3RKSA

Crystal structure of the manihot esculenta hydroxynitrile lyase (mehnl) k176p mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
258
structure length
258
Chain Sequence
MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRPGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Hydroxynitrilase
publication title Crystallographic Studies of Manihot esculenta hydroxynitrile lyase Lysine-to-Proline mutants
rcsb
source organism Manihot esculenta
total genus 100
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2011-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rksA00
2Z5GA 5JAPA 2I03A 3H18A 3H2JA 3KWFA 1MX5A 4CI9A 1DQZA 3F9CA 2XUKA 4X93A 5CT9A 4WY5A 1CV2A 1XKTA 2RHWA 3CCCA 3I2IA 2WUGA 2C7BA 2D0DA 3IA2A 1G4HA 1UOQA 2IITA 3I2HA 3IB3A 5FXMA 3V1MA 5ALUA 2Y1KA 1XRMA 3Q0TA 1HDEA 2BUBA 2OCLA 5JD5A 3O4JA 2J4FA 3O4IA 1UK7A 1XFDA 3S2ZA 3AIKA 5ALFA 3ZLVA 4AXBA 3DEAA 4ZGBA 2JEZA 2XUJA 2XQGA 5AKHA 4JUIA 1WM1A 2PVSA 3B5EA 3H19A 2OCIA 1LGYA 4G4IA 3FOBA 4HZGA 4H7KA 1Q0RA 1ZOIA 3OURA 5ALJA 5ALSA 3NUZA 2RAUA 4EY8A 2WIDA 5AKZA 1A8QA 1A8SA 3ZPXA 2O7VA 5DLPA 1CUDA 2XUGA 4X6UA 2XMRA 4UHEA 4EY7A 1RP1A 4NS4A 5CT6A 1H2ZA 2RONA 4WDQA 1T2NA 2EDAA 1EXWA 4AN0A 3BIXA 4KAFA 3H2GA 3LS2A 4AB1A 4FFVA 1CFJA 5K3FA 1UXOA 4E15A 3AILA 3BDVA 4AZ0A 5FUMA 2HA6A 4UHCA 1AUOA 3HJUA 4Y2XA 1EDDA 2D5LA 4AO7A 4X71A 2GYVA 3QH4A 3C8HA 1XZFA 3G02A 3SK0A 4HTAA 3LCRA 4IH1A 1LBSA 4N8EA 3I2FA 2AJBA 4F60A 1HBJA 4DMKA 5AJHA 3BF8A 2O2HA 1ACLA 3TEJA 2WFLB 2XMDA 2HRRA 3G9XA 2PPLA 3MUOA 3C6YA 5AKGA 5A71A 4WDRA 1EDEA 3WA7A 4YPVA 2WIGA 1E5TA 3HI4A 1B41A 4N5HX 3STXA 2CKMA 4UPDA 1CUHA 2X8BA 2WM2A 4MYDA 3OM8A 4CG1A 3S8YA 5ALPA 4BRZA 3FVRA 5BWBA 2O2GA 1QTIA 3GELA 1A7UA 4Y2TA 2AXEA 3UMJA 1JJBA 2HA4A 1R9NA 5ALIA 2DQYA 4HXFB 5FP0A 4J0JA 5KREA 3K2IA 3FWHA 1R3DA 3K9BA 4B6GA 4J0CA 5LZ8A 1UOPA 4FOLA 3PDCA 1GXSA 2VTVA 3W9BA 1QIFA 2DFPA 1VKHA 1XZLA 2CEKA 2OPHA 4FBLA 4BAGA 3QVMA 3EIOA 5I8PA 3RKSA 4E46A 2PSFA 2XQIA 1G42A 3C5WP 2WFZA 2PSEA 1JT2A 4H7DA 5ESRA 2GYUA 1XZMA 4U2FA 4KAJA 2XUDA 4BP9A 3L1JA 4UFPA 4LKOA 1XRLA 4JH0A 4A5SA 3VJMA 4AMZA 1VOTA 2PKYX 4DNFA 3STTA 1GQRA 5HKAA 5HK9A 1TRHA 3IUJA 4BAZA 1KU0A 1X2EA 3WK5A 3K6KA 4J0DA 5IVHA 1ZJ4A 1XRRA 1XROA 4KAAA 4B84A 3HC7A 1SCIA 2V96A 1O6FA 5A7GA 1XZIA 3HABA 1Y7IA 3HEAA 1P0QA 2VJCA 4JYMA 3DYVA 4X85A 4J0KA 5D3KA 2ORYA 4RE5A 5AP9A 2R8BA 1TCBA 4UHDA 1QFMA 5CW2A 4X94A 4UBIA 3QPAA 3WK4A 5ALEA 2XUHA 3WJ1A 1XZCA 1XRPA 1QIDA 1ZI9A 1J1IA 3H1BA 1QO7A 4QZVA 4BRSA 1YASA 3KXPA 3C8DA 3SWWA 1MAAA 3DYIA 2OGZA 5HF9A 1QIHA 4FBMA 5BWCA 3W05A 3ESAA 4G8CA 4Y2YA 2JGKA 2G63A 4WCVA 3ESDA 2WJ6A 1XRNA 2OCGA 1QIGA 2ZSIA 2QZPA 4DYHA 1ORWA 1ZJ5A 3ILSA 5I9IA 1XZDA 5EHQA 4YX9A 4DIUA 2HM7A 3G9TA 1THTA 2LIPA 1ODCA 3G0IA 4X6XA 4G8BA 5DNWA 4J0IA 2G4LA 4K2AA 5E4JA 1SOMA 2GBGA 2QKYA 4FLMA 4BZWA 5LZ2A 3LIIA 4CFSA 4RE6A 2WG0A 3V1NA 1VXOA 1MX1A 2WIFA 5LKAA 4IO0A 1PFQA 4KE6A 3DL7A 1TIBA 4KE7A 5H3HA 4NVRA 5E4YA 2XT0A 1DWQA 3A2NA 1N8SA 5HF6A 4IH9A 2PBLA 3F96A 1GKKA 5LYYA 3MVEA 4B81A 4EBBA 1DINA 1XZKA 5F4ZA 2XUPA 4ZWNA 1XZEA 2J3DA 4DSZA 3HLKA 4X00A 5D6OA 1EVEA 2HA5A 3QYJA 1ZIYA 4RNCA 3CCBA 4KRXA 2BGNA 1TCAA 3WI7A 5BOVA 2WHRA 2Q0XA 3WKDA 2BGRA 1GPKA 1NX9A 1BU8A 2BFNA 3D7RA 3I6MA 4U2BA 5JAOA 3GROA 3EQ7A 2HRQA 1VE7A 3E3AA 2QXTA 4GBGA 4C89A 2E3JA 4QEKA 3FYUB 4DMFA 2H7XA 3WK6A 5AI4A 2OLEA 5LZ7A 4QDXA 4FHZA 4FLFA 5AKLA 4N5IX 2GYWA 3N0TA 4UHFA 1L7AA 4LXGA 4N8DA 4Q3LA 3BL8A 1AMNA 2RHTA 2V9ZA 3WJ2A 5EGNA 2XQKA 3W2TA 4BVKA 1H2YA 1ZGCA 5JARA 2Z8XA 3WKCA 1K5PA 1R9MA 1MPXA 2ACKA 1EA5A 1TAHA 3JYHA 3DOIA 1I6WA 3P2MA 4K6GA 4ZV7A 4ITVA 1EH5A 2OG1A 2PU7A 4DSAA 1JFRA 1JMKC 3DQZA 4QDOA 3R40A 4H0CA 1ORVA 2CB9A 5A7HA 3QM1A 4CG3A 1LPOA 5CT5A 3R3YA 3WQHA 4QDTA 2ROQA 5AOCA 3FLBA 2HA2A 3W04A 4FFWA 3IDAA 3MGAA 5AK3A 1E66A 4GLBA 4CIBA 4MXDA 1BN6A 1QTRA 3C5VA 4H77A 4WJLA 3PUIA 5ALDA 1CUEA 1CUGA 1ZI8A 1EB8A 4MEBA 3R3XA 2XMQA 3KOOA 4CCWA 4X3CA 2VEOA 3C87A 3FCXA 3WKBA 4HVTA 5LP1A 4DNOA 4PO3X 3ANTA 3ZLTA 3D4LA 4CIAA 3EQ8A 4W63A 4PW0A 4OPMA 3I1YA 3QPDA 4B0OA 4ZI5A 4LXIA 1Q84A 1EB9A 2WFLA 5T4BA 5CURA 4H18A 1A8UA 1XQYA 2WTNA 4H7IA 2QXUA 1YR2A 4Y2SA 1XZAA 4YK7A 4PF1A 4Q1VA 1VE6A 4EA6A 3D5EA 3LIPA 5LLSA 2ZYIA 5T4FA 1N1MA 1VA5A 3AZPA 4BBZA 2JGIA 1ZD4A 5E2IA 3G0DA 1LZKA 4WFKA 2AJCA 2QT9A 4MQLA 5AKEA 4ARBA 3WKEA 4OB6A 4X91A 4OB7A 2X5XA 4FNGA 5SYMA 1YB6A 4K6HA 2XMSA 4CCYB 3VISA 2Y6VA 3F98A 5C8ZA 5IH7A 1CQWA 5AHXA 2CBGA 1FSSA 4Q3OA 3STUA 4B85A 2I78A 1XRQA 3IUQA 2JGLA 1FFBA 1USWA 3O95A 4C88A 5ALVA 1BCSA 1O6GA 1XQWA 1TQHA 5CH5A 3QMWA 3D2AA 1MN6A 1UKBA 3IVMA 3DLTA 1DT3A 4X90A 3UUFA 3ESCA 3FCYA 4FLEA 5JIBA 3I2JA 3B12A 5K3AA 1Z68A 3WWEA 2XMCA 2QJRA 5CRIA 4UBLA 4W1RA 2RGUA 5IVIA 3D3NA 5ALNA 5AK4A 1E3QA 2J4CA 3BDIA 3GFFA 3OOSA 5AM2A 1LPNA 4LIPD 3C6BA 1CUAA 4A23A 1QFSA 1DT5A 1UK9A 2DCMA 1K63A 4LYEA 3I2GA 2HU7A 1P0PA 2XUAA 1CRLA 1Q0ZA 1BS9A 2ZVDA 5DTIA 2FJ0A 5KWIA 1W75A 3HXKA 4I19A 3H2HA 3M82A 4GHWA 4OYLA 4W1PA 1CUJA 4WFJA 3O9VA 5AOBA 4C87A 1UK8A 1C7IA 4KRYA 2OAGA 2WKWA 3MUNA 1GT6A 2HU5A 5DYWA 3NOXA 1CUCA 3V48A 1GZ7A 2WUDA 2ONCA 2WG2A 1AC5A 2WUFA 3O9MA 4XIIA 3ZLUA 5DJ5A 1P0MA 1QJ4A 4BDTA 5FKJA 2X76A 2WQZA 4GWLA 1LPAB 4W1QA 5LKRA 1WOMA 1WB4A 2GBFA 2QRUA 4G4GA 4G9EA 4H7HA 2C5GA 3IUNA 1RWQA 5HKBA 1UFOA 3M3DA 4ETWA 2HU8A 2QS9A 1E8MA 4FMPA 2C0QA 3QITA 4W9RA 2WG1A 4KEAA 3UUEA 3M83A 4Y9SA 2YASA 2FX5A 3WL6A 2PM8A 5HF8A 1YA8A 1E89A 4L72A 4U2CA 4J7AA 5JADA 3LLCA 2OXEA 3WL8A 1AGYA 2YXPX 4NMWA 4BAUA 4CG2A 3O4HA 3IURA 4OYYA 4X92A 3STYA 1C7JA 1HKHA 4X97A 5ALHA 2BJHA 3WMRA 4DTCA 3QMMA 4UFOA 4I4CA 3WIOA 2GBCA 2O2IA 5CXXA 4L0CA 4V2IA 5LIPA 3PFCA 4MEAA 2XLCA 5FV4A 4LXHA 4KJXA 3G0BA 2YYSA 4AZ3A 3T52A 4H35A 4EY5A 2PL5A 3FAKA 5JAHA 3JWEA 2QR5A 5AH0A 4G4JA 5FRDA 2HFJA 4UBOA 4B7ZA 3GA7A 5AKXA 1QIJA 1GGVA 1N5RA 4BZZA 2VQ6A 4DGQA 3BWXA 3KWJA 1VXRA 4BCDA 2WIKA 3C6ZA 4HXGA 2DHCA 5D3ZA 1JKMA 1LPBB 5K3FB 5K5EA 2PU5A 1CUFA 4G5XA 1LPPA 1LPSA 1LBTA 5LZ9A 3PE6A 5KWJA 1YS1X 2WHQA 1JJIA 3QPCA 4TVKA 2JBWA 4IH4A 5HQ3A 2P8SA 1F8UA 1QGED 2VJDA 2XB6A 4IQ4A 2HL6A 1EI9A 1TCCA 3GUUA 1Y7HA 5SYNA 4L3WA 4B9EA 3D0KA 4H7EA 2O7RA 1CUBA 3A2LA 5C8VA 3VXKA 3QMVA 4GEGA 1UOOA 4QDZA 1BEEA 5FPQA 1QO9A 4MYSA 5JAUA 2R11A 3DOHA 3WK9A 4BDSA 4LYDA 4LHEA 5K3BA 1MJ5A 2QMQA 1EK2A 1FFAA 1E8NA 3V9AA 4OB8A 5CBKA 5C7YA 5FPPA 4ZXFA 2G5TA 1W1IA 2XQJA 4TPKA 4OSEA 4BTLA 4UHBA 2FJPA 2HDWA 3WIBA 2XMZA 1ZD3A 3VJKA 4QLAA 4JEIA 2K2QB 4OU5A 5FLKA 1QLWA 1MAHA 4K5QA 5AIBA 4DMHA 5CTAA 5JD4A 3I6ZA 2Z3WA 5EIHA 3R0VA 1IZ8A 2YH2A 1R4ZA 2VA9A 2DHEA 5JALA 3OC0A 2GBIA 4PSDA 5AI9A 2HA0A 1W6RA 4ZREA 1OILA 1BE0A 1LZLA 5HK8A 1BEZA 3U0VA 4C01A 1J07A 5HZGA 1CUXA 4A16A 3SX4A 2VT7A 3TJMA 1Y37A 3AZQA 1OXMA 4F21A 2WHPA 5DYYA 3ZV7A 4W1SA 4I3FA 4J3JA 4BVLA 1FFCA 2ECFA 2XDWA 3PI6A 2CZQA 4U2EA 2JGJA 5E4TA 4NZZA 3Q8WA 1BCRA 1ZICA 1QIKA 3WWDA 3WK7A 3WK8A 5JYCA 4GI1A 1K6EA 5EIEA 5AKKA 5CXUA 5JANA 3BIWA 1G66A 3HSSA 4BE9A 4ARAA 5J3JA 3VDXA 4HS9A 1U8EA 3E4DA 4X7BA 5EIAA 4C4YA 2Z8ZA 5LZ4A 1LLFA 1YS2X 4BVJA 4MJ3A 3FLEA 5LZ5A 4G1FA 3DL4A 4AN1A 4QA9A 1GPLA 3BXPA 1XZGA 4ZRDA 2AJLI 1KEZA 4Y2JA 1IUNA 2IX9A 1BN7A 2DHDA 1HQDA 1QIEA 3WZLA 5CMLA 1N5MA 1GKLA 1JU4A 5HFNA 1EVQA 1HLGA 1J2EA 3I28A 4P08A 3G0CA 3O0DA 4X95A 1MNAA 3ESBA 2VT6A 4C4ZA 4K6KA 3H2IA 3KSRA 5JASA 4BE4A 1K4YA 3E0XA 3ZWQA 1TKRA 4M0FA 1CLEA 3BJRA 1WPXA 3WLAA 5IVDA 5K3EA 1BROA 2B20A 1OCEA 3NGMA 2GZSA 5AI0A 1R50A 2XI4A 4BP8A 1EK1A 4H7JA 3OPMA 1LNSA 1R88A 4EUSA 3RK4A 4B83A 1EDBA 4HRYA 2H7CA 3HACA 4Y2RA 1AURA 1G5FA 4OU4A 1JJFA 4DM7A 1R1DA 5HCUA 3AFIA 4X6YA 1QIIA 1WPRA 3G7NA 1M33A 2C5FA 5CH8A 1XKLA 4M0MA 4HAIA 5EI5A 3EBLA 1T4MA 1WB6A 1ZI6A 1AQLA 3WA6A 4FWBA 1MTZA 2J3QA 4AMYA 3V1KA 4F0JA 2EDCA 3AIMA 3LP5A 1YSCA 2OAEA 3PICA 3R3WA 3TRDA 3H1AA 2CJPA 1DQYA 3IBTA 5JATA 3PFBA 1CUZA 4Q05A 1GQSA 1YB7A 3STWA 2EEPA 3D2CA 3H17A 3CXUA 1YA4A 4DLNA 4UUQA 4ZV9A 3WKAA 4C4XA 3IULA 4TGLA 2H1IA 2WIJA 2OQIA 3PF8A 1XZHA 3FBWA 4FNMA 1CQZA 3FNBA 5ALZA 4Q82A 5JZ9A 3VKFA 1JU3A 3KDAA 5DTJA 5D7BA 4JNCA 1ODSA 1XLVA 1VLQA 2V97A 1SC9A 4J0HA 5CT4A 3IUMA 4AO8A 1AZWA 4EY6A 1EHYA 3DNMA 1KU6A 3M81A 5IKXA 2CMFA 5A2GA 3C6XA 5ALKA 1C4XA 3VVLA 2XUQA 3WZMA 1FFEA 1QONA 1ZD2P 3T4UA 5AM0A 4QNNA 1MO2A 4QE3A 5KBYA 4AO6A 4HRXA 4B80A 5AOAA 2B4KA 4Y2QA 1L7QA 4UBMA 4B82A 5JD6A 2W6CX 3ICWA 4BCCA 2JGMA 3WL7A 2NW6A 3GZJA 4GECA 1CVLA 4KR0A 5I7UA 1DX6A 2WTMA 1CUYA 1MNQA 4XVCA 3ICVA 2WJ4A 2PSHA 1EINA 4UBJA 1W76A 2JGFA 2ZYSA 2BCEA 2HADA 1DWPA 4PSCA 3R3ZA 1YCDA 1UKCA 1XZBA 5AK5A 2HA3A 4B0PA 2HHAA 4MQMA 4FTWA 1X70A 4AX4A 3DJYA 3OG9A 2PSJA 1ACJA 4P93A 5A62A 4RGYA 5AM5A 5ALWA 1B6GA 3D2BA 5AI8A 5AKJA 5EFZA 5ALTA 3IIIA 2OQVA 2I3DA 5T4EA 2G5PA 4Q3KA 5IVKA 1FFDA 1YAHA 1VZ2A 5CH3A 2JIDA 4YASA 3F8SA 3DD5A 2Y2VA 2QOEA 2FUKA 5ALXA 4MWTA 2VAVA 3QBJA 3R3UA 2C0PA 1W4LA 1J06A 2Y6UA 2XQFA 3G0GA 4BATA 1CUIA 4M0EA 3SC2A 3FLAA 3H2KA 3I2KA 1P0IA 1TK3A 2QVBA 2W22A 2BKLA 2UZ0A 1U65A 3WYNA 1DX4A 5DWDA 2XMBA 2OGTA 1IVYA 4WFIA 4JYPA 2HFKA 1CEXA 2DSNA 5AKIA 3TGLA 2JF0A 5AK6A 1JMYA 2IIVA 2H7YA 3N2ZB 1ETHA 4PSUA 1WHSA 4KACA 1SCKA 1HL7A 2PX6A 2OCKA 4B9AA 3AZOA 5ALMA 4P9NA 2PUHA 4KE9A 3I1IA 2RI6A 4Q34A 3OTQA 5JZSA 1IUOA 1L7RA 5YASA 1UWCA 2VATA 4KYVA 2DQZA 2ZJ6A 4Y7DA 1U4NA 7YASA 5AKYA 2JGEA 1BRTA 1CUSA 2BUAA 4GDMA 6YASA 4P92A 2B61A 2WJ3A 2QJWA 4G9GA 1YAJA 4KE8A 2XUIA 2BUCA 1ZGBA 1VA4A 3PUHA 3B3QA 1D07A 2Y2UA 3ZI7A 2ZJFA 3HYSA 2QM0A 5EHNA 2V98A 5C8XA 5K3DA 3I6YA 5CT8A 4EB0A 1XQXA 3FYUA 1HPLA 4O08A 2VSQA 3W9UA 4H7FA 1QE3A 5ALQA 3RLIA 2ZYHA 1WCYA 1IUPA 1VJ5A 1UT6A 4PQEA 1THGA 3G8YA 1CPYA 3AJAA 3A6ZA 4UBKA 4N8SA 2RIPA 4FDMA 1XLWA 5A6VA 4G8DA 3D59A 3STVA 4EHBA 3H0CA 3DS8A 1JI3A 4GXNA 3FYUC 3G9UA 1QOZA 3VJLA 2XE4A 3WYDA 3L1IA 3FVTA 3R3VA 1PJAA 1QZ3A 4XWGA 3QZUA 2PUJA 3DCNA 4DNPA 4UFNA 4Y2VA 4FKBA 4OUKX 4Y2PA 4EY4A 2H9YA 3H04A 4E11A 5ALLA 2BAGA 3G9ZA 4L9AA 1MU0A 2JEYA 4QDUA 5T4HA 4BYMA 4INZA 2I3ZA 2WLSA 2WUEA 3EQ9A 1E8DA 3WWOA 1SFRA 1XZJA 3A70A 5ALYA 3GBSA 3WWPA 4Z49A 1QIMA 4BB0A 1S8OA 2XUFA 3NWOA 3KD2A 1ISPA 2ZSHA 3DKRA 1MX9A 3BF7A 4RPCA 3EF3A 1IMJA 5A7FA 2WILA 1SCQA 3V1LA 3WWCA 1UK6A 5DNUA 2Z3ZA 2GZRA 2ES4A 1NU8A 4UBNA 1IZ7A 4XJVA 1GPNA 1ZD5A 4PNZA 1NU6A 4QWMA 5DNVA 2XMGA 3WL5A 4DMCA 1VZ3A 3DKKA 1EX9A 2WSLA 4E14A 2ACEA 4S0XA 2VJAA 1MT3A 3RARA 4QWWA 4AQDA 5ISMA 2ZJ7A 5DYTA 3X3HA 5AI6A 2WU3A 3HZOA 1RYYA 5BV7A 4UHHA 3F67A 3BE8A 5FOQA 3CN9A 2AJ8A 3F97A 5HQ3B 5AICA 4BTVA 4OD0A 2QUBA 2WFMA 1F6WA 4U2DA 4CCYA 3JW8A 5ALGA 1F0PA 1FJ2A 2DR0A 4C6HA 1CIJA 3W06A 4BCBA 2B9VA 2OGSA 4U2GA 2QUAA 3E1GA 1X2BA 4WY8A 2VJBA 4Y2UA 5AM4A 3L1HA 2VF2A 3R41A 4PV7A 1F0NA 1DU4A 1AKNA 3YASA 5AM3A 1DWOA 4J03A 2HA7A 5AM1A 2AJDA 3AUKA 3VVMA 2HIHA 1H2XA 3C45A 5FDFA 1XQVA 1H2WA 3FSGD 3O4GA 4MWSA 1H22A 4QLOA 3C43A 2VAXA 4HXEB 4D9JA 4ROTA 5HF5A 2QTBA 1WB5A 1CUVA 3ED1A 1UKAA 1W52X 4F5ZA 3AINA 1AX9A 5HFAA 2CUTA 1CR6A 1ZIXA 5ALRA 5K3CA 3AIOA 1Q83A 1K8QA 4BC1A 5JZBA 2PSDA 5C81A 4BC0A 3C70A 5AI5A 1CUWA 3FYTA 3FSGA 4GW3A 1A88A 3RM3A 1CUUA 3DDUA 4EZIA 2XLBA 1WHTA 1XLUA 3CN7A 2C58A 3BJMA 1H23A 3PF9A 5ALOA 2XUOA 1PV1A 4IHAA 4OCZA 2WU4A 1LPMA 3HRHA 4XX1A 5EHXA 5AO9A 3A2MA 2C4HA 1DTEA 1UZAA 5AIAA 2WHPB 2ZYRA 3ANSA 3U1TA 1U2EA 1ODTC 4DNQA 4J0GA 5EHZA
chains in the Genus database with same CATH superfamily
1TGVA 1E1CA 1E9CA 2Z5GA 4L3OA 4R3WA 2I03A 5JAPA 1BW9A 1JDBB 3H18A 1R6AA 3TMKA 1MX5A 1X15A 4E7PA 1REQA 1BCRB 2HBQA 2VDVE 3DBLA 4Q3EA 1EWRA 5K0JA 3P4UA 2C99A 1SWVA 2XDQB 1QLHA 2YCLA 4C2TA 5DGXA 4WY5A 2RHWA 3QUCA 4U7HA 4DQLA 2FG5A 2RARA 4H1VA 3W6ZA 2WUGA 4EF6A 4YQFA 3R20A 1P75A 1Z33A 1KYTA 3SHVA 3VYSB 2QRPA 1Y5NA 3RYCA 2X9LA 3LT0A 2JLRA 3IA2A 3MG9A 5HTOA 5EMMA 4DB2A 1RQGA 1W47A 2XMPA 4R1TA 1PEAA 1B00A 9ABPA 3I2HA 3Q2KA 1L8AA 1DWUA 2DPLA 3IB3A 5FXMA 3MXOA 4UAJA 5ALUA 5INTA 5H80A 3ISJA 3A9VA 3KR2A 3Q0TA 4M8NE 4ZGWA 1JFLA 4G63A 2C4WA 3TRIA 2GVZC 2J4FA 3BH0A 1UK7A 4D74A 5KNBH 5HE8A 3S2ZA 3NU1A 3JQ7A 3ZLVA 1PZFA 2FH5B 1T6XA 4AW9A 3O73A 3F6BX 4G41A 4HB3A 421PA 3ZZTA 4ZGBA 2BEUA 2X3YA 3MJEA 1UDBA 2XQGA 3U4QB 3KXLA 2R8RA 1Q1QA 1M8PA 2PK3A 3CF4A 3GQVA 3P0IA 5JNSA 3PPYA 1M1XB 2VWQA 3X43A 4EEKA 1JS1X 3RE1A 4ABTA 1OIXA 4WASA 4MINA 4BVGA 2AFRA 4H7KA 5JD3A 1ZOIA 4R0MA 3KKPA 3CO5A 2A58A 2J3IA 4MWZA 1L5GB 3HB7A 2EL9A 5ALJA 2G9NA 5E0OA 2A7XA 3TN7A 1QRDA 2QRZA 2CV0A 1I13A 2OZLA 3M1LA 4C20A 3KVYA 3G0HA 5FPTA 1LK5A 2CNNA 2G1AA 1JZQA 1Y63A 2RAUA 1O5TA 1BS2A 2FSVA 2WSIA 3E48A 3G59A 2OLJA 3KJQA 2LE0A 2WIDA 1SKQA 2DT8A 4X6LA 1A8SA 3D1LA 5AKZA 1Q6ZA 5AW5A 5DLPA 4UXJA 1CUDA 3S1LA 2XUGA 3OIDA 4X6UA 3HGTA 3VBCA 3CMMA 3LY7A 3ECAA 3I3OA 3I5YA 4E5UA 4YV7A 2DM6A 2REQB 4M7PA 3RS4A 4F5WA 1V5FA 1FS5A 3GA0A 2C5AA 4CM3A 1T2NA 5CVVA 4GOJA 4MRVA 4E12A 3TL6A 5A3VA 4H0FA 2D0OB 5A5VA 4QAJA 1YZHA 2C4UA 2B1GA 3PL1A 3KHUA 3KAPA 4YJ3F 4DREA 3OQIB 5D3MB 3KB2A 1LS6A 3VPHA 2QLNA 8OHMA 1YIOA 4GKAA 2ZSAA 4K6CA 2H4XA 5K3FA 5JCXA 3NAZA 1UXOA 4WUTA 4Q1EA 4R51A 2BMEA 4S1WA 2DPYA 3TNJA 1EXMA 2GOYA 1M5UA 4ZN6A 2RK4A 1FW6A 2AFIE 1HE3A 1SBQA 1X14A 3R77A 3HEMA 4R54A 2GGSA 4RGQA 4ZQEA 1T3HA 3UC5A 4E2YA 1C3OB 4KR3A 2AC2A 1RADA 1D09A 1T5BA 5FUMA 3IRUA 4ZODA 4P4NA 4ND8B 4UHCA 4RMIA 4OFXA 3QLUC 5TE9A 1AUOA 3HJUA 4HNAB 1EDDA 4R7GA 3H8WA 3RVBA 3WGYA 4C5AA 5C2JB 3W5BA 2GNPA 1N7GA 1PK7A 4TV8A 3VU9A 3KE8A 2O8BA 3TKYA 4KN8A 4JQOA 4UU1A 3CJTA 4TQGA 3G02A 1QNFA 3LCRA 4IH1A 4UVDA 1D5WA 3F47A 4NQRA 4Y1RB 4DBLC 4IHKA 5A0FA 3TOSA 2HK9A 1M0SA 3MJTA 4X5OA 3EPHA 3V2UA 3IP3A 4L16A 1RLMA 4J7UA 2BKEA 1KE1A 2OMKA 5TT1A 4YXWD 5KNLA 4EBFA 4MA4A 4DMKA 5AJHA 1SU4A 1NLMA 1AMUA 3BF8A 1TUBA 2OHGA 3SR4A 2YS6A 4OXYA 4Q4HB 4IZOA 4URHA 5C7OO 2C0CA 3MUOA 3Q0EA 1IB0A 1UKYA 3IIKA 5BNTA 4RHXA 4IDFA 5AKGA 5KIAA 1Z7YA 1Z4PX 3OLYA 4CDMA 2XKKA 1XHEA 1ZK1A 1DKLA 4IEEA 3JATB 5FPYA 4BNTA 2V4ZA 2YJ4A 4OQYA 1ZM7A 4R01A 4FZVA 1QQBA 1ECCA 3GZTB 5CCBA 1H2EA 2GZAA 4US1R 1UBTS 1YR9A 4RWZA 3AEQA 2NP7A 3STXA 3ZX5A 4MMZB 1PT7A 3FPGA 2DXIA 1P7ZA 4XWTA 4ARZA 4ZIRA 5JQGA 5F3WB 3QV2A 2FUG1 4DM4A 4FR0A 1XAHA 5KDLA 4YI3A 1T8UA 1UBNA 3U19A 1V95A 3IJPA 2XXAB 3ZE8A 2QYOA 4MYRA 4F9GA 3V7UA 2XCRB 3FVRA 5BWBA 4UUBA 4WZBA 5AQ1A 4PFQA 1S2NA 1RYDA 4YJGB 1JEQA 3MTJA 3T7KA 2D00A 2GEKA 2QTGA 3PGKA 2GF9A 1DLIA 1MRZA 2OFWA 4Y2TA 3GBPA 1G9TA 3D7KA 4NKRA 4R2KA 2HA4A 5ALIA 1RAAA 1KFKB 4HMOA 2BSQA 3GFGA 4HXFB 4ENVA 1C1XA 1KYVA 3E6AA 4NJOA 3B53X 1YU6A 3ILYA 1ZS9A 1LRKA 2NU9A 3A1WA 3FWHA 2ZR9A 3BMQA 4BWGA 3UKDA 1M8FA 1I4DD 4J0CA 2HHLA 2PZGA 2HIGA 2O2DA 2QIPA 3CY6A 5MGBA 1JKJB 1ZY2A 3LJKA 2HSZA 1HK7A 1GSOA 2FW7A 1GXSA 2OXCA 2QW0X 1VHDA 3HDQA 3M6UA 3W9BA 4A82A 1TTHA 2HRCA 3B6ZA 3NS7A 3B1XA 3SYTA 5FL7D 1EVYA 1E2BA 3RVMA 1RPZA 4R68A 3BMXA 2H29A 1R8YA 3BT7A 1O7JA 3CVXA 1HQCA 1W1UA 3C3MA 4NAVA 1GL6A 2H5IA 2PMEA 3LA6A 3R6LA 5I8PA 3OQNA 4YWJA 3O8QA 3RKSA 3WQBA 5D01A 3CGWA 4JI5B 5EJ4A 2QW8A 4BNDB 1J0EA 4EG3A 1G42A 1E9EA 1RZRA 3HCWA 2PSEA 1JT2A 3PFGA 4YCNA 3WLMA 2JAUA 3CR8A 5I7EA 4JR0A 4B2LA 3VHQA 3BK1A 1KH2A 1JLMA 2OBYA 3TAXA 4U2FA 5ILGA 3LD9A 1CWUA 2VUSA 3MRXA 2XUDA 1NZJA 1FDSA 4OP1A 4BP9A 4ES6A 3HM9A 4YAEA 2AW3A 2R00A 2GPBA 2AXQA 3L1JA 5ULLA 2OE2A 4BE7B 4UFPA 3IO5A 2FFQA 3KB1A 5BQXA 4G1MB 4JH0A 2FUG6 1BMQA 5JUWA 4MMYB 4LZAA 4RPGA 4AMZA 3FF4A 2FOIA 3DAGA 4XYMA 1Y4AE 4RQBA 3JD1A 2VTBB 1GLGA 2VZLA 3ZDRA 1RAFA 1YJAA 3EXHA 4HVAA 4K1LA 4IX1A 2QLFA 4RKFA 4PIMA 3VYTB 2Q50A 5FA5A 3STTA 5HG0A 2H2GA 4DCSA 3OZVA 5HKAA 1OC4A 5EJEA 3LYLA 4WZAA 5TQVA 4HNUA 3WLOA 2R4UA 2RJNA 3SYNA 3EC1A 4G26A 1QRUA 4K9LA 1KU0A 3K6SB 4JI8B 2YBDA 3MWDA 5A9TA 3PGLA 3HWSA 3HPRA 3R74A 4I9GA 1J1ZA 1IH8A 4HGNA 5FUXA 1VDZA 4XQGA 1FYDA 3U3RA 3DVAA 3KKNA 4J0DA 4WLVA 1Z0FA 4X41A 2A1IA 1XRRA 4BGDA 4K9SA 3OUZA 4L4ZA 3SP1A 1DAKA 5B30A 2VAPA 3WGTA 3LC1O 4JXXA 4B84A 1F5SA 5FOWA 4J1QA 1JIIA 2JIPA 4I4NA 3USES 1EX6A 2GBPA 4HGOA 3I6IA 3GGSA 1NIJA 1RYNA 4MVJG 2UZIR 5A7GA 2Q6KA 1Y1SA 1RJDA 1TYAE 2I6UA 2YJ3A 3BRQA 3N2GA 4PYLA 5CLHA 5D87A 5ICSA 2PHZA 1YRLA 2QV7A 3QF4A 3OC6A 1P0QA 1TTQB 2BZGA 3NDJA 3ORHA 1E79D 4K9MA 5E9JA 2X7XA 3L0BA 4M22A 4TYNA 2GXQA 5D3KA 1K66A 2J45A 3GAFA 5IW8A 1W6UA 2BM0A 4BO8A 1JEDA 3LZDA 5CUQA 4EHAA 1C2YA 5KOHB 4EPRA 3INTA 4JBHA 3AF4A 1ENPA 3JR7A 5AP9A 3AM1A 2FJUA 1GU7A 3CZMA 3QEOA 2A7QA 4LYYA 2J5QA 1SCUA 5DE3A 2HBZA 3TB6A 2FEOA 3DVQX 1XXHE 2GYYA 1PSZA 3OOJA 1E2MA 2FMXA 3U6BA 3JQ9A 4J8PA 5L7TA 3NG1A 5CW2A 2ST1A 2W70A 4P81A 1U81A 2DPHA 3U44B 1SKMA 4CQLA 4UBIA 3QPAA 1L5FA 3DEZA 3DM9B 3LV8A 3LYHA 3TW8A 1BXGA 4D9FA 4MO9A 2XUHA 4DDUA 4IHJF 1PS9A 1ODJA 4O8CA 2N9UA 2R79A 2CMHA 3R6WA 1NBMA 3L5OA 3E9RA 4HTFA 4YVFA 3WMWA 4BU1A 1ZI9A 3H1BA 4DR3B 3HNPA 3ASZA 1DBVO 1FRNA 4D9BA 4BRSA 2IKQA 4C5CA 3P45A 5L8VA 1Y8QA 1J22A 3C8DA 1R8SA 3CVUA 1MAAA 4L0MA 1PR4A 5DIFA 1KYXA 2CHEA 1OFHA 1DBPA 5AVOA 3V2IA 2GXSA 1BHQ1 4WY2A 2IXTA 4RK6A 1XVLA 3SXPA 5JR3A 1QIHA 2CHVA 4GR5A 3U40A 2FMIA 4PX3A 3ZWMA 2P4EA 4Y2YA 3ZTWA 1R0SA 5BR1A 2QYTA 3RQSA 1N5JA 3O1LA 1NYRA 1V11A 2JGKA 2DFDA 4KXXA 3W78A 2ZRAA 2JI4A 4MRRA 4WNIA 2CV2A 2PJRA 4YROA 4Z7JA 3I8OA 1NJ2A 3ESDA 3X1DA 4M9UA 2RGGA 4J9UE 4OK6A 4XVHA 1Z0KA 4Z7NB 3GF4A 3IMEA 2QNIA 2H5LA 4R1MA 2QB5A 1M1ZA 1QIGA 2P9EA 3A8TA 3ANMA 3KD3A 3R3SA 2OBMA 2O3UA 2YXNA 3DP9A 4TLAA 3A1VA 3G8CA 3K9FC 2HZ7A 3VU0A 3PGMA 4DSTA 1CK4A 1E3SA 4YX9A 1GCIA 5JXWA 1JIXA 4QSMA 3G9TA 3PEWA 5H5JA 1XGKA 2ZE5A 1U0HC 5KNDH 4XD2A 3HO1A 4EUEA 1RP7A 1LB1B 3ULKA 4WN3A 3OX3A 1STOA 1RRVA 1TVCA 2FMKA 5HIKA 2B8NA 4S35A 2IS2A 4MP6A 5LU9A 4K2AA 4RY8A 5E4JA 3VRHA 1SOMA 2I34A 2EERA 3RHFA 1IXRC 3AEKA 4DSUA 3Q3IA 4HX5A 3TZLA 3V34A 4FLMA 2ESRA 3WO1A 4YMSA 5LZ2A 5U4XA 3QE9Y 1YA6A 1XCPA 3LIIA 4QQFA 1K75A 4NP6A 1PWEA 3F78A 4GKJB 1U9YA 4ZQBA 3TKLA 1KYYA 3HBMA 1U0TA 4V39A 3TPFA 1WZNA 2X4DA 1GFWA 3NVKI 1HC7A 3AP3A 2ZTSA 1F8FA 2ZZNA 3JWPA 4AKHA 1PVVA 1O58A 3NANA 4NENB 3TZKA 1ULSA 2CVQA 2HJVA 4HKTA 1NXOA 5LKAA 4TL9A 3IE1A 4J75A 4RTMA 3AH8A 4KE6A 2ZSKA 1M72A 3SC4A 1JH8A 3JD3A 5H3HA 4B45A 1K98A 2R5NA 1T24A 3U3XA 1GPH1 4MR9A 4IH9A 1GSAA 3OX4A 4G0VA 4JI2B 2QF7A 1PJRA 2PBLA 5F98A 4MRAA 5FTKA 1JV2B 1X80B 1RHJA 3F96A 2ZT8A 2NZXA 5LYYA 4WA7A 4CW7A 3HDVA 3HVIA 2P6UA 1BKYA 3I12A 3SYRA 4RA9B 5I3CA 3GNQA 1NONA 4U7WA 3DFMA 5MGNA 2O14A 3B36A 1DINA 4CHGA 2FWPA 1J8MF 1XZKA 4QSHA 2JEOA 3L7NA 1TYCA 1SXQA 1ZMTA 3HJNA 4BLSA 1KKUA 1JSXA 3K1AA 2OC9A 4MDHA 1WXXA 3DWFA 4PXSA 1BEUB 5JCOA 1J24A 1V25A 1GZ3A 1Q77A 3GOQA 2ZIAA 3NYWA 4UVHA 3H8JA 4ZWNA 2YV5A 4TZTA 3I92A 2ZUEA 1R66A 1NNSA 3E3NA 1Q44A 4UVIA 1W36B 2UYQA 3H05A 3VMFA 4MR7A 2XHEA 3DG9A 3GEEA 5HE9A 3JZDA 5E3JA 3RNLA 4X00A 4D6XA 4EG0A 4LF6B 4XLTA 2XEDA 4F4CA 1V5GA 5DULA 4LZWA 2DE0X 4MMXB 5MF6A 2HQ1A 2UZ3A 2CFIA 4H3HB 1EVEA 1DO0A 2QLTA 2RSLA 2WBLC 3QYJA 1MV8A 4WESA 1FFYA 2ZOSA 2FY8A 2VNHA 4PX9A 4ND5A 3RSOA 5G1PA 3EGIA 4IF4A 4BO7A 1MJNA 4K28A 4KRXA 2BISA 2VK1A 2BGNA 2XODA 3CEPB 3HVJA 1SNYA 1YRWA 4RYLA 4WJKB 3FZGA 2HREA 3ADPA 4XB6B 2DHRA 5BOVA 3U13A 2XDQA 1JXQA 2SNIE 4DVGA 3AR5A 3Q7QA 4OQXA 3U6KA 3HEBA 5JCOC 2H2HA 2PX4A 3A4NA 2CKDA 2E5WA 1NUPA 2H1CA 4L51A 4BNLA 2H4ZA 4TLDA 1TVKB 2IXDA 2BFNA 3PC3A 4PM4A 3VNUA 2YIVX 1NF2A 5IT4A 3TDKA 4DRYA 5JS8A 1ENOA 3WOHA 2CHUA 4U2BA 5JAOA 3MTQA 1NSTA 4XDHA 5KJ1A 2VPIA 5EESA 2CJXA 2B7LA 2FPSA 4G89A 5TRTA 4GBGA 4BLRA 4DIEA 5L3VA 4Z4FA 4BX3A 4QEKA 4TV9B 3ZU3A 3I83A 4M0LA 1IDN1 2UUPA 5DV9A 4DXHA 3RANA 1E0KA 1RI3A 2H7XA 4GNKA 4MW7A 2A3NA 5LZ7A 2WWYA 1R8JA 3EW7A 1XYYA 3KOXA 5FF9A 3OFKA 4D46A 3GLIB 2BGKA 1NN3A 4FLFA 3BERA 1JDVA 1HXHA 1RLTA 2ICAA 3D3WB 3OPVA 4OQZA 3L8HA 4GEKA 4KQEA 4N5IX 3HA5A 1KK2A 2I7XA 4NDZA 1IY2A 4O2BA 5HFJA 2RGCA 4UOQA 3HCRA 2OY0A 2NYAA 2P2YA 3IT1A 4P6VF 3WL4A 5BW5A 5CFLA 3PXGA 5M7EA 3NRCA 4TKVB 1WZEA 5I8WA 3AFHA 3E9QA 3IDOA 1G3QA 5FBHA 1TB4A 1NF9A 1G64A 4L4UA 1AB5A 1R6XA 4PSVA 3QY9A 2JBHA 3NX4A 3DZFA 4MQEA 1KE2A 4R81A 1PYOA 1Z36A 1ZGCA 5FJJA 1OOEA 2C1ZA 2HEIA 4JJ7A 3TLAA 3ZWVA 3PCXA 4E1BA 2B7CA 5JFTA 4PO1A 1C4WA 5B6PA 3T9AA 1P2UA 2JJ2D 1BDIA 1FDOA 5C1OA 2Z8XA 3Q9UA 4Q02A 4HQ0A 2RD2A 1C3LA 1K5PA 1P74A 4INOA 4LZOA 4YV0A 2O8VA 3ZXXA 5DHTA 4LNAA 4NCIA 2REQA 3BXEA 2GSDA 1VYUA 5I4IA 1R4MA 5BSVA 1G8JA 4WGFA 3JYHA 3DOIA 2YWGA 2JB9A 3P2MA 3GRYA 1GGNA 3QKIA 4K6GA 4RK0A 5JJCA 3E9ZA 2IOFK 4OTZA 2GTIA 2P9ZA 1H4VB 4FOOA 2Y4NA 3PE3A 3ASVA 4IGKA 2OG1A 1C41A 1Q12A 1XA0A 4WL0A 4AN4A 1OYWA 4PLYA 5IDYA 4G81A 1PR6A 3PGJA 3TTWA 4BJHB 4WA8A 2OA0A 4ZVNA 3AKDA 3R40A 2QX4A 1EVLA 2B9EA 4NFHA 5GAJA 4O2AF 4TTRA 5A7HA 1KMNA 3AJDA 1EWKA 4Y9TA 1PL7A 4CG3A 1A8PA 1GYQA 2GKGA 2VF7A 2HV8A 3R3YA 4CCSA 5I7RA 1VB5A 5K09A 1X13A 1UPCA 2HDOA 2QPOA 3SY8A 4PY2A 3RYIA 3BOSA 1T5DX 2GDZA 1UMCB 5E6SA 5KSPA 1WQ3A 2EF0A 3IV6A 2G7MC 1E98A 2KB0A 2E6UX 3O4VA 2HB6A 1RI4A 3MGAA 4RIHA 4E6EA 3KU4A 3OHPA 5BN5B 1W581 3TLCA 3HA7A 1HY3A 4QATA 4H77A 4WJLA 3KZOA 3MTIA 5LLTA 4Y0VA 5ALDA 1CUEA 1YVEI 3GVXA 4NCKA 4LSMA 4ND8A 1QVVA 1YZKA 4P4UA 1MZVA 4MEBA 2PFGA 2DQSA 4W9NA 3GFPA 3LK6A 1RLOA 4X3CA 4DV7B 1PWXA 1RHQA 2DLDA 2CDNA 4KXNA 4WK4B 3AKCA 2UXCB 1TFRA 4D80A 1QDLB 2HY7A 5LP1A 3O94A 2G0AA 4DR5B 3GRFA 4Y1RA 2BHTA 1X1QA 4PO3X 4ALJA 4FYKA 1P1CA 2FI1A 3CVOA 1XVTA 3BZBA 3D4LA 1QFXA 5IHXA 3HYRA 1H8ED 2XPCA 4CDGA 1XPUA 4W63A 4PW0A 3CUUA 4K6FA 4QXOA 4LRQA 2CD7A 2PJUA 1XQ1A 3RGGA 3QPDA 4LMAA 4EUFA 5A0TA 3N28A 4BWFB 1S3GA 2RHRA 3Q3JB 5EOVA 4BMZA 4DUPA 4ZI5A 1M2NA 2X0NA 3OJCA 4LXIA 4MZDA 4N47A 4CPDA 1YVUA 3OTWA 4ER0A 4F1WA 1U0JA 2CSXA 2QEQA 4EGFA 3R5FA 1Y6FA 3KYCB 1FFWA 4JODA 4WKCA 4ZRNA 4BN0A 1FSFA 4OQQA 3L4EA 4NIMA 4PYNA 1ZHOA 3M6LA 3MWLA 1YRHA 4FCVA 4CL3A 4KX3A 4H7IA 3FDFA 1YR2A 3DOEA 3JATA 1E2KA 4W9NC 2C4KA 1G2PA 4EGSA 3F4KA 3GJ3A 4WWHA 1TJNA 4PHFA 3CSUA 1SURA 3N0WA 3TX6A 1DCFA 5HPYB 2IE0A 1TM7E 1U2GC 4WKNA 4IDCA 3R9XB 1R4AA 2HMUA 3DW1X 2D5IA 2B5OA 3V3TA 3S8MA 2R8EA 4C14A 1I3LA 4PRLA 1MGOA 1KQ3A 3LC0A 1I0LA 1OKKD 1KSGA 1SUBA 2R4TA 3KQPA 4K87A 3VPDA 4BBZA 4IF6A 3UTCA 1ANKA 5E2IA 1YHNA 621PA 4H60A 3ADOA 1HE2A 4QDKA 5CFRA 4NOJA 1EAYA 1RRGA 2JCYA 3OHSX 4L73A 3G0DA 4OYHA 2P65A 5IEBA 4ZI7B 3HL4A 3KTAB 3U4QA 4RF5A 2JLVA 2XXAA 1HZJA 3TOZA 3G5TA 3MUFA 4Z3DA 4BZXA 2AJCA 1ABBA 4DR7B 1V9SA 1ZOLA 2A86A 4K05A 4D45A 4YJGA 4OBWA 5DBEX 4CGYA 4F2HA 1O0SA 3WKEA 3VFDA 3VSBA 1FUIA 1S2DA 1I7NA 2NACA 4X91A 1PR0A 4MI6A 4CKEA 4ZMSA 2SICE 1KWGA 2NO7A 1A8IA 1I2DA 1O95C 1KZHA 2ZU6A 3FGZA 4FNGA 2A0WA 2GAIA 5B58T 3ZV5A 3RC8A 3HDGA 1AZLA 4TVSA 3OUTA 521PA 1AF7A 2C98A 2A5JA 1FP4A 5JC8A 5IWCA 3GLHE 2PX5A 3DXYA 4G1VA 5AJUA 5JNUA 3AUUA 2YFKA 2P4QA 3ZIAA 3OQHA 5MDHA 4KQFA 2OO5A 3LY5A 3DMYA 3O4FA 1XN4A 3OCYA 3T0IA 1BQEA 2DR3A 3BBLA 1CKEA 4JIMA 2Y6VA 3DCIA 4JP8A 4WKGA 3N75A 3FOEC 1YC2A 5EUQB 1CQWA 1H5QA 2PX3A 4IIBA 2O1SA 1IHYA 3FPJA 4KQ6A 4B43A 5J4HA 1QAOA 1JI0A 1W0CA 2ON6A 1F20A 3B1YA 1UBUS 2G83A 3I53A 4JP5A 1DAMA 2GPTA 3STUA 4K0KB 1UKEA 2PWPA 4DLLA 1FFBA 1VDMA 5CM9C 3ZY6A 2IH2A 4G65A 4ZYWA 5JMWA 1JQBA 2VHTA 2HPZA 2C5EA 4XUCA 1TQHA 3E8MA 3JPWA 3PPWA 4JC0A 4IIJA 3UJ8A 4J16A 1I1QB 1UKBA 1UXKA 1VIAA 3Q3EA 5IDWA 3DLTA 3WISA 3EVCA 5EZ6B 1F8XA 1TU4A 4QELA 1N3LA 1YCFA 5DXFA 3UUFA 3UY4A 3ESCA 4V1CA 3WP0A 5JRDS 3FCYA 3M5PA 1T2FA 1J97A 2FWBA 2PMCA 4XM1A 3MCWA 3PC8A 3K35A 5CFOA 1ADBA 1GKYA 4EG5A 2BFAA 2UVDA 2QJRA 5A0VA 4RM3A 4IVNA 2XQVA 1UP6A 3DB1A 2RGUA 4HRVA 5IVIA 4QGFA 3D3NA 1X8JA 1JDUA 2BHNA 3BWMA 4PG4A 5ALNA 3WZ2A 5JNVA 3P9QA 4J1SA 5AK4A 5L9AA 1Q74A 1S2GA 3BDIA 2P41A 3O03A 4AKSA 1U7DA 2F7SA 3DKVA 1QFYA 3GFFA 5JJLA 3ZQ4A 3PC2A 2EWMA 1F60A 1HYHA 4LIPD 4RABA 4TUYB 4C4OA 4DPKA 3V8BA 4B09A 3KQLA 2NXJA 2C4NA 3GAAA 1N9ZA 2ZB3A 1XD2B 3KK0A 4OL0A 5AXDA 3AXTA 4RTRA 4F04A 3GCWA 2DCMA 4DJ5X 4Q7EA 1NJGA 1EFRD 5LJLA 4LYEA 5KTMA 2PEZA 3MMSA 1LQTA 2QGZA 2WA2A 3I2GA 2HU7A 3VPSA 5IJXA 4CT4B 3CW9A 1NDUA 2ATCA 3BXFA 3H6HA 2OSBA 3K8ZA 1RBYA 1GLNA 4FGSA 1TMGE 3AI1A 3EZ2A 2JS7A 4WHMA 3U3DA 4ZCMA 2Q62A 5TT0A 2WOOA 2ZVDA 3KOYA 3U3ZA 1JTEA 1D0VA 2VDWB 4PZAA 3SPXA 4FHFA 4J1TA 1PTJA 4GMDA 1VFNA 1E1KA 4I2VA 4C7JA 2OP1A 1OHHA 3H2HA 1G19A 1JXOA 4REQB 4OYLA 4KO4S 4W1PA 2JATA 2H4JA 2MMCA 1U8XX 2ZU0C 3A06A 4E5KA 3IKJA 3GGGA 2VH5R 3N0RA 4MPTA 2DY1A 2OWDA 1UZLA 1SKUA 2WZDA 1X7YB 4IOJA 1Z06A 1WIWA 4CTMA 3RUCA 2DF8A 2F8MA 3F71A 4U02A 2D2IA 1RVV1 1B6RA 2Y76A 1CULC 2NZJA 3VR3D 2YVUA 3PDUA 5KC9A 3EHDA 1NBHA 5MN4A 3MINB 4TL6A 3OETA 3O9MA 2WJWA 3HUUA 1NW9B 1IJEA 2WM8A 3A4LA 4XIIA 1CJVC 3C39A 4MVJH 3ADBA 5TJ9A 3QHPA 4NABA 1XDDA 3U44A 4X0EA 1WXFA 5HZHA 1YR7A 2MR5A 1K6IA 4HYEA 5KSWB 1PTJC 3BTSA 4GZ5A 3SFTA 1P0MA 1HEYA 1WF6A 2J48A 4TTPA 4LF9B 1L6RA 4PCAA 5AOVA 5L7YA 2WQZA 4MKRA 4DUGD 1XCGB 4BNNA 5LKRA 3IKLA 4CM4B 3IX7A 5E2BA 4EFLA 4QOJA 3RQIA 5ADVA 4JC5A 1XTBA 4EITA 4MLCA 2AOXA 1XK6A 1XTIA 4X63A 2HNAA 4BX0A 4YMIA 2AGVA 2R1UA 2OBNA 2WNHA 1U0NA 3QPWA 2J32A 1BYIA 1R0KA 1H4QA 3N2YA 1C8VB 1TC1A 3A1SA 3IUNA 5CDUA 4RVNA 3RS0A 4YXWA 1U7WA 1G6OA 3WDSA 2XTNA 4ETWA 2L18A 4NXMB 5B64A 3UO8B 4I46A 1G98A 1IEWA 4XDZA 1PP4A 2BKVA 3ZC3A 1E8MA 3K9QO 3TI7A 1R64A 2C0QA 5G0VA 4FYIA 4GAEA 2JC3A 4MKFA 1UPTA 3HJHA 4BO1A 2YC2C 2CXRA 3RAEC 1YB2A 2Q0HA 1IOVA 1WUYA 1PQWA 3QOWA 2B4TO 4XPZA 1SK8A 4Q4DA 2FZEA 2F8SA 1USKA 4G9BA 2QN8A 1E89A 4Y6QA 1Y8ZA 1T1IA 2CL0X 2CFSA 2QRJA 4LRXA 5DX0A 1T9KA 5IXJA 2I65A 4J7AA 5HIJA 3RFTA 3F0TA 1V6AA 2IDZA 2HWWA 3AF0A 1HNNA 4KQHA 3LX8A 4QICA 3KQYA 3AR7A 4TOIA 1M1YA 2C9OA 3TO5A 4HNSA 1HFKA 3PUYA 3MAGA 3PUWA 1N7IA 2AMFA 3O82A 2R1VB 4GPBA 2WWFA 2XAAA 4UMFA 4EEXA 3R9WA 2GJ9A 1FX0B 1XTTA 2YV3A 3H83A 3WGOA 1OGIA 4KWIA 2P77A 2E49A 1UEXC 1YV9A 2A4KA 3BSSA 1WKBA 3BIOA 3H4VA 4URWR 4DTCA 5LFAA 3X1JA 1NRWA 2E4AA 5FYDA 2AI2A 4ZT6A 2GBCA 3GJXC 3OECA 1SCBA 1W88A 4HBGA 4V2IA 4ZOLB 1QSGA 2W11A 4MEAA 2EFDB 2CVPA 2ZI4A 5FV4A 5DTRA 5ILQA 2A2ZA 3BULA 4A2WA 3PNLA 1IWBB 2CNKA 4FMCF 4B8WA 1QE0A 3K9HA 1SD2A 2NSJA 3HKBB 1NKSA 1NY5A 1F5NA 3PRYA 4TSKA 5EYPB 2B82A 5B3JC 4RVUA 1XFAA 4PYIA 2PL5A 3WYBA 3ZV3A 3JWEA 1VC2A 1E96A 4IIVA 4W5HA 5FL7A 1NBWB 2QJTA 3PDWA 1Q7GA 2VFAA 1WDTA 3PKZA 4M60A 1PNVA 3IEPA 4NARA 1SZDA 2F9MA 2J8ZA 1X38A 3D5TA 4G4JA 4WK2B 5DLEA 5BV1A 1ZAYA 1Z5ZA 3CC8A 2FK7A 1IWOA 4G5OA 1MMFB 2OCPA 1WMSA 2WHYA 1YI0A 1SXHA 3GA7A 3HB9A 5AKXA 4JT9A 1FBNA 5B37A 5TPWA 4B4DA 4AYWA 2P6MA 1N5RA 4LA4A 3EXIA 4ZYTA 2VQ6A 1FP6A 1AKMA 3KAQA 4UUPA 4E33A 3KWJA 5BXYA 1Z9BA 2ZSFA 4CKCB 4BNVA 3EVZA 3ZXUB 4M1EA 2JAHA 1NVDA 1LPBB 1MR3F 4FQ7A 4XXHA 1NJ6A 2ZE6A 2PU5A 1O6BA 4GMKA 4JL5A 5CHYA 5U4QA 1A97A 1CY0A 1W1WA 3LO8A 3ZWKA 2G17A 2ZB7A 3UT0A 2C03A 3GMSA 1MIOA 1YS1X 2Q49A 1C4KA 4UTNA 1NVUQ 5ARBA 1JJIA 3QPCA 3OIFA 1D0IA 4J4BA 4MI3A 2EJBA 5LD2B 5EWJB 2H9IA 3EGOA 4W7IA 4IH4A 4N7RA 4AURA 2IQIA 4PN3A 1ML4A 1JIVA 2FHPA 3IEUA 1FJHA 4Q7KA 4GZMA 5AVWA 5IULC 5K6RA 3V80A 2JIOA 5TQ2B 5GJBA 2O4CA 3RU2A 4CTKA 2Q99A 1IXZA 3QFSA 3NVAA 3LHDA 1GG5A 1WQ4A 4JYBA 4ABYA 1TMKA 1MAUA 2A1UA 3DOOA 1LBIA 5KYWB 1I7SB 2CLCX 4AY5A 2INGX 1PHPA 2Z95A 3AUXA 4W8OA 4L4XA 2EX4A 3LLMA 1VSQA 1JDSA 3EVNA 3UC9A 3UK7A 5A03A 5B4VA 1N6HA 3D0KA 3DV9A 3O8NA 3MN1A 5F1PA 3W1WA 4GICA 2RJOA 4TKUB 3RPEA 4E03A 5B7QA 1P2VA 2QM3A 1XKQA 3IQGX 4TYPA 4XB1A 1EAMA 2IEIA 4MUYA 4UQOA 1BA2A 1PQ4A 4B3HA 5J58A 3G2IA 1BXKA 3CX6A 4IYRA 1NAIA 2ARKA 2X13A 3PHJA 2ETXA 5EE1A 4WXEA 2ZB2A 4OHUA 3QWFA 4OLBA 1C0IA 1U99A 3KM0A 4IPTA 1B6SA 5FPQA 4MYSA 2NX2A 1UMKA 1W87A 5DLYA 1LC0A 2R11A 2UVQA 3GRZA 3PIRA 4F6CA 4TKVA 1I1OA 4YYZA 1XMXA 2AA3A 2Y0DA 5FR2A 4G0PA 2X2PA 3H11A 2YHUA 3PWSA 5D2CA 1NNLA 2MJLA 4BO3A 1FFAA 3AY3A 3FSJX 3HBLA 4GC9A 1LC3A 3G1TA 1LKZA 4X3OA 4UVGA 4CMBA 4L2IB 5EJ9A 2H7VA 1KDZA 4YMWA 2HLDA 4N49A 1ZONA 5CBKA 5DLQC 3IDZA 1OE0A 1KTVA 1K06A 2C2ZA 1DV2A 1T8SA 1FTSA 3HR8A 4Q4AA 4OJNA 4C4TA 2I1VB 3ZVRA 1W1IA 1KOLA 4OSEA 1X7HA 4JJ6A 3EIFA 3PZRA 1F1JA 2OHVA 3ZW7A 2C1EA 2HTFA 4M55A 4XE5A 4WZAE 4YP5A 4ACAA 1I6LA 4MHOA 4QUIA 5AW4A 4XVRA 1AHNA 4CV3A 2EGHA 4XSHA 3ESZA 4FX2A 4R2LA 1RCFA 1LY1A 1SBYA 1P29A 2COEA 2FJPA 3KX2A 4D9IA 3H3JA 5B1HA 4GGPA 3VJKA 4TXMA 5JPCA 5LDHA 2FEKA 1KDPA 2QX8A 1CJBA 3QEBZ 4N6NA 1N6PA 2EQBA 5D86A 3HYTA 5KI6A 4JMPA 1DSSG 5A2QA 3ZN2A 2C3MA 2ECPA 1YULA 2FEMA 1G6Q1 1NMXA 4RZ2A 2FWRA 3VPFA 3SZOA 3FVWA 1YDGA 3OIVA 4KC0A 2YQZA 2XGJA 3ZY5A 1B4DA 1M0EA 3ZWCA 4AJ4A 5JD4A 2IU6A 3CZQA 3E2PA 3I6ZA 3NHPA 3Q3VA 4EX6A 5LL6P 1E3WB 1ZNQO 2HV9A 4EI7A 5I3ZA 5ILOA 3LGXA 4RUKA 4Z4IA 1QPZA 2HGSA 3E1SA 2AF4C 2VA9A 1P9OA 2VR1A 2DHEA 1Q0UA 4INAA 1L5YA 5UKDA 4EFMA 2GJAA 2PWYA 4ERXA 2JVKA 3RDPA 1J9ZA 1L5WA 1Q7EA 1Z5WA 3OIUA 1BSVA 4P82A 4DCVA 5L3SB 1OX6A 3A1EA 2HA0A 4OOEA 2VBIA 4BQEA 3E2MA 4CIWA 1HM5A 4LOHA 2JBAB 4TROA 1FUEA 4ZREA 2HYDA 3UG7A 3RV4A 5ITSA 1WWKA 1G8GA 4A0HA 1QK3A 1U3TA 3LW8A 4TXHA 2XYVA 5LQMA 2H1LA 1P17A 4IV8A 3M6VA 1GYRA 1NUUA 4KFUA 1S1CA 2O2EA 3GUYA 4CLRB 3DZ8A 1RYFA 4PBRA 4A16A 2RGEA 2UZAA 1RE1A 4K6MA 3TJMA 3M4XA 5BMOA 5H8WA 2OCXA 1QQ6A 3RO7A 3L8MA 3P0RA 1AS0A 2G76A 5F1OA 2HSEA 4RMNA 1YUNA 3ONFA 4PGFA 3TH5A 3TZEA 2OKCA 2GCPA 4L7QA 3CZCA 1UMBA 1O03A 2OQ2A 3DMHA 1JA1A 3OEED 4I3FA 4LY3A 4UD6A 2UYHA 5B36A 5GM2A 4IUDS 1BOOA 1RCUA 1MJHA 1SR8A 4RQUA 4AXXA 4IXWA 2XH8A 2ECFA 4XM0A 2PS1A 4RA6A 1CR2A 4RAQA 1DBIA 1K2VN 3KNZA 1E3IA 3MF4A 2Q1TA 4LBWA 4JP2A 3IP8A 2ZE7A 3D0RA 4FGWA 1QS0B 4YACA 2ZBVA 1DJOA 3GOHA 4QPPA 3EGVA 3D8BA 3ZGVA 4QUKA 4BQNA 2VHZA 2PS3A 1RPAA 1EUDA 2Q5LA 3BRCA 3MTAA 3WWDA 3O31A 1QPGA 1TA4A 2ZPAA 4CM1A 3HVUA 3TOCA 4MQFA 4U6QA 5JANA 5EN4A 1NQXA 1T34A 2FWMX 1R5OA 3BIWA 4D4IA 7MHTA 1NA5A 4GPEA 3KEFA 3TTUA 1F38A 4F46A 4LVOA 4EOGA 4BE9A 4D4MA 5BT9A 5LC1A 2XOEA 4PR3A 1X8KA 1KSFX 3H2BA 1J9GA 3KYIB 5JZOA 1PEYA 3RVPA 1NXWA 1QO0D 2C42A 2PGLA 1JG6A 1A71A 3DOCA 5JCJD 1NWHA 3BMOA 2LZ0A 1I3MA 5K05A 2LD4A 2YWJA 3A1FA 1CFZA 1TVEA 3DC7A 2EFJA 1B14A 2NTEA 3WGNA 4C4YA 3ZD6A 3CU5A 1LLFA 3QKRA 3URKA 1YS2X 1MPTA 4H3KB 4M7WA 4RVFA 4BVJA 2X1MA 1O77A 4MJ3A 1FMLA 1Z6ZA 2WLTA 2D5BA 3QFCA 4JB8A 4O3FA 2WYUA 4AUKA 5B58C 2R7LA 2PL1A 1VHJA 5IXYA 1TAQA 2O59A 3NIGB 5DZSA 4AN1A 3THWA 3II6X 1P1RA 1HKUA 4ZHQF 5JXIA 4W5OA 1JJAA 1W5AA 4U6SA 4ALMA 5JXJA 3H1EA 1OH8A 1H2HA 4LRSB 1Q6YA 1P18A 1XT6A 3KALA 4QXMA 4U7JA 2EU8A 2NO5A 2BMJA 2GUGA 3JQ6A 5DX8A 1M2EA 3AQIA 1T35A 1E4VA 2GPAA 1IZ0A 1G8PA 2H06A 4HN2A 5A06A 2GPWA 1KEZA 3QVTA 3BFKA 3MGGA 4BLOA 1DNPA 1NP7A 1KYZA 2IEDA 4JROA 1TJPB 1QIEA 2VPXA 1E9BA 3O1HB 4ME6A 5CMLA 1P2BA 2YY6A 4OIMA 1SOVA 5BW4A 4FFBB 4C7OA 1N5MA 5EIBC 1GKLA 1X9IA 2BTQB 5J2TF 1DFHA 1EVQA 2ZULA 3CT6A 3DEYX 4CMEA 4YLYA 5KO2A 4CR8A 5JJ5A 5LWHA 3DSRA 1CU1A 4MRPA 1J2EA 1SBNE 1K8XB 4TT3D 4EW2A 3EGCA 4P08A 4R8MA 5A4IS 3Q10A 4LW8A 1SQ6A 5KQLA 3SSNA 3ESBA 1BE6A 1NBOA 2ZATA 3G7SA 3CUVA 1PGOA 5K2OA 1N2ZA 3FAZA 1L8LA 4M7RA 1JKIA 2CY0A 2ZIXA 3VR6H 4TUYA 4M3NA 2EKZA 3LZCA 2O1EA 3F74A 4MV1A 4ZP1A 5HMMA 1OW3B 4ETMA 5KWVA 3F6RA 5IXSA 3A37A 3OEHD 3WLAA 2ENUA 5CDGA 5K3EA 4YWHA 1Y1KE 3S2IA 2B20A 3DCYA 1WDKA 1OCEA 2B0CA 3CF6R 3NYIA 4NL4H 4D8UA 3F4LA 3HY6A 2WD7A 2P9CA 3L6RA 4BP8A 1R50A 2JJ2A 2XI4A 5DM2A 2UDPA 3EGXB 4L27A 4YJ3B 4J29A 5K01A 2WF7A 1R6DA 4CMEC 4NZNA 2O8FA 4UHKA 4C4PA 1OFTA 4JV5B 1FYXA 1OJLA 4DKJA 1DEHA 2Q9BA 3RK4A 3RRBA 3FMPB 2II6A 4DPLA 3O8CA 4WV3A 1LNQA 4MS3A 3H9EO 4I8XA 1FRFS 2G9RA 4HRYA 2AJTA 1GKIA 4ZU1X 3RUFA 1XVUA 4EJFA 4Z86A 3ICEA 1BMFD 1C0LA 2MSDB 4CKBA 1QP4A 1G5FA 4GYYA 1Z4MA 1XQ9A 5NLLA 2BI7A 4KMOA 1KVTA 4D4KA 4Z1MD 3C1AA 2JANA 4F85A 3OF3A 2V7XA 3F3KA 4Q7QA 4DM7A 5C53B 3L7BA 4UMVA 4XTRA 4OQPA 4ZK6A 2IOYA 1PQUA 5G4LA 1W4BA 1DC7A 4TL8A 5DWVA 2D2XA 1ND5A 2V0NA 3G68A 2D3TA 3M5DA 2CXTA 2R8YA 3QTLA 3IDSA 3OM9A 4I4TB 3CUYA 3JWHA 4LCBA 4UTZA 1WD5A 3N58A 5CPFA 4IIFA 3TM5A 1X3SA 4HUQA 2Z5LA 4Q3NA 1XDSA 4RVGA 1VRVA 1NXSA 4M0MA 3R7WB 3TXAA 4HAIA 5CNMA 1RC0A 5EI5A 1XTUA 1ZX1A 4KFTA 3RUHA 1HR0B 3K71B 3NIDB 3GJ7A 2PYDA 3NH9A 221PA 4R84A 3DLCA 1RC1A 3DZIA 1U3FA 1ONBA 1QHNA 2PSSA 4FVTA 4B31A 5ERYA 3K0AA 1PJCA 1J9EA 4IXTA 3ND5A 4DLVA 1E1MA 1BE8A 3N6XA 4LCJA 3RVDA 1UJCA 3V1KA 3K5IA 3VZSA 2Q3MA 3P26A 1PLJA 4G3XA 1TA9A 2L42A 3MOIA 5CFMA 1YIAA 3L1KA 4BQPA 2LPMA 1H8EA 1YSCA 1K3UB 1KJ8A 3P2KA 2DG2A 3JALB 5JJIA 3IBTA 3ICOA 1F2UB 5JATA 1B0PA 1OPXA 3GGPA 3PFBA 1U2DA 3PYXA 5A3QA 3DE2X 3OZCA 1GQSA 1UBKS 4KN5A 4ER3A 3D2CA 2JHPA 3RASA 2IOFA 3ZDDA 3H17A 1B0UA 1OWMA 4QUHA 2VHCA 3VYWA 4N82A 1YA4A 1SZCA 3GIWA 4DLNA 5DYNA 1O1YA 4YJHB 2AQ8A 1V6CA 2PE5A 4C4XA 1MJGA 1GQFA 5KQGA 2H1IA 3JD2A 3IESA 5B7NA 4TT8A 2YWHA 4MWCA 1K3FA 2ZZMA 1V45E 4OBEA 5HOEA 2R751 3DEFA 4X61A 4ZAGA 3FDXA 1CQZA 1M2JA 3AR9A 4MICA 5CM2Z 5I51A 2DCUA 2BKUA 1GAWA 3CINA 5E1DA 3KSBC 2NU8A 5IDXA 4NMXB 1QHHB 4QFMA 3JQPA 2G25A 2OFOA 3IPRA 2C97A 4Q82A 5FBZA 1IHPA 3FUWA 4YAOA 5IAEA 5D7BA 5KHAA 2IPOA 1KP2A 4CE6A 3DPUA 3RREA 2Q2NA 1ODSA 4QUBA 2QTVA 2H16A 2ORED 3JYLA 3EZ7A 3JQQA 2DMRA 4EQZA 4F4FA 4BKUA 2V97A 3R8CA 1SC9A 2IYLD 2RFLA 2CNDA 4HLDA 3SD7A 4M6WA 1O4WA 4QUJA 3NC1C 3TYXA 4ZV4A 2JRLA 3A4VA 4EJ6A 3KPVA 2IYAA 4UAGA 3M81A 7ABPA 1NVXQ 5IKXA 1U3VA 3U7HB 4CM9A 3FWKA 4ENQA 3C6XA 5CPBA 1A0OA 5DCWA 3IO3A 4B2YA 1EJ0A 1C4XA 3T3GA 1V7CA 2BFDB 4RJ2A 5EZQA 3WZMA 1PDOA 5JZVA 4KGZA 1FFEA 1ZD2P 3MJDA 3B6EA 2XCQA 3ELYA 4KKXB 4BMVA 3L3BA 5EYPA 2AR7A 1MO2A 3PJEA 1IY1A 3RJ5A 3ZHYA 2R47A 2YWRA 5A1JA 1Z6GA 1A9ZA 3ON5A 5HJ5A 5HIMA 3G1WA 3SAJA 2QBYA 3KO8A 5FA8A 1NYQA 2D74A 4UBMA 4NH0A 1FVHA 3I32A 4E5MA 4M37A 4KQ1A 2ILVA 4CTOA 1P1FA 3L0CA 1MABA 4BCCA 4Z4CA 1W8IA 4TTTS 3TZQA 3NVDA 1GZ6A 2NUBA 3OA2A 3ACBA 1RDFA 4DIMA 4POOA 2HT6A 4D6YA 4J1NA 1X7XB 3UUGA 3GLUA 1DJLA 2EJTA 1I3OA 3REGA 1KOGA 4C78A 2C00A 2V0GA 4KP7A 3SDBA 5F21A 3TZBA 5CCDA 3JWIA 4A0GA 4LNUB 3LCUA 5I7UA 5JWRA 1UBFA 1YT5A 3TL2A 1DX6A 4AJIA 3BD9A 3MAJA 1P77A 1UAGA 3RGWS 1CUYA 1MNQA 3B6MA 3EEIA 3A4IA 3UOWA 2FRXA 2Q7OE 5D5HA 1JECA 4XVCA 4MIYA 5J4LA 5KHLB 4ND3A 3ODGA 4OY3A 2NU6B 2BCEA 4A03A 4JEHA 4U7DA 5CDFE 4WNYA 3W8NA 1H6CA 4PSCA 4V2UA 3USCS 3RIGA 5AW7A 3R3ZA 2NWQA 2ZWPA 1AKTA 1TUEA 2VPYA 3MUEA 5EINA 3UB4A 3L0ZA 3AUJB 1J5XA 3GZNB 1XZBA 3QNWA 4G4SO 3OH8A 4JX8A 2HA3A 3CG0A 2PLAA 4FDLA 1EFRA 4BX8A 4CFYA 2YUTA 4QQ8A 4XIYA 3OZUA 3RJTA 4PPFA 3WLEA 4AX4A 1TK2A 4Q12A 1DIOB 3L0IB 3QYFA 4TKUA 2KJQA 4AY3A 2KLBA 2OKGA 3AL3A 4CM6A 5KKCA 1RZ3A 4JI7B 4LJYA 3BS4A 3CEMA 1P7PA 1KBOA 4RJIA 3F5QA 2E87A 5EL0A 1JPJA 4S24A 2M9MA 3DAYA 4YJFA 1DBWA 1T8TA 1XJ5A 3D2BA 3QVWA 4F6RB 4KLNA 3HFSA 4AKTA 5HQTA 5LN1A 1OB2A 2PZKA 3MS2A 2WMYA 2J30A 4K9KA 3T9FA 3RUDA 3H84A 1RHMA 4IIGA 4MGEA 1RW4A 4YRIA 1AO0A 3TLXA 1A7AA 2Y0BA 2REXB 4IDOA 4JXKA 3TD2A 3GVCA 4IHJB 4GRIA 3BFPA 3DMTC 4RLHA 3VR3A 1YAHA 2QRNA 5DNEA 1RQLA 2JLYA 2J9XB 3NBFA 1DQSA 3KSUA 2VO1A 2Q8PA 3GHYA 2PY6A 2HI0A 3W5UA 4L2IA 3E03A 4RPLA 1MIHA 4YASA 4LF4B 3AUYA 4BMYA 4BNMA 1Z8HA 2CT8A 1HURA 2QVXX 1MZPA 4MV6A 1SULA 1C7QA 1OV4A 3DD5A 2I8AA 3SG0A 2QLLA 2DVMA 1J2YA 2QOEA 4BP1A 2XT6A 1EYZA 1FMJA 1QYDA 2DFNA 3LLSA 3GDWA 3DE1X 1GZVA 1UC9A 3HBAA 4M9XA 5ECWA 2DBRA 4YAKA 1BFKA 2VBFA 4YMLA 2QPAA 3K1TA 3Q40A 1PVOA 3K9WA 3NGXA 3PGXA 3NGLA 4AQYB 2HN9A 2BMFA 5F5NA 2Y6UA 2UYGA 1PSDA 3BC1A 3HRIA 3NKLA 1SB9A 4Q9AA 2CLFB 2XECA 4WMLA 7AT1A 3ZHXA 3OJFA 5IK2D 3GWGA 1CUIA 2FF7A 1IY9A 3JR3A 1XDUA 4M0EA 2ATIA 3T3EA 5JCPA 1PI3A 1RKVA 2DGDA 1YZUA 3L41A 1AZSC 3ER6A 4ASUD 2JLQA 1TMOA 3H2KA 4LHSA 2JI9A 3O1IC 1TK3A 2GEBA 2IELA 3THRA 2WTUA 2QVBA 2BKLA 3I5XA 1U65A 1C3EA 2NYRA 2V6IA 3A58B 4D3ZA 1WU8A 3WRWA 1Z18A 3ZE1B 1I2CA 4CF6A 1E3WA 2G8NA 2OGTA 3L7DA 2V6FA 1YL5A 1Q92A 2IEGA 3ROZA 3FZYA 3GN2A 4IDNA 4AWXA 4C4SA 2FSPA 3IEKA 4IR7A 1ESCA 3ROMA 1C0PA 1GZDA 5E3HA 1IN4A 3GG2A 4N65A 5EVJA 4XVQA 5F2OA 4BPBA 1BVHA 3L82B 3N9IA 2ZXUA 1RNLA 1HFEL 2DSNA 3SEFA 2O8DA 4IZIA 3NAMA 4IVQA 1XRSB 4LZPA 4R05A 1XJQA 4R9NA 5AKIA 5FORA 1L1FA 4UPEA 3SCZA 4TMYA 8GPBA 2JBAA 2DWPA 3T1QA 1QTQA 2PKWA 5FEUA 3GRRA 3VNAA 2FUCA 1E77A 1R5JA 2PCLA 4D3SA 3NCTA 4NI5A 3KPWA 3CF4G 1ETHA 1ODFA 2AG0A 4PSUA 4DEVA 1WHSA 4KACA 5FNVA 2C2KA 3X44A 2C8LA 3A3OA 3PXXA 4M8SA 4N0PA 5DGDA 4MYHA 1VPDA 2Y4OA 2VRNA 1GT91 4GVPA 1Z08A 4Z0TA 3ZI0A 1TO6A 4YXFA 4GYWA 5JJKA 2WT8A 5B4TA 2J07A 4JI0B 3HWWA 1U6KA 2TMKA 2ATXA 3BK2A 3T3IA 4AF7A 4L9SA 4E13A 5J47A 4DCTA 2GVNA 2WB4A 3SHTA 3UXMA 1A27A 4MA5A 4Q34A 3OTQA 4ZDWA 4Z3OA 1H1LA 1LV8A 4RCZA 2HGZA 2IYUA 2CVZA 2WA1A 1ZA1A 2FK8A 4LUCA 2DQZA 3PC4A 3J7AC 2ADOA 4D9EA 2WYHA 5F2NA 2PX0A 4BQOA 1E2QA 1SY7A 4LISA 3ZWWA 2FKNA 3LFHA 4JBYA 5E1MA 3DONA 4PFSA 1UBOS 2I2FA 3RSSA 2DTDA 5AKYA 1SCDA 2BUAA 4II2A 2VYQA 3P96A 1GQYA 2VPWA 2O7QA 3BQNB 5FLEX 1UKZA 3SZUA 3BHIA 2C59A 3LZ6A 5EPUA 4XIJA 1EA7A 3FSEA 3A32A 1WS6A 3I73A 2FX3A 2XUIA 1NXQA 3K31A 3HU3A 3PUHA 3FFAA 4IMJB 2BFOA 4ZU3A 2C7RA 2GSWA 2Q28A 2ZIVB 1VLMA 3HYSA 3ZHQA 1ZYUA 4C05A 2HH9A 3CVJA 3GEMA 2FPIB 3N3AC 5TEVA 4C04A 1N3BA 2XWBF 3ET4A 5C8XA 1A9TA 2YWFA 5FUVA 5K3DA 4EB0A 2XW6A 1XQXA 4RWEA 5C34B 4ETIA 5LWQA 1YVPA 4U3JB 3K9GA 4HHEA 4YQYA 2XSZD 3G6WA 3U9LA 3BQ9A 3M33A 1PJBA 3TE6A 3ADDA 1QE3A 4NBVA 2J6BA 4HGPA 1FSZA 3F73A 2I91A 2VNAA 3EQ6A 5EKSA 1EFDN 1P3Y1 4XSGA 3RLIA 3WBKA 3MGBA 3BM5A 5J5AA 1VJ5A 1RXCA 3DWEX 4HFNA 4PQEA 4HS4A 4C30A 4IDHA 2WWTA 1THGA 4BFUA 3GFSA 4R2JA 4AU1A 4B6JA 4EO9A 2HWYA 5BVGA 3FOFC 3GZ4A 4PTZA 4FDMA 1RFGE 1XLWA 2R5WA 3NEYA 2IV7A 5ITZB 5FTJA 1C0EA 3OCVA 2ECQA 4JOBA 4ZANA 4ZCSA 4OREX 4GPD1 3ZCSA 4WKBA 1AQYA 3VDRA 2P3LA 1WQ1R 3HXOA 5BY2A 3IP1A 2R6ZA 3ND6A 3V8VA 1BXRB 2CVHA 1Z73A 3TXYA 3K05A 1AN0A 4QOFA 5I5GA 4YRSA 5IMSA 3GP8A 1D6NA 4BKRA 3VZCA 4QDJA 8MHTA 5CLIA 3G9UA 2GWHA 3ANYB 4LPSA 4X8OA 1KPIA 3VJLA 4FIZA 3L1IA 3E35A 3FVTA 3LVBA 2Z0MA 3IBCA 1JHYA 3IQIX 4XWGA 1B3RA 3VX3A 1TCVA 2BT4A 2E37A 1UM9B 2OLKA 4DNPA 3DCNA 1QRRA 1G7TA 2C5BA 2DT5A 5KDOA 4ARVA 3L8EA 1B6TA 4HBZA 4BNWA 4JA0A 1X1BA 1Z4JA 1M6HA 3T4EA 5DK4A 3FTEA 4E4RA 2ZSJA 2V55B 1XEXA 2B1IA 2HW8A 4EKNB 4OI1A 2BAGA 1RZVA 2NO4A 2P2GA 4RFSA 3UYLA 3G2LA 3WNVA 4NK4A 1T0JB 1X74A 3I34X 4X1IB 3L4SO 2DKFA 2TRSB 3MPOA 3OE7D 2A84A 2I3ZA 2VJMB 1WVMA 2IYQA 4KRGA 2GAOA 3LBNA 2CL6X 3MTBA 3E53A 1E8DA 4FS8A 4GP6A 4N5LA 4JI4B 2R96A 3UJBA 1H2RS 2A3RA 4IICA 5JSHA 1CZHA 3IUBA 5CJJA 2SKDA 3CTPA 3P52A 4RS4A 4E70A 2G5CA 1H9AA 1RC8A 1HYEA 3PUKA 4D5EA 1OGYA 3HV0A 5C5DA 5I48A 1OJ7A 3Q8LA 1LLUA 4I1PA 1KJQA 4UEKA 2OBFA 4D8TA 3ZD8A 2A0FA 4O2AB 1AS3A 3L79A 3OT1A 1II8A 3EG9B 2QE7A 1DRVA 3F9IA 1WVIA 3IXQA 1G3RA 1WNTA 3STYA 5I4BA 3NWOA 4GOOD 3EOBI 3WBFA 1PZMA 3B1VA 3LXMA 3ZHUA 1GUZA 1RWMA 4JUDX 3KD2A 4Q48A 4YP7A 721PA 1ISPA 2ZSHA 1A5AB 1MX9A 2B6NA 5TIIA 3K4HA 4OHKA 5BQ5A 3BF7A 4RPJA 3D64A 2WRZA 3N2EA 4GR9A 2NPIA 3BMNB 1IMJA 2XF2A 3DFZA 1JZSA 3RCBA 5EE0A 3NBAA 5KX5A 3GVPA 1TMYA 3GLIE 1UK6A 2PH7A 2X4IA 2WKRA 4EG8A 2Z3ZA 3GR6A 3MB5A 3TZHA 2F3SA 3EAQA 2C9DA 2O23A 2Y1EA 4OKNA 1LLDA 1OZ0A 1GZ5A 1IZYA 1I4EB 5DVZA 2GZRA 4FYYA 4UBNA 1DMRA 2PXCA 2DUMA 5HUHA 3ZDCA 5KMGB 3VJRA 4R41A 1BXZA 3G89A 5CNIA 3M70A 1BYUA 1U80A 1UF9A 2WEKA 4MHSA 5K3SA 4A8JB 4C9BA 5BV8A 1HFJA 2CLKB 2YIDA 3IP6A 5DNVA 5HUQA 1R00A 2XMGA 4IV5A 2ATEA 1DJNA 4XZ3A 5CB8A 2I7DA 1DMSA 4ZPXA 1YOBA 4GMHA 4RL6A 3DLPX 2WSLA 5KZMB 4PO9A 4LY9A 3BSFA 1PK9A 1KMHB 4JQCA 3TD9A 3UAZA 4DOMA 2AEMA 2VJAA 2B30A 2FWAA 2LV8A 2CVOA 3PLAE 1VCHA 3PTZA 2ADMA 3BA6A 1QV6A 2J0VA 2ZJ1A 5ES4B 4OHCA 1GUFA 1SUIA 4HP8A 5ISMA 1MW8X 4ID9A 4KO3S 1UFQA 2KS6A 3X3HA 1ZXBA 3OA0A 1EGQA 4MUEA 3IKTA 4NOMA 3AGPA 3R5HA 3QELA 4TV8F 1VI5A 3QY0A 2XVZA 3WRVA 2DUNA 4CEIB 4MROA 1TADA 3BE8A 5FOQA 4M98A 2I4LA 2VK2A 1HDOA 2VP5A 3F97A 1T5IA 2QIOA 4AJJA 5HQ3B 2XF8A 2C7OA 4BTVA 1U8TA 4OD0A 5FTNA 5DPMA 1L7OA 1JDBC 3ORSA 3AUFA 4R1NA 4YJHA 2E4XA 3UWSA 2D8MA 4H27A 4ZZ2A 2DBZA 3KKLA 1OX4B 5C7LO 2AXNA 2Y93A 4JI3B 2GTHA 1F6WA 3K9NA 4C5BA 2BONA 3OP4A 2EOAA 4QQKA 1FPQA 3C1TA 4YP0A 4J3NA 1C8LA 1NYLA 4CUZA 2AXPA 3JW8A 3D3KA 3AHJA 3F6CA 4IJUA 5T7BA 4LTDA 2G1PA 1XF9A 4IDAA 1CIJA 1QX3A 2E0IA 2Z2IA 2YHAA 3G2HA 1HF3A 4RXUA 3W90A 4AM8A 4E09A 2V8BA 3AVYA 2V7GA 4B5KA 1EFAA 2PH3A 5JC1A 1QFJA 1QVAA 1O5IA 2OGSA 1L8OA 3DWGA 3LCCA 2X40A 3QJGA 4G5QA 2E4VA 2QUAA 5EY5B 2VAWA 1X2BA 2PGDA 3I72A 1AF4A 1Y34E 4U4AA 3RYFB 1TPZA 4B3DA 1ZR2A 2VJBA 1T9GS 4DR2B 5T67A 1QO0A 5JQGF 2YXEA 3LPMA 4M1WA 1C30A 4BRUA 1D2AA 3E2IA 2H11A 1Y3IA 5JCJA 3FWYA 1FC0A 2CK3D 2JCGA 3RS5A 3ZE7A 1TO1E 3EN0A 3F90A 2WD8A 1N36B 1AKNA 3BZWA 2X8WA 5AM3A 4I1VA 2JLWA 1FSPA 4FYHA 3IBGA 3TJZA 4U1RA 4F96A 4OLAA 4L7VA 3WRYA 4TXNA 3WLJA 3OFVA 3IOBA 2HIHA 3G5UA 3NDIA 4NSNA 5GGYA 4DJEC 2I3GA 4LGYA 1S02A 4DV2B 2A59A 3C45A 1RBQA 4A36A 3ECSA 1FW8A 2ZUSA 5A9SB 1KPGA 4MGZR 4FQ8A 2J85A 2PG3A 1F7VA 2KYRA 1TM1E 2PLFA 1CDDA 4MVJP 2I3AA 4YLGA 2IL1A 3LXXA 4RLSA 1P3JA 2HJ9A 4PRZA 3OZWA 3HDHA 3AG6A 3IE2A 3QVUA 4C6SA 1A4XA 3ROQA 2XDYA 1W48A 3ML1A 5L3RA 1X77A 4MW6A 2BRUA 4HXEB 2EBFX 3LQRA 4D9JA 4ROTA 4DV1B 5BYJA 5HF5A 3TW4A 3GI1A 1TRKA 3P19A 4JQYA 4JVSB 1IXYA 1N5OX 3EE6A 4YUVA 1V1RB 4BO4A 2BDEA 1Q3HA 3K5PA 1UKAA 1G17A 3GT7A 1NTRA 1FFHA 4ZKDA 4BUJA 4KQCA 4W6QA 3OPYA 4F5ZA 3AINA 1FDTA 2P4UA 2DLNA 2PD6A 1AX9A 1E1DA 1LLCA 5NULA 2K2WA 3QBDA 5ALRA 4BXOB 2B37A 3SX2A 3QFHA 1OYOA 4Z99A 3AIOA 1Q83A 2NOAA 1XCBA 3PK0A 2B78A 1ZD8A 3HYLA 2KX7A 1W9HA 1CVRA 1XF1A 4AUNA 2W5UA 4BGUA 2FP3A 5A02A 1S8NA 2C3PA 3F5FA 3NCHA 5AI5A 2BRUC 1WPGA 3Q1KA 1ZSVA 2H18A 3M6WA 5IJZA 1ZMBA 2ZB8A 3AWIA 1Y3CE 1TM4E 3BCHA 3DA8A 1OZAA 3EZYA 1Q15A 4GW3A 2ZWIA 4NDAA 4Q9LA 5DP1A 3VNVA 1ZIPA 1VIYA 4ZYUA 3OMXA 2GF0A 3OEHA 3HKDB 4HN9A 4PCLA 1HFWA 3JXEA 1GITA 1ZXLA 5CYPA 2G40A 3F3SA 3MTGA 4C0XA 1PLLA 2X5KO 3CN7A 5EMJA 4JS0A 1N8KA 4FP9A 4P0QB 1UT8A 2XB2A 3PF9A 3P9PA 3QP9A 2FFJA 1JNXX 3B9RA 5ALOA 3UJHA 3TTTA 3W2HA