3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
1HK9A 4MTEA 3WE2A 3U2RA 2VT2A 1FBUA 4U88A 3KCCA 2OZ6A 4PJOC 2YLBA 5HS7A 5K5QA 4YRJA 3F6OA 3KLOA 4KUMA 4JRKA 1IXRC 4AIKA 3J80Z 4M7DB 3K69A 1IUYA 4Z2YA 4OIQF 2VBZA 4EMSA 1F1ZA 2P7VB 3BW1A 2AXLA 3L7WA 4XU0A 3LSQA 3QUIA 2Q0OA 1LQ1A 1H4QA 3V8JA 3TOBA 4NB5A 3M7GA 1Y96B 3LA2A 1ZRFA 5JR3A 1WU7A 5D5VB 1SESA 2L01A 1I1GA 5LEKA 4NHJA 1P4WA 2Q2EA 3CTAA 4CH6A 3BZ6A 4M7AB 2ISYA 1D8KA 5D4RA 3EYIA 5TJJA 5CVIA 2XHKA 2COMA 3SWNA 4R8HA 3OOPA 4H2SA 1S3JA 4TWAA 1MGQA 2NS0A 3LQRA 5FD6A 2YSRA 3GZ5A 4EJTA 4M7DE 2WC2A 2DPUA 4YRQA 2DU5A 2QENA 2QHVA 2MLKA 3AAFA 2M5WA 3SZPA 4Q48A 3KP7A 5ICGA 1B70B 4HOBA 2PJPA 3DV8A 3LA7A 2P6TA 2E64A 4PJOE 1NHAA 1B34B 4QLCU 4KN4X 5GAOp 2CFXA 4WXHA 4C8QA 1JJCB 3JB9D 4GYGA 4BHBA 3DXJF 1J75A 3PCOA 5GAOn 3PCOB 4A2UA 2VONA 2VXEA 4M7AE 4EM2A 4RGUA 1IN4A 1N9RA 2M45A 1O3RA 3HTSB 2F5DA 3KLNA 3RIRA 4HWOA 4FHTA 2DW4A 3SB2A 4HWRA 1RI7A 3F72A 5GAN3 3WTSC 4LJZF 3V7SA 2DQ0A 1XCVA 1K79A 4EJWA 2ZMEB 4M77A 4XTWA 2CQKA 2DTOA 4QVCA 3UGTA 4PJOD 4YRIA 4TVAB 4G85A 4CH4A 4P3OA 4EM0B 1WPYA 4F7UG 3JCMd 3V7CA 3ZP5A 3U1DA 1Z9CA 4I0AA 4XTUA 1G51A 2HR3A 4WJ3M 2G9WA 1IN8A 4RCCA 4G8XA 4C92F 3DQVC 1GVJA 4F7ZA 2E1CA 3GFIA 4PZJA 2PEXA 1QO0D 3A31A 2RC4A 4PG3A 4M7DC 2EFPA 3PQKA 2L54A 3BJAA 2I4LA 2XAFA 2HQNA 1NJ2A 2FMLA 3L1AA 1T2KA 3A7AA 5IT9Z 2P7CB 4EMKC 4EMHA 5H20A 2STWA 4DPGA 1B7YA 5GANe 5AIQA 1LJOA 2P5IA 1BI1A 3E3VA 1K78A 3E6DA 4KN7X 1LNXA 2D45A 4XU3A 3HTZA 4CH3A 1KGSA 4EX5A 4BXUA 5GAMh 5H6QA 2DTHA 3QU3A 4ZTZB 5DY9A 3HSBA 2ZZEA 4XTYA 4ZYHA 4WXCA 1G3TA 3NQOA 1VTNC 4NCXA 4D0PA 1XMAA 1TW2A 3FXRA 2ZMEA 1REPC 1WYDA 2C8MA 3VQYA 4O2DA 5ED4A 2FBKA 3JCMg 5C51B 4GGGA 2D2WA 4LK1F 3ISPA 1XCBA 2IT0A 3QSUA 1SMYF 2QHUA 2ZXFA 4K2EA 3UH0A 1XGOA 1HSJA 1B59A 3TO7A 3BY6A 5D5XB 2RVCA 3KP2A 4YREA 4JRIA 5GAMj 3WTZA 4Q5SF 1L0WA 5LEJA 1NJ8A 3ML6A 1Z6TA 2HS5A 2VODA 2ZCWA 5ICCA 3JCMV 1FWZA 4M6XA 1MDMA 4YROA 5HLIA 5GAMg 4RB1A 2DQ3A 2DLLA 4TTVA 1LB2A 2EJGA 3K2ZA 4YRLA 4A0XA 4UP8A 4ZYDA 1RNLA 5LJ3f 4PCQA 1ZG1A 3MQ0A 1G6NA 4C92C 2DI3A 5LJ3j 1MKMA 1T38A 1R7JA 3L4GB 2UXXA 2DU9A 4YG2F 1TW3A 4XBFA 4P75C 4M75D 1B34A 3ZMZA 11ASA 1R1TA 5GAMe 5GAN8 3KEOA 3I59B 2QQBA 5FB2A 4PJOG 1XB4A 1BOAA 3L00A 2J3LA 5F1RA 2EK5A 3NENA 2A61A 2NNYA 5LJ5j 4ETSA 2VC0A 3F8CA 3G73A 1U5TC 4XSXF 2H6CA 2O0YA 2O61A 3CDHA 3SHFA 1ONVA 3I54A 2OBPA 2QZ8A 4U0YA 1YW7A 5LJ3h 3W6JB 2MH2A 2W57A 1SFXA 2RQPA 2XKPA 3P9KA 4YRCA 1H641 2EFWA 4GYIA 3JW4A 4U0WA 1Z05A 2BGCA 3V8LA 1G4DA 4K87A 5GAOl 5DYMA 2VXZA 1M5Q1 4ESJA 1FYMA 3KZYA 5J8CA 1YFRA 1QGPA 1ZN2A 2Z5UA 1Z7NA 3RUXA 5KNNA 2E7XA 4DQ2A 4Q6GA 1W5TA 2ELHA 1WI9A 3TO6A 4C8QE 1KMMA 1D3BA 3DSQA 4M78B 4ESBA 3SFZA 1WQWA 1TQMA 4M74A 2FE3A 4U0VA 2ARSA 2IVMA 3R0JA 1LVAA 2BE5F 3HHHA 4WJ4A 2FF4A 4N9HA 4I7HA 3MCZA 3RJPA 4P73C 3P9IA 5D6FA 3M9AA 1WSUA 1S29A 3HSEA 4HX8A 3PFIA 3A74A 4LG0B 3CUQA 1FOKA 2DEQA 2IW5A 4P72C 2OAZA 2VN2A 1ZH5A 3L4GA 3R4KA 2XV4S 3NELA 2RHQA 2HFHA 3JCMc 2EJRA 3MAJA 2XRNA 2DQLA 3LC0A 1QZZA 4M75G 2K02A 4LGWA 3CMQA 5C53B 3A5YA 1LJ9A 5GAN2 2BV6A 2K86A 4HV6A 3E6CC 4BAYA 1TTYA 3T8TA 1PDNC 3A7UA 1S7OA 2MC3A 2ZINA 2XUBA 3F8FA 3K1PA 3ZMSA 3QO7A 2FMYA 2IRFG 5ILVA 3RDIA 2ADUA 3RYRA 4LB5A 4P74A 2V9VA 4GCVA 4CICA 2IJLA 5K1PA 4XU1A 3ELKA 1IN5A 1P4AA 4HX4A 3ZMUA 4M77D 3FMQA 1D5VA 1IL2A 2ZBKA 3CO7C 1R5GA 3K1MA 4H2XA 3MZHA 2ZT7A 2MBFA 3QOPA 3OV8A 3JCMW 3TDUC 4Y15A 2Q8KA 1N9WA 3IL2A 3R60A 3I53A 4AH6A 2ZR3A 2P6SA 4Q4ZF 2E3CA 1I6XA 1ZREA 4ZYEA 1J2XA 2O6GE 3NETA 2ALYA 2XGXA 4QVDA 4XLPF 2CO5A 3RGLA 3FB9A 3JB9I 2XAHA 4B09A 3GFLA 5JVTA 1M8VA 1R22A 4WI1A 5AIPA 4KIFA 3O3KA 4UP7A 1L0OC 3RYPA 5HDNA 1WNLA 4P9UA 5GAOq 3KP4A 3SWNC 3KP6A 4A12A 4XU2A 1E24A 1W7PB 3B73A 2C6YA 1IN6A 3HRIA 3MF1A 1F5TA 1TLHB 2VBWA 2ZT6A 2G7UA 4OINF 2Q5HA 4IJAA 5ERIA 4HF2A 1VQZA 4L0YB 1TH7A 3GWZA 2R3SA 4ENMA 1T39A 3GX4X 4HLYA 1V3FA 5LLQA 1BI3A 1KYWA 1UHWA 2IP2A 4MMKA 1SD6A 3OD1A 2OQRA 4H2UA 2A6EF 3Q9SA 4M73A 3HFOA 2C7IA 1YW8A 1S8NA 4RGXA 4IVNA 3T1BA 2FRHA 4EGZA 3MEYA 4O6JA 3ZN0A 3F22A 2HTJA 1FPQA 4P55A 4C8QB 1U6GA 3HRUA 3ROUA 1E2XA 4AIHA 4TVAA 2JPBA 2YX4A 2HEOA 3JB9H 1LEBA 2A68F 3M4PA 3FJPA 4HAMA 2RHQB 3QRFF 2R7DA 4X9DA 2O03A 3HRTA 2ZIMA 3L2ZA 1RZ4A 4BQAA 2W24A 4RMFA 1YFTA 4KA4A 4IHTA 1XGNA 5LRRA 4L5JA 3K9TA 4NL2A 3KFUA 1H9TA 4PHCA 2ZNZA 1B9NA 5LJ5h 2R7FA 1HQCA 4HQMA 1U1TA 4CH5A 2VXFA 1XGSA 2ZZGA 1HKSA 4KFCA 2GXBA 1K78B 3QO8A 3M8EA 1Y96A 3JCMX 3WODF 2J5PA 1U1SA 1E17A 4GO1A 1GXPA 3VQXA 4LB6B 2CW0F 2IA1A 2ZJ2A 2CWEA 3L9FA 2STTA 5GMKh 3T5XA 1E1TA 3JCMb 3F3XA 2PMHA 4YRMA 4OOIA 3QPTA 3JTGA 4RB2C 1U78A 2EWNA 2VBYA 3HFNA 2GA1A 3HUGA 1NJ5A 4BHPA 4YYEA 3KP3A 1SFEA 2JZYA 3F8MA 5J6XA 5FLXK 2EA2A 1FC3A 4RGRA 2XAGA 4HVCA 1RUNA 2BBYA 4G6DA 3KZZA 1H4TA 2QUFA 4HF1A 3JCMf 2CYYA 4L9TA 3QO3A 1GHCA 4A0YA 2DKGA 2HKOA 1XN7A 4LNSA 3KP5A 1JE8A 1YFHA 2K4BA 3TKYA 3GZ6A 1KOGA 4IRHA 4HA8A 5GAN4 2VBXA 2L4MA 1X2GA 3P8YA 5K5RA 2Z3YA 3RERA 2BEOA 2VC8A 2MLGA 1C0AA 4AD9A 5FD5A 1BBWA 2HYGD 1XSDA 1CF7A 3EQLF 4KMUX 1Z6RA 4EGYA 4F7UA 1HXDA 1GGMA 4MTDA 2YLCA 3FIFA 3JCMP 1FY7A 3VU3C 4HDUA 1FSEA 1LOJA 5E17F 2ZTGA 1BC8C 1NYRA 4P96A 3LSTA 4N0BA 3R07A 1B1BA 1XMKA 2GWRA 1SD5A 4P71C 2KJBA 4M75C 5BS6A 1I4K1 2CGPA 3HXWA 3HFZA 4UPAA 4Q15A 3HIFA 5K1XA 3WTXC 4JUVA 5DUKA 3I58A 1SERA 1EQRA 1YG2A 2FA5A 5DCMB 3TQNA 2EV6A 3IWZA 2PMEA 2HQRA 1HKQA 3GYHX 1STZA 4M75E 1USTA 3LAPA 3HRMA 3NEUA 4CYDA 5LHIA 3M1EA 5HS8A 4RQEA 4IXAA 3R6SA 1ZARA 3F8BA 4MMLA 4OMYA 3ERRA 4YRRA 3P8TA 3RESA 5E1XA 1YFSA 1HC7A 1KQ1A 1U8RA 1BI0A 5HVQC 2VOPA 3M4GA 1FP2A 3WTVC 1KU2A 1BN5A 4ZH4F 1D3YA 1J7KA 3AHUA 1PP8F 4OU0A 4NL3A 2IY5A 3Q5FA 2YX7A 1UB9A 5EEHA 4EJVA 2TDXA 4M7AG 1YTYA 3PQJA 4M7AF 2E7WA 2AMCB 2XAQA 4ESFA 5FLXZ 5D8KB 1PYSB 1NNHA 3LWFA 4C8QG 1BBYA 2KIUA 4HWSA 4YPFA 4M77E 2PN6A 2XAJA 1R5HA 2MH9A 4N0AC 3INZA 1KQ2A 2E5AA 3RI4A 3J7AO 1YIOA 5E1ZB 4YRKA 4HYEA 1P92A 3VFZA 3RPQA 4Y13A 3HFZB 3LSSA 4YRNA 1MJBA 4HW0A 2W85A 4H2WA 4F7UF 1F9NA 5GAMf 5GANg 3TEHB 4MQ9F 4A53A 3S2WA 1FSHA 4YCVA 1G5IA 2PMUA 3HXUA 4YRPA 3R0AA 3RL6A 5F64A 4KR2A 3U9GA 2FYKA 3EFRA 3IHUA 1EH6A 2X0LA 1S7AA 2DPDA 2G4CA 1FNNA 4M71A 2DZ9A 3D5LA 3BJ6A 2GXGA 3WTYC 4Y17A 3ZMDA 3JSPA 4M9ZA 4YRSA 3RTRA 2KIMA 1NYQA 3WU1B 4LLNA 4MNUA 4YP0A 5LJ3d 1LNWA 3HXVA 3ZN1A 2MD5A 1KU3A 2QM3A 3J80K 1T0FA 3HXXA 3RKXA 2ZFWA 2PLYA 2EA4A 2PFBA 3JTHA 1FX7A 3H3UA 4IRIA 4MEYF 1Q1HA 4EMKB 3UGQA 4J6XA 5L3EA 3E5QA 4ENNA 3Q9VA 4RQFA 3M4QA 1SETA 1SD4A 2E1HA 2DVEA 3GXOA 2UZKA 2Q7EA 5CLSA 1ZG3A 4NOYA 2ZO4A 5HOOA 4EVIA 4XSZF 1ASYA 3C3WA 5ILUA 2DTRA 5L3FA 2KJCA 3SWNB 4O5VA 4A6EA 1D8JA 4HBLA 4IHSA 4M7AA 4L0ZB 4J6YA 3DF8A 1YQAA 4YFXF 2DDZA 5CJ9A 1PUEE 1MJ9A 3ECOA 3H92A 3HSFA 4PGHA 2IA0A 3E5UA 2K27A 4L18B 4ZTUB 1KQ9A 5H6RA 4XEOA 3JCMJ 3JCMh 1HSTA 5KK1A 4IF4A 2P8TA 5F6FA 4YFNF 4E70A 1O3SA 5GAOr 2FOKA 4YIIA 3SXYA 2CJAA 4P74C 1MDMB 4M9SA 3CJNA 3REOA 4R1HA 4A5NA 1DPUA 1FBQA 1U5TB 4P3NA 5HLGA 4TQFA 4M7DA 2XKOA 3GVAA 3V8KA 2GQQA 3IRQA 3DEUA 1HBXG 4M75A 1XGMA 3NRVA 4A0ZA 4BHCA 1KYZA 3HSRA 2FB7A 1I81A 3ECHA 2EL9A 1OMIA 1DDNA 4KYWA 1Z91A 4FX4A 3D0SA 4ON0A 4X5OA 2EV0A 3QU6A 4EJUA 4P3PA 2I4MA 3FXQA 3KEQA 2NYXA 4A54A 3I64A 2GAUA 5CVUA 4P71A 3BJUA 5LJ5f 1YB3A 5BPDA 1WQ7A 2RKHA 2CSOA 2H94A 1USYA 2RA2A 2H6BA 4G7OF 5BMZA 1C0WA 1WQ2A 3HY1A 4G94A 5DD4A 2OQGA 4QWQA 3JAMK 3IC7A 2A69F 2Y90A 1X3UA 4AWXB 5DUIA 4NQWA 4A6DA 1LDJA 4RAZA 4YFKF 3KETA 4UUVA 4YDQA 1B9MA 4F7UE 4G9YA 2M1BA 1EFWA 1H4SA 1SMTA 2OU2A 1ASZA 4UHTA 3RACA 4H2VA 4LD5A 4I01A 4DNCA 5FO5A 2QBYB 4KIBA 3EUHA 1R23A 2O3FA 1GXQA 2EFQA 1R58A 5CVJA 1OR7A 1W4MA 3HRKA 3FWEA 3V4GA 1JHHA 1DUXC 4ZZDA 2E1NA 2W25A 5HDKA 4TV7A 2W84A 1JRIA 4CS4A 2A5YB 1ZHFA 4YCUA 2WWYA 2D1VA 2NRAC 2AKWB 4RDXA 2YPRA 2Q7HA 2FEZA 2FBHA 2A3SA 2LKPA 5L3CA 4OP0A 4H2YA 4ENKA 1YCYA 2XTIA 1ZGJA 4K86A 3HFVA 5D6EA 3ZMVA 2J5OA 2EB7A 2OZUA 2EFOA 2VE8A 4M77B 1OYYA 2UXNA 2HZTA 4U7DA 1SFUA 3FMRA 4M7DG 2AS5F 2EV5A 2DT5A 2Y75A 1AWCA 4M7DF 2QBYA 3R61A 3GLXA 3W3SA 4M75F 5GMKm 1I27A 1WKMA 4LK0F 3BROA 2HYFA 1R1VA 2HTSA 3JB9G 2Z33A 1BI2A 3IKMB 4PJOF 2ZXJA 3FZVA 1XDUA 2VC1A 2IA2A 2QVOA 4GXOA 3BPVA 3IALA 4MGRA 3JSOA 3W6KB 2ZCEA 4MEXF 5GAMd 1R1UA 3O2PE 4WCGA 4C92B 2QTXA 1XDSA 3TO9A 2YHTA 1E1OA 4B8XA 3BY7A 4KIGA 2P5VA 5D5UB 4KMFA 5LJ3g 2M30A 3FMSA 5LJ5e 1X2HA 3HYIA 2OA4A 3E6BA 1X01A 3TEHA 2Q5IA 4HWTA 1JGSA 2E41A 3TGNA 4YRGA 2QHSA 1JHFA 4L9JA 5GANh 2YU3A 4HT8A 5FFZA 1KQ0A 2EAYA 1IF1A 2ZT5A 3GFJA 1A04A 2V79A 5IT3A 4RCBA 5EEGA 2LDUA 2ISZA 2DXUA 1UFMA 2LSOA 3P7NA 3LQQA 3HXZA 2ZR2A 1TBXA 2I4OA 1WRJA 3F8NA 3VODA 2FQ3A 2E65A 5GMKi 1EIYA 1X56A 2HGCA 2RD1A 3DPLC 2ACJA 2AMCA 4U7BA 3B02A 4FT8A 3HXYA 4P72A 4HZFA 2JPCA 4S04A 4UV8A 1D3BB 3BP8A 5AONA 1LYLA 1ODDA 4AVPA 1BBUA 1USYC 3G3ZA 2RN7A 1MJAA 4HX7A 1U5TA 4XLNF 5CAIA 2ARTA 1W7PA 1ZAOA 2F2EA 3FF5A 1ON2A 3I4PA 2RGVA 4UVCA 3ZPLA 3TDZC 1S6LA 2MA3A 2E10A 2I4NA 2Y48A 5GMKj 5DEQA 3H3ZA 3WU0A 4ENJA 3JCMQ 1HTTA 5TRDA 5KVRA 5LGNA 4BH9A 3RKYA 3JCMe 5DD8A 3CLOA 3EDPA 1YO5C 4CS2A 5LBQA 3G1ZA 2KRFA 3FHZA 3I0TA 2AKWA 3GUDA 1K7AA 3GIBA 2L02A 3P9CA 1UCRA 3SQNA 2FXAA 2EFNA 1I5ZA 3A32A 1JBMA 1G3WA 3E97A 5GANf 3O6BB 1OYWA 4XTZA 3J81K 2PG4A 4OMZA 4CGZA 2DFIA 3F23A 3PZCA 1RIOH 1KU9A 1H9GA 2RM4A 5GANj 1O57A 4M78D 4RAYA 5K5OA 3VBBA 4M78C 4M78E 1FLIA 5GAN6 4K88A 2F5CA 2NAZA 1TQIA 1IW7F 2FNPA 4AIJA 3A7RA 4PJOB 2NNNA 1QPMA 3ZMTA 1CGPA 3JAMZ 5L3BA 4JBAA 2F5FA 5E18F 5GMKe 1HW2A 3IKLA 3DP7A 1K6OA 4KICA 2G7HA 1BIBA 1OKRA 3FM5A 2QQ9A 4UVAA 1PP7U 4UP9A 4I0BA 3KFWX 2L4AA 3WGGA 5F5WA 4HT9A 1Y0UA 2FNAA 3F6VA 3ICAA 1HW1A 3L09A 2PI0A 3HOTA 2JN0A 2QQAA 4EMGA 1FYLA 2O8XA 4X9CA 1IAWA 2VT3A 4CXFA 2DO7A 4MHGA 1YS7A 1F4KA 5BOXA 2HDCA 4WXDA 4RGSA 1ON1A 2LF8A 3E6MA 4HQEA 3SZTA 2EJ9A 3A5ZA 1HKTA 4CZZA 3E9IA 5LHHA 3WTWC 1X55A 3REUA 1ZRDA 5L3DA 5LRSA 5LGTA 5J8FA 1KMNA 4P9FA 5CVVA 1MD0A 2HWVA 3WE3A 2DBBA 3WTTC 3MF2A 3VQVA 4C92A 4IPAA 3C1DA 4G7ZF 4Q47A 2GZWA 2ODRD 4YRFA 2IPQX 4UV9A 5E3IA 3ULQB 1FBSA 1BM9A 1EVKA 1ULYA 3IKVA 1O7FA 2WV0A 3E5XA 4RB0A 2RDPA 4L9VA 4EV0A 3GFMA 4M7AC 3GEZA 5GAN7 1YLFA 2L3DA 4WF2A 1IRFA 5JFRA 3N4MA 3GF2A 4EM1A 4RB3C 2JTVA 1AOYA 4TQDA 4FX0A 4LMYA 2DJZA 3BPXA 1O3TA 3N97A 5D4SA 2HNIA 2DTIA 4XEMA 3PGGA 2BYVE 4WK8F 4N0AA 4HDVA 2RB6A 2QWWA 3JB9F 1I5LA 2Q7GA 3BOQA 4M7DD 2VE9A 1IZ1A 1EVLA 2Z9OA 1ADJA 4I98B 4M78G 4MQVA 1KA8A 5LJ5d 4KNYA 1EIYB 3WG9A 6PAXA 2JT1A 4PNOA 3FM3A 4XTVA 1G3SA 3HTUA 4C92G 1IXCA 5DV5A 3IRRA 1EOVA 2PQ8A 1EV7A 3I5UA 3V7RA 4LFUA 1FZPB 2CG4A 4HV5A 3L2CA 3VB2A 3BDDA 1J5YA 4JLIA 4M7AD 5I21A 2K4JA 2CJBA 3IKTA 1YW9A 3QHSA 3VOEA 1YS6A 1Z7UA 3CUQC 1ZG5A 2Z99A 1I8FA 4G84A 5L3GA 3QPHA 4BNCA 5HS9A 2QYOA 1ZLJA 4JK1X 4TVYA 4PDKA 4M75B 2K57A 4Y91A 1B8AA 3WGIA 4L5IA 1ADYA 3HRSA 4M77G 3C18A 4YRTA 4M77F 4UNOA 2K7LA 1G3YA 4EQQA 3WGHA 1B7YB 5BPIA 2JRTA 2ZNJA 1WLEA 4OIRF 5E8GA 3TUPA 1UHMA 3P8VA 2P5LC 4KR3A 4E51A 4OIOF 2ODRC 3K0LA 4ZYGA 3KE2A 4OLFA 5CYVA 3ZQ7A 4HLXA 2X4HA 2RHSA 2A07F 2P5KA 4CDGA 1ZYRF 3QP6A 4LLLA 4ASNA 4A5MA 3QNEA 3UFGA 1J9IA 5FGMA 5ELNA 4R79A 4CHUA 1QZYA 3LFKA 5A2QK 1USSA 2ZIOA 1O3QA 1PYSA 5E8IA 1B76A 3EYYA 1OPCA 4LLGF 5HLHA 2RHSB 3T8RA 4BW9A 2M87A 3BWGA 3BDUA 2XIGA 1N9SA 4M78F 1KU7A 1FYKA 4JQFA 2ZT8A 5LGUA 3I59A 4EMKA 4C92D 5BQTA 4YCWA 1TNTA 3LA3A 3VEPA 2I2LA 1B4AA 2ESHA 2ARUA 3QO5A 4WWCA 5FFXA 4ZIBA 4H2TA 1G5HA 2V1UA 3WQZA 4V2SA 5JHUA 2V6CA 2XGTA 4XRFA 2V1DA 2ZKZA 2XVCA 2WTEA 4TVWA 3ERED 1ZRCA 1QBJA 2XROA 1MGTA 2FBIA 2ZNYA 4XQ3A 3CUOA 2DK8A 2FSWA 4L87A 1ATIA 4I09A 5ICEA 5GMKl 2VOOA 3E9HA 2J3MA 1U3EM 2HOEA 3HY0A 1KQ8A 1IXSB 1DPRA 1T6SA 3GO5A 2ZGWA 4J15A 5DDGA 4P75A 3TOAA 2ETHA 3M8FA 1NJ6A 3GW2A 2HKXA 5HGQA 4P73A 2V1XA 3FXUA 1O7LA 5HDGA 3QTCA 3REXA 4BWAA 2DK5A 1FYFA 1R36A 1QNTA 3WTUC 5K1YA 1IRGA 1XD7A 1NJ1A 3LAJA 1OYIA 5GAOm 3JB9J 4C8QF 2JSCA 4G6QA 4M78A 3TEGA 3CUQB 4HF0A 3NEMA 1DP7P 2RV8A 1CF7B 4XTXA 1JXSA 1SAXA 2QLZA 2FU4A 4C8QC 2M8EA 2ESNA 4J6WA 1P4XA 4OIPF 1MZBA 2PMFA 3MZYA 1I1SA 3COAC 1SD7A 4BYYA 3FX3A 2YR2A 1J59A 2IY5B 1B70A 2GA2A 3CO6C 4PJOA 1HW5A 1W5SA 1LDDA 3J81Z 1SRYA 5JI6A 3I71A 4EO4A 2A6HF 2KKOA 1QQIA 1YGBA 1P6RA 3DPTA 3HHGA 1W7PD 4HWPA 5GAN5 5IT9K 1Z7MA 2ZZFA 3QAHA 3QP5A 5ELOA 3IG2A 3K1NA 5CVRA 2DU7A 2P4WA 1LEAA 4H0EA 2ALYB 2KIFA 3HOSA 2H27A 3C7JA 4H02A 5LJ5g 1R00A 5D8LB 5LJ3e 4UXNA 5E20A 3EFSA 2DXTA 2XASA 5DCMA 3I7FA 2CGHA 4M72A 4G7HF 1W66A 5A2QZ 2LNBA 2D1HA 1FP1D 4N9IA 5ILSA 2P0LA 5GANd 4KQEA 4CS3A 5E1WA 3RPUA 4I02A 4C92E 1U2WA 4C8QD 1EH8A 1H4VB 3BFMA 1XSXA 1LDKB 4YIFA 4CO8A 4L9NA 2DQRA 4J5YA 2RNJA 2QHTA 3ABTA 4PGGA 4IRGA 4S05A 2H09A 1X54A 1RIQA 1J0RA 1YYVA 5C52B 4H2XB 2GIVA 1B6AA 1J5WA 3MEXA 5D5WB 2DZCA 4I2OA 1H0MA 4KDPA 2CIMA 1QF6A 2CJ9A 1ZLKA 4M6YA 2PBIA 1TNSA 3F21A 2Y0MA 1L3LA 2OD5A 4ZZLA 2LF7A 12ASA 4F7UB 1Z1DA 3IWFA 4RS8A 2B0LA 1WWXA 2EJFA 1FT9A 1RUOA 3RF1A 2DAOA 2ZNIA 1ZGAA 1XSVA 4P5OA 3DKWA 1BJAA 5DCFA 1JJCA 3ABUA 4KT5C 4M9XA 3MWMA 1V4RA 1E22A 3VQWA 1BC7C 3T0YA 1BIAA 4O3MA 1P2FA 4LG0A 3RKWA 2UWMA 4WX9A 3MFKA 4EJOA 3BJOA 1QE0A 1IN7A 1EH7A 4UVBA 5LHGA 1TQPA 3DFGA 3EETA 5ICFA 2F5EA 1T98A 4M77C
chains in the Genus database with same CATH superfamily
1HK9A 2FUG2 4MTEA 3WE2A 3U2RA 2VT2A 4F17A 1FBUA 4U88A 3CXCS 3KCCA 2PQWA 5F04A 2OZ6A 4PFPA 3ABMH 5F0HA 2VKNA 2GOXB 5GPAA 4PJOC 4QQGA 1TWGJ 4CC3A 1WXBA 2DA3A 2YLBA 2XDBA 5HS7A 5K5QA 2EZLA 4YRJA 3F6OA 3KLOA 1T0JA 1WFXA 4KUMA 2ZSHB 4F93B 1UGVA 2CDTA 4JRKA 4AFUC 1IXRC 2BVMA 4AIKA 1B72B 1WYXA 2YDLA 1ZR4A 3J80Z 2I10A 5EC7A 4M7DB 3K69A 4PJMA 1IUYA 4E2FB 2V4JC 5L23A 2L3QA 4Z2YA 2DA5A 2QDYB 2P0WA 4OIQF 3OYIA 1U5SA 1RPWA 1QWEA 2VBZA 2QA4I 4EMSA 2MW8A 1F1ZA 4HSRA 2P7VB 5F27A 2AXLA 3L7WA 1IGUA 3BW1A 4XU0A 3LSQA 4QW2A 3QUIA 2Q0OA 3CCSA 1LQ1A 3EG0A 2XIDA 1H4QA 1WJCA 3BCAA 3V8JA 3TOBA 4RTXA 2QA4Q 2NLUA 4NB5A 3M7GA 1WJFA 2L7FP 1Y96B 3LA2A 1ZRFA 5JR3A 5KYXA 3OA6A 1WU7A 1Y07A 2GGRA 5D5VB 2QGUA 1G5VA 1SESA 1VQLI 3A1YA 1AHDP 1Z0XA 3I9V2 2L01A 1UHCA 1POGA 1I1GA 4PJNA 1V5FA 5LEKA 2CZ7B 2KLOA 1UAAA 1UUEA 4NHJA 1P4WA 4KGZB 3MN2A 2Q2EA 2GTJA 5FROA 4XLEA 3CTAA 4CH6A 3V42A 4F55A 3N5BB 3EUKL 2C0TA 3BZ6A 2CZ1B 4C9YA 1E6HA 4M7AB 3TSZA 3ULRB 2ISYA 1D8KA 5D4RA 3SDZA 3CCUI 1JJ6C 3EYIA 2XGCA 5TJJA 2IAIA 2OF7A 5CVIA 2BUDA 2XHKA 3L2WA 2BZXA 2ED0A 2COMA 3SWNA 1U9OA 2LY2A 3OOPA 4R8HA 3A4CA 2M4KA 1S3JA 2WV1A 2R7SA 2RQRA 4H2SA 3EUAA 3AFHA 4BU2A 4TWAA 1MGQA 4FE4A 3QYHB 4DOWA 4E4HA 3OYBA 4PFOA 1K4SA 2NS0A 2FZKB 3LQRA 4UUSB 5FD6A 4FCYA 2GQIA 2YSRA 4RKUE 2RMOA 3GZ5A 5IHIA 4EJTA 2COZA 2LH9A 4M7DE 3H0FA 2NVUB 2WC2A 2D5VA 2G4CA 2DPUA 4RTZA 4YRQA 2DU5A 2QENA 2QHVA 4HCKA 2MLKA 1KIKA 3AAFA 3AL0B 2M5WA 3SZPA 4Q48A 3KP7A 3G1MA 5ICGA 1WZ2A 2OI3A 3E9GA 3LGLA 4Y28E 1NJIC 1B70B 1IJWC 4HOBA 1VQNA 1WI7A 2PJPA 4LDWA 2B8AA 3DV8A 3LA7A 2P6TA 3JREA 3AG1H 1NHAA 1PUFA 2E64A 2K7AA 1B34B 4QLCU 3M0UA 2RHZA 3DU6A 4KN4X 4BUPA 1JQQA 2CFXA 1M2OA 1YNZA 2DBKA 3QPLA 4NC8A 4WXHA 4B48A 1TWBA 4ORZA 2ZC2A 1BOBA 4C8QA 1M90C 1JJCB 3JB9D 2HMAA 2J6OA 1OR7C 3AT1B 4GYGA 4Z89A 2K9LA 2P0KA 5DLQE 3G1LA 4X0GA 4BHBA 1U8BA 1YJ9T 1NTCA 4AFSC 3DXJF 1J75A 3PCOA 2DETA 1QRYA 3PNYA 5GAOn 2UUZA 3PCOB 4A2UA 4NC6A 1YWPA 1ZLMA 2PX9A 2VONA 4C30A 1NM7A 1A35A 3P5JA 1LKXA 2VI6A 2P81A 2V7FA 2VXEA 5IXFA 2XI9A 2LVSA 3S3NA 1B8IB 4EM2A 4M7AE 1MBEA 1K8AC 4RGUA 3L2VA 1ERDA 1IN4A 1N9RA 2M45A 1O3RA 2ROLA 1VQNI 3HTSB 2F5DA 3KLNA 4MFEA 2ZPBB 4Y7NJ 1RR8C 5B66C 5EGOB 1JKRC 2KT1A 3RIRA 3CD6A 4HWOA 1X27A 2XGDA 3CCMA 2XB5A 4FHTA 1I1JA 2DW4A 1PC0A 4XICA 5BNGA 2LQKA 4QQDA 3SB2A 4HWRA 1RI7A 3F72A 5GAHJ 3K4MA 3JRDA 2JA5J 3WTSC 4LJZF 3V7SA 5GAN3 1VQ7A 2K3FA 1W4SA 2E70A 2ECBA 2KDZA 4OVAA 5C4XJ 1IDYA 3OMYA 4ZGEB 2HU9A 2KFDA 1S7EA 2MG4A 1XCVA 3G71I 1NEBA 1K79A 4EJWA 2CFOA 1V76A 2HDDA 2EBPA 4C0ZA 4LVMA 3H3VK 3S8PA 2LCLA 4AFQC 2EFIA 2ZMEB 2MCNA 2DA6A 2DX1A 1T0FC 3WU2C 4UUSA 2KQWA 2X3WD 2ZPGB 2CQKA 2DTOA 3QKJA 4M77A 4XTWA 4C5HA 4QVCA 2QEXQ 4PJOD 4PFZA 3UGTA 4YRIA 3AG3H 4TVAB 2ESWA 4D8KA 5KNLA 4G85A 5KCOA 2MWPA 4CH4A 2D6FA 4P3OA 4EM0B 1WPYA 4F7UG 3JCMd 1Z7LA 1VQLQ 2NVXJ 2R7TA 3CC4A 1MV3A 3V7CA 4ZDOA 3ZP5A 1IV8A 3U1DA 1UECA 2BY0A 1WFWA 2QQ8A 1Z9CA 4I0AA 4AYBA 3NMZC 4XTUA 2O88A 1T8IA 4LVIA 1G51A 2HR3A 4J19A 4WJ3M 1H88C 3LGFA 2G9WA 3HPGA 3BG3A 4D9JA 1MBKA 2WAQA 1IN8A 1A31A 4G8XA 4RCCA 4C92F 1P9QC 3DQVC 1GVJA 2OCEA 3RSNA 4F7ZA 3OYGA 2E1CA 1K1ZA 4CCKA 3GFIA 1OU8A 4PZJA 2PEXA 2Y31A 5CKDA 5EG0B 1QO0D 2LRDA 3S2HJ 3A31A 4HEA2 3ZXSA 2ENMA 2O9VA 3A8OB 2JJ7A 4YEJA 3CCJT 1B7TA 2O9SA 3EG3A 2RC4A 4PG3A 2F48A 2EFPA 2KZVA 4M7DC 3PQKA 2E5KA 1YI2Q 1HYOA 2K2VA 3QPSA 2L54A 1VQ4A 2XDPA 3QQAA 4DOVA 1M4ZA 4JJCA 2JVVA 1JJ8C 2NUZA 4V2GA 5DTDA 3M0RA 3BJAA 4OB2B 4A4HA 2I4LA 2XAFA 2HQNA 1EKEA 1Q82C 1NJ2A 2FMLA 3L1AA 1T2KA 3QZ9B 2GQVA 3A7AA 5IT9Z 2M0MA 2P7CB 2Y4XA 4EMHA 4EMKC 2DEUA 5H20A 2STWA 4V2FA 2LY1A 1B7YA 4DPGA 4A63B 5GANe 3A8MB 5AIQA 1LJOA 2CZ0B 1FTTA 2V1RA 1KD1R 1VQOI 2NS8A 5M5YJ 2DYBA 3ZL7C 4JZ3A 2P5IA 3H41A 2K9GA 3M53A 1Q95G 4E47A 1BI1A 2CUJA 3E3VA 1GFCA 1K78A 2P0PA 3BLYA 3WHCA 4BJTA 3DEEA 3E6DA 1OCPA 3OYFA 4KN7X 1R8OB 2ATCB 2KRNA 2VGMA 4QKUA 2DRKA 5CQXA 1LNXA 1QVGA 4HCBA 2D45A 2KL4A 1TWHJ 5CKFA 3BCBA 2PVGB 4XU3A 3HTZA 3PFYA 1MHNA 4CH3A 3S32A 3PIOF 1KGSA 5B1AH 4EX5A 2CUEA 2DA1A 4BXUA 3VSKA 5GAMh 1SVMA 2GIZA 2SEMA 1YJNT 1VZ0A 5H6QA 2R7WA 2HOSA 1OFCX 2DTHA 3FRNA 3QU3A 2CJAA 1TUDA 2COYA 2K9QA 4ZTZB 3QBYA 4ZC3A 5DY9A 1VQPI 3HSBA 3UR3C 1WPKA 2ZZEA 1YHQI 2QQRA 3FBNB 4WXCA 1G3TA 4ZYHA 4BY1J 1TS9A 4XTYA 3NQOA 3O8HA 4XOPA 3OSFA 2BXZA 1VTNC 2ME0A 1YP5A 3AG2H 3WXMB 4NCXA 4D0PA 1RAGB 1XMAA 1QKWA 1TW2A 2Z2SB 2ZMEA 3FXRA 1REPC 4Q5WA 1WYDA 2C8MA 2X4JA 2H8HA 4OMQA 1HSQA 2WA0A 4O2DA 2JVHA 5IHNA 2LTPA 4XORA 5ED4A 2FBKA 3JCMg 5C51B 4GGGA 4CCLA 3I5SA 4XRMA 3OBYA 2D2WA 4LK1F 3ISPA 1XCBA 2J6FA 4FSXA 3I3LA 2IT0A 2L9SA 1YN8A 5IH2A 2Z1DA 3QSUA 1SHFA 4AIDA 3G71T 1SMYF 2QHUA 2Q7EA 5KCHA 2LMDA 2ZXFA 3H0DA 4K2EA 4KT0E 1I39A 3UH0A 2XD0A 1XGOA 1W0UA 4E6RA 1HSJA 3M07A 1B59A 3TO7A 3BY6A 5D5XB 3ZQFA 2RVCA 4JPBW 2PVOB 4I6ZA 4CYCB 1EIFA 1U0JA 5J26A 3KP2A 4C5IA 3G4SA 2HVRA 3CCUT 4HVVA 4YREA 4OMPA 1OCTC 3CMAI 3KPHA 4JRIA 5GAMj 3WTZA 1K6YA 1WVRA 1VFCA 1ZQ3P 3I55A 3AG4H 2VVKA 4MZTA 4Q5SF 1S72A 1L0WA 5LEJA 4RAFA 1NJ8A 2JTEA 1EFNA 1QW1A 3ML6A 1Z6TA 2K6DA 2ZXHA 2HS5A 4NBQA 2ZCWA 1H8AC 5ICCA 2VODA 3JCMV 1FWZA 1KC8U 4M6XA 4DZJA 2IS1A 1MDMA 2GBQA 4YROA 1EZZB 2QYZA 1YFNA 5HLIA 4GBQA 5GAMg 1QWFA 4RB1A 2EIJH 4XN3A 4Z02A 4B6MA 1GFDA 2DQ3A 1IREB 2DLLA 2Y30A 4TTVA 2XPUA 1LB2A 2EJGA 4J9IA 3K2ZA 4YRLA 4A0XA 2OTJT 1OOTA 5EDNA 4F3QA 4A3MJ 2DAQA 2E19A 4UP8A 4ZYDA 1RNLA 5LJ3f 4PCQA 1ZG1A 3MQ0A 4J01A 2FQ4A 3Q0WA 1M8MA 4HKEA 2MK5A 3R6OA 5FU7C 3G71Q 1G6NA 4IIMA 3VS4A 2JA6J 4C92C 1PD1A 2DI3A 5LJ3j 2KE9A 1MKMA 3G6EA 2WACA 3HM5A 4IOCF 3H8ZA 3CBOA 4BJ5C 1T38A 1R7JA 1UE9A 2UXXA 2RH2A 2DU9A 2OV7A 3L4GB 1VQMI 4YG2F 1TW3A 3VYSB 4XBFA 1M3BA 4P75C 2P84A 4PL6A 1E6GA 2A28A 5A0DA 4M75D 1GUUA 1TT5B 1B34A 1NJIR 3ZMZA 11ASA 1T33A 1R1TA 5IYCJ 3PIPF 1PKTA 1MBGA 3OR1C 1YITI 3GTLJ 2MF2A 3KEOA 5GAMe 3FK7A 5GAN8 4PJ0C 2F4OB 2QQBA 3I59B 4EEFG 1XB4A 5FB2A 4Z6YA 1BOAA 5FRNA 2E3IA 3L00A 2L0AA 2PTKA 4NS5A 3WVEB 5F1RA 2EK5A 2BE9B 1VQ6Q 3ZQHA 2A61A 3NENA 1GXIE 2AHJB 3SHWA 4XK4A 2NNYA 1OULA 3FIWA 5LJ5j 2NUPB 4ETSA 2VC0A 4IHYA 3CCET 1S5LC 3K4NA 3OS5A 4NNJA 3F8CA 3GTOJ 3DCFA 3G73A 3A03A 1U5TC 1UMQA 2H6CA 4XSXF 4AT1B 5I2SA 1Q82U 2O0YA 1TSFA 1Q86U 3BZKA 2O61A 3CDHA 2QEXT 1M30A 3SHFA 1ONVA 3I54A 3Q0VA 3AL0C 3E9FA 1OZ3A 2LC4A 2QA4A 3O8VA 1SVOA 4R56A 1OX9A 2OBPA 2QZ8A 3PFSA 4QQ6A 4U0YA 3RDVA 5GAN2 4KH0B 1VIEA 1YW7A 1XJWB 1QPIA 3OW2P 1UJYA 5GJWB 1E7OA 1HD3A 4P5NA 3G4ST 3PVLA 5LJ3h 2MH2A 2W57A 1SFXA 3P9KA 2RQPA 2XKPA 3FISA 3W6JB 1LFUP 2KMUA 1H641 4YRCA 2EFWA 4GYIA 3X2QH 1J3TA 4RA2A 3VS7A 3JW4A 3HEFA 1Z05A 2BGCA 4U0WA 3V8LA 4BJ6C 1G4DA 2AT1B 2YT6A 1M1KR 4K87A 5GAOl 5DYMA 2LDMA 5DS9A 2VXZA 1M5Q1 2RJEA 1AWWA 4ESJA 1FYMA 3KZYA 4DBQA 5J8CA 1ZA2B 4UB6C 1QGPA 3LWHA 1YFRA 2A8EA 2D9TA 1ZN2A 1YCSB 2Z5UA 4G12A 1Z7NA 2Z0WA 3D1NI 1QMCA 2QASA 3RUXA 5KNNA 2E7XA 4DQ2A 4Q6GA 1Z7MA 3J81E 1W5TA 2ELHA 3KYDB 3NTHA 1IRZA 1KD1U 1WI9A 3TO6A 4C8QE 4J83A 4J9GA 3AKZA 1KMMA 1D3BA 2L2OA 3DSQA 4M78B 3JRFA 4ESBA 3HB9A 3SFZA 2TCTA 3CC7A 1WQWA 1TQMA 4M3DA 4M74A 3C95A 4Y92A 2FE3A 2HXOA 4U0VA 2IVMA 3R0JA 2ARSA 1JT6A 1LVAA 2KMTA 5E3LA 1JU5C 2BE5F 2DMUA 3BR2A 2XB0X 3HHHA 1M27C 2FF4A 4WJ4A 4N9HA 3GBGA 4I7HA 2IGMA 3BT9A 3OIPA 5EZGA 2VJ5A 2RN8A 2XKOC 3MCZA 3RJPA 2G0EA 4P73C 3P9IA 3O8GA 2YUPA 5D6FA 5B1BH 1NG6A 4LIVA 4RMNA 1IO6A 2Q1ZB 3M9AA 2E6ZA 1WSUA 1S29A 3G4SI 2L3SA 1UHSA 3HSEA 4EMGA 4HX8A 3PFIA 1K0XA 3A74A 3IP4B 4A69C 3CUQA 4LG0B 3EHQA 1MH3A 5C4JJ 3QOEA 5EJCA 1XTDA 3RR6A 2R5ZB 2QSGX 4MO7A 1FOKA 2DEQA 3LW5E 2E5NA 5CKTA 2IW5A 2E2HJ 3OS0A 3LH0A 4LUEA 4Y4RA 2JM8A 2OAZA 2VN2A 2ZB9A 1ZH5A 4P72C 3L4GA 3R4KA 2XV4S 3O5ZA 2KBTA 3FXKA 1XTAA 3E0JB 3A0BC 1JKOC 2RHQA 3NELA 4P71A 2HFHA 4CC7A 3JCMc 2EJRA 3MAJA 2XRNA 3PVQA 2DQLA 5IAYA 3LC0A 4C3HJ 1QZZA 3CD6T 1TWAJ 1TWCJ 1FMKA 1KD1C 3TQ7P 2XDDA 4BBRJ 2B63J 1ZHIA 4M75G 2K02A 4LGWA 3CMQA 5C53B 3A5YA 1LJ9A 2J3LA 1R6RA 2X1DA 1OJLA 2DYIA 2YUOA 4F14A 2BV6A 3HZJA 4PSXA 4FE7A 2K86A 2FEIA 4HV6A 1P7IA 1BR2A 3E6CC 4BAYA 2KQRA 1TTYA 3T8TA 2G3RA 3SEZA 2LMJA 2ZPFB 3OYEA 3NGPA 2OTJA 2HQ5A 2X85A 1B3QA 1PDNC 2BTTA 1S7OA 2GCXA 2X3XD 2MC3A 1ZTRA 4B4CA 1B7YB 2ZINA 2XUBA 2CJJA 2K9SA 2R0QC 2E60A 5A0LA 1YJNQ 3F8FA 4MFDA 2MYSA 2E1MB 3K1PA 2DPPB 3K4KA 3HG9A 3ZMSA 3LL7A 3QO7A 2FMYA 2IRFG 5ILVA 3FEOA 3RDIA 2ADUA 2KI7A 3RYRA 4LB5A 3GCMA 4P74A 3PO2J 2V9VA 2LP0A 4GCVA 1VQ6A 2M8GX 1WIEA 4CICA 1N8RR 5DM6F 2IJLA 2VKDA 3ERMA 5K1PA 4XU1A 3ELKA 1IN5A 1P4AA 3ZQCA 4HX4A 3ZMUA 2CQXA 3FMQA 3IUOA 1D5VA 2LNHB 4M77D 2ZBKA 3ZFJA 4EIKA 2CQ7A 2JQ7A 1OU9A 1IL2A 3CO7C 1R5GA 3K1MA 4H2XA 2JJ9A 2MMPA 4BE2A 2CW7A 2R5AA 1WJRA 1JO8A 1XNIA 3MZHA 2DBMA 4A3GJ 2DL3A 1D1BA 3CCRQ 2ZT7A 3DBHB 2MBFA 3QOPA 2BY3A 1KHCA 5FJ8J 3OV8A 4BQNA 2CS7A 3TDUC 3JCMW 4HVWA 4Y15A 2Q8KA 4A93J 3HGGA 3SDBA 2VGNA 3IAS2 1N9WA 2CU7A 2JN6A 3R60A 3IL2A 1UDLA 5J3BA 3I53A 3PUBA 3ME9A 4AH6A 5HK3A 3CCMI 2ZR3A 2KXDA 4IUUA 2P6SA 2LKXA 2RI2A 4Q4ZF 4AM3A 4J9HA 1LFPA 2E3CA 4BE1A 3VRZA 1I6XA 1ZREA 1QVPA 2VJ4A 4ZYEA 1J2XA 4ZTJA 4AYBN 2O6GE 1X2QA 3NETA 2ALYA 2XGXA 4QVDA 1DQUA 1SFKA 2M51A 1KK7A 4LVJA 2CRGA 2I8DA 4XLPF 2MFZA 2CSIA 1ETXA 4HCZA 2CO5A 5CR2A 3K4BA 4AG2C 3RGLA 3FB9A 1ETVA 3JB9I 1MMAA 2XAHA 4BQOA 3LNQA 2KT8A 4B09A 3GFLA 4HG2A 5JVTA 1OX8A 1M8VA 2KP6A 2K5IA 1R22A 4WI1A 3QG1A 5AIPA 2L89A 4XONA 1JEGA 3WG7H 2O9LA 1W70A 4KIFA 2JS2A 1JTYA 3O3KA 3OL4A 4UP7A 1L0OC 3RYPA 5HDNA 3OSGA 1WNLA 2DT6A 4P9UA 5GAOq 3KP4A 2A08A 1YITA 3MD2A 2EYXA 2LKSA 2DMOA 3KP6A 2PUOB 4A12A 2VYTA 3SWNC 4XU2A 5JLXA 1E24A 4CA0A 3A5ZB 1Z67A 3EG2A 1W7PB 3HL2A 3B73A 1A0NB 2C6YA 1X3WB 3TEDA 4XIDA 1IN6A 2V6EA 2EYZA 4R0KA 4BI3A 1JJ2S 3RCOA 3HRIA 1YI2I 1SPKA 3MF1A 1F5TA 4LIUA 4AC0A 3TU4K 1TLHB 2VBWA 1RAIB 2LQWA 1VQ8I 2HZYA 2ZT6A 3PUFA 2G7UA 4QIWN 1TP4A 3K4JA 2R7UA 2EW3A 2E5QA 2FOWA 4VUBA 4OINF 1RADB 1WHGA 2Q5HA 4B3AA 1Q81C 2X35A 2VQGA 3M3YJ 4IJAA 5ERIA 5FKKA 4A3IJ 4HF2A 4A3JJ 2BW3A 1KZHA 3VS1A 3CXCA 1VQZA 4L0YB 3C2BA 1RAEB 1BB9A 3GWZA 1TH7A 4RTVA 2R3SA 4ENMA 1T39A 4LXCA 3GX4X 4HLYA 1V3FA 5LLQA 1BI3A 4ZGJB 1UHWA 1KYWA 2IP2A 4MMKA 2L9RA 1SD6A 1N8RU 3OD1A 2OQRA 3X28B 1SHGA 3CMAQ 4H2UA 2HVQA 4J9CA 5KE2A 2A6EF 2KYBA 1KFZA 1QP2A 3Q9SA 4M73A 3HFOA 2XPWA 2C7IA 1YW8A 1S8NA 4RGXA 3MCAB 4ZNXA 1VI0A 2H1KA 5DM7R 4IVNA 3T1BA 3PNWC 2FRHA 4FIBA 3REAB 3BR5A 4EGZA 2E12A 3MEYA 4O6JA 3ZN0A 1BW5A 1V5GA 5GAOp 2O4XB 4XR6A 1UG0A 5FKOA 2V8IA 4EPCA 3X25B 3G4SQ 2M16A 3F22A 5J1RA 2HTJA 3ZQLA 1FPQA 1D1AA 4P55A 2EGAA 5J40A 3VS6A 4C8QB 1U6GA 2QSFX 3HRUA 3VS0A 2M02A 2DL8A 1NG7A 3ROUA 4DIQA 2XG8D 2O2OA 1E2XA 4AIHA 5JLWA 4TVAA 2EIMH 2JPBA 5CKEA 2YX4A 1WJAA 3CCSI 2ZJQF 1I3QJ 2HEOA 2CP0A 1HC8A 2GNCA 1X4OA 3HPWA 1GL5A 4OMFB 1S72Q 2HL3A 5FLMJ 1LEBA 5C3EJ 2A68F 3RKQA 1H89C 3KXTA 3JB9H 3EH1A 1X2NA 2YWWA 3M4PA 3FJPA 4HAMA 1Z77A 1VUBA 2RHQB 3QRFF 2R7DA 4X9DA 2E35A 2DYSH 2O03A 3HRTA 2QG9B 2K3XA 3TEEA 2V8KA 1SKUB 1JTXA 2ZIMA 3L2ZA 3CCUA 3X20B 2LQ8A 3S1QJ 3RQIA 2AO9A 1RZ4A 3CMAT 2J3MA 2RQWA 4BQAA 2EQKA 3LSIA 2W24A 4FYVB 4II1A 3VYGA 4RMFA 1YFTA 4KA4A 4IHTA 1XGNA 1VQPA 2KY9A 1Y0MA 5LRRA 3RZDJ 2WAFA 2Z16A 4L5JA 3OYJA 3K9TA 1NPRA 3C12A 4J9DA 4NL2A 3DKMA 1ETOA 2K3BA 3KFUA 2DMQA 1H9TA 4PHCA 2ZNZA 4FISA 1B9NA 2O8KA 4A3DJ 2CP5A 5LJ5h 2R7FA 1HQCA 2ID3A 4IO9F 4HQMA 2MABA 5C44J 1ZKGA 2ME6A 1WJ5A 1U1TA 4CH5A 2VXFA 3CCYA 1XGSA 2FJ1A 3CCJA 2E5AA 2NS6A 2ZZGA 1HKSA 4KFCA 2GXBA 1K78B 1ZSZA 3QO8A 3E1SA 3M8EA 1Y96A 4BD3A 3CC7I 3CQTA 3JCMX 2Y69H 2BE7D 4MDXA 3WODF 2J5PA 1U1SA 2LT1A 3VKIA 4BDYA 3HDDA 1X2KA 2VV5A 5IXBA 1E17A 1BBZA 4GO1A 3CMYA 3CJTB 1FMVA 4XKCA 3UDCA 3CC4Q 1GXPA 3VQXA 2CS3A 4LB6B 2CW0F 2IA1A 2ZJ2A 1TWFJ 2CWEA 3L9FA 4LOCA 3T5XA 1PJRA 2JWTA 2STTA 1PRLC 2EQUA 2CV2A 2MC4A 3M4YA 4FT4A 4Z8AA 1SEUA 2O31A 4C5EA 3JCMb 3F3XA 1Z9ZA 1K9AA 4DYQA 1D0XA 1MW7A 3OYYA 4LITA 2PMHA 3CXCP 1VQ5T 4YRMA 4OOIA 2L2PA 3QPTA 1WGSA 3JTGA 4RB2C 1U78A 3VUBA 2EWNA 1PG5B 2VKVA 1UB4A 3DLLA 2VBYA 1M1KU 3OYMA 5FKMA 2E34A 3J7YJ 3HFNA 4AU7A 2GA1A 3HUGA 1VQ9A 1NJ5A 3QWYA 2CV1A 4Y33A 2ZPEB 3C4SA 1WA7A 4BHPA 4BUGA 2BOLA 3KP3A 2ZZFA 4YYEA 5HODA 1SFEA 1WGXA 1XX5A 2JZYA 3F8MA 5J6XA 2EA2A 5FLXK 1SFOJ 1AOJA 1WZOA 2A7YA 3E2UA 4J7FA 1FC3A 4RGRA 2XAGA 5EG0A 2MPXC 4X1VA 4HVCA 8ATCB 3ZCOA 1RUNA 3PO3J 2BHYA 2BBYA 4G6DA 1VF9A 2KRCA 3KZZA 3TMOA 1SF9A 4JS5A 1Q81U 2E1MC 2DIQA 2QUFA 2OTLA 1H4TA 1QF6A 4HF1A 3JCMf 1Q82R 2KZGA 1IO2A 2CQNA 1H3ZA 2W4SA 2CYYA 1YJ9I 2D0NA 2EZIA 4JX5A 1F1BB 4E7ZA 2CZ6B 4L9TA 3R6NA 3UPUA 3BTLA 3QO3A 5F08A 1KG1A 4ITVA 4A0YA 1GHCA 2DA9A 2DKGA 2RI5A 1VQKT 2GM4A 2HKOA 1XN7A 4LNSA 2X51A 3JRCA 1ACMB 1QCNA 3KP5A 4XKVA 1JE8A 1YFHA 2K4BA 3JRIA 3MKZA 4X6AJ 3TKYA 3GZ6A 3GBQA 3KFVA 4OB1B 1KOGA 1NJIU 3OYNA 4IRHA 1UGSB 3H9QA 5M5WJ 2DL5A 3OW2A 2F2XA 4HA8A 5GAN4 2ELJA 2VBXA 2L4MA 3UA6A 2PNIA 5EYRA 4RTUA 5B5EC 2OTJI 1O75A 3T9NA 3I9QA 2OTLT 1X2GA 3P8YA 1TL8A 5K5RA 1I6HJ 2LREA 2Z3YA 2NXNB 3RERA 2BEOA 3ZQIA 1B72A 2MLGA 3FXOA 3LFUA 2VC8A 3EHRA 1VQ8Q 2RNAA 4AD9A 3A5ZA 1C0AA 5FD5A 3G2BA 1BBWA 2HYGD 1XSDA 1CF7A 3EQLF 4KMUX 1Z6RA 4EGYA 4KUIA 2EYYA 4F7UA 1HXDA 3BQYA 1SEMA 2KHMA 1ZBXA 1GGMA 4MTDA 3CMMA 2YLCA 4KH1B 5HK0A 1KC8C 2KXCA 1Z21A 3FIFA 4MIMA 1VQ4I 3JCMP 1FY7A 2QK0A 4KBMB 3VU3C 2KT0A 3K70C 4DOZA 4HDUA 2DD4A 2L3PA 1IHVA 3Q3SA 1FSEA 1LOJA 5E17F 3KBGA 2ZTGA 2R7OA 3CCUQ 1BC8C 3A1PA 1NYRA 1RETA 4P96A 3MZ8A 1SSHA 3I56T 5J47A 4QSHA 3LSTA 3E19A 4N0BA 2DN0A 3CCEI 1R9TJ 4ZTFA 1CKAA 1B1BA 1XMKA 2GWRA 3M54A 1SD5A 3R07A 4P71C 3HBLA 1YITQ 4ABZA 3X24B 2QEXI 3BQZA 2KJBA 2R7RA 3CC4I 2DOFA 3NARA 3M57A 4M75C 3CCEQ 5BS6A 1I4K1 1R77A 2WADA 1UFFA 1KC8R 2DERA 2DVJA 4C2UA 2CGPA 2LD5A 2VUBA 3M0SA 3HFZA 3HXWA 2CP3A 1UJ0A 4DBRA 4UPAA 4Q15A 3HOZJ 1AEYA 2W1OA 2JUGA 3HIFA 5DLOA 5K1XA 4ESRA 3WTXC 3DBRB 5I2MA 4JUVA 2JMAA 2R7VA 1Q81R 1X01A 2B7EA 3J7AF 4IUVA 5DUKA 3I58A 4EATA 2ZJPF 1BKBA 3OSVA 4IUPA 4C2TA 5CIUA 1SERA 2Y9YA 3FKJA 2LC2A 4DYRA 2JA2A 1EQRA 1YG2A 2FA5A 5DCMB 3TQNA 4BACA 2EV6A 3IWZA 1K83J 1DJ7B 1OZ2A 1YRNA 4A4KA 2PMEA 4BBSJ 1X75C 4IUTA 3GP8A 1R5ID 2HQRA 2XK0A 1HKQA 1I50J 3IAM2 3GYHX 1STZA 3I4MJ 2WSEE 4M75E 1MSFC 1USTA 3LAPA 1E3HA 3HRMA 3NEUA 2RHIA 3OL3A 4CYDA 5LHIA 5GPCA 4HNTA 3NPFA 3M1EA 3TSWA 5HS8A 4PJLA 4IXAA 2LNVA 3OMGA 4EDUA 3R6SA 1ZARA 2DFEA 3F8BA 4OMYA 4MMLA 4F04B 5C6SA 3ERRA 4YRRA 1YHQA 2RF0A 1WJEA 5E1XA 3RESA 1YFSA 2KR3A 1HC7A 3VJPA 3P8TA 4LG3A 1KQ1A 2KROA 4ZN1A 2DMTA 2JRMA 1BI0A 1GV2A 5HVQC 1U8RA 2VOPA 2AIRB 1FP2A 2CUDA 3M4GA 3LSGA 4BI8B 3WTVC 1OPKA 4LD9K 3GTGJ 2VPLA 1KU2A 4BE0A 1Z9QA 2JM9A 4PLLA 4DA4A 1BN5A 1XG1A 1NYFA 4ZH4F 3DKYA 4D1QA 1SVLA 2DRMA 1D3YA 1QA6A 3VRYA 4M7DA 1NH3A 1J7KA 2HVSA 2K3YA 3RMSA 3AHUA 2DA7A 2IEKA 3PNVA 4OU0A 1PP8F 1QKXA 5IHKA 4NL3A 2IY5A 5CQGA 3Q5FA 2LRQA 2YX7A 4DJAA 1JKPC 2K3PA 1UB9A 4KT6A 1ZA1B 3OYCA 4W97A 5EEHA 4YRVA 2KPMA 4EJVA 3CCQA 4N4HA 1TOVA 2TDXA 3CCVT 1AA7A 1C0MA 4DZPA 3KZIC 4M7AG 1PCXA 1H8KA 2UV1A 1YTYA 2M1HA 3PQJA 1Q86R 4M7AF 2E7WA 1QVFS 4K11A 5FU7B 1RI0A 2AMCB 3KUFA 2XAQA 4ESFA 2DFHA 1ZELA 2PUKB 5FLXZ 1BK2A 4PJOG 1Z3XA 3CEYA 3SFIA 2A36A 1MSEC 5D8KB 2XSJC 1PYSB 1NNHA 3LWFA 3BG9A 2IPOB 4C8QG 1BBYA 2KIUA 3NAUA 2JVGA 1BJZA 1LUJB 4XRSA 3L1PA 3HC7A 5FLVA 3S1NJ 2FG0A 5D6XA 4HWSA 4YPFA 2BY1A 1GBQA 4ZJZA 4M77E 1K73U 1JT0A 2PN6A 2XAJA 3KYLA 1R5HA 2P0QA 2ZMEC 2MH9A 3EFOB 4N0AC 3QYBA 3INZA 1KQ2A 1N77A 4M3BA 3RI4A 1FJLA 3J7AO 1YIOA 4XK8E 4MZPA 2HXIA 1X4PA 2QKLB 1DGWY 1VQ4T 1LFBA 1PKSA 5I11A 5E1ZB 5F0CA 3K2AA 1KQSP 1FOXA 4YRKA 4JRQA 1X3ZB 2CSQA 2EBIA 4HYEA 5K7ZA 2AK5A 1YX3A 1P92A 3VFZA 3RPQA 3UWNA 2KIQA 4Y13A 5F1JA 2GXAA 1WCMJ 3OS1A 3I56I 3I55T 3HFZB 2CREA 2KRSA 5CKHA 3CMAA 3LSSA 4YRNA 2IS6A 1MJBA 4HW0A 2W85A 2LR8A 3K7AJ 2NOJB 2LFBA 4F7UF 4MZMA 1F9NA 1R49A 4PJJA 5GAMf 5GANg 5D6WA 3CMEA 1HF0A 4J9FA 3TEHB 4MQ9F 4JJBA 4A53A 1Y0NA 3S2WA 2DFFA 2JNGA 4IUQA 1FSHA 4YCVA 3SYTA 2JTFA 3U21A 2O4XA 2PMUA 3LOCA 4RUGA 1VQOA 1G5IA 3HXUA 4YRPA 3R0AA 3RL6A 2AKKA 1AVZC 2FHDA 5F64A 3TL4X 4KR2A 3U9GA 2FYKA 3EFRA 4G6TB 3IHUA 2E5ZA 4J9BA 2VPRA 1U3OA 1EH6A 4J00A 4IZZA 4JDSA 1HCRA 2X0LA 1S7AA 2DPDA 1NEGA 1FNNA 4GDFA 5CPRB 4M71A 1U06A 4AVZA 3GTMJ 2IS2A 1X58A 2DZ9A 4F52A 3D5LA 3CCQT 1Y39A 3A01A 2EZKA 4TVRA 3EGDB 5KYWA 1YI2A 3OOUA 2L7MP 4X1EA 3VPRA 1KHIA 3BJ6A 2DXBA 3CPFA 1QVGS 1AKHB 5E3MA 2KK4A 2GXGA 3WTYC 3HL8A 4Y17A 3E9HA 3BTCA 3D5SC 3ZMDA 5KAFC 4M9ZA 4CH7A 5EGOA 3JSPA 3S3OA 2NWMA 3MEUA 3NHNA 1K8AU 2M2EA 4YRSA 3RTRA 2KIMA 1NYQA 3WU1B 1FMWA 4LLNA 4MNUA 1T0HA 2E6NA 4YP0A 1SC7A 3M59A 4CC4B 3PSFA 1YITT 2JA8J 5GJVB 1RACB 5LJ3d 1LNWA 3OIOA 3VS3A 4XL9A 2DMNA 3HXVA 3ZN1A 2VB6A 2MD5A 1G2HA 4GFBA 3CLQA 1KU3A 2QM3A 3J80K 1T0FA 2WY8Q 2X6WA 5FRMA 1M2VA 1T3SA 2JMCA 3HXXA 4OLFA 2R7ZJ 4FYYB 2O01E 1WJQA 1F36A 2XU8A 2BZTA 4MDWA 2ZFWA 3RKXA 4QVZA 2PLYA 2OCCH 2EA4A 3HOXJ 2PFBA 2X48A 4D6WA 1X19A 3JTHA 2LBFB 5H2FC 3REBB 5J1YA 4B47A 1FX7A 3FC3A 3H3UA 2QSHX 4MEYF 1Q1HA 4IRIA 4EMKB 4J6XA 3UGQA 5L3EA 3E5QA 2X1EA 2VJJA 4ENNA 3Q9VA 4E7JA 4RQFA 2X4XA 2E1OA 2D0QB 3DLAA 2PJRA 1QVFP 2NUPA 3FJ5A 1SETA 1SD4A 1Y8RB 3M4QA 5CQEA 1JJ2A 1ITYA 4JX4A 2E1HA 2DVEA 3GXOA 2UZKA 2HQAA 2EILH 2MI6A 5CLSA 1ZG3A 4BEHA 4M4ZA 2KRMA 1QHGA 2ZO4A 5HOOA 4NOYA 4EVIA 4XSZF 1ASYA 2EVRA 5KE3A 3S2DJ 3C3WA 3BG5A 1NK2P 2FPFA 3QWXX 1VQ7Q 4KULA 4RG2A 5ILUA 2DTRA 2O7OA 2KJCA 5L3FA 3SWNB 4O5VA 4A6EA 2RJFA 3DLMA 5IN1A 4CUGA 1D8JA 4HBLA 4IHSA 4M7AA 2LX7A 1IRXA 4L0ZB 4J6YA 3DF8A 1YQAA 4YFXF 1QQJA 3D7SB 3JSCA 3L42A 4JRPA 2DDZA 2ZXWH 3BTJA 2XF7A 1I3AA 1TG0A 5CJ9A 2HDWA 4IEJA 1PUEE 2HOAA 1A5JA 5HCKA 1S9HA 1MJ9A 2XPVA 3ECOA 3H92A 3HSFA 2XF5A 4PGHA 3MQZA 2IA0A 3E5UA 4N4IA 2K27A 4L18B 1H3HA 4ZTUB 2PU9B 1KQ9A 3JRZA 5H6RA 4XEOA 3JCMJ 3JCMh 2H8RA 1HSTA 5KK1A 2ZPHB 4IF4A 2P8TA 3F9KA 5F6FA 4YFNF 4E70A 4QTRA 2OJ2A 3LH5A 4RTTA 2GFUA 3I55I 1O3SA 5CKBA 3S93A 3GTJJ 1DP3A 3BR6A 2LT4A 2Y2ZA 5GAOr 2FOKA 4YIIA 3SXYA 2L8DA 1X1CA 4ZDLA 2HBWA 2W10A 2HEQA 4YTLA 1M90R 4P74C 1MDMB 4M9SA 3CJNA 3REOA 2VQHA 1BW6A 4R1HA 4E7KA 4A5NA 4WCIA 1DPUA 1FBQA 1U5TB 2EYWA 5HLGA 4HVUA 4P3NA 2HKNA 4TQFA 2QI2A 1MMSA 2DNUA 2AQEA 4XM3A 2XKOA 3GVAA 3V8KA 1UG1A 4ATOA 3LSHA 4AUXA 1YWOA 2K5LA 1RAHB 2EH3A 2GQQA 3DEUA 3IRQA 1WLPB 3MEAA 1XMXA 1HBXG 1MMDA 4M75A 1VQMA 1XGMA 2L7ZA 3NRVA 1BCOA 1A6QA 1X2MA 2HL5C 2M0YA 2XICA 4P72A 1LE8B 2JW4A 1U9NA 4CYCA 4BDZA 5FU6C 4ZYAA 2JUFA 4A0ZA 4BHCA 4L5GA 3CD6I 3TCJA 1K73R 1KYZA 3HSRA 4FW1A 3M8JA 2CKKA 5IOYA 2FB7A 3C0CA 4E6KG 1I81A 3ECHA 2HI3A 2LQNA 5HY6A 2EL9A 1OMIA 1DDNA 5LD2C 4DEYA 4KYWA 1Z91A 4FX4A 3D0SA 2QGFB 1TZLA 3ABLH 4ON0A 4X5OA 1OI1A 1YJWT 5KYNA 3OYLA 3CF5F 2EV0A 3QU6A 4EJUA 1M3AA 2M0OA 4P3PA 2X4WA 1UGPB 2I4MA 1YE9A 1RABB 3FXQA 3KEQA 2NYXA 2JT4A 4A54A 2XHCA 3I64A 1NZ9A 3RQ4A 3HHTB 1ETQA 3W6VA 2GAUA 1JUMA 1D1CA 1MBFA 5CVUA 1W1WE 2EQIA 4M77C 3P8BB 1I07A 4GRIA 3ONQA 2LVMA 4OMOA 1ORKA 5LJ5f 3HOWJ 3I56Q 3BJUA 1MNMC 1YJ9Q 4LVKA 5IT9E 1YB3A 4FW2A 1SAUA 1BYMA 4E7SA 5BPDA 4IURA 3I4NJ 3BDLA 1WQ7A 4OMLA 2IBDA 2RKHA 2CSOA 2H94A 2VIXA 2KGTA 2H6BA 2RA2A 1USYA 2CT4A 3K4CA 4KGXB 5KCMA 2HAXA 3QODA 3HPHA 5M9OA 2V9KA 3FKIJ 3A2KA 5BMZA 4G7OF 2HSPA 1C0WA 1WQ2A 2YUQA 3HY1A 5E3OA 3MKWB 1N6AA 4G94A 1D5YA 5DD4A 2HCKA 2OQGA 2LYCA 2RAEA 4QWQA 1MMNA 3JAMK 4IHWA 2QGGA 3IC7A 1AHJB 2ZSIB 2A69F 1ZX6A 2Y90A 4UUTA 1X3UA 4AWXB 5DUIA 4OB3B 4NQWA 4A6DA 4BL0B 1LDJA 3W2WA 4RAZA 2F5VA 4YFKF 3KETA 2OTJQ 2FRWA 4UUVA 2F1LA 2QQSA 3A98A 2F6CA 4YDQA 3FDRA 1W6XA 4II3A 1OISA 4RDUA 1RAFB 1B9MA 1M1EB 4F7UE 4H2XB 1PHTA 1MNEA 3JRHA 5A2QE 4G9YA 1IXDA 4XKBA 2M1BA 3FXMA 3ZOBA 3CCLI 1EFWA 3PE0A 1H4SA 5FWBA 2DYRH 4B1RA 1T3LA 4CI0C 4PJOE 1SMTA 2OU2A 1ASZA 3HUGB 4S0HB 4UHTA 3RACA 2JK3A 3DU5A 4H2VA 1JGGA 2X6OA 1Y7XA 2FPEA 3BR3A 3BG7A 4LD5A 3H5AA 4I01A 4DNCA 1Y71A 3QYGB 5FO5A 2QBYB 1UGQB 1M3CA 4KIBA 3EUHA 1R23A 2O3FA 2H1LA 1RR7A 1GXQA 2EFQA 1R58A 2BKDN 2H3EB 3IQLA 5CVJA 3KX2A 1OR7A 1W4MA 5JHFA 4HRIA 1SRMA 3FWEA 2LTOA 3V4GA 4OMMA 1JHHA 4BI4A 3A7UA 4HXJA 1D0YA 1DUXC 3UT1A 2DE0X 3GLLA 2C06A 2FD5A 4DW6A 2E1NA 4ZZDA 2W25A 1PNJA 5HDKA 2ZJRF 4TV7A 2LJ3A 4NDLA 1VQ5A 2W84A 3OY9A 1JRIA 2YXYA 2GFAA 4ANJA 2R7XA 4M3FA 2DIGA 2JS0A 2LJ1A 1PRMC 4CS4A 3HKZN 2E2JJ 2A5YB 2ID6A 2L7KA 1ZHFA 3TW6A 2CP2A 2WWYA 3MEWA 4JJNK 4YCUA 4B3XA 3CCJQ 3EGXB 1V55H 4XKWA 3ZQGA 2D1VA 2HZDA 2E71A 1FTZA 2NRAC 5IYBJ 4D7MA 2AKWB 2H3JA 4RDXA 2YPRA 1N75A 3SDGA 2JTMA 1S72T 4BY7J 2W48A 4P1WA 2Q7HA 2FEZA 1YIJQ 3I5RA 1N25A 2LZ6B 2FBHA 3CQZJ 1YI2T 4YIRX 5HNFA 3CPWS 2VUMJ 3PMIA 2A3SA 2LKPA 2JMWA 1K9MR 5L3CA 2F5TX 4JLGA 4OP0A 1QU3A 2DT7B 1RLQC 1RI9A 4H2YA 4ENKA 1YCYA 2EGEA 3MHXA 2XTIA 1ZGJA 1GCQC 4FTHA 2N8GA 3FXJA 3H1CA 3A0HC 4D5CA 2RHYA 3HFVA 2XGEA 5D6EA 2YUNA 3VYRB 3ZMVA 4C0DC 2J5OA 4XQFA 1R4MB 2EB7A 2OZUA 2EFOA 2VE8A 1ABOA 1OQKA 2JZ2A 4M77B 1OYYA 2UXNA 2HZTA 1VYTA 4U7DA 1SFUA 4RM3A 1WDXA 1UELB 3FMRA 4M7DG 3H9NA 1QCFA 2AS5F 2HBPA 2X9DA 3HKSA 1WXUA 2XDVA 2EV5A 2AHQA 3EGUA 4B9WA 2DT5A 2Y75A 3MKLA 4IQ4A 1AWCA 1ZSGA 4M7DF 2QBYA 2OX7A 3R61A 4KISA 1FYNA 3EGXA 3GLXA 1K76A 1M90U 3W3SA 4LD6A 1N8RC 4M75F 5GMKm 1I27A 1WKMA 4LK0F 3BROA 5KYXB 2HYFA 1R1VA 1ENHA 1X6BA 2HTSA 5ECAA 3JB9G 3CJRB 2Z33A 1BI2A 3K6GA 4DBFA 3IKMB 4RMOA 4PJOF 1K4US 2ZXJA 3FZVA 1XDUA 2VC1A 3HXLA 3VYUB 4XRSG 1AKHA 2IS4A 2IA2A 2QVOA 4GXOA 2R4GA 3BPVA 4MGRA 4N4NB 1S72I 3JSOA 1WHMA 3IALA 3W6KB 2XMFA 1V54H 3LX7A 2ZCEA 2YRDA 3CP8A 4OGEA 2ZAEA 2LOOA 4MEXF 2M4GA 1X1PA 1R1UA 3O2PE 5TGTA 2F2VA 3C94A 5GAMd 4WCGA 4C92B 2QTXA 1XDSA 3TO9A 4CZCA 2YHTA 3CC7Q 4D7NA 5F0FA 3CMET 1E1OA 4B8XA 1ACIA 1PWTA 3ASNH 3BY7A 1Y1VJ 4KIGA 2P5VA 5D5UB 2DODA 4KMFA 4A4EA 5LJ3g 3ABKH 3HXYA 2KISA 2M30A 3FMSA 5LJ5e 2L5QA 2NVTJ 4HCCA 1X2HA 1VQ4Q 3HYIA 3CCRI 2OA4A 3E6BA 2JUCA 2PMZN 3TW7A 1SANA 5IP6A 3OR2C 2GLOA 4IOAF 2WB1N 3VDXA 2MD0A 2A05A 2FZGB 3P8HA 1JGSA 4B9XA 2E41A 3GMEA 4HWTA 2CUBA 3IV5A 4DGWB 3TGNA 4LNPA 2DQ0A 4FYWB 4YRGA 2QHSA 1JHFA 2BY2A 1E3OC 3OMCA 4L9JA 2Y0SA 2FPDA 5GANh 3M1CA 4PUSA 2YU3A 1NK3P 4BXXJ 2A6TA 2CUZA 1JXMA 5FFZA 4HT8A 1KQ0A 1GT0C 1LCKA 2AQFA 3CC2T 2EAYA 1IF1A 1IHWA 4D8DA 3CCLA 1BR1A 2ZT5A 2RPNA 2CH4A 3GFJA 1A04A 2V79A 5IT3A 1OV3A 5EEGA 2LDUA 2ISZA 4RCBA 1Y1WJ 1YHQT 4HSTA 2CUFA 2DXUA 1UFMA 1TUGB 5AT1B 2LSOA 3MJXA 4A3FJ 3P7NA 1AZGB 2ZPIB 3LQQA 4FM4B 3VS2A 3HXZA 2BIVA 2ZR2A 4UC4A 1TBXA 3HOVJ 3S3MA 2I4OA 4FSSA 1WRJA 3F8NA 1LE8A 2CT3A 3VODA 2FQ3A 5GADJ 2FO0A 2DF6A 2E65A 5GMKi 1EIYA 2K40A 1X56A 3H5NA 2HGCA 2RD1A 3DPLC 2ACJA 4RBOA 3JV3A 4BB7A 3KYCB 4U7BA 5GMKh 2AMCA 5TISC 4LDVA 3B02A 4FT8A 2RQVA 2GOMA 3CBMA 4F92B 4Y3OA 2R5YA 4HZFA 1ZBJA 3MKDA 4IHVA 1WHLA 1VQ5I 2G6FX 5CO7A 2DJNA 2HD0A 2X1CA 2EIKH 2JPCA 4AMCA 1NYGA 1IGQA 4S04A 4UV8A 1D3BB 3M0PA 3BP8A 5AONA 4N4GA 2KAFA 2V1NA 3M0TA 4RG8A 2LJ0A 1LYLA 4E7LA 1ODDA 1G2BA 4AVPA 3LYIA 5E3NA 1EA3A 2D8HA 5HNHA 3CC2I 2KEAA 3G1JA 2J6KA 1BBUA 3G1OA 1R0BG 3G3ZA 2RN7A 2IIMA 3VS5A 1USYC 7AT1B 1MV0B 1PD0A 2FX0A 2P4TA 5FKNA 2K5CA 3OQ5A 5C0MA 2RI3A 1MJAA 2EQMA 4PK4A 4HX7A 1YHQQ 1U5TA 2H8WA 1TXQA 1GVDA 4XLNF 1EF4A 5CAIA 3RMQA 2YS9A 1W7PA 2ARTA 1ZAOA 1QVTA 2YRCA 2F2EA 3FF5A 1ON2A 4Z88A 3I4PA 3DLLF 1XOVA 2RHSB 2QAZA 3HRKA 4IQJA 1C1AA 1RRJA 1WXTA 2RGVA 4UVCA 3ZPLA 5D6YA 4BXFA 2VLAA 3TDZC 1YJNI 3S17J 1Y8QB 1S6LA 2MA3A 3LSJA 1VQKI 2E10A 4AFZC 2Y48A 4OWRB 3CPWA 1ETYA 2I4NA 5GMKj 3TVTA 5K7HA 1W36D 5DEQA 3H3ZA 2DCEA 3WU0A 4ENJA 3JCMQ 2C0IA 3GOXA 4J8OA 5TRDA 1VQPT 1HTTA 3PTAA 3IH3A 5KVRA 4DYCA 5LGNA 4BH9A 2E36A 4I99C 3RKYA 1RAAB 3QWLA 3JCMe 2R5YB 5FW9A 5DD8A 3CLOA 2DO3A 4RTYA 4E7HA 3EDPA 1AWOA 1YO5C 3TEHA 5LBQA 1W1FA 4BS9A 3G1ZA 2KRFA 2OTLI 2XF6A 3FHZA 3I0TA 2QF7A 2AKWA 3GUDA 4JX6A 1WHKA 1O4XA 2M7BA 3LSKA 1VYVA 2V9PA 1K7AA 1VOMA 3GIBA 1IUFA 2L02A 3P9CA 1AZEA 1UCRA 3SQNA 5GAGJ 4OF1A 2OTLQ 2FXAA 4LVLA 1I5ZA 2EFNA 4IX7A 3NWTA 2EKHA 2EKOA 3A32A 4IL6C 1JBMA 1G3WA 2ZFUA 1IV6A 3QJYA 2WSFE 1PSEA 3CD6Q 3E97A 1HOMA 2RQQA 5GANf 3S14J 3O6BB 1OYWA 4XTZA 3CCQQ 2PG4A 1WHUA 3J81K 4OMZA 4BEHB 2DFIA 1Z3YA 3F23A 4CGZA 3PZCA 1RIOH 2DL7A 1KU9A 1H9GA 5J4VA 3BTIA 2RM4A 2O5RA 5GANj 1O57A 4PKCC 4UY8I 1KSWA 2AZSA 4M78D 4RAYA 5K5OA 3VBBA 4M78C 2V1QA 4M78E 2IGKA 1FLIA 3SD4A 2Y0SN 3NTIA 2LCSA 3S16J 5GAN6 1GBRA 4K88A 2F5CA 2NAZA 1TQIA 1IW7F 2FNPA 2Y9ZA 1MIJA 2VKHA 4AIJA 2LCCA 3A7RA 1K4TA 1AWJA 4PJOB 5JVGF 2B9SA 2NNNA 1R4NB 1QPMA 2XC7A 2HYJA 3ZMTA 1FXXA 3FXLA 2X4YA 1YJWA 2PMZA 3JAMZ 5L3BA 3SZGA 4JBAA 1CGPA 2F5FA 3LSPA 5E18F 5GMKe 1HW2A 3IKLA 3DP7A 2RO0A 3CMEQ 1BU1A 2NVQJ 1SSFA 4FL6A 1M2VB 1K6OA 1VQ8T 4KICA 2G7HA 1BIBA 1N5ZA 1OKRA 2L0KA 3RZOJ 3EG9A 4BY6C 3FM5A 2EYQA 2M7AA 1E1TA 5IY5H 2OC6A 1M9SA 4J7IA 1YOVB 2J06A 3VUZA 1VQOQ 3LMMA 4GY5A 1OCRH 2EIFA 2QQ9A 4UVAA 1PP7U 4UP9A 2DJQA 3M55A 4I0BA 2JSPA 2K9NA 3MVPA 1UHFA 3KFWX 2L4AA 3WGGA 5F5WA 4LDXA 4HT9A 4HNUA 3OIQA 1Y0UA 2FNAA 3F6VA 3J80E 3ICAA 1HW1A 1K9MC 3L09A 2OJED 2X9HA 3DBLB 1Q7YC 3W2AA 1YJWI 2PI0A 1QHHD 3HOTA 2JN0A 2BW3B 3ASKA 2GBYA 2DMPA 2QQAA 3A01B 1HLVA 2O8XA 3GZNB 2VXDA 1FYLA 2MAMA 1IAWA 1TTHB 4X9CA 1K61A 3CCVA 1ZQ1A 1VQ7T 4RQEA 2VT3A 4CRIA 4CXFA 1BR4A 3W3CA 1JXOA 1X1AA 2DO7A 4M3GA 1UZCA 2VKEA 4MHGA 2R5MA 5DM7F 2XRLA 2A37A 1YS7A 1F4KA 5BOXA 2HDCA 2NOGA 4RLFA 1BA5A 1UG2A 4WXDA 2VQCA 4RGSA 3JRBA 2DD5A 5M3FJ 2OAUA 1VQ8A 1KQSA 3CESA 1ON1A 2LF8A 3E6MA 3OWTA 3SZTA 4HQEA 1GDTA 1Y57A 1HKTA 2EJ9A 2LLKA 4CZZA 3EFOA 3EH2A 4JJDA 3UA7A 3E9IA 1VQ9T 5LHHA 2A5WA 4XN0A 5EF6A 3OYAA 3H5RA 3WTWC 1TUCA 2DFUA 4FT2A 3OW2S 3A8HB 4JYKA 1SG5A 2FZCB 4IKFA 1X55A 3REUA 3VSLA 1WJDA 1ZRDA 2LK2A 1QZEA 5L3DA 5LRSA 5LGTA 5J8FA 4A3KJ 3CF2A 2HKQB 3ZR8X 4KITB 3CCJI 3JAME 2Q2EB 1IDZA 1KMNA 1UGRB 5IP9J 3MP8A 4P9FA 5CVVA 1MD0A 2HWVA 2DOAA 2DBBA 3WE3A 3WTTC 3JRAA 1QLYA 2BZYA 3MF2A 1QVGP 1VQPQ 2FL7A 4C92A 4IPAA 3C1DA 4II2A 4G7ZF 1NE8A 4Q47A 4OAZA 2YRVA 2GZWA 2ODRD 4QPOA 4YRFA 4Y52J 1ZSZC 2IPQX 4UV9A 3CCSQ 2CP7A 3G7ZA 5E3IA 3RPUD 3ULQB 1FBSA 4ZGDB 1BM9A 1EVKA 1ULYA 4ZN3A 3IKVA 1DU6A 3MEVA 3CCEA 3H9GA 1O7FA 2WV0A 3E5XA 3B6CA 4RB0A 2RDPA 4L9VA 3G6ET 1Q7YR 2M34A 4RAGA 4EV0A 1MMGA 1OQYA 1OYXA 3EAEA 3GFMA 2JOYA 3PT9A 3CC2Q 2NVYJ 4HPQA 4M7AC 3GEZA 5GP9A 5GAN7 2BXYA 2TRTA 2LY9A 3PSIA 3X26B 3UNGC 2CQQA 3CCLQ 1WI3A 3CBPA 1YLFA 2L3DA 4WF2A 1IRFA 5JFRA 3N4MA 2ZCFB 3PIOA 1MBJA 3GF2A 4XLCA 4EM1A 4L6V5 1UJ8A 1JUPA 5K7FA 1OPLA 2VASA 2LP5A 4RB3C 5A0GA 2JTVA 2HDAA 1JUSA 1AOYA 4TQDA 4FX0A 4LMYA 2DJZA 3BPXA 1O3TA 3ZQQA 2F4MB 3N97A 5D4SA 2HNIA 2RJDA 3CCVQ 2DTIA 4XEMA 3E7LA 3PGGA 1V5EA 2BYVE 1CKBA 4DBHA 3DPUA 2DDAA 3H35A 5IP7J 4WK8F 1VA7A 2KVQG 3BE3A 4J9EA 4N0AA 1X1DA 3BG6A 1G83A 9ANTA 4HDVA 1ZK8A 2RB6A 2QWWA 4RTWA 1I5LA 3JB9F 2Q7GA 3BOQA 2HPMA 1W2BS 4M7DD 2VE9A 1IZ1A 1V29B 1EVLA 4NQWB 4BKXA 3WHBA 2Z9OA 4C5GA 1ADJA 4I98B 3GNGA 4M78G 2R93J 2E4HA 4MQVA 4DEXA 3A8GB 1KA8A 5LJ5d 2HPIA 3BR0A 3GF5A 4KNYA 4PLIA 3S6WA 1EIYB 3WG9A 6PAXA 1W0TA 2JT1A 4PNOA 3FM3A 2DL4A 2RHUA 4XTVA 1G3SA 2OPTA 3HTUA 3I56A 1HJDA 1VQ6T 1GV5A 4E7IA 4C92G 1TT0A 3MMYB 4PSWA 1YIJI 1IXCA 5DV5A 1NG2A 3A02A 3JCUC 3IRRA 3WVDB 1EOVA 2PQ8A 2M0CA 1EV7A 3K4LA 3I5UA 4UB8C 2KRHA 5D7UA 2K4YA 1X6GA 3V7RA 3N05A 3MKYB 3HTRA 5CK9A 1RC9A 4A3CJ 4LFUA 1I5OB 1FZPB 3DTEA 1G8XA 2CG4A 4HV5A 3L2CA 3VB2A 3BDDA 2EQRA 1VQ7I 1J5YA 1HA8A 4JLIA 2V8JA 4M7AD 5I21A 2K4JA 2HOTA 1N27A 2CJBA 3IKTA 4FASD 1YW9A 2EQJA 3QHSA 1D09B 5KYYB 3VOEA 3CCRA 1YS6A 1W36C 4FQGA 1Z7UA 3CUQC 1ZG5A 4A3BJ 2Z99A 2WB1A 4XLAA 1WJSA 1WX6A 3THKA 2EPFA 1GRIA 1I8FA 4G84A 5L3GA 4I76A 3CC7T 3QPHA 4BNCA 5HS9A 2RHXA 2EINH 2QYOA 4OB0B 4OMNA 4NUBA 1ZLJA 1DGRM 3K70D 3CCMQ 4JK1X 4TVYA 3VWBA 4PDKA 4M75B 2NS7A 4GLKA 2K57A 4Y91A 2L9VA 4LDUA 1B8AA 3WGIA 1GLNA 3SFMA 5KH6A 3GTQJ 4L5IA 1AD5A 1NPPA 3PIPA 2AZVA 1WHHA 5LL6S 1OCOH 1VQMQ 3CCRT 1ADYA