  1STZ A;  3TMO A;  2ZME A;  1N78 A;  1JT0 A;  1S7E A;  2HFH A;  2DJI A;  1BOA A;  3F3X A;  3K1M A;  1V54 H;  2EFQ A;  3DQV C;  1EH6 A;  1R4N B;  1Z9C A;  1S3J A;  2C6Y A;  3IAS 2;  1I6X A;  4EQQ A;  1ZH5 A;  1Y0U A;  4IQ4 A;  5E17 F;  1RES A;  5E79 C;  4IHY A;  4XRS A;  2H1K A;  4OMZ A;  2DMQ A;  3GEZ A;  2HVQ A;  1W5T A;  2VJI A;  4KMF A;  5H20 A;  2YR2 A;  4UNO A;  3G73 A;  2LBF B;  3BC8 A;  3L2U A;  5HVQ C;  2X48 A;  3HRU A;  4XRM A;  1BW5 A;  3K7A J;  4N4N B;  3DKY A;  3HOX J;  1EH8 A;  4IKF A;  1K4T A;  1XG1 A;  3KEQ A;  5DYM A;  2PMU A;  3DV8 A;  3UR3 C;  2GAU A;  1DQU A;  2V1N A;  2MA3 A;  4U0W A;  3BDD A;  1I39 A;  4S05 A;  5FRM A;  1IF1 A;  1D3Y A;  3W6V A;  1PJR A;  3SEZ A;  1WFX A;  2VQG A;  5JVG F;  2IA0 A;  1TWA J;  5FKL A;  2K9S A;  3FBI B;  3DEE A;  2P81 A;  2ZXW H;  1DDN A;  2BE5 F;  1XGS A;  3E1S A;  1K6O A;  3H9G A;  1H88 C;  3SJM A;  5JR3 A;  4BEH A;  1R5I D;  2V1D A;  2X6X A;  2JZY A;  4HBL A;  2E2H J;  1TT5 B;  2EH3 A;  1RUN A;  5LLQ A;  3K0L A;  3D5R C;  1OR7 C;  2EIK H;  4NC7 A;  2M3A A;  3ZMT A;  4KIS A;  1YI2 I;  3F8F A;  4LK1 F;  1B1B A;  2BBY A;  3K1N A;  3BOQ A;  4UVB A;  4U88 A;  3PM1 A;  3TOA A;  5JLX A;  3V8K A;  9ANT A;  3CCV I;  3GUD A;  2X0L A;  3IKV A;  1MDM A;  5KHD A;  2WAF A;  4II3 A;  3DF8 A;  1YIT I;  2VC1 A;  3HRM A;  4M3D A;  2GZW A;  5KAF C;  2OJE D;  4B09 A;  1AHD P;  1GXQ A;  1B9N A;  4BJ6 C;  2A5W A;  5K7F A;  2O7O A;  2D1V A;  3G1O A;  1OCZ H;  3NQO A;  4QIW N;  5J1Y A;  3ML6 A;  2IS1 A;  2R7X A;  3HPH A;  2LNB A;  2UUZ A;  3HG9 A;  2TRT A;  1ACI A;  3RZO J;  2LG4 A;  3JRE A;  2XAF A;  2LTP A;  5J1R A;  4CDG A;  2OTL I;  3HGY A;  1MBK A;  2PMZ N;  2G9W A;  4E70 A;  4YEJ A;  1MH3 A;  3FK6 A;  4A3J J;  4Y3O A;  1O3R A;  2IGO A;  2PMZ A;  1XMX A;  1SMY F;  1QHG A;  2M0C A;  3GTJ J;  3PUF A;  4U7B A;  2L01 A;  5CPR B;  2FBK A;  1TC3 C;  2L0K A;  4A3D J;  2B0L A;  3L7W A;  2FUG 2;  2JRT A;  4KIF A;  2NS0 A;  3RI4 A;  2VQH A;  3OYL A;  2OZU A;  2XPW A;  3MCZ A;  3MKW B;  1FYL A;  3WHB A;  4DOZ A;  1MZB A;  4N0B A;  4KT5 C;  4BE2 A;  3TW7 A;  3IP4 B;  1DUX C;  3DFG A;  3CDL A;  3E3V A;  3DPT A;  5DS9 A;  4OWR B;  2VI6 A;  1WI9 A;  3KP5 A;  4YEL A;  4BHB A;  2Y0M A;  3GZ5 A;  3BJA A;  4C3H J;  2E1N A;  3QPT A;  1BC7 C;  4GYG A;  3ZQG A;  1IV8 A;  2W25 A;  4KIC A;  1DU0 A;  2PLY A;  2EWN A;  2R3S A;  3NWS A;  4LK0 F;  2NVU B;  1H9T A;  3HSE A;  1AU7 A;  4O3M A;  1BIA A;  3CP2 A;  2M7B A;  1SD7 A;  4MTD A;  4JX4 A;  4FIS A;  4IX7 A;  5CJ9 A;  5HNH A;  3ZQ7 A;  1BA5 A;  2WY8 Q;  3K4B A;  4A0Y A;  2DA1 A;  2PG4 A;  1OR7 A;  3CJR B;  4CUG A;  4C2T A;  4B4C A;  2LRE A;  5BNG A;  2QBY B;  2IGN A;  2V1U A;  3JRI A;  2CG4 A;  2PJP A;  5DCM B;  3S15 J;  1S7O A;  2ELJ A;  3WG7 H;  1UST A;  3BJO A;  1B4A A;  2WC2 A;  4AUX A;  1J75 A;  1ZQ3 P;  1OCC H;  3SFI A;  1J9I A;  2R5Z B;  2KDZ A;  3ZMD A;  4IVN A;  4JYK A;  1Z6R A;  4B3A A;  5E18 F;  2DQL A;  1QQI A;  2FD5 A;  2K85 A;  4UHT A;  5L3D A;  5J6X A;  1VQP I;  2XUB A;  3BR3 A;  1FSH A;  3E5Q A;  2VUM J;  2Y31 A;  1FOY A;  5F0C A;  4BGD A;  4XIC A;  3WTS C;  4HA8 A;  1OMI A;  2DT7 B;  2KL4 A;  1IGN A;  1A5J A;  4EJV A;  1J7K A;  3PL8 A;  3B6A A;  3Q9V A;  5IP9 J;  2L9V A;  2QQ8 A;  3M7G A;  5TJJ A;  4PSW A;  3QYF A;  4XM3 A;  3ZN1 A;  4M72 A;  2BEO A;  3R60 A;  3G2B A;  3MZ8 A;  3IL2 A;  3S93 A;  4HYE A;  1FOK A;  4P9F A;  5E1Z B;  1IRG A;  5ICG A;  1F1Z A;  4ZZL A;  3H3Z A;  1YJW I;  1WHU A;  3M8F A;  3WU0 A;  4F92 B;  4RBO A;  4M74 A;  3PQK A;  3HJE A;  4HV6 A;  4J01 A;  3HUG A;  2VJ4 A;  3A0H C;  3EPZ A;  3B02 A;  5J8F A;  2W84 A;  3ULQ B;  1Z3Y A;  3DP7 A;  1G3Y A;  1XN7 A;  2JT1 A;  1W36 C;  2FQ4 A;  2ZXJ A;  4U7D A;  2NOJ B;  2OD5 A;  4L9N A;  4FHT A;  4CCO A;  1IXR C;  1QHH D;  2IA1 A;  1E17 A;  3JRB A;  3OSG A;  4PJ0 C;  2GBY A;  2QA4 I;  4AYB A;  1VQM I;  2A6H F;  3QOP A;  2CV1 A;  5FFZ A;  2DOD A;  2R92 J;  3SZG A;  3MKL A;  1YJ9 I;  2ICW G;  1W0T A;  2KDO A;  3TGN A;  3J7Z I;  1UFM A;  1I5Z A;  3Q5F A;  1YS6 A;  5KNL A;  4NC8 A;  1JJ8 C;  1VFC A;  5K5Q A;  3A1Y A;  2CQ7 A;  1XSX A;  5M3F J;  3PNT A;  2H27 A;  2IA2 A;  2MGQ A;  1U9N A;  5E3L A;  3KZI C;  1Y56 A;  3HTU A;  2IEK A;  5IPA A;  3QRF F;  3CCL I;  2CH0 A;  1B72 B;  1WJB A;  3DBH B;  3H5A A;  3KEY A;  1JUM A;  4XR6 A;  2W1O A;  4MO7 A;  1D8J A;  2EA2 A;  1TW3 A;  1POG A;  2DFH A;  4MQ9 F;  3TL4 X;  1HBX G;  1HC8 A;  3KZZ A;  3F8B A;  4CYD A;  2AXL A;  4L9V A;  1GDT A;  1H89 C;  3FXQ A;  1X2M A;  2O61 A;  2K40 A;  2VN2 A;  1Q1H A;  3CUO A;  4WF2 A;  5IT9 K;  2HXO A;  2KT0 A;  2D1H A;  2LLK A;  1EA3 A;  3WTW C;  1TW2 A;  4BHP A;  2DMP A;  4B8X A;  3G1L A;  3OY9 A;  2NNN A;  3TDZ C;  4E7I A;  4RA2 A;  3JW4 A;  5HLT A;  1JE8 A;  1J59 A;  1FEX A;  1GV5 A;  5C4J J;  4C2U A;  2B9S A;  2IVM A;  2EPF A;  3V4G A;  3ZGK A;  4HLY A;  1UMQ A;  3CC2 I;  3LSK A;  2VOD A;  2NVY J;  5EG0 B;  2QSG X;  4PSX A;  1SAN A;  1JUS A;  5AIQ A;  4A5N A;  3S17 J;  1K4S A;  2J5P A;  1WQ2 A;  1RR7 A;  5JHU A;  5E3M A;  5E8I A;  3HOY J;  4ZZD A;  1I3A A;  5BPI A;  1HDP A;  5CVR A;  4GO1 A;  2LDU A;  4U87 A;  3LL7 A;  4IF4 A;  3LMM A;  4FCY A;  5EEH A;  4IOC F;  3E6B A;  1FBS A;  3HC7 A;  2DI3 A;  5L3E A;  3OOU A;  2AS5 F;  4RM3 A;  4MGR A;  1MKM A;  3F9K A;  3I4P A;  3MN2 A;  1K7A A;  3WTT C;  3F72 A;  2G7H A;  2DOA A;  3DKX A;  5E3O A;  4I99 C;  3Q0U A;  4AD9 A;  1D5Y A;  2FU4 A;  1X58 A;  3DCF A;  4QPQ A;  3J7Y J;  2DDB A;  2ZNY A;  3K2A A;  3DBR B;  3H35 A;  1RR8 C;  3C3W A;  1AA7 A;  2LBF A;  2K4B A;  3L2R A;  1GXP A;  2DFI A;  4GDF A;  4O5V A;  2F6C A;  2Y9Y A;  3F22 A;  2D5V A;  1MNE A;  4HX8 A;  2BY2 A;  3ERM A;  3FMQ A;  1EV7 A;  2M1B A;  2VJ5 A;  1FT9 A;  2HKX A;  3ZMV A;  3LSP A;  2ZCW A;  3EYI A;  5FRO A;  3LWF A;  3JCU C;  4V2G A;  3I9V 2;  1SD6 A;  2Y0S N;  3ABM H;  4XLC A;  1I6H J;  1T08 B;  4BNC A;  2XDV A;  4HNU A;  3GW2 A;  5FLX K;  4B44 A;  1HKT A;  4BL0 B;  3A2K A;  2HS5 A;  2CWE A;  4PGH A;  1IV6 A;  5DUK A;  1J5Y A;  2JSC A;  5HDK A;  5J40 A;  5B3S H;  2FQ3 A;  5D4S A;  3F0C A;  1JXS A;  1UHS A;  2RQP A;  4FE7 A;  3HM5 A;  4B43 A;  4CYC A;  4OIR F;  2Z2S B;  3DXJ F;  4M9X A;  4HV5 A;  4LD5 A;  2J5O A;  2RGV A;  4P96 A;  5ILU A;  2P5L C;  4IHT A;  4Q47 A;  1VND A;  3BJ6 A;  2EBI A;  1U78 A;  3FXU A;  2LVS A;  2ESN A;  4IRH A;  2V4J C;  5LBQ A;  2JVH A;  3JTH A;  3GFJ A;  5BPD A;  4J00 A;  3EUH C;  1OIS A;  3ZN0 A;  3DU6 A;  3BG5 A;  4AVZ A;  3V7C A;  3VWB A;  2O8K A;  3PFI A;  3QU3 A;  5F27 A;  3GZN B;  5FRN A;  1FOX A;  2QWW A;  3ECH A;  5ED4 A;  4JK1 X;  1O4X A;  3IWZ A;  4E7J A;  2IPQ X;  3FXR A;  1SEU A;  3LFK A;  5L3C A;  5L3B A;  3ONQ A;  1S8N A;  4UVA A;  2K9N A;  3DKW A;  2JN6 A;  1RRJ A;  3M3Y J;  2HR3 A;  3S16 J;  1U9O A;  1PVE A;  1IN4 A;  3ABK H;  2OC6 A;  4KYW A;  2E1O A;  2YUS A;  3V7S A;  3RIR A;  1ZG5 A;  2CV2 A;  1D0Y A;  1BIB A;  2KLO A;  2XRO A;  2G0E A;  2JUG A;  5L3G A;  4KN4 X;  3GFI A;  4KJZ A;  3U1D A;  1E2X A;  2KJC A;  1OCR H;  4A6D A;  4RAG A;  2R7V A;  5F1J A;  5ILV A;  2R7W A;  4DZJ A;  4IRI A;  1YX5 A;  3OL4 A;  2MD5 A;  3KPH A;  4AWX B;  3BR5 A;  3RDI A;  2MC4 A;  4EAT A;  1PYV A;  1FZP B;  3P9I A;  2Q2E A;  2VIX A;  2M2E A;  3SQN A;  2L54 A;  2EA4 A;  2VE8 A;  5FLV A;  3ZQF A;  1YE9 A;  1ON2 A;  2ACJ A;  1JKR C;  2YU9 J;  4FT8 A;  5ICE A;  3HKZ A;  3HTS B;  4RAF A;  4I0A A;  1B59 A;  2CS3 A;  1TT0 A;  3K6G A;  2Q2E B;  4N4O B;  2EZI A;  2E60 A;  1LFB A;  4HF0 A;  2P7V B;  3HOV J;  1IG7 A;  2HU9 A;  1TQI A;  5FLX Z;  2VL8 A;  5FKK A;  3J80 K;  5EGO A;  2P7C B;  2HVS A;  1MGT A;  1D0Z A;  3VDX A;  4KUM A;  1Y1V J;  3BTL A;  3I4M J;  3I71 A;  3R0J A;  1F43 A;  2GOX B;  3VYT B;  2KIQ A;  3JR9 A;  5C4X J;  3ZQL A;  3GME A;  1LFP A;  3C18 A;  3HPG A;  2EB7 A;  2E19 A;  3NWT A;  3VEP A;  1AKH B;  2RC4 A;  1QVT A;  1WJD A;  3DBL B;  2ELH A;  3K10 A;  1W1W E;  2KIM A;  2X6W A;  3AG3 H;  3TP3 A;  5FJ8 J;  2YU3 A;  3S3O A;  4CIC A;  4CGZ A;  2FA5 A;  1OFC X;  2M45 A;  1IDZ A;  2O5R A;  2BHZ A;  2VAS A;  1SVL A;  2PI0 A;  2BW3 A;  4YRV A;  3IV5 A;  2M5W A;  3MKZ A;  2R7T A;  3S1N J;  1I1S A;  1A6I A;  2F4I A;  5DD8 A;  3I3L A;  4NQW A;  1YIJ I;  2A5Y B;  4XL9 A;  1P7I A;  4YFX F;  4L9T A;  4RAY A;  5EJC A;  2V1X A;  4E7L A;  4BQN A;  2A6E F;  3IH3 A;  5IT3 A;  1SFO J;  3WOD F;  5AIP A;  1MW7 A;  2YPR A;  3KX2 A;  2R7Q A;  1O7L A;  5ICF A;  3WGH A;  1JI8 A;  1CF7 B;  4HNV A;  1B72 A;  1VQ7 I;  1R7J A;  2KJB A;  2JJ7 A;  3W2W A;  4ESJ A;  4BU2 A;  5DUI A;  3FIS A;  2CYY A;  3BG7 A;  4NBQ A;  4XLN F;  5CQG A;  5HS8 A;  2L9R A;  1MD0 A;  2GXA A;  4CA0 A;  3VFZ A;  1X1P A;  3FHN A;  3M9A A;  1T38 A;  2NOG A;  4QSH A;  2DDA A;  3ELK A;  3FMR A;  3U21 A;  3U2R A;  2MAB A;  3V7R A;  2X4H A;  3QU6 A;  4E6K G;  2IBD A;  3D5S C;  1I27 A;  1W5S A;  1QO0 D;  5DV5 A;  1T8I A;  5D8L B;  3OS2 A;  1YFH A;  4WCG A;  2R93 J;  2PJR B;  3KET A;  3JSO A;  5D8K B;  5D6F A;  3L2C A;  1R9T J;  3QYB A;  1F9N A;  1ON1 A;  3CZ6 A;  5DEQ A;  4Y13 A;  1BI3 A;  3G6E I;  3Q3S A;  2QUF A;  2YX4 A;  1YX3 A;  2H09 A;  1IDY A;  3C7J A;  1EF4 A;  2EFW A;  2WB1 A;  5DCF A;  5K1Y A;  1SFK A;  4KN7 X;  1MBG A;  4JQF A;  3QOE A;  3TO6 A;  4HX7 A;  1WH5 A;  4BQQ A;  2DMU A;  4LLL A;  3GO5 A;  3MKY B;  3ZMU A;  2DOF A;  4AM3 A;  4M3G A;  4WXD A;  3OYA A;  1O7F A;  2CFX A;  3OSF A;  1ETW A;  2KIU A;  3D0S A;  1FBU A;  2FF4 A;  3GVA A;  3G4S I;  1BR4 A;  1ZTR A;  3G1M A;  2VJJ A;  3FM5 A;  2JMW A;  4NC6 A;  3EDP A;  4IHW A;  1IAW A;  1WSU A;  1SAX A;  4XKB A;  2ADU A;  3BP8 A;  2CUJ A;  2E7X A;  3O2P E;  1OJL A;  3KP3 A;  3LAP A;  4LIU A;  3VYU B;  1R5G A;  1V4R A;  3I54 A;  1ORK A;  5BQT A;  3A02 A;  5M5X J;  3ZQI A;  3MFK A;  4IPA A;  1ETY A;  4KIG A;  2L3D A;  5GAD J;  2BY3 A;  3R61 A;  1OKR A;  4BJ5 C;  2MSY A;  1PUF B;  3BR0 A;  2XIG A;  2LKX A;  2OAZ A;  4BXU A;  1X4P A;  2HDC A;  2GA1 A;  1UHM A;  3FZV A;  1MSF C;  3ZXS A;  5GTI C;  3BY6 A;  4I7H A; 
#chains in the Genus database with same CATH homology
 4MFE A;  5EGO B;  2XRL A;  1UG2 A;  4JX4 A;  4FIS A;  5F0F A;  1BA5 A;  5F04 A;  1ZR2 A;  3O8G A;  1T33 A;  4AC0 A;  2DA1 A;  3ZQH A;  4EEF G;  3JRG A;  2DN0 A;  4B4C A;  1IJW C;  2H8R A;  4A3K J;  5BNG A;  1OCP A;  2LR8 A;  3BTI A;  4IHV A;  3JRI A;  3S15 J;  2CJJ A;  5EZH A;  5IYC J;  4AUX A;  1ZQ3 P;  3SFI A;  4D5F A;  2CQQ A;  3GTP J;  3HOW J;  2MG4 A;  4S0H B;  2R5Z B;  2KDZ A;  2L7M P;  4JYK A;  3BR6 A;  4B3A A;  4A3M J;  2FD5 A;  1ITY A;  2DA3 A;  2R5Y B;  4XID A;  3JRA A;  2NS7 A;  5FKN A;  2E2J J;  2Y2Z A;  3BR3 A;  5C44 J;  2VUM J;  2Y31 A;  2HI3 A;  5F0C A;  4DW6 A;  4XIC A;  1A5J A;  1IGN A;  3B6A A;  1IC8 A;  2LFB A;  5IP9 J;  1LFU P;  1YRN A;  2NVX J;  2Y9Z A;  3CCY A;  2R5Z A;  4V2F A;  4A3B J;  3H3V K;  1ZR4 A;  4UUS A;  1APL C;  2EQR A;  2L7F P;  3LOC A;  4RBO A;  3HKZ N;  3PO2 J;  3FKI J;  2E2I J;  3QQA A;  1QPI A;  1JTX A;  2FQ4 A;  3HGG A;  5FKO A;  1FIA A;  1MH4 A;  3FK7 A;  1AKH A;  3JRB A;  2LK2 A;  4BY1 J;  2IAI A;  3OSG A;  2GBY A;  3Q0V A;  5JLW A;  3RKQ A;  2EZL A;  5K7Z A;  5IP7 J;  3JRC A;  5J3L A;  2WV1 A;  2R92 J;  1BL0 A;  3MKL A;  3ZQC A;  1W0T A;  3S2D J;  2DA6 A;  2DA2 A;  4ABZ A;  5EEA A;  3GTQ J;  1HF0 A;  3E7L A;  1JJ8 C;  2XPU A;  4LOC A;  2VKE A;  5F0H A;  1VFC A;  3TED A;  4XK4 A;  2HOS A;  5M3F J;  4C2M J;  2MGQ A;  1U9N A;  5E3L A;  4JX6 A;  3LSR A;  2IEK A;  4I76 A;  5IPA A;  3NAR A;  1B72 B;  2XGC A;  3JRF A;  1JUM A;  5EF6 A;  4MO7 A;  3RQI A;  1POG A;  3IH2 A;  3LSJ A;  1ETQ A;  4BBS J;  5M5Y J;  1ZK8 A;  1GDT A;  2R5Y A;  4X1E A;  4XRS G;  1H89 C;  1X2M A;  3S14 J;  2K40 A;  3NAU A;  1FTZ A;  3SDG A;  3FIW A;  1ETV A;  3A01 B;  2HXO A;  2KT0 A;  2LLK A;  4RDU A;  2JA5 J;  4MLO A;  2DMP A;  1T56 A;  1ENH A;  3G1L A;  1FIP A;  1YRN B;  4JX5 A;  2Y30 A;  1FEX A;  1GV5 A;  1RKW A;  5C4J J;  2JWT A;  4NDL A;  1MSE C;  3O8H A;  2M8G X;  1I50 J;  4QTR A;  3BQY A;  3JRD A;  2DA5 A;  1IUF A;  1RPW A;  1UMQ A;  3A01 A;  1WPK A;  3S2H J;  1TWF J;  3QPL A;  1OCT C;  2NVY J;  5EG0 B;  1SAN A;  1JUS A;  3S17 J;  4D7N A;  3HDD A;  2HYJ A;  4G12 A;  1RR7 A;  2HOA A;  3TW6 A;  5E3M A;  3HOY J;  2XSD C;  1HDP A;  3JRH A;  2DA7 A;  3L1P A;  1JGG A;  4Y52 J;  3BT9 A;  4FCY A;  4X6A J;  5IOY A;  4D7M A;  2DMN A;  2XB0 X;  1GV2 A;  2CUF A;  3OOU A;  5IYB J;  3HB9 A;  3MN2 A;  2FJ1 A;  2R7Z J;  1Y1W J;  4A3L J;  1QRY A;  1B8I B;  4A3F J;  5E3O A;  5EDN A;  1F36 A;  3Q0U A;  2L7Z A;  1D5Y A;  2X9D A;  1X58 A;  3DCF A;  1VF9 A;  1Z77 A;  2M34 A;  2VKV A;  3OIO A;  1MBJ A;  1JUP A;  3K2A A;  5J1U A;  3BQZ A;  2CRG A;  2DTZ A;  2ID6 A;  3BR1 A;  3B6C A;  1GT0 C;  1P7J A;  2Y9Y A;  4DZP A;  2D5V A;  1WCM J;  2RAE A;  2VPR A;  4M3E A;  3LSP A;  3I4N J;  4V2G A;  2XGE A;  1I6H J;  2Y0S N;  1W0U A;  1JT6 A;  4IEJ A;  2MW8 A;  2AO9 A;  4B1R A;  1K61 A;  1ZGW A;  2YS9 A;  3GTG J;  2CU7 A;  2JA6 J;  2OF7 A;  1IV6 A;  3CQZ J;  1QVU A;  1BW6 A;  5F08 A;  4A3G J;  2NVQ J;  3F0C A;  1UHS A;  4FE7 A;  4CYC A;  3HM5 A;  2JA8 J;  2HDD A;  1VND A;  1U78 A;  2EBI A;  2X6O A;  1JJ6 C;  2JA7 J;  3GBG A;  2ME6 A;  2LVS A;  3D1N I;  3CMY A;  1K83 J;  2M9H A;  1FJL A;  1VI0 A;  4L5E A;  2NS8 A;  2OPT A;  1H8A C;  2LY9 A;  2I10 A;  3BG5 A;  4AYB N;  2O8K A;  5F27 A;  3HBL A;  4M6V A;  4A3C J;  2AHQ A;  3TP0 A;  1O4X A;  4J19 A;  2GLO A;  1HOM A;  2CUE A;  4M3B A;  1MBH A;  1JKP C;  2K9N A;  2ECB A;  2JN6 A;  3M3Y J;  4C3I J;  4CYC B;  3S16 J;  1U9O A;  4UUT A;  1MNM C;  2E1O A;  1JKO C;  2YUS A;  5EYR A;  1HDD C;  4GFB A;  4UUS B;  2G0E A;  1HLV A;  2NVT J;  1B8I A;  4BY7 J;  1ZKG A;  5EZG A;  4I6Z A;  1AU7 A;  5IYD J;  5F1J A;  4DZJ A;  1BJZ A;  1U8B A;  5FKM A;  3BG3 A;  4Y7N J;  4A3I J;  1WI3 A;  1JTY A;  3BR5 A;  1TWG J;  2ZB9 A;  4FE4 A;  5DTD A;  3IH4 A;  3RZD J;  2XPV A;  2B63 J;  2M2E A;  3DEW A;  5FLV A;  4JP0 A;  3ZQF A;  5IOZ A;  5M3M J;  2R0Q C;  2K9Q A;  4A69 C;  2N8G A;  1JKR C;  2YU9 J;  1JKQ C;  3S1Q J;  1HCR A;  1ETX A;  1G2H A;  5EG0 A;  1LE8 B;  3GTL J;  2HQ5 A;  4C3J J;  1JT0 A;  1S7E A;  1NK2 P;  2QCO A;  2FX0 A;  2EZI A;  1LFB A;  3GTO J;  3HOV J;  1IG7 A;  2COB A;  5FKK A;  1TWC J;  4W97 A;  4BXX J;  1PUF A;  5EGO A;  1RES A;  4IHY A;  4XRS A;  2H1K A;  1Y1V J;  3BTL A;  3I4M J;  1ETO A;  2DMQ A;  1F43 A;  3BTJ A;  5C4X J;  3JR9 A;  2XB5 A;  3ZQL A;  3M4O J;  2ME0 A;  4DYR A;  2LD5 A;  3BR2 A;  1E3O C;  1I3Q J;  2E19 A;  2X48 A;  4XRM A;  1AKH B;  1BW5 A;  1QVT A;  1LE8 A;  2HXI A;  3K7A J;  2WAQ N;  3HOX J;  3TP3 A;  3LSG A;  5FJ8 J;  2QF7 A;  5FLM J;  1XG1 A;  1NTC A;  1GVD A;  1OFC X;  1IDZ A;  1ETK A;  4A3E J;  2CQX A;  1WH7 A;  5C3E J;  3IV5 A;  3W6V A;  2HOT A;  3S1N J;  2DJN A;  1A6I A;  2EZH A;  1TWA J;  3H0G J;  3C2B A;  5FKL A;  2K9S A;  3BG9 A;  4BBR J;  2P81 A;  1P7I A;  2LP0 A;  3ZOB A;  3IH3 A;  1SFO J;  3HOU J;  4MIM A;  5M5W J;  1H88 C;  3SJM A;  3GTM J;  2WB1 N;  3A03 A;  3VPR A;  2EH3 A;  2DMT A;  2E2H J;  3QPS A;  2DA4 A;  4BKX A;  4HNV A;  1B72 A;  4A93 J;  1MBE A;  4MFD A;  2JJ7 A;  3FIS A;  4M3F A;  4D5C A;  2L9R A;  3S1M J;  3PM1 A;  5JLX A;  9ANT A;  5GPA A;  2NOG A;  4QSH A;  5GPC A;  1Q1V A;  2IBD A;  1DU6 A;  3PO3 J;  4M3D A;  2O9L A;  1AHD P;  2R93 J;  5K7F A;  2O7O A;  3G1O A;  4QIW N;  5J1Y A;  5GP9 A;  3UKG A;  1R9T J;  2XGD A;  1RKT A;  3Q0W A;  2TRT A;  3RZO J;  1Z0X A;  3Q3S A;  3JRE A;  2LTP A;  5K7H A;  5J1R A;  3HGY A;  1MBK A;  2PMZ N;  1IDY A;  1EF4 A;  1MH3 A;  4W1U A;  1MBG A;  1XC5 A;  3FK6 A;  4A3J J;  1FTT A;  2JK3 A;  1WH5 A;  1IRZ A;  2DMU A;  2M0C A;  3GTJ J;  2EZK A;  4A3D J;  1TC3 C;  2L0K A;  4M3G A;  3OSF A;  1XS9 A;  1ETW A;  1NK3 P;  1MBF A;  1ZTR A;  2XPW A;  3G1M A;  2JMW A;  3HEF A;  3WHB A;  4IHW A;  3HOZ J;  3WHC A;  3TW7 A;  1OJL A;  2ELK A;  1X2N A;  3CDL A;  3S1R J;  1ORK A;  1RET A;  5DS9 A;  5IP6 A;  3A02 A;  2TCT A;  1GUU A;  2VI6 A;  3ZQI A;  5M5X J;  3MVP A;  1ETY A;  2ECC A;  5E3N A;  1TWH J;  4IHX A;  4C3H J;  1WGX A;  2MSY A;  2ID3 A;  4DYC A;  1PUF B;  3LNQ A;  3BR0 A;  2W48 A;  3ZQG A;  2LKX A;  3BTC A;  1DU0 A;  2GM4 A;  1CQT A;  4DYQ A;  5HOD A;  1MSF C;  4FTH A;  3GTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...