3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
1KQ8A 2WV0A 3MWMA 2ZCWA 2Q5IA 4WJ3M 1ZRFA 2YHTA 1D3BB 2VXFA 5BS6A 1E17A 5CVVA 3HRTA 5E1XA 5LJ5e 1ATIA 3HFVA 5D5XB 2OD5A 3EUHA 2DTHA 2DQRA 2H27A 2STTA 4Q6GA 3HFOA 2V1UA 1D5VA 2PMUA 5FFZA 5GAMh 1BI0A 5EEHA 4C92A 4XTYA 5ICGA 4QVDA 3R61A 1U6GA 1ZG5A 2ZGWA 4A6DA 4ZYHA 4M77C 1O7FA 2YX7A 1SRYA 1MDMA 3ZN0A 3ROUA 1YW8A 5LJ5g 5DD8A 1M5Q1 3EQLF 4B8XA 3A7RA 5LJ3j 4ZZDA 5GAN4 2DVEA 2RHSA 3WTSC 3HHHA 1USSA 1TNTA 1EH7A 1JBMA 4IXAA 5IT3A 4HDVA 5LJ5d 2P7VB 2O8XA 3JB9D 4G84A 2ZTGA 4KMFA 1X55A 3KCCA 3DXJF 2Q7GA 3TDZC 4G6QA 3EFSA 1DPRA 1KQ0A 4XU1A 1BC7C 2HGCA 3RYRA 5FB2A 2HEOA 3KZZA 3BJ6A 4MTDA 2ARTA 1P4WA 2QBYA 4EJVA 1YTYA 2UWMA 2YSRA 4N0AC 1FZPB 3PGGA 3D5LA 4M77A 2L54A 5ED4A 3VU3C 4MQ9F 3REUA 1ON2A 2XASA 4ENNA 5ILVA 4PJOC 3LA3A 3LQQA 4U7BA 3GFIA 2UZKA 3F8BA 4K2EA 4OOIA 1M8VA 3LAJA 3T5XA 4M7DF 2MH9A 4M7AC 5LRRA 3VB2A 4OU0A 4CO8A 4YRJA 3K0LA 4R79A 3V4GA 4CICA 3JCMc 1HW1A 1LNXA 4AWXB 3V8JA 5TRDA 2CJBA 4BH9A 2DZCA 2M45A 1R1UA 2DQ0A 1B9NA 2E1HA 2NS0A 4H0EA 4ENMA 3FIFA 3AHUA 1WQ7A 3HY1A 5AIPA 5KVRA 4N0AA 3FMRA 3HOTA 2HYGD 4YRKA 2A5YB 4O5VA 3T0YA 1HKTA 4RCCA 3Q9VA 4M74A 4OIOF 3R0JA 3L2ZA 3HRUA 4PJOA 5HS8A 4HV6A 1R7JA 1G4DA 2XAQA 3O6BB 2K57A 4KT5C 4M7AA 4A12A 2O6GE 4LLGF 4G7OF 1L3LA 1DP7P 3L9FA 2KIFA 5GAOl 2OAZA 4LD5A 3J81K 3E6DA 2JPBA 5DCMA 3NELA 1P92A 4OINF 4U7DA 4M78C 2F5FA 4UV9A 3FXQA 4IHTA 3NENA 3R6SA 1NHAA 2ZNIA 2EV0A 1R5GA 1FBQA 3JW4A 3GZ6A 2EFQA 4I7HA 1P4AA 1ZG3A 4RB0A 4KA4A 4HQMA 1FYMA 4IJAA 4IVNA 1WKMA 3FWEA 3HXYA 1N9SA 1XMKA 4Q47A 4C8QE 5DD4A 5ICCA 5BMZA 1YW7A 2ZXFA 3C3WA 5GAMf 1ZN2A 4HOBA 1XGOA 1QZZA 3FM5A 3TEHA 5H6RA 2FNPA 3RKWA 4TQFA 3J80Z 4YCUA 2W57A 5HDNA 2XV4S 2ZBKA 1BI3A 4UV8A 4S04A 5FFXA 3KP3A 4YDQA 5GAMe 3HSFA 1K78A 4LB6B 2DW4A 2BBYA 4H2TA 4YRSA 4M78A 3RESA 3GVAA 1G5IA 1NNHA 3LSQA 2O61A 3O3KA 1MDMB 2JZYA 1LYLA 1BBYA 2YR2A 2VE8A 5DUKA 3HHGA 2FEZA 3IC7A 4RAYA 5GMKe 4Q4ZF 3V8LA 2KKOA 3D0SA 4JLIA 1U1TA 5D4SA 3ML6A 4C92D 3HXWA 2CJAA 5GAMg 4EJWA 4PZJA 1HSTA 4HQEA 3R4KA 3L09A 4DQ2A 2Z33A 2E1CA 3SWNB 2JT1A 2DLLA 2CGHA 4CZZA 5I21A 5GAMd 2XAHA 2FNAA 4TVYA 4LG0A 4UVAA 3WTZA 5D5WB 3KFUA 3KEOA 5A2QK 4OIRF 1BN5A 1FX7A 3G3ZA 4YG2F 1WWXA 2B0LA 2AMCA 3LAPA 3JTHA 3JCMb 2PN6A 1J0RA 4P55A 2DTOA 4L18B 1MJ9A 2ZXJA 3QP6A 1YQAA 2W25A 4ESFA 4K88A 1SD4A 1OYYA 3DV8A 3V7RA 1BIAA 1IXCA 3IWZA 4NHJA 2YLBA 4TVAB 5JFRA 4XEOA 1YO5C 3P9KA 3HFNA 2FA5A 3E5XA 2Q2EA 1H4QA 4M77D 2RKHA 4AIJA 4CHUA 1YFSA 1H4TA 4RQFA 2MH2A 3RACA 2QENA 4XRFA 1YCYA 3HRIA 2E1NA 3R60A 4O3MA 2AKWB 4C8QG 4PGGA 5ERIA 1I6XA 4NCXA 2J3LA 1J7KA 1P4XA 1W4MA 4XQ3A 3VOEA 5C52B 3BP8A 5GMKl 1P6RA 4YFXF 12ASA 4PNOA 2H6BA 2DPUA 3RPUA 2VBWA 2QM3A 5JI6A 4L5JA 4P3OA 3TQNA 2Z5UA 3Q5FA 2CW0F 3H92A 5BPIA 2DPDA 2EFOA 2EK5A 4PGHA 1XMAA 3IRQA 1BIBA 4XTUA 2ZT5A 2ZZFA 5E20A 1Z9CA 1B1BA 1D3BA 5FD5A 2OBPA 1FLIA 2DK8A 2DTIA 1HQCA 2E5AA 5IT9Z 1B70B 1D3YA 3BROA 4KYWA 4V2SA 1LOJA 2GA1A 5CVUA 2QHUA 2FMLA 2IPQX 2OZ6A 3DF8A 2RGVA 2CJ9A 4MTEA 4PJOD 4C92E 1GXQA 3K1MA 2HNIA 1ASZA 4M9ZA 1UCRA 4HV5A 2Q7HA 3SZPA 2EJGA 2TDXA 2QUFA 3V7CA 1KGSA 2K86A 4M7AD 2NAZA 1W5TA 1XN7A 3LA7A 3ELKA 4M75A 2ELHA 1OYIA 5D6EA 4JUVA 3H3ZA 2ARSA 1F4KA 2OA4A 2JPCA 2ZIOA 1EH8A 4A0XA 2GWRA 3QHSA 1OR7A 3L1AA 1PDNC 2OQGA 4ON0A 2Q8KA 3EYYA 3KE2A 4JRKA 1USYA 4XSZF 3SB2A 1U1SA 1K78B 4L0ZB 2HTJA 1FPQA 3VEPA 4PCQA 2A6EF 3LQRA 4Y91A 2EAYA 2FXAA 3BJOA 5DUIA 3HTZA 3C7JA 2CWEA 4CYDA 1YB3A 1SD7A 4GCVA 4HBLA 4JRIA 4XU0A 1ADJA 2FYKA 4M77E 5E1WA 2XGTA 3KETA 5E3IA 1FNNA 2QQAA 1DUXC 1J75A 3JCMh 4YRCA 4RGUA 5H20A 1EIYB 2PQ8A 3HYIA 4I02A 5K1YA 5KK1A 4ZYDA 4M78D 3E9HA 1FBUA 4CH6A 2F2EA 4P72C 4Q15A 3JB9F 4BWAA 3OV8A 4BYYA 3I54A 3EFRA 3TDUC 1EVKA 1G3YA 1IN4A 1TQMA 3PQKA 5CVRA 4C8QF 2G4CA 3RKXA 4ZH4F 3GO5A 2STWA 2AMCB 1Z1DA 1WSUA 1U5TB 2PLYA 2HYFA 2X0LA 3WE2A 1Z7NA 1X3UA 2DXUA 1RZ4A 3RTRA 1SETA 2ZKZA 5HS7A 1RI7A 1JXSA 1HW2A 3JAMK 2ESNA 3M7GA 4WXCA 3J7AO 1V4RA 4MHGA 4J6WA 1J5YA 4KICA 1S6LA 2DT5A 2DDZA 2IP2A 1O3RA 4BXUA 4H02A 1XSXA 1EH6A 5LHHA 3ZP5A 1W7PB 4P72A 4XU3A 3IKMB 2RDPA 4C92G 4M7AE 1O57A 2J5PA 3K69A 4XEMA 4XU2A 1ZH5A 3V7SA 5D5UB 2E65A 3HRKA 4CH3A 2XGXA 1R22A 4H2UA 3U9GA 4CS3A 4M7DC 1B9MA 1E1OA 4H2WA 1SMTA 1NYRA 5GMKi 2JSCA 1PP7U 1SFXA 4ZYGA 4G85A 2Q5HA 3U1DA 1C0WA 2PG4A 1LNWA 3DP7A 3GUDA 3GW2A 1X2HA 4I01A 3A7AA 1QQIA 4M6YA 1U3EM 2LF8A 1LDDA 2G7HA 1H9TA 5DCFA 4KDPA 2EA2A 4YIFA 1MKMA 3F23A 3WU1B 1N9WA 1TW3A 3SWNC 4WI1A 1RNLA 4RB2C 2ZR2A 1MGTA 4H2YA 4HF0A 2M8EA 3HRSA 3INZA 1XGMA 3E5UA 4M75B 3BZ6A 1GHCA 4M78E 2L4AA 1NJ6A 4M7DA 4HW0A 5CLSA 5LHGA 3TUPA 5J8CA 4PDKA 3GFJA 4U0WA 1BC8C 3GZ5A 5J8FA 3JCMW 4C8QB 2R7DA 4YCWA 4LK0F 3HXXA 4BW9A 2XHKA 5GAOm 4IHSA 1HSJA 3KEQA 3F21A 3MCZA 3KLOA 4KNYA 4HA8A 2VOPA 4ENJA 1UHWA 1WRJA 6PAXA 2DK5A 1QZYA 3TEGA 2ZZEA 4F7UE 3I64A 2ZINA 3SWNA 3KP4A 4MEXF 4XTWA 3I0TA 3M9AA 1R5HA 5HLGA 1YFRA 1T39A 2DAOA 2MLKA 4BQAA 3E6MA 4EJOA 3GXOA 4WJ4A 3ZMUA 1F1ZA 4QWQA 2OQRA 3RUXA 1UB9A 3JB9H 3VBBA 2IW5A 5DYMA 5BQTA 5GAOr 5FO5A 3IRRA 1HBXG 5E8IA 1OYWA 4M7AG 1XGSA 1I5ZA 2CFXA 3E6BA 4HAMA 4P74C 3RGLA 1SMYF 4YRFA 2HFHA 3I7FA 3BY7A 1EQRA 1L0WA 1S8NA 4C92F 2A6HF 4P73C 2WWYA 3W3SA 3A7UA 2C7IA 2P6TA 3C18A 4E51A 4Q5SF 4TVAA 4MEYF 4HT8A 4J15A 3LA2A 2RD1A 1IRGA 1EOVA 1KQ1A 5L3DA 2LSOA 1HKQA 4KN4X 3KP5A 1ZRCA 3LC0A 1TNSA 1J2XA 3F3XA 2AKWA 3S2WA 3P9IA 4HF1A 5GANh 3HIFA 3JCMJ 2UXXA 4L87A 3QO7A 1KMNA 3JCMd 2G7UA 5ELNA 4YFKF 2EB7A 2ZCEA 4A2UA 1KYZA 3K2ZA 4P74A 3HTSB 1IN6A 2CIMA 1FP2A 4YREA 4HLXA 2I4OA 4P73A 2BE5F 1E24A 2C8MA 2VN2A 2DFIA 1XGNA 2HKXA 4ENKA 2GXGA 3WGHA 4M78G 3JTGA 3T1BA 4P96A 3I53A 4A5NA 4M77F 3UGTA 4UXNA 1B70A 5LJ5j 1PYSB 3A32A 4I2OA 4RS8A 1ZREA 2FMYA 3QAHA 4RB1A 2V1XA 3NEUA 4UVBA 2ISZA 1I81A 5F6FA 3WGIA 4PHCA 2DZ9A 4GO1A 3WODF 3WTUC 2EWNA 2FF4A 1FBSA 1FT9A 3EYIA 1EVLA 3M8EA 2ZZGA 3I4PA 3ULQB 3PFIA 4D0PA 4XTZA 4F7UG 3A5YA 1Y96B 2Q7EA 4MQVA 4EMHA 2EFNA 3BPXA 1ZRDA 2GIVA 3I58A 4YRNA 3Q9SA 1VQZA 1DDNA 2CO5A 2ZO4A 3PZCA 3A31A 2DTRA 4L9JA 4L5IA 4LNSA 4YCVA 3CMQA 3BFMA 1TTYA 3REXA 4EGZA 1O7LA 1T98A 3NQOA 1FP1D 4IF4A 1USTA 2A69F 4M7DB 3WGGA 5BOXA 3DQVC 5AONA 2VOOA 2QHSA 1X01A 1SD5A 1T2KA 5HLIA 3WTWC 3KP7A 1NJ8A 1U5TC 4PJOF 1S29A 1XB4A 4LB5A 2ZT7A 1Q1HA 4LK1F 2ZFWA 2EFWA 3K9TA 4IRGA 5LJ3h 4M7AF 4HWRA 5DEQA 4OP0A 4HYEA 2ADUA 4U0YA 3WTTC 3V8KA 3DKWA 4EMGA 2XAFA 3IALA 1FSHA 4YRIA 2P5LC 2WTEA 1CGPA 4LGWA 2VBXA 2EJRA 2P7CB 2YPRA 2HQNA 1EIYA 4UPAA 1U8RA 1Z7UA 5GAOq 3F6VA 4UNOA 4NOYA 4M7DD 1LJ9A 2DO7A 3FXUA 1X54A 4HWPA 3WG9A 5J6XA 1G51A 3B73A 4U88A 4G9YA 3IL2A 2GQQA 2E3CA 4EM1A 1IN5A 4G7HF 3MZYA 1K79A 1ULYA 1U5TA 4M9XA 3HY0A 1J5WA 4HT9A 1WU7A 3TO6A 1HKSA 2VC8A 1G5HA 3MEXA 4M9SA 2QVOA 2I4MA 2HS5A 1OPCA 1B34B 2MBFA 1T0FA 1O3QA 1B7YA 5FLXZ 3T8RA 1BI2A 4FT8A 2ISYA 3ISPA 2I4NA 5FD6A 4M78F 3RF1A 3UGQA 3VFZA 5GANf 3HSRA 2GAUA 3CDHA 3JB9G 1JHFA 3R0AA 1W7PA 3IG2A 2MA3A 3MF2A 4PG3A 3WTYC 5K5OA 4HLYA 4AIHA 1YLFA 1WLEA 2D45A 3N4MA 5LEKA 2K7LA 5K1PA 1HW5A 1LVAA 2NYXA 4M75C 5EEGA 4P75A 1MZBA 3BWGA 3QPHA 2R7FA 5LHIA 1PUEE 4F7UF 2ODRD 1ZLJA 2Q0OA 5K5QA 3A5ZA 4C8QC 2NNYA 2KIUA 2FRHA 4K87A 1USYC 3CLOA 1UHMA 1YFTA 2QHTA 4BHPA 5L3EA 1IZ1A 3I59A 1SD6A 3GYHX 3F6OA 2AXLA 4G7ZF 2Y0MA 2P6SA 4WXDA 3J80K 2IA2A 3MFKA 4LLNA 4LFUA 4S05A 3ECHA 3BW1A 1QO0D 1U2WA 1KU9A 3T8TA 3VQWA 2O0YA 4RGXA 5AIQA 2IT0A 5FGMA 3SHFA 1ONVA 3QU3A 2C6YA 2ZIMA 2DU9A 1YYVA 5GANd 4GYGA 2VT2A 1Z6TA 5GAMj 1STZA 3E97A 1YW9A 1IAWA 1YGBA 1LEAA 3ZMDA 1LQ1A 2ZJ2A 2O3FA 3TO7A 2LF7A 2GZWA 4BAYA 1JE8A 1BBWA 3ABTA 4C8QA 3DSQA 1G3SA 4IPAA 1MD0A 4KR3A 2JN0A 4Y17A 5K5RA 1ZGJA 3RL6A 2DKGA 5GMKj 4XSXF 4Q48A 1AOYA 5GAN5 3HSEA 5GAN2 2L4MA 4TTVA 1JHHA 3ERED 4RB3C 3P8VA 1A04A 1XCBA 5ELOA 5LJ3f 3F8FA 2ZNZA 3F8CA 1UFMA 4WX9A 1F5TA 4UVCA 3I71A 4L9NA 4WCGA 2PMHA 4OIPF 3F22A 2XKPA 4HWOA 2PFBA 1Z6RA 5CVIA 5LJ3e 3WTVC 1QPMA 3RERA 3G1ZA 1L0OC 3KZYA 3MAJA 2F5DA 4M71A 3SXYA 1OKRA 4U0VA 4O6JA 4NL2A 3RIRA 1LDJA 4CDGA 4X5OA 3UFGA 3HTUA 3TO9A 2ZMEA 3HXVA 1P2FA 3HRMA 3KP2A 4G94A 2RQPA 3CO7C 2K27A 1KU2A 2CQKA 2F5CA 1HC7A 2OU2A 3WQZA 1YS6A 5LJ3g 1IUYA 1KYWA 1FYFA 2H09A 2VT3A 1KQ2A 3I5UA 3RPQA 2Z3YA 5LJ3d 2E41A 4QLCU 2DJZA 1QE0A 4RDXA 1B7YB 3QUIA 2P4WA 5E1ZB 1QGPA 4UP7A 4N9HA 2E10A 4PJOE 4BNCA 2A61A 1JRIA 3VODA 4FHTA 3CTAA 2HTSA 5HGQA 3JCMP 4JK1X 2D1HA 4M72A 4YRGA 4G8XA 2YU3A 5IT9K 3BJAA 4P3NA 3GIBA 2XIGA 2E64A 1NJ2A 5ICEA 5KNNA 3GFLA 1RIOH 1PYSA 1OMIA 3DFGA 2V6CA 3JSOA 4OMYA 2M5WA 1I1SA 1I1GA 2I2LA 2WC2A 1IL2A 4EVIA 3P7NA 4HVCA 4ZYEA 4HF2A 2CSOA 1FYKA 3M1EA 1F9NA 2NRAC 1QF6A 2L02A 1RUNA 1W7PD 1FOKA 3I59B 3JCMQ 4YPFA 4I0AA 1Z7MA 1GGMA 4EGYA 4YYEA 5C51B 1Y96A 1KU3A 2IY5A 3RYPA 2Y90A 3LSTA 1XD7A 1LJOA 2DBBA 4OMZA 4H2SA 4WWCA 2LDUA 1RUOA 3J81Z 3HUGA 3FHZA 5LEJA 3SFZA 4M77G 3RI4A 3TKYA 5L3BA 5D8KB 3B02A 3QP5A 4EM0B 4MMLA 2HDCA 4X9DA 2W84A 4L0YB 5HS9A 1IN8A 3GFMA 4EJUA 1YIOA 1YS7A 3HXUA 3OOPA 2ESHA 2RM4A 3IWFA 4AD9A 1R1TA 3C1DA 4A53A 4YRQA 2RHQB 1FYLA 5GAN3 3BY6A 1WNLA 2MLGA 4NQWA 5GMKh 2ODRC 1KMMA 4NL3A 1D8KA 3KP6A 1LDKB 2Z99A 2VC1A 4R8HA 3LSSA 2A3SA 4M75D 2H6CA 3ZPLA 3MQ0A 2A07F 2LKPA 4HWSA 4KIBA 2P5VA 3JCMf 4TQDA 1SFUA 2COMA 4N9IA 3K1NA 4RAZA 2AS5F 5DDGA 4C8QD 1BBUA 4ZIBA 1TBXA 2KJBA 5L3GA 3DPLC 2RA2A 4DPGA 2PEXA 1W5SA 3TOAA 4H2XB 4PJOG 1MJBA 1PP8F 5E8GA 4R1HA 4LJZF 1E2XA 3E6CC 3JCMe 2BGCA 4A0YA 3IKVA 1KU7A 5HDKA 3OD1A 3DEUA 2PI0A 3QNEA 1TH7A 5E18F 5GAN7 2ZMEB 2QYOA 2PJPA 3L4GB 1C0AA 5CJ9A 1B34A 4RCBA 3KLNA 3GLXA 3GF2A 1JGSA 2MC3A 2HQRA 3VQXA 2Y48A 1ZLKA 3GEZA 1B8AA 3W6JB 1E1TA 3P8TA 2GXBA 3M4PA 1YFHA 3M4GA 3PQJA 1TW2A 4TWAA 4M73A 4MGRA 5HOOA 3L00A 1EV7A 4KN7X 1YG2A 1IXSB 5GAN8 4ESBA 5HLHA 3JCMg 4ETSA 4CH5A 5A2QZ 4JQFA 4ESJA 4IRIA 3FMQA 1NYQA 1X56A 3ZMSA 3KFWX 2QTXA 2FE3A 4YRPA 2EV6A 2XROA 4H2VA 2ALYB 3ERRA 1SFEA 3L2CA 2ARUA 2FBHA 1H9GA 3FB9A 2HWVA 1XSDA 3W6KB 1H641 3LFKA 1H4SA 4EX5A 5CYVA 5TJJA 1R00A 2P5IA 3REOA 3NRVA 1JJCB 3QO3A 1ADYA 4YRRA 2P5KA 1IXRC 5L3FA 4RQEA 1TQIA 4FX0A 4WF2A 4XLNF 2O03A 3AAFA 3F8MA 2RV8A 1MJAA 4HWTA 2EJ9A 3CUQB 4EMKB 2V9VA 1SESA 1S7AA 5GAN6 4YRTA 4K86A 2QHVA 1CF7B 3K1PA 3P9CA 3ZMTA 3CUOA 4NB5A 3BOQA 2VXEA 3BPVA 3LWFA 3TGNA 5D4RA 3ICAA 4GXOA 3QPTA 2W85A 5F64A 1W66A 3PCOA 3O2PE 4L9TA 3JB9I 1QBJA 4M75E 4WXHA 3R07A 1ZGAA 2DXTA 2IY5B 2HZTA 2XAJA 3HFZA 5HVQC 4HX7A 3QTCA 5LBQA 3EDPA 1IF1A 3L7WA 5K1XA 2OZUA 3FZVA 4UP9A 2M30A 2VONA 3TOBA 4RGSA 4A5MA 3F8NA 2PMEA 1I4K1 1V3FA 2LNBA 5GMKm 2M1BA 4G6DA 2RNJA 4C92B 3IKTA 2HOEA 2PMFA 5D8LB 2QWWA 2RB6A 2X4HA 1B59A 4GGGA 4EV0A 1K6OA 2UXNA 3DPTA 1FSEA 1ZYRF 3GWZA 2XKOA 3HSBA 1N9RA 1G6NA 1TLHB 2EFPA 1O3SA 4N0BA 1LEBA 3M4QA 3RJPA 1ODDA 2BYVE 4F7ZA 2RHSB 4Z2YA 1FY7A 2JTVA 1KOGA 2DI3A 4E70A 2EJFA 2FB7A 4AH6A 2EA4A 3RDIA 1D8JA 2PBIA 3MF1A 3E9IA 2CYYA 5LGUA 4F7UA 3GX4X 1FWZA 4J6XA 5JHUA 2ZT6A 5LGNA 4HX4A 2QBYB 4P75C 4KFCA 4CS4A 4TVWA 2IJLA 2ZNYA 1SAXA 4M77B 1BOAA 1ZAOA 2A68F 5HDGA 2K4BA 5JVTA 1E22A 2D2WA 1Y0UA 3COAC 3FJPA 1WYDA 5LLQA 5E17F 1GVJA 1U78A 1G3TA 2HR3A 1QNTA 3QRFF 3QU6A 1J59A 1XDUA 4XLPF 2H94A 4LLLA 3WE3A 3EETA 2IRFG 3BDUA 4UUVA 2DU5A 3FMSA 4B09A 2NNNA 4CS2A 5ILUA 2CG4A 1S3JA 3G73A 4CGZA 2FQ3A 4M75G 4RMFA 5CAIA 5GANe 4J6YA 4ZTZB 1XCVA 2BV6A 4M6XA 1NJ5A 1R23A 4YIIA 3E3VA 4ZZLA 2G9WA 4KQEA 2QLZA 2MD5A 2DQ3A 2I4LA 1WQWA 2L3DA 4AVPA 3JAMZ 1FC3A 4KIGA 1X2GA 2QQ9A 2J5OA 1G3WA 4PJOB 2P8TA 1R58A 1R1VA 3FX3A 5F1RA 3MEYA 2Y75A 2FSWA 3VQYA 3NEMA 1K7AA 4M7AB 4L9VA 2F5EA 4LMYA 5GANg 1ZARA 3F72A 1I27A 2XUBA 4EO4A 2YX4A 1GXPA 4MNUA 3QO5A 5LJ5h 4ASNA 3FXRA 5DCMB 4GYIA 2R3SA 3E5QA 4YRLA 3WTXC 3MZHA 3PCOB 3CJNA 3P8YA 1REPC 3VQVA 4P3PA 2FU4A 1BI1A 1B6AA 2DEQA 3BJUA 2IA1A 5DY9A 1VTNC 2BEOA 4M7DE 2W24A 3ABUA 1HK9A 1RIQA 3HFZB 4P71C 4KUMA 3JCMV 3ZQ7A 3ZMVA 3RKYA 1DPUA 3BDDA 1KA8A 1IN7A 1ZG1A 2KJCA 3U2RA 4OLFA 4KIFA 2KRFA 1IW7F 2P0LA 2XRNA 5L3CA 3TEHB 2RHQA 2L01A 1T6SA 4BHBA 1WQ2A 4ZTUB 4HDUA 4CXFA 3SQNA 4HX8A 2XAGA 3WU0A 4I0BA 4WK8F 3HOSA 4X9CA 2VE9A 5C53B 1ZHFA 1S7OA 4M78B 3A74A 4KR2A 2ZR3A 5GAOn 4UP8A 1H4VB 5BPDA 1HXDA 2Z9OA 2K4JA 3IHUA 1R36A 1B76A 4XBFA 2FOKA 5DV5A 2VODA 5CVJA 4H2XA 4YFNF 2K02A 5LGTA 4P71A 3QO8A 4XTVA 4QVCA 1AWCA 5F5WA 1XSVA 4P9UA 2XTIA 4BHCA 4YRMA 3M8FA 2FBKA 5D6FA 4P5OA 2YLCA 3L4GA 5FLXK 3QSUA 1IRFA 4JBAA 4AIKA 4F7UB 2DQLA 5GAOp 2RC4A 1WPYA 2VC0A 2RN7A 2EL9A 1B4AA 2ETHA 1HTTA 5H6QA 4EMSA 3ECOA 4M75F 1NJ1A 3JSPA 3CO6C 1XDSA 2D1VA 1TQPA 1LB2A 4LG0B 3CUQC 2FBIA 4EMKC 1Z91A 2IVMA 1H0MA 4OIQF 4DNCA 4P9FA 5D5VB 3JB9J 1T38A 3NETA 2RVCA 2EV5A 4KMUX 4A0ZA 4A54A 2GA2A 2XVCA 5ILSA 1I8FA 1WI9A 4EJTA 4IRHA 5GANj 2ALYA 4I98B 3N97A 4YROA 1ON1A 2V1DA 2VXZA 4I09A 4FX4A 5ICFA 1J9IA 3ZMZA 3QOPA 3SZTA 4Y15A 2M87A 2E7XA 1EFWA 1JJCA 4MMKA 2QZ8A 4A6EA 3HXZA 2V79A 1O3TA 1SERA 4RGRA 2J3MA 3FF5A 2KIMA 4M7DG 2JRTA 2DU7A 2ZT8A 1I5LA 4Y13A 4UHTA 3CUQA 4C92C 4EMKA 5JR3A 3H3UA 3JCMX 2QQBA 4O2DA 1CF7A 1BM9A 3ZN1A 2HKOA 4XTXA 2ZNJA 3IKLA 3UH0A 1MGQA 5LJ5f 2VBZA 3FM3A 2CGPA 1BJAA 4EM2A 5LRSA 1ASYA 2IA0A 11ASA 1Z05A 1KQ9A 4EQQA 2E7WA 4TV7A 4YP0A 4J5YA 2VBYA 2ACJA 4HZFA 4CH4A
chains in the Genus database with same CATH superfamily
1KQ8A 4YEJA 1VIFA 3FKIJ 3OW2S 3EGUA 3CC4Q 5TISC 1ATIA 3HFVA 4ATOA 1UJYA 3VS4A 2LLKA 2V1UA 5LD2C 4XICA 1D5VA 4B48A 2BKDN 5GAMh 5EEHA 2ZAEA 5ICGA 4QVDA 3R61A 2OCEA 4HT4A 1ZG5A 2ZGWA 4A6DA 1WJDA 4ZYHA 2XF5A 2DVJA 2DMPA 2WY8Q 1X75C 1MDMA 3ROUA 5DD8A 4A3LJ 4B8XA 3G4ST 1M90U 1RAAB 2DVEA 1JJ2S 1G2HA 3HHHA 2CUJA 4IXAA 5IT3A 2NVQJ 2LD5A 1GCPA 2O8XA 4G84A 1UE9A 4KMFA 3HTRA 4ZDPA 2HQXA 3DXJF 2Q7GA 3RSNA 3EG3A 2LCLA 4XU1A 1WDXA 1UGPB 2HD0A 4E47A 2HEOA 3BJ6A 1D09B 3X24B 3QPSA 4A4GA 3FHNA 4PSXA 4EJVA 2A37A 2YSRA 4BQQA 4QVZA 2Q1ZB 1OJLA 4FQGA 4CCKA 2R5AA 2L54A 4MQ9F 2K40A 4D7NA 2JUFA 3QWXX 1S72I 3A01A 2VVKA 4LNPA 3T5XA 2F6CA 2MH9A 5LRRA 1VNDA 3SZGA 4R79A 3V4GA 3JCMc 5FU7B 1HW1A 3V8JA 5TRDA 4BH9A 4AG1C 1K9MU 4EEFG 2M02A 1K61A 1Z7LA 4ABZA 2NS0A 4FETA 4B6MA 2DDAA 3FIFA 3AHUA 5KVRA 4LVLA 1PWTA 2A5YB 2YUOA 3T0YA 4RCCA 3CCLI 1AZEA 2HDWA 3R0JA 3HRUA 1E6HA 3PSIA 1G4DA 2O5RA 3OOUA 3ZR8X 2K79A 1VQ5T 1XTAA 5HNFA 2VJ5A 3EFOB 2ZCFB 3M8JA 3D1NI 1P92A 4UV9A 3R6SA 1NHAA 3P8DA 3CPWS 3JW4A 1KG1A 2DN0A 2F4IA 4I7HA 4B3AA 1ZG3A 4KA4A 4QT7A 3THKA 2F4MB 3PFYA 3A8MB 3CMMA 3C3WA 1A31A 5CR2A 1QZZA 5H6RA 2FZCB 1EX4A 3RKWA 4YCUA 2W57A 3S3MA 1VQOT 5HDNA 2XV4S 3AG4H 1BI3A 2EYWA 1SAUA 5GAMe 2DW4A 5B5EC 2G3RA 3FK6A 1BW5A 3RESA 2X1DA 1NNHA 2RO0A 5J1UA 1MDMB 2R58A 1UG2A 1BBYA 2YR2A 5DUKA 3HHGA 2FEZA 2H8RA 4XKWA 2LVSA 4RAYA 2ATCB 2L3SA 1VQ4T 4JYKA 1U1TA 5D4SA 4ZTFA 2E60A 2CJAA 2X1CA 2A08A 2EGCA 3LSMA 4EJWA 1M2VA 5HY6A 1YI2I 1XJWB 1W2BP 3GTPJ 4RG8A 3CCUT 2BXYA 4LG0A 3KFUA 3HKZA 4AFQC 3G3ZA 1NK3P 2B0LA 2R7ZJ 3JCMb 3A01B 2E34A 2DTOA 4A63B 4L18B 2ZXJA 2W25A 1ZR4A 1BR2A 3C2GA 3LWIA 1VYTA 5CQYA 3DBLB 3IP4B 3CCLQ 1YFNA 3IWZA 2DA7A 2DL3A 3R6NA 3P9KA 3HFNA 3TCJA 4B4CA 4M77D 2DMUA 2RKHA 4RQFA 4OMNA 3QYHB 3QWYA 3QZ5B 1KHIA 4BE2A 2KBTA 2AKWB 4C8QG 4PGGA 5ERIA 1H8KA 1YN8A 1FIAA 4XQ3A 3VOEA 3G6ET 5C52B 3BP8A 2E2IJ 1P6RA 1WPKA 4YFXF 3MQZA 3DKYA 4A3GJ 1VQNA 3RPUA 1DJ7B 1QVGP 3TQNA 2OTJA 2XGEA 3SYTA 4IZZA 4LDVA 2EFOA 3IRQA 4KITB 2MF2A 2OBPA 1HQCA 4D6WA 5IT9Z 1B70B 2Y69H 4AFSC 3LOCA 3BROA 4V2SA 2FMLA 2O8KA 2OZ6A 4PJJA 2K3PA 2Q7HA 3SZPA 4F55A 3ELKA 4ME7A 2ELHA 3H3ZA 2I10A 3CZ6A 3L1AA 1PDNC 2OQGA 3EYYA 3KE2A 4XSZF 3ZL7C 3AT1B 1FPQA 3VEPA 2OTLI 1W70A 2GLOA 4KJZA 4LUDA 1JJ8C 2CWEA 4CYDA 1SD7A 4HVUA 1JB0E 4A4KA 4JRIA 4ZGJB 2HI3A 1JT0A 3VS1A 3HPWA 2FYKA 4M77E 1UELB 3OL3A 1J75A 1DUXC 5F0HA 1V5FA 1EIYB 2PQ8A 1TUDA 4I02A 3E9HA 2VJJA 4CH6A 4D5FA 5IP6A 2M1HA 4P72C 3OV8A 3I54A 4IIOA 2ZPIB 3TREA 3OYKA 2E5KA 2K9NA 1G3YA 1TQMA 3R6OA 1YHQQ 1Z1DA 1WSUA 2PLYA 3K4BA 1UHCA 3GLLA 3H9NA 3RTRA 1P7IA 1A35A 1RI7A 3OMGA 4RAFA 1B72A 3M7GA 2DERA 4WXCA 3J7AO 1VQ7T 2VWFA 2D6FA 4J6WA 1S6LA 1VQPI 3SFMA 3MEVA 5CPRB 1UGVA 3ZP5A 4LVMA 1WHHA 4P72A 3IKMB 2J5PA 1IB8A 1Y0NA 1BYMA 5D5UB 1HA8A 1IXDA 3HRKA 4CH3A 4MLOA 4IHWA 4H2UA 3U9GA 3K4KA 4M7DC 1H92A 1H88C 9ATCB 3FISA 5E3OA 1E1OA 2JSCA 1SFXA 1LNWA 1HF0A 1NK2P 2YDLA 1KHCA 5J39A 2MIOA 2HVSA 3I9QA 3LMMA 5DCFA 4KDPA 4A3EJ 2BW3B 1N9WA 1TW3A 2QKLB 2K6DA 2IEKA 4HF0A 1UGQB 4Y3OA 3INZA 3NTHA 4M7DA 3TP0A 4U0WA 1RABB 4C8QB 1F36A 4LK0F 3HXXA 2K85A 1OI1A 1I6HJ 5KE2A 4ENJA 2ZFUA 2K9SA 2RI5A 4HNVA 1RKTA 4MEXF 4ZNXA 5GTIC 3META 3M9AA 1YFRA 3UWNA 2MLKA 3NWSA 1B3QA 3HJEA 4F17A 1VQ5A 1YRNA 3RUXA 4J9DA 5GAOr 5FO5A 1HBXG 2YUQA 2HOTA 3O8VA 5CKHA 3OA6A 2X9HA 1VQPQ 4BE1A 3NARA 5CQGA 4P73C 2WWYA 2RHUA 3F0CA 1W4SA 2M7BA 2B7EA 4J15A 2EFIA 1MNMC 1EOVA 4AT1B 5BNGA 3OR2C 5K7HA 1NLPC 5L3DA 1HKQA 1ZRCA 3LC0A 3LSKA 3RQIA 4M4ZA 1E6GA 4AMCA 5GANh 2DRMA 3LGLA 1VQOA 3HIFA 3TMOA 4FYWB 4NC8A 3UF4A 2G7UA 2RREA 4Z88A 3FBIB 4A2UA 3K2ZA 3HTSB 1JU5C 2YWWA 4HLXA 4P73A 1E24A 2C8MA 2I0NA 2HKXA 1TT0A 4ELYC 4M77F 3OR1C 1VQ4A 3CMYA 2L7FP 4RS8A 1APLC 1FMKA 2FMYA 4RUGA 2CV1A 5F6FA 4PHCA 1R6RA 2DZ9A 4MDWA 3WODF 3M0RA 1VUBA 2QI2A 3M8EA 3FC3A 1TWCJ 3I4PA 4BXXJ 4F7UG 4XTZA 4M3EA 3A5YA 3CESA 1H8AC 3I58A 4YRNA 2JZ2A 3Q9SA 4XOPA 3M59A 2ZO4A 2F5TX 2DTRA 3BCAA 1K76A 4YCVA 3CMQA 4BY6C 2DK3A 1T98A 4IF4A 1USTA 4M7DB 2L3RA 4R56A 5HLIA 4A4HA 1LPQA 2PNIA 2DXCA 2GIZA 2NOGA 3K9TA 1Y1WJ 5LJ3h 1K8AC 1R5ID 2MABA 4NQWB 3WTTC 3DKWA 4EMGA 2QGUA 1FOYA 1T0FC 8AT1B 3IALA 4OWRB 1YBYA 2P7CB 2HQNA 3S93A 1Z7UA 3H0GJ 2HPMA 3G6EA 1QLYA 1VQKI 3MP6A 3WG9A 2NS7A 3CBOA 2K3BA 1IN5A 3CCET 4G7HF 3MZYA 1NPRA 3S16J 4M9XA 2MPXC 4HT9A 3NAUA 3TO6A 2WAQN 4B9WA 2I4MA 5B1AH 3TEEA 1T0FA 5FLXZ 1BI2A 1UGRB 2ISYA 2I4NA 5FD6A 5GJVB 3UGQA 1T3LA 3VFZA 3HSRA 2GAUA 3EPZA 2ELJA 4PG3A 4HLYA 1YLFA 3N4MA 3GCMA 5LEKA 2DFFA 5K1PA 1VQ9Q 4P75A 1MZBA 5KE3A 3PNVA 3QPHA 2WSCE 1IGQA 1EZZB 4NS5A 2D9TA 2QG9B 3PJRA 3E1SA 4IOAF 5GAHJ 4HRIA 1D1BA 3CF2A 4CA0A 3FIWA 3J80K 2N8GA 4CCOA 4LFUA 3T8TA 3VQWA 2O0YA 5DLOA 1JTYA 1IAWA 3ZMDA 1LQ1A 2O3FA 4AUXA 2DYIA 2RI2A 1D0ZA 3BR6A 4IPAA 3HOZJ 3C12A 2RNGA 5K5RA 4XSXF 1AOYA 3HSEA 5GAN2 2L4MA 3CCMA 1WCMJ 1A04A 5ELOA 4EIKA 3VS5A 2LP5A 1UFMA 1VQMI 1F5TA 4UVCA 1RAFB 4E4HA 3I71A 4XLFA 2PMHA 3QKJA 2HDAA 2XKPA 3L1PA 4K11A 5LJ3e 3NTKA 2GFAA 3OW2P 3MKYB 4GFBA 2DRKA 3W2VA 1MMAA 1PVEA 4RTYA 4BI8B 2EQKA 4CDGA 3UFGA 1WH7A 2LT1A 1VQ6Q 5KYWB 3HXVA 1P2FA 2NUTA 1SKUB 3KP2A 3JSCA 2AK5A 2K27A 3G1OA 4XK8E 2VT3A 2KDSA 3RPQA 2ENMA 2CDTA 2X6XA 1PCXA 4MDXA 4II1A 4AIDA 3I3LA 4BS9A 5E1ZB 3SEZA 3PUBA 4N9HA 3CC2I 2C0TA 3CTAA 1N78A 2L2OA 5JVGF 1GDTA 2QGFB 1VZ0A 4G8XA 1Z3XA 3S1MJ 4HXJA 3O8HA 3CMAI 1PYSA 1OMIA 2D0QB 3B6AA 2M5WA 2WC2A 1M30A 3P7NA 1OQKA 1FOKA 4CZCA 1Z7MA 3HC7A 1OFCX 2FD5A 1Y96A 3GPLA 3U21A 3RYPA 3QBYA 2DBBA 3J81Z 1ZSZC 5LEJA 3SFZA 5L3BA 2KRNA 1VQMQ 2KVQG 1KD1C 1X3WB 4ITVA 4RBOA 2LCCA 3QP5A 4EM0B 4MMLA 2HDCA 4XONA 3IWFA 1OCZH 4IURA 2AQFA 3PL8A 1MIJA 1V55H 4DGWB 1JKRC 3KP6A 1LDKB 2Z99A 3ZRGA 4XN0A 2H6CA 3MQ0A 1XX5A 4E7SA 4XNFA 3JRCA 1BB9A 2Z1DA 1ZSZA 2COMA 3FDYA 1T56A 4C8QD 1BBUA 2KJBA 1DU6A 2PEXA 1PP8F 3E6CC 3JCMe 3FLGA 1KU7A 3AG1H 2J05A 1Q81U 1YWOA 5CO7A 2M0MA 2NUTB 3GLXA 3CJTB 3CC2Q 3LH0A 1I5OB 3MJXA 3P8TA 2ROTA 1YFHA 4R0KA 3HOXJ 2VQCA 1EV7A 5HLHA 4ETSA 4CH5A 3NGPA 3CC4T 4ESJA 3FMQA 3CMAQ 2RMOA 1X56A 1QVFA 2EV6A 1SFEA 1N8RU 1AVZC 3FB9A 1WHJA 3J7YJ 1QWFA 1H4SA 4EX5A 4NNJA 1BK2A 2P5IA 1ADYA 1IXRC 2NOJB 5E79C 1SFOJ 2HOAA 2RV8A 2EJ9A 2E19A 1XTDA 2DXBA 2GNCA 4I6ZA 3P9CA 3GF5A 4NB5A 5D4RA 1B7TA 3QPTA 3E19A 4RTZA 3I55I 1W66A 3O2PE 3H35A 1RLPC 3A98A 1ZGAA 3SD4A 5A2QE 2BY1A 1VQLQ 4IHYA 1WXUA 2PMZN 3EDPA 3L7WA 3G2BA 2CQNA 2DYRH 2VONA 4LXCA 1Y8QB 4UUTA 2CUZA 2PX9A 2F2XA 3CQZJ 1VQ8I 3J7AF 2PUOB 4G6DA 4C92B 3EGDB 1FMWA 1YJ9Q 2RB6A 1Z0XA 2LBFA 1K6OA 2IIMA 4BACA 3S1RJ 1E3HA 1TLHB 5KYNA 1O3SA 3VS6A 4IUTA 2BYVE 3A02A 2RHSB 1FY7A 5KYUA 3HOVJ 2EJFA 2EZKA 3K7AJ 3OYBA 4OMMA 3VYSB 1OISA 3GX4X 2PTKA 1WVRA 3H41A 1MMGA 1PSEA 4KT6A 1BOAA 1WI3A 4CCMA 3KX2A 2A68F 4JX4A 3OYFA 3LFUA 1ACIA 2WADA 2Y2ZA 3LWHA 5AYFA 1ETOA 5CK9A 2E1MB 2A0FB 3QRFF 4LLLA 3EETA 1NE8A 4UUVA 3FMSA 3ZQGA 1D0YA 2DOFA 3G73A 4M75G 1IO6A 4IQJA 4ZTZB 2BV6A 1NJ5A 1R23A 2NVTJ 3E3VA 2BY2A 2DQ3A 2I4LA 4A3IJ 3G4SI 2B8AA 2ZJQF 3I55Q 2DA2A 2TRTA 2X48A 4ZC3A 3CCSQ 2L5QA 1Q7YR 1KC8C 3MEYA 2X4XA 4JJDA 2KDOA 3NEMA 4M7AB 3IV5A 4LMYA 2DA5A 2F5EA 2EZLA 2W4SA 4OMPA 2XUBA 2YX4A 2XSDC 4GYIA 3MZHA 1WJEA 1REPC 3S1QJ 4M3FA 1BI1A 1B6AA 2A6TA 1VTNC 2BEOA 4M7DE 5GPCA 2W24A 4QQGA 4P71C 2D0NA 3RKYA 1AWJA 1KA8A 1SHGA 2KZGA 2M0CA 4N4OB 5FKMA 4OLFA 1IW7F 3CD6A 4BHBA 3Q3SA 2ME6A 1WQ2A 2GBQA 3SQNA 2XAGA 5KNLA 1LFBA 3UA7A 3JAME 4OMLA 4AYBN 3HOSA 3EGXA 4IUPA 2RH2A 2EQUA 3CCLT 4UUSB 5C53B 2LBFB 1ZHFA 4M78B 2ZR3A 5GAOn 1NEBA 3M0SA 4AVZA 4ZDLA 4C0DC 4H2XA 4YFNF 4P71A 5KYUB 2RPNA 2KMUA 5F5WA 2DTZA 3CCRQ 1HJDA 4P5OA 2FEIA 1IRFA 2DQLA 1WPYA 2VC0A 2EKOA 2EL9A 1B4AA 2CFOA 3OSVA 4KGZB 4L5GA 1TQPA 2IVMA 1OU8A 3OYDA 3JRDA 3I5SA 5D5VB 1T38A 2H8WA 2NVXJ 1GFDA 9ANTA 2RVCA 4KMUX 4A54A 2GA2A 5EF6A 1XPXA 1JKPC 4IRHA 4ZDOA 3N97A 1WHGA 3M0UA 5CIUA 4QPQA 4I09A 5M3FJ 2IS1A 3CCVI 1J9IA 3ZMZA 3CDLA 1JJCA 3DKMA 2Q2EB 2V79A 1O3TA 4A4FA 1SERA 4RGRA 2K3YA 3HP9A 3S2DJ 1BR4A 1I5LA 4OMQA 3VUBA 4LDUA 4UHTA 1R8OB 3H3UA 2CU7A 4O2DA 1UHFA 3DTKA 2HKOA 4RTWA 3G7ZA 2VBZA 5C6SA 2IA0A 1Z05A 5IP9J 4YP0A 2LJ1A 2X4YA 2WACA 4HZFA 1M90R 2WV0A 2KAFA 4A3DJ 2AZSA 4WJ3M 2XB5A 3CCUI 2VXFA 1X6BA 5BS6A 3HRTA 2CS3A 2LY9A 4JZ3A 5D5XB 3OYAA 2OD5A 1S1NA 2DQRA 2H27A 4Q6GA 2K5IA 3HFOA 2E36A 4Y92A 3HDDA 3VDXA 2QSFX 1JJ2A 2QA4A 2KROA 3QJYA 1U6GA 4PJMA 2MWPA 1O7FA 2YX7A 1YHQT 1SRYA 2ZXHA 3ZN0A 1YW8A 4DA4A 3CC4A 1YJWA 2WAQA 2Y9YA 4IOCF 1V1CA 1TNTA 2E35A 1X43A 3JRZA 3TSZA 2ZTGA 1X55A 5A0LA 3EFSA 2A7YA 1JQQA 2HGCA 3RYRA 1K9MR 1YTYA 2EPFA 3M54A 4N0AC 1FZPB 3PGGA 2AT1B 4C5EA 5ED4A 1ON2A 1UAAA 4ENNA 3CBMA 5ILVA 4PJOC 3M57A 2Y4YA 3GFIA 3CCVQ 4OOIA 4M7DF 4OU0A 2LFBA 4VUBA 2GQIA 2RQTA 5IHNA 2DL8A 2CJBA 2M45A 3PNWC 5E3MA 2P0QA 2R7OA 2DQ0A 4DBQA 1OZ2A 3JV3A 2WSEE 2JRMA 1ETKA 1OQYA 4XLCA 2E71A 2VQLA 5AIPA 1GRIA 4N0AA 3Q0WA 3LL7A 2IPOB 2ZSHB 3DLLA 1HKTA 3HL2A 4OIOF 3L2ZA 3KPHA 2LCSA 4PJOA 3CPWA 3O6BB 2K57A 3FXOA 2KMTA 4G7OF 2L7KA 1FXXA 3SFIA 3G71A 4IUQA 2OAZA 4LD5A 3E6DA 3VS7A 2JPBA 5DCMA 3H36A 2UUZA 3AFHA 2DETA 2ZNIA 2EV0A 4PFOA 3UR3C 5J3BA 3GZ6A 3CPFA 1V76A 1P4AA 4RB0A 3FWEA 1XMKA 4Q47A 4J9HA 2DOAA 5BMZA 4IEJA 5KCOA 2EH3A 5GAMf 1ZN2A 3CEYA 2HCKA 1LFUP 5FWBA 2L7MP 2AKLA 2FNPA 2VJ4A 4TQFA 4JS5A 2FX0A 4UV8A 4C0FA 2V4JC 3KP3A 2PU9B 1VQPT 1K78A 3GVAA 1G5IA 1LYLA 1VQ7I 1QWEA 2DCEA 5C3EJ 5J1YA 2K7AA 4Q4ZF 2V9KA 4TVRA 4HEA2 2XIDA 3ML6A 4C92D 3HXWA 3UKGA 5GAMg 2O88A 1HSTA 4HQEA 3R4KA 3SWNB 4CZZA 5GAMd 2XAHA 2HPIA 4LDWA 2FNAA 5J3LA 2WAFA 5D5WB 4OIRF 2R7RA 3CJRB 1RI0A 1FX7A 2RQUA 1SSHA 3JTHA 3BC8A 3ZQIA 2PN6A 1I0CA 1J0RA 2WBMA 4P55A 5K7FA 5IOZA 2E12A 1S72A 4XLEA 5C4JJ 1OYYA 3VS0A 1X1CA 1YIJQ 3W2AA 1Q1VA 3VYUB 2EVRA 2FA5A 1RAGB 1H4QA 1YFSA 3H1CA 3I56Q 4HCCA 2QENA 3PM1A 3RMQA 4GBQA 1Q82U 1I6XA 3LYIA 1KSWA 2LNVA 2GBYA 3L42A 2J3LA 1J7KA 4AU7A 1P4XA 1K4SA 3I35A 1W4MA 2RJFA 4XKCA 1BW6A 1RPWA 3CCLA 2LP0A 4PNOA 2VBWA 5JI6A 4BL0B 4LD6A 4P3OA 1QU3A 1MBJA 4Y7NJ 3I4NJ 2HBWA 3H92A 2EK5A 4PGHA 4C2TA 1K83J 4XTUA 2ZT5A 2ZZFA 4IO9F 1D3BA 4J9EA 2OCCH 4M3DA 2DK8A 4DYCA 2E5AA 1D3YA 2QHUA 3BTLA 2IPQX 4PL6A 4XM3A 4MTEA 3SJMA 4C92E 4HV5A 3PMIA 2YRCA 2EJGA 2TDXA 4FT4A 4M7AD 2NAZA 1IV6A 2O31A 1GT0C 5CCAA 1F4KA 3ONQA 3CCQQ 2JPCA 1YX5A 2GWRA 4I76A 1K78B 3LSHA 1YNZA 2HTJA 2BZTA 2A6EF 3LQRA 4Y91A 2K9MA 1H3HA 5DUIA 3HTZA 1YB3A 5IT9E 1Z77A 4GCVA 1C6VX 4HBLA 2CUFA 5K7ZA 4XU0A 1ADJA 5E1WA 2XGTA 3CCYA 4DOZA 3C4SA 5CKBA 4YRCA 2D8JA 1VQ9T 4M78D 1V29B 1FBUA 1DU0A 1YI2A 4Q15A 4HSTA 4BWAA 4BI3A 3HOWJ 3TDUC 3OYNA 2G4CA 5CVRA 3CDIA 4AM3A 1ZX6A 4ZH4F 5KYYB 4RTUA 1BCMA 3L2QA 1U5TB 5F1JA 3WE2A 1Z7NA 1X3UA 4RDUA 4PKCC 1SETA 3OYCA 2JSPA 3H5RA 1PKSA 1G5VA 1X27A 5EZHA 2R92J 1J5YA 4KICA 4A3CJ 4FISA 1XSXA 1UB4A 5LHHA 3A1YA 3P5JA 2O4XA 2PMZA 2B86A 4M7AE 2EQJA 4OMFB 2C0OA 1BKBA 3K69A 4XU2A 1K6YA 1ZH5A 2EILH 2E65A 2HEQA 2GM4A 3OYHA 1R22A 1AA7A 4CS3A 2YRDA 1B9MA 5GADJ 1NYRA 3A5ZB 2H1LA 4ZYGA 1C0WA 2AHQA 2JVVA 3LNQA 3GTGJ 3GUDA 2V9PA 2MI6A 2X9DA 1X2HA 3A03A 2KRCA 3A7AA 3K10A 3GTLJ 1QQIA 4M6YA 2W82A 1WJRA 2EA2A 4YIFA 3CCEI 2ECZA 1RNLA 4RB2C 2DM1A 2V26A 2VL8A 1VQ6T 1G2BA 3E5UA 3BZ6A 1GHCA 4M78E 2DAQA 5J4VA 2L4AA 4HW0A 2K2VA 4PDKA 3GFJA 3HL8A 1BC8C 1O9SA 3ASOH 3JCMW 3M53A 2VASA 1SHFA 3ULRB 4YCWA 2KK4A 3P8BB 4IHSA 2JA6J 1ZA2B 1N75A 1HSJA 3F21A 4KNYA 3KLOA 4B9XA 4JRPA 3DBHB 2VOPA 1MV3A 6PAXA 3VYGA 2DK5A 3TEGA 2OTLA 1D0XA 3I64A 3M4OJ 4N4NB 1TWFJ 3I0TA 1YE9A 4J7IA 2DFUA 1T39A 2DAOA 2HVRA 4BQAA 3GXOA 2DE0X 1TL8A 3QYGB 2IW5A 1J09A 3EG0A 3WU2C 1U9OA 1OYWA 1XGSA 4S0HB 4P74C 2CQ7A 3CP8A 5I2MA 4YRFA 1HCRA 2HFHA 2JUGA 3BY7A 1ZQ1A 4C92F 3LSPA 2P6TA 3KEYA 1IJWC 4Q5SF 2HQHA 4MEYF 4TVAA 3LA2A 4MFEA 1KQ1A 2EIFA 3D5RC 4KN4X 2WSFE 1TNSA 3ASNH 2FUG2 3S2WA 2AXTC 3P9IA 4HF1A 3FBNB 2CP5A 1RC9A 5A0GA 1VQMT 5M9OA 3QO7A 1SRLA 2BVLA 1VQPA 2O4XB 2ZCEA 1TU0B 4C30A 1FOWA 2V1NA 4P74A 4YREA 4OB1B 1OLTA 4X6AJ 2DFIA 1XGNA 1M4ZA 2VQGA 3TVTA 3WGHA 2R5YA 3T1BA 2KRHA 4UXNA 1U0JA 4AYBA 3FDRA 3A32A 3CBPA 3QAHA 2V1XA 3NEUA 1I39A 2ISZA 4AC0A 2LKXA 4GO1A 1RESA 2FF4A 1FBSA 2ZZGA 4C0GA 1NJIC 4D0PA 2IVWA 1RI9A 4BY1J 2EFNA 2X1EA 4J8OA 1DDNA 1ZHIA 2CO5A 2MGQA 4L9JA 4L5IA 1S5LC 2DDBA 4LNSA 1TTYA 5EGOA 1O7LA 2A69F 5E3NA 3CC2T 4JJNK 5BOXA 4Z8AA 3DQVC 5FU6B 1SG5A 4BJ6C 3KP7A 2HDDA 1M1KC 2ZFWA 1S9HA 4IRGA 4M7AF 4HWRA 5DEQA 4OP0A 4IX7A 1T0HA 4HYEA 5ECAA 3CXCS 4U0YA 4ZYAA 2DL5A 3CMAT 2CP0A 1WGSA 2P5LC 2WTEA 2LVMA 2EJRA 2F2WA 5M5YJ 5GAOq 4UNOA 1OYXA 1LJ9A 3FXUA 3H0HA 4E7HA 4G9YA 3IL2A 1Y6IA 3I9V2 2GQQA 4BE0A 4EM1A 4C2MJ 4HVVA 1YJNI 2CV2A 3BT9A 1K79A 1ULYA 2KXCA 4XL9A 3DB3A 1G5HA 3MEXA 2L3PA 2QVOA 1QKXA 4BI4A 1B34B 4DBFA 2JK3A 2OF7A 2JUCA 2KRMA 1HDPA 4XOTA 4M78F 3RF1A 5GANf 3VWBA 2RNAA 3JB9G 1JHFA 1W1FA 1W7PA 1VQLT 3MF2A 3HOUJ 4AIHA 3MO8A 2D45A 3VJPA 3GTKJ 2EYXA 2NYXA 4M75C 3PIOF 2R7FA 3UA6A 1XMXA 5IP7J 3CLQA 2EW3A 1YJ9T 5EC7A 2FRHA 4NC6A 1USYC 1YFTA 2R5YB 2FVUA 1IZ1A 2XDVA 2IA2A 2DA3A 4LLNA 4A3BJ 1WHKA 5FLXE 5CKDA 5FGMA 2XGCA 3SHFA 2ZPGB 3ASKA 4PJLA 2DU9A 1YYVA 5GANd 1HD3A 4GYGA 4OAZA 4HCKA 5GAMj 1LEAA 3OYEA 3TO7A 5LFAA 1TWBA 2GZWA 4EDUA 1BBWA 3DSQA 1G3SA 1MD0A 2JN0A 1I3QJ 3X25B 2J6FA 1Q86C 5EGOB 1PKTA 5LJ3f 1EA3A 3EG9B 1PRLC 4L9NA 3QDRB 1YJNQ 2KIQA 2X51A 1QPMA 2V6EA 2DD4A 2FZGB 3G1ZA 5HNHA 4CCNA 3M55A 1ZLMA 4M71A 1HYOA 5IH2A 4O6JA 4C0ZA 4NL2A 2X4WA 3I55T 1AEYA 1VQKA 1QMCA 1QHGA 3CCST 2F5CA 2CQKA 2JS2A 3WQZA 5LJ3g 1JXMA 4JX6A 4PJ0C 1IUYA 2RJCA 2H09A 3L2VA 3I5UA 2Z3YA 5LJ3d 2E41A 4QLCU 1K0SA 3K4MA 4RDXA 1WYXA 4FU6A 2E70A 2DMQA 4Z02A 2DBMA 3H8ZA 1BBZA 1QGPA 4PJOE 4YIRX 3M0QA 1JRIA 3VODA 4FHTA 2HAXA 2D1HA 2A28A 1X1PA 4M72A 2M34A 2CT4A 4YRGA 2GOMA 5EG0A 3BR2A 3GIBA 3E9GA 2BE7D 1QP2A 2XIGA 4OB2B 3GFLA 1RIOH 4BGDA 2EZHA 2ZPBB 2MCNA 3H9JA 4OMYA 1I1SA 1K9AA 2I2LA 4EVIA 1NZ9A 2XDPA 4HVCA 1FYKA 2KE9A 1J3TA 1QF6A 2VB6A 2L02A 1RUNA 4D7MA 4L6V5 2JJ7A 1TTHB 4J7FA 4I0AA 1GGMA 2R7XA 5C51B 1I07A 2IY5A 2OI3A 1KC8R 3MMYB 2MG4A 1KQSA 3CCRT 5L23A 4WWCA 1EF4A 3HUGA 3TKYA 2M7AA 2K4YA 2IGNA 4FIBA 4X9DA 4CYCB 1IN8A 3GFMA 4EJUA 2E2JJ 1YIOA 2GTJA 1YS7A 3HXUA 3OOPA 3PFSA 2IGKA 4AD9A 1R1TA 3OSFA 4A53A 4YRQA 5JLXA 5GAN3 1Q81R 2CUDA 4B44A 4Y28E 2ECBA 4UY8I 1OCOH 1HC8A 2KLOA 2CQXA 2VYTA 2VC1A 4R8HA 2B63J 3ZPLA 1VQMA 4HWSA 2HXIA 3JCMf 4KT0E 4TQDA 4KH0B 4N9IA 4RAZA 2XGDA 5DDGA 3VSKA 4ZIBA 3MEWA 5L3GA 2RA2A 1HDDC 4I99C 3J81E 2OUMA 5E8GA 1W36D 1F43A 2HKQB 3A8HB 2BGCA 4PFZA 3OD1A 3DEUA 2PI0A 1N8RR 5GAN7 3KYDB 2PJPA 1C0AA 2QASA 2AHJB 3VQXA 2Y48A 2ICWG 1FOXA 1B8AA 2DX1A 4JJCA 1E1TA 3M4PA 3N5BB 3L00A 3JCMg 4IRIA 4C3JJ 2QSGX 1NYQA 3BG7A 2FE3A 3OIPA 4YRPA 2OJED 4H2VA 1PRMC 2ALYB 3ERRA 2ARUA 2FBHA 3UPUA 4JX5A 1H9GA 2OX7A 3CC2A 3W6KB 2E2HJ 3QPLA 1BR1A 2DLPA 1R00A 2M8GX 4KH1B 3GOXA 1UECA 3QO3A 5L3FA 2R57A 1TQIA 4X1VA 5LL6S 1UG0A 2L9VA 3CUQB 4EMKB 1SESA 3CMAA 5GAN6 4YRTA 5DM7F 1JKQC 4XRMA 3ZMTA 3BOQA 2VXEA 3BPVA 3LWFA 3TGNA 2D5VA 3ICAA 2EIMH 3C2BA 4L9TA 2PZ1A 1G83A 2E4HA 2P84A 3R07A 2ECCA 2DXTA 2TCTA 2IY5B 2HZTA 4P1WA 2ZJPF 3HFZA 3JR9A 4LITA 3QTCA 1WJBA 2DYSH 3K2AA 2OJ2A 1PUFA 4CC3A 4UP9A 4RMOA 3TOBA 3REBB 2PMEA 1X1DA 5GMKm 2M1BA 1U06A 2RNJA 3CCVT 3IKTA 3NPFA 2BVMA 2QWWA 1N6AA 2X4HA 2RF0A 3DPTA 3GWZA 1N9RA 1Z3YA 2COWA 4N0BA 1LEBA 2MWOA 4DW6A 4Y33A 1AWOA 2JTMA 4Z2YA 5IYDJ 2DI3A 1VF9A 2EA4A 2HKNA 3NFCA 1X6OA 5DM7R 3OIOA 3QIIA 3MF1A 1R77A 4CUGA 1FWZA 4J6XA 5JHUA 2ZT6A 4KUDK 3RZDJ 1GV5A 1RADB 2ZNYA 2QCOA 1D1CA 3OL4A 1ZAOA 5HDGA 1QZEA 2D2WA 2XPVA 3COAC 3FJPA 1WYDA 5LLQA 3FXKA 2HR3A 2LT4A 4PLLA 2R5ZA 3QU6A 4J9GA 4XLPF 3BDUA 3TW7A 5KAFC 4CS2A 1HLVA 1WHLA 1S3JA 2KL4A 4KGXB 2XSJC 5CAIA 1V54H 2CJJA 1XCVA 1NG6A 1YHQI 4M6XA 4ZZLA 2G9WA 4KQEA 4JDSA 1WQWA 3PO2J 3ZEHA 4E7KA 2J5OA 1R58A 1R1VA 3DKXA 3FX3A 3MZ8A 1PD1A 2W10A 2Y75A 2FSWA 3AG2H 5EDNA 1K7AA 1ZTRA 1UMQA 1I27A 3CCMQ 3QO5A 3ZOBA 5LJ5h 2PVOB 3MVPA 2R3SA 3SDBA 2W0ZA 2DODA 3M1CA 3GTQJ 5IXFA 3CJNA 3IQLA 3VQVA 4RLQA 4IUUA 1W2BS 4LDYA 3I55A 2VGNA 5GP9A 3HFZB 1UDLA 3TQ7P 3ZMVA 1DPUA 5FKNA 2R7QA 1IN7A 1MNEA 4FE4A 2ZC2A 3U2RA 3K70D 2KRFA 5L3CA 1B8IA 2RHQA 1T6SA 2L0KA 5FWCA 4F16A 4HDUA 4CXFA 4HX8A 3BZKA 2H8HA 3WU0A 4I0BA 1VQ8A 1VYVA 2KFDA 1AOJA 3ERMA 1YIJT 4KR2A 1ZA1B 2K4JA 3IHUA 1ZQ3P 2DNUA 4ORZA 4XBFA 5DV5A 2VODA 1ETQA 3ZQFA 3PIPA 4IHVA 4XTVA 1NYFA 3I56T 1QP3A 1XSVA 2IBDA 4P9UA 3M8FA 3L4GA 4F3QA 1M2VB 2SRCA 4AIKA 5GAOp 1QVGS 4EMSA 4RTXA 3ECOA 4PSWA 3CO6C 2ID6A 5DS9A 4LG0B 1H0MA 1RAEB 4P9FA 3FXMA 3JB9J 2BZYA 3NETA 5HK0A 4LN2A 4ZN3A 5ILSA 5A0DA 5EEAA 4JJBA 1WI9A 5GANj 5GTHC 4C3IJ 2R5ZB 2M16A 2V1DA 2VXZA 4FX4A 5ICFA 1HOMA 3QOPA 4Y15A 1K8AU 4XQFA 2E7XA 2QZ8A 4C3HJ 2J3MA 2KIMA 3CCQT 4M7DG 2JRTA 2DU7A 1TP4A 3DWLE 4LG3A 4A3FJ 3G4SA 1CF7A 1WH5A 3ZN1A 1IREB 3UH0A 1MGQA 2V1QA 2W7NA 4J9IA 1RR7A 4B1RA 4EQQA 2E7WA 4AG2C 3Q0UA 2H3EB 2LX9A 4DZJA 2ZB9A 2LDMA 3RMSA 3MWMA 2BUDA 2YHTA 2LH9A 2LQNA 1R49A 1E17A 1PM3A 5CVVA 3MEAA 5LJ5e 3AL0C 1ZK8A 1YOVB 1KZHA 2JVHA 2DTHA 2STTA 4OF1A 2CZ1B 2LTPA 2PMUA 5B3SH 3M5AA 3U1KA 3OIQA 2NUPA 2VGMA 5IHKA 2VKDA 1B8IB 4M77C 1K73C 3CF5F 5TGTA 1GXIE 1WX6A 2XC7A 3KIOA 1M5Q1 3C2HA 1ORKA 3A7RA 5LJ3j 1QVFP 3OMYA 5GAN4 1YCSB 3WTSC 2XDBA 4HDVA 1W0UA 3JB9D 2LG4A 4AFUC 1IV8A 3TDZC 3IH3A 4G6QA 5FKLA 1ZELA 1DPRA 1KQ0A 1BC7C 1FTTA 4ZGEB 4LOCA 1OCPA 4C5IA 4MTDA 3CMEI 5J26A 2QBYA 2UWMA 4FSSA 4E2FB 2GF7A 1T8IA 4M77A 2BHYA 3REUA 2XASA 2CH4W 2CH4A 2RQQA 1UZCA 1QQJA 3F9KA 3LA3A 3LQQA 4U7BA 2UZKA 1M8VA 3LAJA 2LR8A 1T0JA 2L3QA 3VB2A 4CO8A 4YRJA 3K0LA 4CICA 1BU1A 1LNXA 2QK0A 3H9GA 4AWXB 2JT4A 1ERDA 1R1UA 2HYJA 4IHXA 1YX3A 1B9NA 1SPKA 1IRXA 2VQHA 3GTOJ 3HY1A 1B72B 3FMRA 2HYGD 3UATA 1M8MA 3CCVA 2KI7A 2AQEA 2J6KA 2IAIA 1ARKA 5GJWB 4HV6A 1WZ2A 2XAQA 2JMCA 4KT5C 2DBKA 4A12A 2O6GE 4LLGF 1L3LA 2P4TA 3NELA 1XNIA 4J83A 3MKZA 4U7DA 2MSYA 3FXQA 1BA5A 1R5GA 1ACMB 2EFQA 2F5VA 1VQ9I 2AKKA 2D1XA 5KYXA 4IJAA 1LKXA 3J7AY 1K4US 2V7FA 5ICCA 3DPUA 1PJRA 1ENHA 2OPTA 2EIKH 1QVPA 3CCUA 2VUBA 1XGOA 3FM5A 3TEHA 2LC2A 1I1JA 3J80Z 3L2WA 1YWPA 1Y39A 2ZBKA 4S04A 2KY9A 2NUPB 3HSFA 4LB6B 3OYMA 4H2TA 4YRSA 3OMCA 1TOVA 3LSQA 2A3LA 3CMEQ 2O61A 3O3KA 2JZYA 3VSLA 2VE8A 5GMKe 4XKBA 4ZJZA 2ZPFB 2RN8A 4JLIA 3X26B 3MP8A 2FJ1A 2LRDA 1LE8A 2IS6A 4JRQA 2K2MA 4A3KJ 2E1CA 2JT1A 2CGHA 5I21A 3FXLA 3A1PA 3RBBB 2I8DA 3WTZA 1YITI 3KEOA 5A2QK 1Q82R 3WVEB 4YG2F 1YRNB 3MEUA 2EBPA 1KD1U 5IOYA 3VKIA 1MJ9A 3LSIA 4GY5A 4ESFA 1SD4A 3DEEA 1IO2A 3V7RA 1BIAA 5JFRA 2ED1A 4KRTA 1YO5C 2L2PA 1X1AA 1VQ6I 2FRYA 4G12A 4AIJA 4CHUA 1H4TA 3DU6A 2WB1N 4J9FA 1YCYA 2E1NA 4O3MA 4ELZC 3ZXSA 3RDVA 2DT6A 2Y4XA 12ASA 2H6BA 5HODA 2QM3A 1ZUKA 2M3AA 4L5JA 1OR7C 3CD6Q 4W1UA 2PJRA 2RJEA 2CW0F 5BPIA 3HM5A 2DPDA 2A36A 1XMAA 4OVAA 1T33A 1BIBA 3G1JA 5E20A 1Z9CA 1FLIA 4KYWA 1LOJA 2GA1A 2CZ0B 2L7ZA 2BE9B 5CVUA 5C0MA 4X0GA 3DF8A 2CJ9A 3LLRA 4OGCA 4A4EA 3K1MA 1UCRA 5F08A 1QHHD 2MMPA 1W5TA 1XN7A 4BQNA 2ZIOA 1EH8A 4A0XA 2Z16A 3QHSA 1OR7A 2DMOA 4ON0A 3JRBA 2Q8KA 2NS6A 1NJIR 4J9BA 1AT1B 1JUSA 3SB2A 1U1SA 4L0ZB 4JLGA 2EAYA 3BJOA 1VQ7A 1Z9ZA 4J01A 1B07A 5F0CA 1YITQ 1CKBA 2DJQA 5I2SA 3KXTA 1MBHA 1M1KR 4RLFA 1LVKA 5IPAA 3JCMh 5H20A 2EBIA 2A05A 5K1YA 5KK1A 2KISA 3JB9F 1G8XA 2HNHA 4BY6B 3EFRA 3DB4A 1EVKA 3PQKA 1IN4A 3RKXA 5GPAA 1H3ZA 3GO5A 2NWMA 2STWA 4LUEA 2F4OB 3EUKL 4E6KG 4F14A 2HYFA 2X0LA 1ABQA 2HZYA 4BJTA 4N4GA 3EG1A 1HW2A 1CSKA 3JAMK 2A8EA 1JJ2P 1N5ZA 4MZTA 1PYVA 2R7UA 3VYRB 3OWTA 1RR8C 2DT5A 4JPBW 4H02A 1X2MA 1EH6A 4CC4B 1GUUA 1WXTA 1MBEA 3CCJI 4C92G 1O57A 4JZ4A 2YUNA 3V7SA 3M4YA 1M9SA 2PVDB 2Y31A 2XGXA 1KFZA 2QA4Q 3A2KA 3EHQA 4H2WA 1PD0A 5GMKi 4HG2A 2Q5HA 2E3IA 3DP7A 3GW2A 3ABLH 1TT5B 1YJNT 4I01A 1YJWQ 2LC4A 1U3EM 2LF8A 3I5RA 1LDDA 4MZPA 3F23A 3WU1B 4WI1A 2QQSA 2ZR2A 4H2YA 3RPUD 2IGOA 2JA2A 3HRSA 1QCNA 4JS4A 1TSFA 1UGSB 1NJ6A 5CLSA 5HK3A 3TUPA 3K4LA 1XC5A 2KP6A 4PK4A 4J19A 2DA1A 2R7DA 1KQSS 1OZ3A 2K3XA 2XHKA 5KHDA 1VQLI 2EPDA 4XORA 4HA8A 3VS2A 2E3HA 1WRJA 1KC8U 1Y57A 2XICA 1EFNA 2EYZA 1Q86R 6AT1B 2JW4A 1D5YA 1SSFA 3KP4A 4EATA 3CPWP 2QXFA 1XQHA 3KFVA 5HLGA 2DILA 2R93J 2CMPA 2KYBA 1Z67A 2E5QA 3E6MA 4EJOA 1YJ9I 4WJ4A 2RQVA 1MUZA 1UFFA 1F1ZA 4QWQA 1UB9A 3JB9H 2K5FA 2O2OA 3PNTA 5BQTA 2KGTA 4M7AG 1I5ZA 1X58A 3E6BA 3RGLA 1SMYF 3I7FA 1EQRA 2A6HF 3W3SA 4FSXA 2C7IA 2HXOA 3C18A 1JUPA 4E51A 1ETYA 3CCJQ 3G71Q 2QEXI 1IRGA 1WJ5A 1EIFA 3HGYA 1SRMA 1OULA 2LSOA 2DIGA 1Q7YC 2AKWA 1SFKA 2XDDA 2UXXA 5ELNA 1WIEA 2JMWA 4XN3A 1WI7A 2BTTA 1IN6A 2CIMA 2I4OA 2COBA 2BE5F 2WAEA 2M9UA 3CJQB 2VN2A 4ENKA 2GXGA 4M78G 4P96A 3I53A 2YT6A 1B70A 1O75A 1PYSB 1ZREA 2OC6A 4UVBA 2FPFA 1I81A 4WTOB 3QWLA 3WGIA 3CC7I 2L9NA 2EWNA 2KHMA 3QYEA 2RHXA 4RTTA 1FT9A 3EYIA 1EVLA 3ULQB 3CCSI 1Y96B 4MQVA 3BPXA 2GIVA 3CCEA 1Y8RB 3PZCA 4QQDA 3X2QH 3CXCA 3H0DA 3REXA 2K9QA 3NQOA 4EGZA 4A3MJ 4A69C 1U3OA 5AONA 4FM4B 2EYYA 3WTWC 1NJ8A 4LB5A 1Q1HA 2X6OA 5IYCJ 1SVLA 3BDLA 2ADUA 4P5NA 1S72Q 4J9CA 2VV5A 4OAYA 2VBXA 2GOXB 2ZPEB 1EIYA 2O9VA 3KBGA 3X20B 2QGGA 3F6VA 5FKKA 4NOYA 4M7DD 1ZSZB 1X54A 3B73A 2QEXQ 1RRJA 5FLMJ 5J4YA 2HSPA 2COZA 1MH4A 2E3CA 1MHNA 2QAZA 1WJSA 2KT1A 1J5WA 1WU7A 4MFDA 3CCRI 1O3QA 2LQKA 3ZQCA 3T8RA 4FT8A 3ISPA 4QW2A 3H6ZA 2F5KA 2MA3A 3WTYC 2K5LA 2H1KA 5K5OA 1WLEA 1N25A 1JI8A 1A5JA 2K7LA 1LVAA 2F69A 3A0HC 5IAYA 3BR1A 5EEGA 2QSHX 1M90C 1AU7A 2DMTA 3CC7Q 1PUEE 3L2RA 2ODRD 1ZLJA 2Q0OA 4C8QC 3PVLA 2NNYA 4Z6YA 4BHPA 2FOWA 5L3EA 4BB7A 3S3OA 3F6OA 2GFUA 4G7ZF 2Y0MA 4HVWA 3BW1A 3S8PA 1QO0D 1U2WA 1KU9A 2DOEA 3REAB 2J7IA 2BW3A 5AIQA 2IT0A 3PVQA 1P9QC 2C6YA 2ZIMA 1I3AA 2EQMA 2VT2A 1U8BA 2NS8A 1Z6TA 1STZA 1YW9A 1YGBA 2LF7A 2CSIA 2JA7J 4LE9A 3A8OB 4BAYA 2V1RA 4RM3A 3ABTA 4C8QA 1WGXA 4KR3A 2DKGA 4PJNA 3BG5A 5B1BH 1K9MC 2ZMEC 5EJCA 1YI2Q 2RK2A 1JHHA 3ERED 3P8VA 1XCBA 4OGEA 3F8FA 3F8CA 2ME0A 2Y9ZA 1IHWA 4WCGA 4Q5WA 4OIPF 3F22A 4HWOA 2PFBA 1BCOA 1Z6RA 5CVIA 1R4MB 3MAJA 4GLMA 2F5DA 3SXYA 3RKQA 1OKRA 4U0VA 3RIRA 1LDJA 4X5OA 3HTUA 3M0TA 5IY5H 3OYLA 2ZMEA 1OV3A 1ZUYA 3HRMA 4G94A 4CH7A 2RQPA 3ZFJA 1HC7A 2EQRA 1YJNA 1LUJB 1WXBA 1FYFA 3OYYA 2KXDA 3CCMT 2CQQA 1KQ2A 2VJIA 1VI0A 3TU4K 1K4TA 1SVMA 2DJZA 1QE0A 3GBGA 3QUIA 2P4WA 2YS9A 4FYYB 3A4CA 4L5EA 2MW8A 4BNCA 2A61A 1HSQA 4BD3A 2KYMA 3PIPF 5HGQA 3JCMP 2DPPB 1NG2A 2YU3A 3KUFA 5IT9K 4P3NA 2M9HA 5ICEA 3JSOA 3MHXA 1XOVA 1I1GA 1IL2A 1S7EA 2BY3A 4LIUA 4HF2A 3PO3J 2CSOA 3M1EA 1F9NA 3C95A 3JCMQ 3AKZA 4YPFA 2XK0A 1UJ0A 7AT1B 2MYSA 4EGYA 2KNBB 2CKKA 3JRAA 4B47A 2NLUA 2PVGB 2DXIA 3LSTA 1LJOA 4OMZA 1RUOA 4V19K 2OTLQ 3NMZC 3RI4A 4ZN1A 3M0PA 4BEHA 2L9SA 3B02A 2XU8A 4IKFA 3GZNB 3S32A 5CKFA 1W1WE 2ESHA 2RM4A 1DQUA 3M3YJ 3GNGA 1FYLA 3BY6A 2MLGA 4NQWA 2ZZDA 1QVTA 5FLVA 1V5GA 1VA7A 2ODRC 1KMMA 4NL3A 1D8KA 4B3XA 3UDCA 3LSSA 5J1RA 4BUGA 2IG0A 3EGXB 4BJ5C 1MSEC 2P5VA 5JHFA 1RLQC 3OYGA 5H2FC 2FZKB 2AS5F 2KPMA 2XRLA 1TBXA 3H0FA 4E7LA 3DPLC 3TOAA 1W5SA 2WB1A 4H2XB 4PJOG 1MJBA 2HZDA 1JT6A 4R1HA 1FIPA 1TWAJ 4LJZF 3T9NA 4A0YA 3QNEA 2YXYA 2ZMEB 5CJ9A 3KLNA 3S17J 3QG1A 1JGSA 2MC3A 3VPRA 1OX8A 1ZLKA 3OSGA 1X19A 3W6JB 2Z0WA 3M4GA 3PQJA 3S15J 4RMNA 2L8DA 4TWAA 1W6XA 3PSFA 5HOOA 2CP3A 2RQRA 4KN7X 1YG2A 5GAN8 4ESBA 1C0MA 3GNFB 4C0DB 2K9LA 2LYCA 3ZMSA 1N27A 2XROA 2YUPA 1FMVA 2PUKB 1A0NB 4D1QA 2LJ0A 2DA4A 1H641 1C1AA 2GCXA 5TJJA 2DO3A 1Q95G 3NRVA 1JJCB 4YRRA 3SDZA 4FX0A 1YIJI 1JUMA 1MJAA 4HWTA 1GLNA 2V9VA 4K86A 3I56I 3HXLA 2CH0A 3W3CA 1R71A 4BBRJ 2M0YA 2DJIA 3JB9I 4LDXA 2KSSA 2C06A 4MIMA 4IUVA 4NUBA 5LBQA 3FK7A 2OZUA 1MV0B 3FZVA 3ZBDA 5KAIC 3OY9A 3H3VK 4BEHB 5M5WJ 4V2FA 1X2QA 2CUEA 1V3FA 1GFCA 1I4K1 5KH6A 4AFZC 5I22A 3VUZA 4BQOA 2HOEA 2PMFA 1OU9A 3ZQLA 4XAXB 2UXNA 1ZYRF 2NVYJ 2DL7A 1D1AA 1G6NA 2L9RA 2EFPA 1UHSA 3M4QA 3DLAA 4F7ZA 2M0OA 1K73R 2JTVA 3CCQI 4AH6A 1VFCA 1WJQA 3RDIA 1D8JA 3E9IA 1F1BB 5KYWA 4M3BA 4KISA 4F7UA 1WFWA 2W1OA 4HX4A 4V2GA 2EKHA 4P75C 4KFCA 4CS4A 4TVWA 2VKEA 1SAXA 2COYA 4FCYA 2X4JA 3JRFA 1EKEA 1Y0UA 3VYTB 3BQZA 2RAEA 1U78A 1G3TA 1QNTA 2EQIA 2BIVA 3MP1A 1RKWA 4JOMA 1BJZA 1XDUA 2H94A 3WE3A 1KK7A 3MN2A 1IDYA 2Y0SN 2CG4A 1IGNA 1QA6A 4LD9K 2O01E 4RMFA 5GANe 4J6YA 4OB3B 2ED0A 1DGRM 3WHBA 3GBQA 1P7JA 5IYBJ 4KIGA 1X2GA 2BZXA 1AZGB 1G3WA 2ZXWH 4PJOB 2P8TA 3CMET 2LQWA 1W2BA 5CKEA 3E0JB 4EO4A 3NWTA 2DD5A 4PUSA 4ASNA 1IG7A 5DCMB 1M1EB 3QJ6A 3E5QA 4YRLA 3WTXC 4M3GA 3P8YA 5FRNA 2FU4A 2DEQA 3BJUA 3ABUA 1RIQA 3BDDA 2WA0A 1ZG1A 2KJCA 5B66C 4FYXB 2P0LA 3M58A 2JJ9A 2FL7A 1MMNA 1G59A 1VQKQ 2EGEA 2CP6A 4CCLA 4E7ZA 4X9CA 2VE9A 4DZPA 2VKHA 4GDFA 3D7SB 3A74A 1W5CC 4UP8A 1ZBXA 5BPDA 1H4VB 1QVGA 2FRWA 1B76A 2VPRA 3QO8A 2E1OA 1AWCA 2QTVA 3ZQQA 2XTIA 3E7LA 4YRMA 4YRVA 2D8HA 1MMDA 1NLOC 2P0PA 3HHTB 2FBKA 3MKLA 1E7OA 5IHIA 5FLXK 4F7UB 1R4NB 2XB0X 2LNHB 2RC4A 1K8AR 2RN7A 1HTTA 3MPUB 1NJIU 5H6QA 3JSPA 1XDSA 3CD6T 2GGRA 2LY2A 2FBIA 1ABOA 4DYQA 3HPHA 4RKUE 3EHRA 5DM6F 3JCUC 4OIQF 1KQSP 2IGMA 4E6RA 2EV5A 3KYLA 2LMJA 1I8FA 1T95A 4OMOA 2XAUA 4HNUA 3LSJA 1M1KU 4YROA 3SEMA 2HSEB 5F0FA 4II2A 5FRMA 3HXZA 3EUHC 3FF5A 3ME9A 3VV0A 3H0IA 2ZT8A 4Y13A 1YHQA 4C92C 2SEMA 2QQBA 1PHTA 3ABKH 2J6OA 3EH1A 3QZ9B 1BM9A 2DA9A 4XTXA 2ZNJA 3IKLA 4CI0C 3M07A 5LJ5f 4C9YA 2CGPA 1BJAA 4EM2A 5LRSA 1QCFA 4BKXA 1ZSGA 11ASA 1KQ9A 1E3OC 4J5YA 1YITT 2VBYA 2CS7A 4GLKA 1VOMA 1IDZA 1WA7A 2L0AA 2ZCWA 2Q5IA 4BUPA 1X2NA 1ZRFA 1D3BB 4WCIA 5E1XA 1UTIA 3EUHA 1OPLA 5FFZA 1BI0A 4C92A 4XTYA 4YELA 4FW1A 3EGDA 1ZUUA 3BTJA 1CQTA 3OYJA 4W97A 4RG2A 3DCFA 1NG7A 3TBIA 5LJ5g 3EQLF 1M3AA 4ZZDA 2JTFA 2RHSA 1USSA 1EH7A 1JBMA 5LJ5d 3PE0A 2E1MC 2P7VB 1QVUA 3KCCA 4UC4A 4RM2A 5HCKA 3PT9A 3QDFA 5FB2A 3KZZA 2KEAA 1M3BA 3LSRA 2ARTA 1P4WA 4RTVA 2O9SA 3D5LA 2DJNA 3VU3C 3S1NJ 2QA4T 1WJAA 3HGGA 3BE3A 3O5ZA 2X6YA 3GTJJ 5EZGA 3F8BA 4K2EA 4XR6A 1TXQA 2O9LA 3OBWA 3NTIA 4M7AC 1NYGA 3HBLA 3VRZA 2KT8A 3U23A 3WG7H 1WLPB 5CQXA 2DZCA 3JREA 1YJWT 1Q86U 1OCTC 2JMAA 2E1HA 4H0EA 3OS0A 4ENMA 4M6VA 1Z9QA 1WQ7A 1E0EA 3OS2A 4EPCA 2LX7A 3HOTA 4YRKA 4O5VA 3Q9VA 2ROLA 4M74A 1VQNI 3LH5A 5HS8A 4XRSG 1R7JA 2OTJI 4M7AA 3BR0A 5D6XA 2LMDA 1DP7P 3L9FA 2KIFA 5GAOl 3J81K 1X1BA 1ITYA 2MK5A 4OINF 4M78C 2F5FA 4IHTA 3NENA 4NBQA 1FBQA 2HL3A 1TZLA 4HQMA 1FYMA 4IVNA 1WKMA 3HXYA 1N9SA 1NTCA 4C8QE 5DD4A 3OYIA 2XHCA 1OX9A 1YW7A 2ZXFA 4HOBA 4DEXA 1Y0MA 1TWHJ 2K3FA 5FFXA 3NHNA 2YUSA 4N4HA 4YDQA 4UUSA 2BBYA 4RAGA 4M78A 3CCJT 3G71T 2R7WA 2E5NA 3IC7A 1KD1R 3V8LA 2KKOA 3D0SA 1O4XA 1NEGA 1AWXA 3IAM2 3PIOA 2QF7A 2LREA 3UNGC 4PZJA 3L09A 4DQ2A 2Z33A 1SANA 2DLLA 4X34A 3LGFA 2XI9A 3CMEA 4Z89A 4TVYA 2FG0A 1A36A 4UVAA 3J80E 1BN5A 1ZBJA 2YSQA 1GCQC 1R0BG 1WWXA 4C5GA 2LTOA 2AMCA 2G0EA 3LAPA 2CSQA 2DYBA 1X2KA 2OAWA 3QP6A 4DYRA 2R7SA 1YQAA 3PUFA 2F2VA 2RHYA 4K88A 1AWWA 1SC7A 4OB0B 2DF6A 3DV8A 4LIVA 1VQNQ 4HKEA 4ESRA 1IXCA 4NHJA 2YLBA 4TVAB 4BBSJ 4XEOA 2OTJQ 3EUAA 2C0IA 3E5XA 2Q2EA 3BTIA 3S6WA 4D9JA 2MH2A 1QKWA 3RACA 2HOSA 2BZ8A 4XRFA 3HRIA 1BOBA 3R60A 1WHUA 4IL6C 1QW1A 5FJ8J 4ANJA 4NCXA 3X28B 1GCQA 4C5HA 5HKCA 1IZ6A 4FTHA 1XS9A 5GMKl 4G6TB 5F04A 2VKNA 2DPUA 2Z5UA 3Q5FA 5EG2A 2GTOA 2L89A 1VQ8Q 3L2UA 1B1BA 5FD5A 1S72T 2DTIA 4CRIA 4BDYA 1IRZA 4QQ6A 1ETWA 4QTRA 4MO7A 5L8RE 2RGVA 4PJOD 1Q81C 1VQ9A 1GXQA 2HNIA 1ASZA 4M9ZA 3V7CA 2QUFA 1KGSA 2K86A 2QEXT 3H5NA 3LA7A 4M75A 1OYIA 5D6EA 4JUVA 1UG1A 2ARSA 2NUZA 3OB9A 2OA4A 1JGGA 2R5MA 5D7UA 4DJAA 4JRKA 3URGA 1E3PA 1USYA 2YRVA 3OS5A 4FL6A 2XF7A 4PCQA 1X69A 2FXAA 4FE7A 4CC7A 3ZGKA 1N8RC 2XF6A 3C7JA 2RHZA 1X4OA 2X3WD 3MD2A 4NC7A 2FQ4A 1VQ5I 2X3XD 3QOEA 4RA2A 3KETA 5E3IA 1FNNA 2QQAA 3GTMJ 3MKWB 2EINH 4RGUA 3HYIA 4ZYDA 3M56A 3CC7T 4FT2A 2F2EA 2RJDA 4BYYA 1MBGA 3GP8A 2DMNA 4C8QF 1YITA 1EJ9A 4D5CA 1AKHA 3LX7A 2AMCB 2HVQA 3PMTA 1IHVA 3G4SQ 2R0QC 3DU5A 2DXUA 5DTDA 1RZ4A 2ZKZA 1TG0A