3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
3M8FA 4HDUA 3J80Z 1RUNA 3TOBA 1R58A 1HKSA 2FQ3A 5HDGA 2FB7A 3PGGA 1ZAOA 4UHTA 1B70A 1UB9A 4JLIA 2DTHA 2DTIA 2K27A 5DEQA 2Y48A 4AIKA 3W3SA 3JCMP 2DU5A 1R22A 1HSTA 1TW3A 3JB9I 2ADUA 2HZTA 4NOYA 1KGSA 4KFCA 2IW5A 1QZYA 3K1MA 2C7IA 3SFZA 3VQYA 2MLKA 4LNSA 3ABUA 3BZ6A 2EV6A 2YHTA 4LB5A 4M7DC 4H2YA 3WU0A 2K86A 3VQWA 3LSQA 1QF6A 1IRGA 2PBIA 1I4K1 3HXXA 4F7ZA 4EMKB 1SFUA 2CJBA 1WLEA 3TEHB 1YFHA 5GMKh 1SRYA 1OYWA 4N0AA 2F5EA 4IRGA 4YIFA 1W7PD 1OKRA 5KVRA 1J9IA 3RF1A 3S2WA 2JPBA 5ERIA 1YGBA 4P3PA 2KIUA 3Q9SA 2ZZGA 3SZTA 3O3KA 2KKOA 3B73A 5ICCA 1XCVA 1FBUA 5GAN3 4CZZA 2BV6A 1H0MA 2GXGA 1FSHA 1PYSB 1EH8A 1SAXA 3KZZA 1J5YA 3K9TA 4TVYA 3HRTA 3F8NA 4CXFA 3VFZA 5D8KB 4R79A 1U1TA 5GAN6 3L09A 3DPTA 4QLCU 4TTVA 2FRHA 2GA1A 4H02A 4YRSA 5F6FA 1P92A 3I0TA 1LNWA 1B1BA 4M77C 5E8IA 2NNYA 4NL3A 3HFVA 2DFIA 4RMFA 4H2XA 1WPYA 3KP5A 4YPFA 2XAFA 2QLZA 3E6MA 1QZZA 4YCWA 5LRRA 4XU2A 4LGWA 2EJ9A 3A32A 1LB2A 2OZUA 1FP2A 5E1WA 4TVAA 3KP3A 2WWYA 4RB3C 2BE5F 1WWXA 3TQNA 2AXLA 2ZT6A 3RPQA 4EM0B 3A7UA 3MCZA 3GFMA 1XGOA 4XQ3A 1EOVA 3WTZA 2E3CA 3GF2A 1Q1HA 5A2QZ 4YRIA 2PJPA 3QRFF 1OYIA 2ISZA 3WTSC 1X2HA 4RQFA 1TNTA 4WXDA 3PZCA 4L87A 1YB3A 3EYYA 1PDNC 4HYEA 1OYYA 1MD0A 1AOYA 2HOEA 2VBYA 2VN2A 4BHBA 5C52B 3ELKA 2UZKA 2VC0A 3HFNA 2ODRC 1ODDA 4M78E 2E1NA 2XKPA 3T8TA 1YCYA 2HTJA 4UXNA 2J5OA 2VBWA 1T38A 3FB9A 3LC0A 5LGNA 1A04A 1ZG3A 3VU3C 1ZARA 3K1PA 4WCGA 4N0AC 1KQ2A 5FLXZ 2LKPA 2VBXA 4XTWA 2W24A 1BC7C 4I7HA 2DDZA 2DZCA 2ZGWA 4Y15A 5ILSA 4MHGA 3T1BA 1K78B 4BNCA 3ZMZA 3HFZB 2GWRA 1EIYA 3LA2A 5CAIA 4QVDA 2AMCB 3RJPA 1KQ1A 1OMIA 4M77A 1DDNA 2Z3YA 1ULYA 2O0YA 1QO0D 5J8FA 3RKXA 3MFKA 1S3JA 3FMQA 4P72C 5KK1A 4CH3A 2LF8A 4Q15A 2DQ3A 1YIOA 2CW0F 4PDKA 1KQ9A 4EJUA 1F4KA 5GAOp 4KT5C 3WE3A 2K57A 1LNXA 3V8KA 3H3ZA 3E9HA 1TLHB 1K79A 2ZR3A 5GAMf 4IJAA 3QPTA 2GIVA 2E65A 4ENJA 1J75A 3I4PA 2Q5HA 3ERED 1D8JA 4EVIA 1V3FA 4C8QA 3FZVA 3REOA 4U0WA 4M74A 2EWNA 3JAMZ 4Q48A 4AVPA 4WJ3M 1IN8A 2VXFA 3JSOA 2OAZA 2DK5A 3P9KA 1I6XA 4P73C 5ELOA 1BIBA 1XGNA 3E5XA 1MDMA 4RGSA 4ZZDA 1KU7A 5E18F 2RM4A 3ULQB 5GANf 2FNAA 5GAMg 1NYQA 3BY7A 4LG0B 3JCMX 2A5YB 1AWCA 4TVAB 4NB5A 2DQRA 1VQZA 3BROA 3JB9D 1FC3A 1P6RA 1EIYB 2TDXA 4YFKF 4HWSA 4AH6A 4YRCA 4M78F 1SD4A 1MZBA 2IJLA 4NHJA 4H2WA 2EJFA 1WQ2A 2J3LA 4XSXF 3RKWA 2QQAA 1O7FA 2D1HA 1U78A 4N9HA 4O5VA 2HYGD 2PQ8A 1HSJA 3CUQC 3CMQA 3A5YA 2M1BA 4L9NA 3SWNB 1USYA 3RIRA 2KIFA 4RB2C 2EFPA 2FBIA 2EA2A 3TDUC 2HS5A 3Q5FA 3UGQA 4G6DA 1X56A 2V6CA 2YSRA 4PG3A 4M77B 4ON0A 2CGPA 5TRDA 4L9JA 2XROA 3HSEA 4A2UA 4XTVA 1G3YA 1T98A 3V7SA 3H92A 1O7LA 1PUEE 1H9GA 4R8HA 4OMZA 3LQQA 2YX4A 1RIOH 1MJ9A 3TO7A 2Q0OA 2EJRA 2GZWA 3FX3A 4Y17A 1BOAA 2P5KA 3A31A 2G4CA 5GMKe 1R00A 5GAMh 3QOPA 3R0JA 4KN4X 3FF5A 2HYFA 5D5VB 4EO4A 4EGYA 3O2PE 5H20A 4S05A 2V1DA 2M45A 1B34A 4JRKA 2PN6A 4DPGA 5L3CA 2COMA 4CH6A 2VE9A 2FF4A 1CF7B 1GVJA 3E5QA 1LEBA 1QNTA 3C1DA 4P3OA 3K0LA 2DTRA 3OV8A 3JCMQ 2AKWB 5LJ5e 4WI1A 4V2SA 2ZNJA 4HWRA 4LLGF 4KQEA 4G7OF 3VBBA 4P55A 1YLFA 2VXEA 2FBKA 2BBYA 1U3EM 3GZ5A 4MNUA 1LQ1A 1HKQA 3QHSA 4H0EA 1YFRA 2O3FA 5HLGA 4RGRA 2XVCA 3HHGA 3QUIA 5GAMj 4UV9A 2UWMA 2R3SA 1G6NA 2QWWA 1R5GA 4UPAA 1YS7A 2RA2A 3AAFA 4U88A 4EM2A 4ASNA 4PZJA 4CYDA 2MH9A 2PFBA 5E1ZB 5LGTA 4MEXF 2QM3A 1FYLA 3DPLC 2KIMA 2P6SA 5JVTA 1ZN2A 5DY9A 3QPHA 1G5IA 4L5JA 3PQJA 4XLPF 1N9SA 4M75B 4M75F 1LYLA 2H94A 2RVCA 4UUVA 2P0LA 4YRRA 1XDSA 4TQDA 2BEOA 3E5UA 4UVCA 3SWNA 3I71A 4GO1A 2RHSB 5E8GA 3WTVC 5D5WB 1NJ1A 3SQNA 5GAN8 1G3WA 2H09A 3A74A 1NHAA 4L5IA 5GAOn 4HV5A 3DF8A 3CDHA 3FIFA 3FXQA 4M6YA 3ZMDA 1JHFA 1XB4A 3ROUA 1SETA 1JE8A 2LF7A 1NJ8A 4UNOA 4C8QD 2O03A 2DU7A 2OA4A 3ZN0A 4G7ZF 2DPDA 3OD1A 4EX5A 4ZZLA 1ZHFA 4KNYA 4KMFA 1QGPA 2GXBA 4HW0A 2MC3A 1G3TA 3MEXA 5F5WA 3LSTA 5DUIA 3WGIA 5LJ5g 2EFWA 1HKTA 3G73A 4H2SA 3WTTC 4BW9A 2R7DA 4YYEA 1EQRA 2EFQA 2OQGA 1XD7A 1FBSA 3FM3A 1G5HA 1KMMA 4C8QB 4EJTA 1ASYA 3TDZC 5CYVA 3GXOA 4UP8A 3E9IA 1LEAA 3E6DA 2E41A 1U6GA 2IVMA 1HQCA 3KP7A 1W7PB 4I0AA 3IKTA 1WI9A 2NNNA 2F5FA 3ZMSA 5DD8A 1SERA 3C3WA 3GVAA 4YCUA 3IWZA 4U0VA 2JTVA 4XU3A 1B8AA 3A7AA 4WJ4A 4C8QE 5CVIA 5LHIA 3SHFA 5JHUA 3HRIA 1NJ2A 1B4AA 3PQKA 3L1AA 3BJ6A 5CLSA 4N0BA 3R07A 1L0OC 3WTXC 2QHSA 2ZXJA 4M75G 3ZP5A 3GIBA 2RQPA 5TJJA 3F8FA 4OINF 2Z5UA 4HDVA 3HXZA 5ICEA 3GW2A 2KJCA 2RV8A 2VE8A 3P9CA 4KIGA 3UH0A 3HXUA 4CS4A 1IXCA 4K88A 3RL6A 4P72A 2ZNZA 2ZZFA 4AWXB 4HF0A 4MMLA 3RTRA 2CGHA 2W84A 1GXQA 4EM1A 3K1NA 5DCMB 1I81A 2M30A 2MH2A 1Y96A 4M75E 4F7UA 3IC7A 3RDIA 3I58A 1BI0A 2M5WA 1JXSA 4LMYA 5L3FA 2K02A 5L3GA 4LK1F 4KN7X 1BBWA 1JHHA 2H6CA 4C8QC 4G84A 3IL2A 5LEKA 3TKYA 1D3YA 4Q47A 1WQ7A 3GEZA 4DQ2A 3JCMg 4YIIA 5LGUA 3N97A 4TV7A 4YG2F 1HTTA 1SD7A 2O61A 5BS6A 5L3EA 4M73A 2CJ9A 1E2XA 1OPCA 3QU3A 2XGXA 4HLXA 2Y90A 4JRIA 2JRTA 4LK0F 4M7DF 1T39A 2LDUA 5D6FA 2ZCEA 4I01A 3IKMB 1DPUA 3EDPA 3RACA 1TQIA 3OOPA 1M8VA 4P71A 1G51A 3SB2A 1TQMA 3HOTA 2NRAC 3FWEA 1MJBA 5ILUA 2K4JA 4HF1A 3TUPA 2ISYA 2CO5A 2E1HA 3IKLA 2HR3A 5GAN7 2ZINA 5HLHA 2WC2A 3V7CA 4HX4A 1KU9A 3A7RA 3EYIA 1E17A 4I02A 1OR7A 1SFEA 4HX8A 1LDJA 3R61A 1D5VA 3HXWA 3JCMe 1UHMA 3BJOA 4XTYA 1KA8A 5GMKm 4RAZA 3JCMJ 3GZ6A 1KQ8A 1ZGJA 5GAOr 1USYC 3IG2A 1EFWA 3E6CC 3NEUA 3RYPA 1F9NA 3P8VA 4A6DA 3D5LA 1D3BB 2QBYA 3F72A 2FSWA 4O2DA 3J80K 4IPAA 3KFUA 4M77F 2A69F 2XAHA 3JCMc 1GGMA 3ABTA 3FMSA 1H4VB 4XEMA 2EJGA 3BPVA 4YRMA 3VB2A 4Y13A 1BN5A 5AONA 3HY0A 3ML6A 2M87A 1PP8F 1J7KA 1R7JA 4RCCA 2ARSA 3UGTA 1F5TA 4J5YA 3RUXA 2EA4A 1F1ZA 1Y96B 2CIMA 1KOGA 4P75C 3BPXA 3KFWX 3HY1A 3GYHX 3L7WA 2ZIMA 4H2VA 1U5TA 3GX4X 1IXSB 3GFLA 4S04A 1ZH5A 1WKMA 2J5PA 2MD5A 2MLGA 3JCMW 3BOQA 2Z33A 2QYOA 2EV5A 3RYRA 4A0XA 4M7DG 3BWGA 2STTA 4WF2A 5FFXA 3MF2A 4CS2A 4JUVA 1TBXA 4G8XA 2OQRA 3QAHA 1K7AA 1WQWA 1YFTA 3MF1A 1L0WA 2A6EF 5K5OA 5IT9K 1SD6A 1U1SA 1B7YB 4Y91A 4EMSA 2A61A 4CGZA 3BDUA 1XMKA 2DQ0A 1I1SA 1FLIA 3WQZA 3ZQ7A 1RI7A 3L00A 2L02A 2RHSA 4G85A 1SFXA 2K7LA 3IRRA 2JZYA 5GAN2 2Q7HA 1YW7A 5FGMA 1I5ZA 3LSSA 2DJZA 2L01A 1Y0UA 4EMKA 4M7DE 1KQ0A 4XEOA 5D4RA 4XRFA 5LEJA 1HW2A 4D0PA 1W4MA 3MZYA 4LG0A 4WWCA 5J8CA 4PJOD 2IA1A 1W7PA 1IAWA 4HV6A 1IN4A 2HQNA 1Z9CA 1RUOA 3HRUA 3W6KB 2XGTA 3J81K 3T8RA 2PMUA 4PJOG 3QSUA 4MTEA 4M7DB 3L4GB 3KCCA 4YFNF 3GFJA 4M78A 3TEGA 4GXOA 1O3RA 3JB9F 2CQKA 2LNBA 2ZCWA 2XRNA 4PCQA 1ZRDA 2D2WA 2OU2A 1E1TA 2VT2A 1YS6A 5GANj 4H2UA 5GAMd 4G6QA 4RS8A 3ZPLA 5D6EA 4ENNA 2DXTA 5K1YA 3DV8A 2CJAA 2A68F 2D45A 4GGGA 1JJCA 2HNIA 4OIRF 5GANg 2P7CB 1J59A 3ECHA 1SMYF 1C0AA 1CGPA 4ZTZB 3C7JA 4HAMA 5GMKl 1MJAA 4M7AC 4YDQA 4E51A 3RPUA 4I0BA 3L2CA 2FOKA 2W25A 2P5IA 1XDUA 1LVAA 5LHHA 4RB0A 3L2ZA 1XSXA 2D1VA 4IVNA 2BYVE 3DEUA 1EVLA 5IT3A 3JB9J 1X01A 4GYIA 2V79A 3NETA 1U2WA 3N4MA 3I64A 5C51B 3M7GA 3REUA 5HLIA 5BPIA 3DFGA 4HZFA 2YLCA 1TQPA 4HF2A 3PCOB 4I2OA 1H641 3SWNC 4FX4A 2QQ9A 2E5AA 3V7RA 5DDGA 4F7UB 1X2GA 1S29A 3E6BA 3HHHA 4KR3A 5LLQA 2ZT7A 2P8TA 1RZ4A 1TW2A 4KUMA 4TVWA 4HWOA 1X3UA 4XBFA 2Q5IA 4Q6GA 1LDDA 4EJOA 3M1EA 5GAOm 4HBLA 4IHSA 1KYZA 1WU7A 2ZT8A 4RAYA 4M9XA 4YRQA 3HFZA 1K78A 4OIQF 2AS5F 5ICFA 2DW4A 1Z6TA 4IHTA 3MWMA 4XTXA 2L54A 2EL9A 2ZNYA 1Z1DA 3FJPA 1HBXG 1BC8C 2PG4A 2P7VB 5HS8A 3K2ZA 3GO5A 3TO6A 1YFSA 5BPDA 5LJ3e 1IZ1A 2EFNA 3CUQA 2ZMEA 3I54A 4M75A 4ESFA 2GAUA 4ZYEA 4CDGA 5DCMA 4EGZA 4M7AF 1FNNA 4OOIA 1NJ6A 4U7DA 1S7AA 1PP7U 3KE2A 3GFIA 1VTNC 5HGQA 2A07F 1I5LA 4MQVA 3J7AO 1R23A 1GHCA 1MGTA 1LJ9A 1QPMA 1G3SA 2XKOA 3WTYC 4ESJA 2QZ8A 1IL2A 3LA3A 4LLLA 5BOXA 3HSFA 1FP1D 4N9IA 4Q4ZF 3VEPA 3NEMA 4M71A 3CUOA 1NNHA 4ENMA 1EVKA 5HS7A 1UFMA 4OMYA 1D3BA 3TO9A 1T2KA 1LOJA 1BIAA 2H27A 3L9FA 1U8RA 2G7UA 3D0SA 5GMKi 1XGMA 1MKMA 2Q7GA 5HDNA 3FHZA 1FT9A 4J15A 2RGVA 4M7AD 4JK1X 4MMKA 4C92F 2P4WA 2W85A 3ZN1A 1MDMB 5GMKj 4HQEA 2VOOA 3ISPA 4U7BA 4LD5A 4P9UA 4HOBA 3WTWC 1FYFA 4WXHA 2QENA 2VBZA 2HGCA 3HRMA 4UV8A 4YRLA 3ECOA 2VT3A 5L3BA 3EUHA 1DP7P 4EQQA 4OIPF 3TEHA 3PFIA 1PYSA 4MEYF 1USSA 1S8NA 3Q9VA 1FX7A 5DCFA 4YFXF 1XGSA 4AIJA 2J3MA 5ILVA 3G1ZA 4HX7A 1LDKB 3CLOA 3HXVA 4HWPA 5LJ3g 4C92D 3IWFA 2IA2A 4J6WA 2FU4A 5JFRA 2XTIA 5A2QK 5AIQA 1IUYA 1NJ5A 1FOKA 3VQVA 2X0LA 2ZJ2A 4YRJA 3RESA 3FXRA 1E24A 2ZFWA 2L3DA 1HK9A 4FHTA 3HSRA 2OBPA 2V1XA 3HTSB 2ELHA 1QE0A 2VOPA 4F7UF 2PI0A 4OIOF 4M78B 3KP4A 3I7FA 3F21A 5HDKA 4C8QG 3KLOA 2Y75A 2DLLA 3IALA 3W6JB 2QHUA 1CF7A 1Z05A 1ZREA 2VC1A 4M7DD 3JAMK 2V1UA 4O6JA 1R1TA 4C92C 3MEYA 11ASA 1BI1A 4P75A 3SZPA 4M78D 2P6TA 3HIFA 5GAOq 4M7AG 4A0ZA 4CHUA 1WNLA 5BMZA 4C92G 4YRKA 3JCMd 1IXRC 1J5WA 2PMEA 3I53A 4RDXA 4PGGA 5JR3A 3TOAA 3DQVC 4M7DA 4RGXA 1NYRA 1TNSA 1UCRA 1Z7UA 4EV0A 1GXPA 3GWZA 5LJ5d 2EB7A 4EMKC 2ZIOA 2ODRD 1ZLKA 4KIBA 1SD5A 1BI3A 3MZHA 4XTZA 4OLFA 5FO5A 2HQRA 3V4GA 3JTHA 1RIQA 5ELNA 3LA7A 4IRHA 1Z7MA 3QO8A 3HSBA 3EFRA 3ICAA 1QBJA 1I8FA 4EMGA 2A3SA 4O3MA 3P8TA 1P4AA 4M78C 4BHPA 1O57A 3WGHA 4I98B 4PJOF 3JCMV 2DU9A 4EJWA 1FBQA 2E64A 1ZYRF 2IP2A 2L4AA 4I09A 2E10A 4HQMA 5E1XA 1ON1A 5GANh 4XLNF 4QVCA 2YPRA 2VODA 4RCBA 5FD5A 1Z7NA 3JTGA 4L9TA 2VXZA 3INZA 2FEZA 5LRSA 1ZG5A 4Q5SF 3NENA 3R60A 1REPC 3M4QA 2DTOA 4CH5A 2P5VA 1XN7A 2A6HF 4KDPA 2UXXA 2Q2EA 1IN7A 3QP5A 2FMYA 5C53B 3ZMTA 4RQEA 3V8JA 2QHTA 5F64A 3HTZA 2RHQA 3VQXA 2WV0A 4BH9A 4KICA 4UP7A 1H4TA 2DI3A 3F3XA 4A0YA 3T0YA 3WU1B 3FMRA 3P8YA 3RGLA 4KR2A 3BY6A 3WE2A 3RKYA 4K86A 3CTAA 1V4RA 2F5DA 1LJOA 4NQWA 1W66A 1M5Q1 2XV4S 1QQIA 3BW1A 4HT8A 2R7FA 2EV0A 5J6XA 5KNNA 2UXNA 1BBUA 2ZZEA 2NS0A 1EH7A 2CSOA 4KIFA 4P5OA 2HEOA 3U1DA 1B7YA 2EFOA 4UVBA 4M77D 2ESHA 1P4XA 3KZYA 1B34B 3KEQA 2QBYB 5K1XA 1P2FA 2CYYA 1USTA 1ADYA 2I4OA 3QO5A 1BM9A 3HOSA 1BJAA 5I21A 3QNEA 1ONVA 3BDDA 1N9WA 3WTUC 4ZYGA 3BJAA 2RKHA 4G94A 3O6BB 4M9SA 4NCXA 4HA8A 3P9IA 3JCMb 1XSDA 4FX0A 3TGNA 4M75D 3L4GA 5GAOl 2FNPA 4ESBA 3NRVA 3KETA 2VC8A 1B9MA 3EFSA 4ZYDA 1D8KA 3REXA 4OU0A 1IN6A 3R0AA 4TQFA 2DZ9A 3RI4A 4M7AB 4M9ZA 1H9TA 5D8LB 4BXUA 2LSOA 1FYKA 4BHCA 4RB1A 5LJ5f 5GAN5 1O3SA 4TWAA 2CWEA 3U9GA 2ZT5A 4CICA 2AKWA 2FBHA 4ZIBA 4P96A 4PHCA 2ACJA 4M78G 2OZ6A 3JW4A 3E97A 3IKVA 3F8BA 3JCMf 2B0LA 1ZGAA 3F22A 2YX7A 1JGSA 2DT5A 2CFXA 4PJOB 3HTUA 3ZMUA 2DPUA 1EV7A 1B6AA 3QTCA 2QUFA 2ZR2A 3COAC 1YG2A 1ASZA 3M8EA 1ZLJA 2Z9OA 4XSZF 2VONA 4XU1A 4WX9A 4XTUA 4L9VA 5LHGA 5E20A 2YR2A 1JBMA 3QU6A 4GCVA 1T6SA 5CVVA 4P74A 3BP8A 1KU2A 1P4WA 4MGRA 1S6LA 4A6EA 3J81Z 5LJ3f 1BI2A 3NELA 3C18A 5LBQA 2ZNIA 2IY5A 5FD6A 5LJ3j 3FXUA 2ESNA 3WGGA 3CO7C 2HFHA 3E3VA 5F1RA 2HTSA 2JSCA 5E3IA 4IF4A 1EH6A 2DKGA 3WG9A 1B76A 3ERRA 2F2EA 3BFMA 3ZMVA 1YO5C 4U0YA 2ZBKA 1XSVA 2Q8KA 2STWA 2I4NA 2KJBA 1J2XA 2RD1A 3F8CA 4LB6B 5FB2A 2RDPA 2XAJA 4L0ZB 5GAMe 2C8MA 5BQTA 3LQRA 5LJ3d 1FYMA 1X54A 2O8XA 1U5TC 2Q7EA 5FLXK 5EEGA 5DUKA 1I27A 1KYWA 4K87A 5CJ9A 4P3NA 3CO6C 4X9CA 2BGCA 4G9YA 1R5HA 2DXUA 3F8MA 4P9FA 4AD9A 2QTXA 2OD5A 2MBFA 2RB6A 4YRGA 1RNLA 3IHUA 4J6XA 1KMNA 5LJ5h 2RN7A 4BAYA 2W57A 4F7UE 4HLYA 2GQQA 4ZYHA 2XASA 1W5SA 1IF1A 4KA4A 4C92E 4IRIA 3P7NA 3VODA 5ED4A 4M7AA 4EJVA 1R1UA 2ARTA 1HXDA 1C0WA 4L0YB 1SMTA 1FPQA 3U2RA 1KU3A 3I5UA 4CS3A 5H6RA 2PMHA 3DXJF 4BYYA 2ALYB 4CH4A 5EEHA 2HWVA 4C8QF 4WK8F 3I59B 3T5XA 3WODF 2YLBA 3KLNA 2YU3A 4LLNA 1N9RA 4YRNA 3EETA 3G3ZA 1TH7A 2JT1A 1ZRFA 3LWFA 1WYDA 1IN5A 4M77E 1U5TB 2E7WA 3CJNA 4AIHA 5LJ3h 4DNCA 2FXAA 3KP2A 3AHUA 1ZRCA 2P5LC 4PGHA 3UFGA 2DQLA 1G4DA 2IRFG 1FY7A 2XUBA 5GANe 4BQAA 1Z6RA 4C92A 5K5QA 2NYXA 3GUDA 5AIPA 6PAXA 2ZMEB 1H4QA 2Y0MA 3JB9H 2EK5A 3HRSA 4J6YA 4M72A 2KRFA 4YRFA 4M6XA 2XHKA 3BJUA 1I1GA 2PLYA 4RGUA 1S7OA 4PJOE 1STZA 4CO8A 2I4LA 2XAGA 5D5XB 4M77G 4C92B 2H6BA 3F6VA 2ZXFA 3R6SA 2RNJA 1O3QA 2MA3A 2JPCA 1T0FA 5E17F 3DP7A 1DPRA 4ZH4F 1YYVA 2CG4A 2HKOA 4K2EA 4JQFA 1FWZA 2DBBA 4MTDA 5K1PA 4KMUX 4ETSA 4Z2YA 4B09A 1WRJA 2DVEA 1JJCB 2I2LA 3JSPA 1XMAA 2V9VA 1ZG1A 1JRIA 3MQ0A 1R36A 3JB9G 4X5OA 2E7XA 2ALYA 4P73A 2ETHA 5HVQC 3QO7A 4M7AE 4LJZF 1YQAA 2C6YA 4LFUA 4F7UG 5DV5A 3HFOA 2FE3A 4P71C 4M75C 3KP6A 1YW9A 2O6GE 1E1OA 4G7HF 5D5UB 4JBAA 3EQLF 2ZO4A 2EAYA 4FT8A 2IPQX 2WTEA 2HDCA 1TTYA 3F6OA 4R1HA 4YRTA 5ICGA 4A5NA 1H4SA 5L3DA 2IT0A 4HT9A 4A53A 1IRFA 5H6QA 3SXYA 4X9DA 2NAZA 4PJOC 3M9AA 5GAN4 4E70A 4UVAA 2DAOA 4A54A 1HW1A 1YTYA 2ARUA 2PMFA 5CVRA 5LJ5j 4OP0A 1FZPB 3VOEA 4YP0A 4IXAA 3V8LA 4UP9A 5FFZA 1X55A 1IW7F 2E1CA 2DK8A 2HKXA 4A5MA 2DEQA 3DSQA 4YREA 3HXYA 1DUXC 1R1VA 4A12A 2IY5B 1SESA 4L18B 3LAJA 2I4MA 3GLXA 1L3LA 1B9NA 3LFKA 2ZTGA 3B02A 3I59A 5K5RA 3RERA 3M4PA 2L4MA 2PEXA 1J0RA 3PCOA 4HVCA 5D4SA 3M4GA 2FA5A 1W5TA 4WXCA 2K4BA 2Z99A 4ENKA 2RC4A 2AMCA 1FSEA 3QP6A 1O3TA 2G9WA 4YRPA 2F5CA 3K69A 4ZTUB 5DD4A 4P74C 4PNOA 4XU0A 2XAQA 1MGQA 4PJOA 1HC7A 2G7HA 2GA2A 5IT9Z 2DO7A 4H2TA 2XIGA 3FM5A 3H3UA 3CUQB 2FMLA 1ADJA 2ZKZA 2M8EA 1XCBA 3A5ZA 4B8XA 2QHVA 5DYMA 4BWAA 2QQBA 1UHWA 3HUGA 5CVJA 2JN0A 4YCVA 4GYGA 3DKWA 1ON2A 3KEOA 4NL2A 4KYWA 2X4HA 4QWQA 3MAJA 3F23A 4EMHA 5CVUA 1YW8A 4H2XB 3IRQA 1BBYA 4YROA 4HWTA 1B70B 1B59A 3R4KA 2FYKA 5JI6A 12ASA 3HYIA 5HOOA 3HRKA 1HW5A 5GANd 1WSUA 1ATIA 1K6OA 1E22A 2IA0A 3NQOA 1Z91A 2QVOA 3LAPA 2RHQB 3JCMh 4MQ9F 5HS9A 3QO3A
chains in the Genus database with same CATH superfamily
3M8FA 2VGNA 3D7SB 3G71I 4HDUA 3J80Z 1R9TJ 2W48A 4BEHA 1RUNA 3TOBA 3CCVI 4EEFG 1R58A 2L89A 4RMOA 1HKSA 2FQ3A 5HDGA 1H89C 1AWJA 2FB7A 3FB9A 3PGGA 1NBEB 2DVJA 1ZAOA 4UHTA 3Q1JA 1B70A 1UB9A 1RAFB 2DILA 4JLIA 1IDZA 2DTHA 1ACIA 2DTIA 2K27A 5DEQA 1J3TA 2Y48A 4AIKA 1ZHIA 4ZN1A 3W3SA 5GAGJ 4LD9K 3O8VA 5KYNA 1VQ8T 2MYSA 4RM3A 3JCMP 2DU5A 2QQSA 4OB0B 1R22A 1HSTA 3VWBA 1TW3A 3JB9I 4XRMA 2FEIA 1U9NA 2ADUA 2HZTA 4NOYA 1KGSA 4QTRA 2OTLQ 3KPHA 4KFCA 2DTZA 2IW5A 1QZYA 3K1MA 2C7IA 3VRYA 3SFZA 4BEHB 1N5ZA 1WXTA 3K4BA 2KRSA 1VQMI 4MIMA 2MLKA 4LNSA 2YS9A 4RUGA 3ABUA 3BZ6A 2EV6A 3H1CA 2YHTA 2JW4A 4LB5A 2ROTA 1WA7A 4M7DC 3EGUA 3WU0A 4H2YA 5FU7C 4J7FA 2K86A 3VQWA 1IGNA 3LSQA 1QF6A 1IRGA 1TZLA 1UJ8A 2PBIA 1GV5A 1XPXA 1I4K1 1ZSGA 4F7ZA 2W10A 2P4TA 3GTQJ 1Y71A 3BE3A 4EMKB 4NC8A 1BB9A 1YWPA 1SFUA 2L3SA 1YJ9Q 2CJBA 1WLEA 3NGPA 1YFHA 3TEHB 2QEXQ 5GMKh 2HU9A 2DFUA 4KULA 1SRYA 1OYWA 4N0AA 1WPKA 2F5EA 2KLOA 3I4MJ 3IH3A 3HM5A 4IRGA 2E71A 4YIFA 1RAHB 2RF0A 4C5GA 1UDLA 1W7PD 1OKRA 5KVRA 1J9IA 1K8AR 3S2WA 1KQSS 3RF1A 1VQ7A 3PFSA 1NEGA 3OL4A 1X6OA 3C95A 4UC4A 4C0FA 2JPBA 5J39A 5ERIA 1PRLC 3MJXA 2LCSA 2KIUA 2B63J 3VJPA 1IREB 1YGBA 4OGCA 4P3PA 2JOYA 3Q9SA 2AMCA 3ZQLA 2ZZGA 3SZTA 3O3KA 2RMOA 2KKOA 2M7BA 3B73A 5ICCA 3PMIA 2K7AA 3KIOA 5IXFA 2E12A 1XCVA 1FBUA 1X1CA 2E60A 4XONA 1LE8A 5GAN3 4CZZA 1JJ2P 2DXIA 2BV6A 3HOVJ 1ZBJA 4F92B 1H0MA 3RNJA 2GXGA 1FSHA 2QDLA 1AZGB 1EH8A 1SAXA 1X4OA 3KZZA 1J5YA 3K9TA 4N4OB 4NNJA 3NARA 4TVYA 1RR7A 3HRTA 3LSPA 3MP8A 2OV7A 2E1MB 2OAUA 2COWA 1ETQA 4A3CJ 3F8NA 4CXFA 3VFZA 2BXZA 5D8KB 1S1NA 4R79A 1U1TA 3BR1A 2LTPA 5GAN6 3L09A 1SANA 3DPTA 4QLCU 4TTVA 3I56I 3LX7A 2FRHA 3GTMJ 3LSRA 2GA1A 2JA7J 1IV8A 1WI3A 4BXFA 3HXLA 1M30A 2EZIA 2HPMA 2Y9ZA 2EQJA 5F6FA 1TWCJ 3PO3J 4P5NA 1P92A 3UKGA 4E7JA 1O75A 3DTEA 3I0TA 1IDYA 2IGMA 3LSGA 1LNWA 1XOVA 4J9EA 1AKHA 1B1BA 1WZ2A 1RI0A 4D7NA 3Q0WA 2YUNA 3DTKA 3ZQQA 5E8IA 1GCQA 1QVPA 4M77C 2LQKA 1IO6A 2NNYA 2K2VA 2MWPA 3I56Q 4ESRA 1YI2I 1HSQA 5A0LA 4NL3A 5J4YA 3I5RA 2IS6A 3PIPF 3D1NI 3CCQA 2MOXA 3KYCB 2GLOA 4KUDK 2DFIA 4J9GA 5IP6A 4RMFA 4H2XA 2E3HA 1VQLI 1WPYA 3KP5A 4B48A 2DL5A 1FJLA 3CPFA 4XIDA 2L7MP 2ECZA 1KIKA 1QVUA 4YPFA 2DT6A 1RI9A 1P7IA 4J19A 2XAFA 2BTTA 2QLZA 1QVFA 3E6MA 3OYCA 1QZZA 4A3FJ 5LRRA 4AYBA 2MAMA 4YCWA 5F0HA 4LGWA 2XF7A 2CUJA 2BY1A 2HDDA 4QIWN 1LB2A 2EJ9A 2VKNA 3A32A 1WHHA 2OZUA 1FP2A 1MMSA 5E1WA 3BTLA 3LGFA 4E7KA 4TVAA 3KP3A 2WWYA 1KC8R 4ATOA 2R0QC 4CRIA 4RB3C 4FE4A 2BE5F 5IOYA 3CCLI 2DO3A 1N77A 1B8IA 5J1YA 1QU3A 1SC7A 4Y92A 2VWFA 1WWXA 4BQNA 2L0KA 2M34A 3TQNA 2EQMA 2HSPA 3ME9A 2JT4A 2AXLA 2ZT6A 3RPQA 3OW2P 4EM0B 3CC2I 2DIGA 3MCZA 3A7UA 1W2BP 1ZUYA 3GFMA 1XGOA 4XQ3A 1EOVA 3JRZA 3WTZA 2E3CA 3GF2A 1Q1HA 5A2QZ 3M0TA 4YRIA 2PJPA 3QRFF 2PMZA 2V8IA 1OYIA 4Y28E 1GRIA 2ISZA 3WTSC 4JJCA 1X2HA 4RQFA 2ZSIB 3CCQI 1YJNI 1TNTA 4WXDA 2ELJA 3PZCA 4L87A 1YB3A 3EYYA 2LVMA 3H0IA 3ABKH 1PDNC 1QLYA 4HYEA 1OYYA 3G6ET 4HVUA 2A05A 4C0DC 5KNNA 1MD0A 3HL8A 1X1AA 1AOYA 2HOEA 2VBYA 2VN2A 1G2HA 4BHBA 1TTHB 4F04B 3CC4Q 3NTIA 5C52B 2L3PA 1VQ9A 3ELKA 2CV2A 3ZRGA 2UZKA 2YRVA 2ECBA 2VC0A 2ZXWH 1APLC 1CKAA 3CEYA 3HFNA 4N4NB 4IIMA 3I56A 3CPWP 4DA4A 2ODRC 4QKUA 1ODDA 2JM8A 4M78E 2E1NA 3W2WA 2FX0A 1KHIA 2RHXA 2XKPA 2RQWA 4V19K 3T8TA 1NYGA 2RNGA 4XM3A 2HTJA 3DBRB 4UXNA 1YCYA 2R4GA 4A3LJ 2DD4A 1GCQC 2H1LA 2J5OA 2HQ5A 2QQ8A 2VBWA 3SEZA 1T38A 3PT9A 3QOEA 5K7ZA 2HD0A 1OCZH 2E5ZA 3HKZN 2LR8A 1A04A 1ZG3A 5EZHA 5LGNA 3PIOF 5IP9J 2H1KA 1X43A 1ZARA 3VU3C 3K1PA 3A0HC 4WCGA 4N0AC 3G4ST 1KQ2A 1WHJA 5FLXZ 2QXFA 3SEMA 2BOLA 2LKPA 2VBXA 2W24A 1BC7C 4I7HA 4XTWA 2DDZA 2BZTA 4CYCA 2DZCA 4MDWA 2ZGWA 5I11A 4Y15A 5ILSA 1GUUA 4MDXA 4MHGA 2RNAA 1I3QJ 2YRDA 2FOWA 3T1BA 1K78B 2JN6A 4BNCA 3ZMZA 3HFZB 2GWRA 3BZKA 1N6AA 1GBRA 2M9HA 2ZJQF 1EIYA 3LA2A 1H8KA 5CAIA 4II2A 2NS6A 1NJIU 1MH4A 2DA9A 1Y0MA 2YWWA 3ZEHA 3K4NA 2MIOA 4QVDA 2AMCB 3K4KA 1TWHJ 3RJPA 1Q1VA 1KQ1A 3EH2A 1OMIA 3FK7A 4M77A 2HQEA 2EQRA 1DDNA 2Z3YA 3BG3A 4OB2B 1LFUP 2SRCA 1ULYA 1WJQA 2O0YA 5EGOA 3GTGJ 4PKCC 2BKDN 1QO0D 3CDIA 5J8FA 2YUOA 3CF2A 4PFPA 3HZJA 1BL0A 1PHTA 3RKXA 3MFKA 1X27A 3VS4A 2CQ7A 1S3JA 4YYEA 1WH7A 3FMQA 3LSJA 4I76A 3FK6A 2GFAA 2Q2EB 2JK3A 4CCKA 3FC3A 4P72C 4CZCA 1UG0A 5KK1A 4CH3A 2LF8A 2I10A 2EYXA 2J6KA 1U9OA 5D7UA 4Q15A 2AO9A 1VQLA 2OTLT 2DQ3A 3CCVQ 5FRMA 1WH5A 1YIOA 2VPLA 4J9FA 3IH2A 3LC0A 2CW0F 1JXOA 4PDKA 1YBYA 1KQ9A 2VJJA 4EJUA 1F4KA 3TCJA 3CCEQ 5GAOp 1V54H 4KT5C 3S14J 1PM3A 3WE3A 3UWNA 4HVWA 2L0AA 1NG6A 2K57A 5CIUA 1LNXA 3AG3H 3V8KA 2EVRA 1RKTA 3H3ZA 3TMOA 2LMJA 2MK5A 3RMQA 3HEFA 3E9HA 1TLHB 3M4YA 1Y8RB 4RTUA 1K79A 4LVJA 2XAUA 2ECCA 1FMWA 1OU9A 2ZR3A 5GAMf 4IJAA 4ZJZA 4GLKA 3QPTA 2YUPA 2GIVA 2E65A 3QWXX 4ENJA 3E9FA 1J75A 4GDFA 3MP6A 4LUDA 3I4PA 3Q0VA 2Q5HA 2Q1ZB 3ERED 2DF6A 2XHCA 2QAZA 4XICA 1D8JA 2CUBA 1YRNA 3S16J 4EVIA 1DGRM 1V3FA 1JKRC 4C8QA 4X1EA 3FZVA 3BTCA 3REOA 4FCYA 3I9V2 4U0WA 3I55T 3VSLA 1QA6A 3LL7A 1VF9A 3O8HA 4M74A 3BQZA 2EWNA 2OF7A 3GCMA 3JAMZ 3QYFA 4E7IA 1ZLMA 3A98A 4BY7J 3G6EQ 4QPOA 4Q48A 3DLLF 3MKLA 4AVPA 2DLPA 1FOXA 2JM9A 1IN8A 3NTHA 5D6YA 2VXFA 3CMMA 4WJ3M 3JSOA 2OAZA 5GTIC 3EGDB 3QJYA 1HC7A 5F27A 2VB6A 2DK5A 3P9KA 4C2MJ 1I6XA 3BR6A 1ETWA 2R7RA 4P73C 5ELOA 1BIBA 1Y6IA 3M0QA 1XGNA 3E5XA 1K9MR 3EGXB 1MUZA 1E3PA 4OMQA 4LNPA 2LX7A 5JLXA 1ZSZC 2CS3A 2XIDA 1MDMA 1PVEA 4UB8C 1QKWA 4RGSA 4ZZDA 1KU7A 1WJRA 3ZQHA 4A4GA 5E18F 2RM4A 1UJ0A 3ULQB 3G1LA 4A3GJ 5GANf 1PUFA 2FNAA 2VJIA 3PNTA 2KRMA 5GAMg 1U06A 1NYQA 4BE0A 3BY7A 3MQZA 1OZ3A 2LC4A 1YI2Q 4LG0B 3JCMX 2A5YB 1AWCA 2NWMA 4TVAB 4NB5A 2KQWA 1YIJI 2DQRA 2OC6A 1VQZA 3QXEB 3BROA 3JB9D 3GOXA 3BC8A 1FC3A 4XKWA 2CZ0B 1P6RA 1EIYB 3CCYA 2TDXA 1LCKA 3CCMQ 4JP0A 4YFKF 3C2HA 1HDDC 3R6OA 1VQMA 2QKLB 3CCUQ 4F91B 4HWSA 3AG1H 4H4KC 4D5CA 4AH6A 4YRCA 3GF5A 3CQZJ 4M78F 4N4IA 1SD4A 1N25A 1MZBA 2HI3A 2IJLA 1T08B 3VS3A 4XRSG 1GDTA 5D6WA 4NHJA 1VQ6A 1NEBA 4H2WA 1ABQA 2EJFA 1WJCA 2X4JA 1WQ2A 4Y33A 4XSXF 3RKWA 6AT1B 3CCSA 2QQAA 1SEMA 2CH4A 1O7FA 2J3LA 2D1HA 1WHMA 1U78A 2FQ4A 4N9HA 4F7UG 5IY5H 4JS4A 5HNHA 4O5VA 1YFNA 3ZQIA 2HYGD 4AFSC 1K0SA 2PQ8A 3Q0UA 1YJWT 1HSJA 1T8IA 1UJYA 3CUQC 3CMQA 3A5YA 2DMNA 2M1BA 2MFZA 1QKXA 3CCVA 2TRTA 4L9NA 4DOVA 3F9KA 2HBWA 5M5YJ 4I6ZA 3GTOJ 1OZ2A 3SWNB 3EAEA 2CT4A 1KD1R 4BQOA 1USYA 3RIRA 2NVTJ 3FEOA 2KIFA 4DZJA 4OMLA 4RB2C 2EFPA 3H3VK 2FBIA 4AU7A 5IPAA 2EA2A 3EUAA 4NC6A 3TDUC 1GBQA 2HS5A 3Q5FA 1K0XA 3UGQA 4G6DA 1X56A 1WFXA 2V6CA 2YSRA 5E3NA 4CI0C 4PG3A 3M53A 4M77B 4ON0A 3BZCA 2CGPA 4UY8I 5TRDA 2EGCA 4L9JA 2XROA 3HSEA 4A2UA 4MZPA 1LPQA 4XTVA 1VQPA 1G3YA 3HPGA 3IH4A 3L42A 1T98A 3V7SA 3H92A 1O7LA 1PUEE 1H9GA 4R8HA 4OMZA 3ASNH 1OCOH 2DT7B 1BOBA 3SDBA 2YUQA 3MEWA 1XMXA 3X20B 5IAYA 3P8DA 3LQQA 3EPZA 2LT1A 3LSIA 3VUZA 1F36A 2DDAA 4J00A 3DKYA 3SFIA 2YX4A 3BCAA 1MJ9A 3H0DA 1RIOH 2D8JA 3TO7A 3QYGB 2Q0OA 2EJRA 1X55A 2GZWA 3C2BA 3FX3A 2DJNA 2MABA 4Y17A 3M0PA 1BOAA 2P5KA 3X28B 2HAXA 3A31A 2G4CA 1TUDA 3MHXA 5GMKe 2JZ2A 1R00A 2X1DA 3RR6A 5GAMh 3I4NJ 4A93J 2LNHB 3VS1A 1TT5B 3QOPA 1TP4A 3R0JA 1E3HA 4KN4X 1QWEA 2GTOA 2X3XD 4QVZA 2QEXT 3FF5A 4E4HA 1MW7A 2HYFA 2VIXA 1AVZC 4KGXB 2P81A 3M8JA 2QGUA 1AOJA 2O7OA 5D5VB 2RHZA 4EO4A 4EGYA 3O2PE 5H20A 3ERMA 2X48A 4S05A 2V1DA 2M45A 1B34A 2JSPA 4JRKA 5IYCJ 5KYXB 2PN6A 2ZFUA 1ITYA 3N5BB 3EFOB 4DPGA 3UDCA 5L3CA 2COMA 4R0KA 3VUBA 4CH6A 1M4ZA 2VE9A 1Y1VJ 1ETOA 1JI8A 5DM7F 2FF4A 4AIDA 1CF7B 1YIJQ 1GVJA 3E5QA 1VQ6Q 3A1PA 5CQGA 2EKHA 1PSEA 5FKOA 1LEBA 1QNTA 3CMYA 3C1DA 2HPIA 3HOUJ 1UG2A 2V1RA 1C1AA 2A6TA 5KYYA 1VQNT 4P3OA 3K0LA 3CC4A 1AHJB 2DTRA 3OV8A 3I55A 1DQUA 4KT6A 3GZNB 3BDLA 3JCMQ 5LJ5e 2JWTA 2AKWB 2MF2A 4WI1A 4HT8A 4V2SA 2ZNJA 4HWRA 4LLGF 4KQEA 3M54A 5IHKA 2EW3A 4BY6C 1ZK8A 1JTXA 5I2SA 4G7OF 3PNVA 3VBBA 4CC7A 3QODA 4P55A 1YLFA 1BA5A 2AKLA 2GFUA 2VXEA 2FBKA 2BBYA 1QHGA 2WACA 2XDVA 2I8DA 1M2VA 2KT1A 3PE0A 3OA6A 2L7KA 5M3MJ 1U3EM 3ULRB 2L3RA 2WY7Q 3GZ5A 4MNUA 3HTRA 3GBGA 1LQ1A 1HKQA 1IHVA 3QHSA 1NE8A 2V26A 3TP3A 2XSDC 4Y3OA 2V8JA 3M3YJ 4QQ6A 3KYLA 1D1CA 2VKDA 2Y9YA 1KZHA 2R7WA 3OYNA 4H0EA 1U8BA 1QPIA 1E0EA 2M0OA 3CMEA 3CCST 4JX5A 1M1GA 2JA5J 2EPFA 2UV1A 4G6TB 1J09A 1RAAB 2O3FA 1YITI 3S15J 5HLGA 2HVQA 4YTLA 3BLYA 4RGRA 2IGNA 2XVCA 3HHGA 1QQJA 2B86A 2F2XA 1H92A 1S5LC 3QUIA 5GAMj 1W0UA 2R7XA 4UV9A 2UWMA 2FZCB 2R3SA 3CP8A 1G6NA 2QWWA 3CPWS 3WG7H 1R5GA 4UUTA 4AYBN 3IAM2 1YS7A 2RA2A 1U0JA 4UPAA 3AAFA 4U88A 4EM2A 4ASNA 4PZJA 2C0IA 4CYDA 2MH9A 3DU5A 2Y69H 1EIFA 2PFBA 1F1BB 2XTIA 4RG2A 3REBB 5E1ZB 5LGTA 2QA4T 4MEXF 5CCAA 2FUG2 4OAZA 2QM3A 1FYLA 3DPLC 2JVHA 1V76A 2EQUA 4BUGA 2KIMA 1VQNQ 2CH4W 1RC9A 3H9JA 2P6SA 5JVTA 1ZN2A 1YN8A 4RTYA 5DY9A 4B9WA 1TT0A 2IGOA 2NS7A 3QPHA 4AG2C 1G5IA 4L5JA 2IS1A 1YJWQ 2GM4A 1QW1A 3PQJA 4QQGA 1KK7A 2NUTA 2CFOA 4CH7A 4XLPF 1KMNA 1N9SA 4M75B 4M75F 1LYLA 2H94A 2RVCA 3S1RJ 2IS4A 5DS9A 1SHGA 1Y07A 4UUVA 2P0LA 4YRRA 1XDSA 4BY1J 4TQDA 4JLGA 1SAUA 3OMGA 2BEOA 2EYZA 2EZLA 3E5UA 5C3EJ 4UVCA 3C12A 4II3A 3SWNA 3CMAA 3CCJT 1W2BA 3I71A 4GO1A 1Q86R 2RHSB 5E8GA 3WTVC 1SFKA 5D5WB 1CQTA 3PUBA 4MFDA 1NJ1A 4GRIA 3SQNA 2WADA 3ABMH 5GAN8 1G3WA 2H09A 2PMZN 1VQ5Q 1XX5A 2K4YA 2DEUA 2AKKA 3A74A 2LOOA 1NHAA 3DPUA 4HPQA 4L5IA 3G1JA 2Z0WA 5GAOn 4HV5A 4NBQA 2XB5A 3DF8A 5IP7J 2LKXA 2R93J 2OTJI 1S72Q 3CDHA 2DETA 2JA8J 3FIFA 3FXQA 3OY9A 4HVVA 4M6YA 3ZMDA 1JHFA 1XB4A 3QIIA 4LDYA 1N75A 4PJNA 3ROUA 1NK2P 1SETA 1JE8A 4B9XA 3UGTA 2LF7A 4OVAA 2V1QA 4JRPA 1ETXA 2QEXA 2DK3A 1Q86C 4UNOA 1NJ8A 4C8QD 2O03A 4LDWA 1VQ4A 4HCBA 4E7LA 2DU7A 2DA1A 2OA4A 4FETA 3ZN0A 2KRHA 1VQNI 2KY9A 3LWIA 4G7ZF 4BE2A 2DPDA 1QWFA 4JZ4A 4ZZLA 1ZHFA 2XDBA 4KNYA 4KMFA 3OD1A 4EX5A 3RSNA 4A4HA 1ABOA 2GGRA 1QGPA 1KQSA 2NVYJ 1K73U 2GXBA 1RRJA 4HW0A 2MC3A 1G3TA 2A5WA 3MEXA 2DERA 3LSTA 5DUIA 5F08A 5F5WA 3WGIA 5LJ5g 2EFWA 3OSSC 1HKTA 5JVGF 2R5YB 3G73A 4H2SA 2OTJA 3WTTC 4BW9A 3OYKA 2R7DA 2HL3A 1VQOQ 1GL5A 2EFQA 2OQGA 1LUJB 1W36D 2DRKA 1ZR2A 3PVLA 1EQRA 2KT8A 1XD7A 3J7AF 4FSXA 2RQVA 1FBSA 5J40A 3FM3A 1G5HA 1KMMA 3JREA 4C8QB 1YITQ 4EJTA 4E6RA 2JA6J 1HJDA 2K9NA 1ASYA 3CMAI 2E6ZA 2KFDA 3TDZC 3CMEQ 5CYVA 2LNVA 3GXOA 4UP8A 3E9IA 4E6KG 1IJWC 1LEAA 3E6DA 2K6DA 5FU6B 2ZMEC 2E41A 1U6GA 2IVMA 1YJWA 2LBFB 1HQCA 1BU1A 2DL3A 3UR3C 3KP7A 1W7PB 4I0AA 3IKTA 1WI9A 2LP0A 2F5FA 2NNNA 3ZMSA 3FKJA 5DD8A 1BCMA 1SRLA 4P71A 1SERA 3C3WA 3GVAA 1E7OA 1JQQA 2W00A 4IQ4A 4YCUA 3IWZA 4U0VA 2JTVA 4MLOA 4XU3A 3CC4T 3CCMA 2VJ5A 2ID6A 1WXUA 3CCUA 1B8AA 3A7AA 3TBIA 4WJ4A 4C8QE 1WXBA 5CVIA 3ZR8X 5LHIA 3SHFA 2Z2SB 1NPRA 2ZPBB 2KDSA 3BG5A 2QG9B 3ZFJA 4E47A 3X24B 2V4JC 1UGVA 5JHUA 3QDFA 1HD3A 2DE0X 3JAME 1XC5A 4WTOB 3HRIA 1NJ2A 4EDUA 1B4AA 2KRNA 3GTPJ 2AK5A 3PQKA 1W4SA 3L1AA 2E6NA 4F17A 4X5OA 1TXQA 2O9SA 1I39A 1Q7YR 3BJ6A 5CLSA 4N0BA 1VOMA 3EG3A 3R07A 1L0OC 3X2QH 3WTXC 2DFHA 1WDXA 4N4HA 2QHSA 2ZXJA 2VQCA 4M75G 1BR4A 2KQRA 3GNFB 1UAAA 3Q3SA 4XK4A 1Q82U 2LMDA 3ZP5A 4L6V5 3GIBA 2RQPA 5TJJA 3F8FA 4OINF 2Z5UA 5KHDA 4HDVA 2A37A 3HXZA 2FZGB 5ICEA 4LDVA 3GW2A 2KJCA 3C4SA 3VYGA 2HDAA 2RV8A 2VE8A 3P9CA 4KIGA 4F14A 3UH0A 1YX5A 3H9GA 3HXUA 2F1LA 4CS4A 1YFRA 2XGCA 3U1KA 4B3AA 1IB8A 1IXCA 2CQXA 1BYMA 4RKUE 5EGOB 2P0PA 2K40A 4JYKA 2KYBA 4K88A 3H5RA 5KH6A 5C44J 4PSXA 4M6VA 4QT7A 3RL6A 4HT9A 4P72A 2ZNZA 4E7SA 3CD6Q 3OMYA 4D1QA 2K9LA 3I55I 3KYDB 1UFFA 4Z88A 2ZZFA 4AWXB 5F0FA 3S3OA 4NS5A 4HF0A 4MMLA 3RTRA 2CGHA 2W84A 1AU7A 1GXQA 4RA2A 3K1NA 4RAFA 5DCMB 2M30A 4EM1A 1I81A 2MH2A 2HQXA 1ETVA 1Y96A 2NUTB 2VUMJ 2R5MA 3IC7A 4M75E 3RDIA 3THKA 4F7UA 2R7TA 3SFMA 2BY3A 2DA4A 3CXCA 2RK1A 1LE8B 3I58A 1BI0A 2DMTA 2JUGA 2M5WA 1JXSA 3TSZA 4AT1B 4LMYA 2ENMA 5L3FA 2E35A 2K02A 5L3GA 2QDYB 1UELB 2XB0X 3OBYA 4D6WA 3PIPA 1QVFP 3LSKA 2NLUA 4LK1F 2LQWA 3VS5A 4GFBA 3MD2A 1UE9A 4KN7X 2V6EA 1BBWA 1JHHA 2H6CA 1JT6A 4C8QC 4G84A 4DGWB 3TKYA 1D3YA 5LEKA 3IL2A 2EGAA 3FIWA 2SEMA 4C5IA 2G3RA 1PC0A 3QZ9B 4Q47A 4LVKA 2V8KA 3TP0A 1WQ7A 3GEZA 4XKVA 3H0GJ 4XL9A 1T33A 4DQ2A 2KMUA 1XG1A 2PJRB 3JCMg 4YIIA 5LGUA 3N97A 1A6QA 2VQLA 4BI3A 4J9CA 2X9HA 3AKZA 2OCCH 3QPSA 4TV7A 4YG2F 5LL6S 3VV0A 1K73R 1BBZA 1HTTA 1SD7A 2O61A 5BS6A 5L3EA 4BE1A 2JMWA 4X34A 4M73A 1V55H 2CJ9A 1E2XA 1OPCA 3QU3A 2XGXA 4HLXA 4BU2A 2Y90A 5CK9A 1I0CA 4C3JJ 1MV0B 1EX4A 3DLMA 4JRIA 3C2GA 2JRTA 3OYIA 2KNBB 3UA7A 4LK0F 4M7DF 4IQJA 1OPKA 1T39A 4ZDLA 2BVMA 1T3SA 2LDUA 3M0UA 5D6FA 2L3QA 3VSKA 2ZCEA 1EF4A 1SSHA 4I01A 1NZ9A 2DNUA 3NPFA 4R55A 3IKMB 1DPUA 3EDPA 4C3IJ 3HG9A 1JU5C 3RACA 4A3KJ 1TQIA 1LKXA 3OOPA 5E3LA 4DZPA 2LQNA 1ACMB 2LY9A 4S0HB 3FJ5A 3G7ZA 1G51A 4J9IA 2HOTA 3SB2A 1Z3XA 1WJBA 1TQMA 1NH3A 2F5TX 3HOTA 2NRAC 3FWEA 1MJBA 3RCOA 5ILUA 2K4JA 4HF1A 3TUPA 3F70A 2ISYA 2CO5A 2E1HA 3IKLA 2HR3A 4A4KA 3SD4A 4B6MA 1VQ6I 2HXOA 2H3JA 3FLGA 5CKBA 4ELYC 5HLHA 5GAN7 2WC2A 5EEAA 1QVFS 3V7CA 3JV3A 4HX4A 3M0RA 2X1CA 1KU9A 4OMOA 4AC0A 1WJDA 1MSEC 2K3XA 3A7RA 3EYIA 3PIOA 2QKMB 1E17A 1JEGA 2P0WA 4I02A 2R5ZA 2K9GA 2NUPB 1OR7A 1MBHA 1YHQA 1SFEA 4HX8A 4A63B 2WA0A 3H9QA 1LDJA 4IEJA 3R61A 5HODA 1D5VA 3ZL7C 2EIFA 2XDDA 3JCMe 1UHMA 1WYXA 1SVOA 3HXWA 5EG0B 3BJOA 5TGTA 4XTYA 3NWTA 1WVRA 1KA8A 4KISA 1M3CA 4G12A 1TSFA 3OB9A 5GMKm 3ASKA 1N8RC 4RAZA 5FKNA 2A08A 3JCMJ 3M59A 3OYFA 1YIJA 2ZZDA 4AFUC 3GZ6A 1KQ8A 1ZGJA 5GAOr 1USYC 1VQ9T 3IG2A 3MCAB 1EFWA 3E6CC 3NEUA 2O9VA 2E5QA 2QTXA 3RYPA 3DKMA 1F9NA 2WBMA 5JLWA 1YHQT 1R4NB 3MZ8A 3RQ4A 1V1CA 2R7OA 3D5LA 4A6DA 1D3BB 2QBYA 4Y4RA 3F72A 3MEVA 3G6EA 1QZEA 2FSWA 4O2DA 3J80K 1E6HA 4IPAA 1M27C 2BUDA 3KFUA 4M77F 2A69F 2XAHA 4MZMA 3JCMc 3ABTA 3EUKL 1GGMA 1K6YA 3FMSA 3QWLA 2DL4A 3LNQA 1QCFA 2ZCFB 1H4VB 1RPWA 3LSMA 4MO7A 2BHYA 4LUEA 4XEMA 2EJGA 3BPVA 4YRMA 2HVSA 3TEEA 3VB2A 2ZXHA 1BN5A 5AONA 4Y13A 3ML6A 2M87A 1DP3A 3HY0A 1PP8F 1X6GA 2LY2A 2EZHA 1TWAJ 2FRYA 5EC7A 2DAQA 1J7KA 1R7JA 2H3EB 4RCCA 2F4IA 3LW5E 1F5TA 4J5YA 3RUXA 2DOAA 3CJQB 5KE2A 2EA4A 3FKIJ 1Y7XA 1F1ZA 1JTYA 1Y96B 4FL6A 4RTXA 1NG2A 2CIMA 2IG0A 4P75C 4BDYA 1KOGA 3BPXA 1BR1A 3OSVA 3KFWX 2E4HA 3NFCA 3HY1A 2O5RA 3GYHX 3L7WA 2YXYA 2ZIMA 1BR2A 1ZUUA 4H2VA 2KP6A 3KXTA 2L7ZA 1D1BA 1U5TA 3GX4X 1ZX6A 2MWOA 1IXSB 3VYRB 3GFLA 4S04A 2X6XA 5E3MA 1ZH5A 1WKMA 2J5PA 2E2JJ 4VUBA 2VYTA 1WGXA 2MD5A 2MLGA 2HMAA 3BCBA 3JCMW 5IT9E 3BOQA 5GADJ 2Z33A 4RG8A 2QYOA 8ATCB 2EV5A 2HDWA 5IYBJ 1YCSB 4TVRA 3RYRA 2ZSHB 4A0XA 4M7DG 3BWGA 2STTA 1JXMA 3HC7A 1T0FC 4WF2A 5FFXA 5J47A 1PNJA 2RPNA 2OUMA 3MF2A 4CS2A 4JX4A 1TBXA 4D9JA 4JUVA 1K83J 3CC7Q 4G8XA 2W4SA 2OQRA 3QAHA 1K7AA 2HCKA 1WQWA 1YFTA 4A3IJ 3MF1A 3JCUC 2B7EA 1L0WA 2A6EF 2KIQA 5K5OA 2QTVA 3X26B 5IT9K 2AHQA 5KCMA 3CD6A 3CCLT 3OYLA 1GFDA 1VQKA 4FQGA 1SD6A 1UZCA 1U1SA 1M8MA 3M58A 1B7YB 2ME0A 4Y91A 4EMSA 4C2TA 2JVVA 3H0HA 2A61A 4CGZA 3LOCA 5IOZA 3GTJJ 1XMKA 2BZ8A 3BDUA 2DQ0A 2ZINA 1I1SA 1FLIA 3A8HB 3WQZA 2BW3A 1RI7A 3L00A 3ZQ7A 1JB0E 3RQIA 2L02A 3JRCA 2RHSA 2XI9A 4G85A 4M3EA 1HF0A 1SFXA 2K7LA 3IRRA 2JZYA 4BUPA 4J01A 2GTJA 5GAN2 1YW7A 1K8AC 2Q7HA 2A36A 5FGMA 2AZSA 1I5ZA 4II1A 3LSSA 2H8RA 1KG1A 2DJZA 3DB3A 1PJRA 1K9MU 2L01A 1Y0UA 4EMKA 3ZOBA 4DEYA 4M7DE 1KQ0A 5GPCA 3HOYJ 3NAUA 3VS7A 2LJ0A 3LH5A 4XEOA 5M5XJ 4XRFA 5D4RA 4OMMA 5KE3A 5LEJA 1VQPT 2ABLA 1HW2A 2WY8Q 2L5QA 1W4MA 3MZYA 4D0PA 1ARKA 4LG0A 4WWCA 1MBGA 2M7AA 2IA1A 3KEYA 5J8CA 1W7PA 4PJOD 1IAWA 4HV6A 2AHJB 5CQYA 5I2MA 3J80E 2KZGA 1IN4A 2HQNA 1Z9CA 4B43A 1RUOA 3HRUA 1JKQC 3W6KB 1WHUA 3J81K 1AD5A 3CCMI 2XDPA 3S8PA 3I56T 4DBQA 2XGTA 3T8RA 2PMUA 1IZ6A 4PJOG 1MIJA 5I22A 3QSUA 4MTEA 2JTMA 4M7DB 3L4GB 3PSFA 5GP9A 3KCCA 4YFNF 5J1RA 2RJEA 3GFJA 2FPDA 2VKVA 4M78A 2LX9A 3CXCS 1SG5A 1W0TA 3TEGA 4GXOA 3OS2A 1O3RA 4DBHA 2CQKA 2LNBA 2Y2ZA 2ZCWA 3JB9F 1RUWA 2XRNA 4PCQA 3CCLQ 1M1FA 5EG0A 1ZRDA 1K76A 5EG2A 2D2WA 2RI3A 2OU2A 1QRYA 2L2OA 1QVTA 1K61A 2R5ZB 2NUPA 3BR3A 2VT2A 4QPQA 1E1TA 4I99C 1YS6A 4ITVA 5E79C 2OTLA 5GANj 1IRZA 4H2UA 3JRBA 4HRIA 1RACB 2CZ6B 2ZPHB 5GAMd 4G6QA 2A8EA 4LVIA 2BVLA 3BTJA 3L2RA 4IUTA 4RS8A 3ZPLA 5D6EA 4ENNA 2DXTA 5GJWB 4CC3A 5K1YA 3DV8A 2CJAA 1Z9QA 1EKEA 2A68F 1VQ8A 3DU6A 2D45A 3I55Q 2X51A 4GGGA 5A0GA 1JJCA 2HNIA 1YJNA 4OIRF 5GANg 1JT0A 1ZQ3P 2ZPGB 2FO0A 3FXLA 4UUSB 1VQ4I 2P7CB 2FHDA 4XR6A 1J59A 2E5KA 2IXSA 4HT4A 2RI2A 5KYUB 3AL0C 3CCRA 2D6FA 3ECHA 1SMYF 3QYBA 4W97A 1NJIR 4QSHA 1C0AA 1CGPA 1MMAA 1M2OA 5HGQA 1YITT 4ZTZB 3C7JA 4HAMA 5GMKl 1MJAA 3NTKA 4F3QA 4M7AC 4E51A 2DBMA 1MBKA 3OYGA 4RTZA 4YDQA 4IKFA 1FOWA 3RPUA 5DTDA 4I0BA 4JJBA 4A3MJ 4BDZA 3L2CA 4BBSJ 2FOKA 1E3OC 4ZGEB 4ZGJB 4M3FA 3NHNA 5B5EC 1V29B 4D8DA 3J81E 5DM7R 2W25A 2HVRA 5EF6A 2ZPEB 2P5IA 1AHDP 4BD3A 4IHWA 4B3XA 1XDUA 1LVAA 5LHHA 4Y52J 4RB0A 2ROLA 3L2ZA 1XSXA 2WAFA 2D1VA 2HKQB 3CPWA 4ME7A 3JRGA 2PVGB 5EDNA 1S9HA 4IVNA 5CKDA 2BYVE 3DEUA 3G2BA 3PO2J 1Y1WJ 4FW2A 1EVLA 4DW6A 5IT3A 3JB9J 3G71Q 1X01A 1POGA 3PM1A 1ZELA 4GYIA 2V79A 2XRLA 4AUXA 2D0QB 2DRMA 3NETA 1U2WA 3N4MA 4BXXJ 3I64A 4HSRA 5C51B 2CW7A 3M7GA 5HLIA 3REUA 5BPIA 4GBQA 3DFGA 4JX6A 1JJ2A 4HZFA 2YLCA 1TQPA 4HF2A 1NPPA 3PCOB 1IRXA 4I2OA 3FHNA 1H641 1R4MB 2KR3A 3SWNC 3OSGA 1QMCA 5FKLA 4FX4A 2QQ9A 5KAFC 2DJQA 2CUEA 2E5AA 3V7RA 2CDTA 1X3ZB 1PD0A 5DDGA 4F7UB 2LZ6B 1X2GA 1X69A 2DL7A 1S29A 3E6BA 3HHHA 2CRGA 3DTIA 3I35A 5LLQA 3WXMB 4KR3A 4B44A 2P4RA 5C4JJ 3CMAQ 2CJJA 3H0FA 1M90U 1VQ7T 1X6BA 1VQPQ 1AWWA 2P8TA 2ZT7A 1RZ4A 1TU0B 1U5SA 1YJ9T 2K3BA 1TW2A 1Y8QB 4KUMA 2ICWG 4TVWA 4HWOA 1X3UA 4XBFA 2Q5IA 4Q6GA 1JO8A 1LDDA 4EJOA 3M1EA 5GAOm 2PX9A 4HBLA 1NK3P 4IHSA 2DBKA 3S1QJ 2HZDA 3META 1KYZA 3OR1C 1WU7A 2CP5A 3CBOA 2ZT8A 3CCRQ 1FOYA 4RAYA 4M9XA 3EG2A 4YRQA 4X1VA 3HFZA 4RLQA 1WHGA 3EH1A 4W1UA 2FG0A 5AYFA 5GJVB 1RAGB 1K78A 1VQOI 1X2QA 4BBRJ 4OIQF 3KX2A 2AS5F 5ICFA 3A01B 2DW4A 1Z6TA 4IHTA 3MWMA 4XTXA 4BI8B 2L54A 2EL9A 2ZNYA 1Z1DA 4YELA 4B1RA 1R5ID 3FJPA 1YI2T 3LSHA 1HBXG 1OLTA 2PQWA 1BC8C 1OYXA 3CC4I 4AVZA 2VVKA 5CKFA 5IHNA 1M1KC 3RDVA 2PG4A 2P7VB 2Y4XA 1RETA 4NC7A 4XLEA 5HS8A 3K2ZA 3GO5A 1JKPC 2AQFA 2E36A 4V2FA 3BR5A 1F43A 1WHKA 2DXCA 4HNVA 2A7YA 2G6FX 3ESWB 3TO6A 1YFSA 3CCSQ 1JKOC 5F0CA 2JJ9A 2DMPA 1GCPA 4CCNA 3OYJA 5BPDA 2M0CA 2GXAA 5LJ3e 1IZ1A 2CYZB 2EFNA 1WJSA 3CUQA 2ZMEA 1BCOA 1WJ5A 1WGSA 2KMTA 2OTJT 3I54A 2KGTA 4ESFA 2GAUA 3PUFA 1JJ8C 4FYYB 4M75A 2CP2A 4ZYEA 1XTAA 4CDGA 4XLHA 4XAXB 1ZGWA 3OYMA 5DCMA 4BB7A 5J26A 4EGZA 4M7AF 4RTTA 1FNNA 4OOIA 1NJ6A 4JOMA 4U7DA 1S7AA 1PP7U 2ED0A 3HDDA 1LFBA 3W2VA 3KE2A 2RREA 5J1UA 3GFIA 3H5AA 3HL2A 1VTNC 3UNGC 2A07F 1FTZA 1BW6A 3K6GA 4MQVA 2WSFE 3J7AO 1I5LA 1R23A 1IC8A 2HYJA 1GHCA 4ORZA 1MGTA 1KC8C 1LJ9A 3A4CA 1QPMA 1G3SA 2XKOA 1LPLA 2E1OA 3IAS2 3WTYC 4ESJA 2QZ8A 2RQTA 5CKEA 1IL2A 1Y0NA 2YSQA 1RESA 3LA3A 4LLLA 1ENHA 5BOXA 3HSFA 1FP1D 2V9PA 4N9IA 4Q4ZF 2IVWA 3DKXA 3G71A 1JJ6C 4XOTA 5L8RE 1H3ZA 3VEPA 3NEMA 2VLAA 4M71A 3HPWA 3CUOA 3H9NA 2CW8A 4ZDPA 3TREA 4XN0A 2W0ZA 4ENMA 2O88A 2M0YA 1NNHA 1UG1A 5EJCA 2KVQG 1EVKA 3ZXSA 5HS7A 2O4XB 3MP1A 2DYRH 4H02A 2FZKB 1UFMA 5F1JA 1M3AA 1RABB 4OMYA 4J7IA 1VQKQ 3TW7A 2AT1B 4Q5WA 2JMCA 5GAEJ 1D3BA 3TO9A 2HSEB 2LT4A 2K3PA 1T2KA 1LOJA 1VNDA 4JS5A 3H5NA 1BIAA 2F69A 2H27A 3L9FA 1M90C 3BQYA 3TL4X 1U8RA 2L2PA 2G7UA 3CDLA 4D5FA 2EQKA 1GVDA 3D0SA 5GMKi 1K8AU 1XGMA 1MKMA 2X1EA 3ZGKA 2Q7GA 4BL0B 4BS9A 5HLTA 5HDNA 3FHZA 1FT9A 4KT0E 4CSWA 4J15A 2RGVA 2KAFA 4XMYA 4LDXA 4M7AD 1UHSA 4JK1X 5J3LA 1OULA 4MMKA 1G8XA 5ECAA 1D0ZA 2E1MC 2VJ4A 3A8MB 4ZNXA 4C92F 2LCLA 2P4WA 2W85A 3ZN1A 1MDMB 1JUSA 1UGSB 5GMKj 4HQEA 3CCSI 2VOOA 2ZXIA 3ISPA 2OAWA 3QKJA 4U7BA 5CKHA 3VRZA 2YDLA 1IUFA 3VQYA 4LD5A 4RMNA 2RAEA 2XPVA 2MSYA 4P9UA 4LDUA 4HOBA 3CCEA 3UF4A 3WTWC 4KITB 1W36C 2CUZA 3E9GA 4FSSA 1FYFA 3GBQA 1BKBA 2HOAA 4WXHA 3M55A 3UA6A 2Y0SN 3G4SI 2DYBA 2QENA 4LIVA 2VBZA 2HGCA 2I5UA 1FMVA 1ZKGA 2DOEA 3HRMA 2LCCA 4UV8A 1X2MA 1LVKA 4YRLA 3ECOA 2VT3A 3M57A 3PNWC 3G4SA 5L3BA 2QA4Q 1WJAA 3EUHA 1DP7P 1OV3A 4EQQA 1VQLT 4OIPF 2DPPB 2DX1A 5CO7A 3TEHA 4DYRA 3PFIA 3K70D 4KH1B 4MEYF 1PYSA 3CCEI 1USSA 4PLIA 3V42A 3OIQA 1S8NA 3Q9VA 4XKBA 3HHTB 1FX7A 5DCFA 4YFXF 3OSFA 2KXCA 1XGSA 4AIJA 1YJ9A 4YRSA 2K5IA 5H2FC 1RKWA 3CMET 1AZEA 4E7HA 2J3MA 2IEKA 1HDPA 2E3IA 3PMTA 5ILVA 2NOJB 3CBMA 4ELZC 1KQSP 5M9OA 3ZQFA 4IHXA 4KUIA 4OF1A 3OYHA 3G1ZA 4PJJA 1RL2A 1VYUA 3D5RC 1G2BA 1X3WB 4HX7A 2B9SA 1LDKB 3CLOA 1CSKA 4FTHA 3HXVA 3CCUT 1X58A 4HWPA 5LJ3g 2FL7A 4C92D 3IWFA 1Z21A 2IA2A 2PTKA 2QYZA 4J6WA 2FU4A 1MMDA 3AFHA 3G1MA 5JFRA 5A2QK 2BIVA 2OI3A 3W6VA 3EHRA 3MO8A 2J6OA 3JRIA 4K11A 4LVMA 5AIQA 1I5OB 1V5FA 2R5YA 1IUYA 1NJ5A 1R6RA 1FOKA 3M0SA 2KZVA 2X0LA 2ZJ2A 3T9NA 1Q81C 4YRJA 1V5EA 1UUEA 3VQVA 3RESA 4B47A 2YT6A 1SKUB 3M9QA 3K7AJ 2DM1A 3FXRA 4XLCA 1N8RR 3DWLE 9ANTA 2K5CA 1NTCA 1E24A 2CUDA 2DIQA 2DCEA 2L3DA 2ZFWA 1I50J 4HXJA 2LFBA 5K7HA 1HK9A 3RZDJ 2LDMA 2MPXC 2HEQA 4FHTA 2KI7A 1Z3YA 4KRTA 2OCEA 3HSRA 5HKCA 2NVQJ 5L23A 2HOSA 2CSIA 2OBPA 2V1XA 4N4GA 1IG7A 1FIAA 2D8HA 3HTSB 2ELHA 5CQXA 5C0MA 3OWTA 5KCOA 1QE0A 2VOPA 1WI7A 4F7UF 2PI0A 2DODA 4OIOF 2DA6A 4M78B 3G4SQ 5FLVA 3KP4A 1D0XA 3I7FA 1QVGA 3M56A 3PL8A 2X6YA 3F21A 5HDKA 4C8QG 1MMNA 3KLOA 2E2IJ 2COZA 1MSFC 4AFZC 4F16A 2Y75A 3CESA 4DJAA 2DLLA 1ZA2B 1ZBXA 3IALA 3W6JB 2QHUA 2DA5A 2X6OA 3IV5A 1CF7A 2JQ7A 2Y30A 1Z05A 2M1HA 3OL3A 1ZREA 2VGMA 2VC1A 2MC4A 1SPKA 4M7DD 2PU9B 1ZSZB 1LFPA 3JAMK 1SRMA 3BR0A 2DFFA 2F2VA 3EFOA 2V1UA 1YHQQ 1MH3A 1R1TA 4O6JA 5K7FA 3QZ5B 4C92C 3MEYA 11ASA 1BI1A 1AT1B 4P75A 3A5ZB 3SZPA 4A3EJ 4M78D 2P6TA 5FLXE 3HIFA 5GAOq 4M7AG 4M3DA 4A0ZA 1KD1U 4CHUA 4CUGA 4XLAA 1R0CB 1WNLA 5BMZA 4C92G 3EG9B 1C0MA 1WLPB 4YRKA 3AG2H 3JCMd 1YJNT 1IXRC 1J5WA 2PMEA 2CQQA 3MKYB 3I53A 1VQMT 4GLMA 4RDXA 2R58A 4PGGA 5HY6A 1VQOA 5JR3A 3TOAA 3CCET 3W3CA 3DQVC 4M7DA 3GMEA 2VKHA 4U87A 4RGXA 2CREA 3EUHC 1NYRA 1TNSA 2Y0SA 4IO9F 1UCRA 1Z7UA 2Y31A 1JGGA 1XJWB 5KYUA 4BQQA 4EV0A 1GXPA 3GWZA 1CKBA 2JS0A 2EB7A 2RQQA 5LJ5d 5KYXA 4EMKC 3A02A 1YE9A 1QP2A 1FIPA 2JTFA 2ZIOA 3DB4A 1VQ8I 1ZLKA 4J9HA 4KIBA 1SD5A 3AG4H 1BI3A 2ODRD 3MZHA 2X4YA 4XTZA 1DJ7B 4QW2A 3J7YJ 3OBWA 4QQDA 1Z0XA 4OLFA 5FO5A 3EG0A 1P7JA 2HQRA 3V4GA 3JTHA 2K5FA 1RIQA 5JHFA 2GF7A 5ELNA 3LA7A 3ZCOA 3BG7A 3FXKA 4IRHA 2KXDA 1TWBA 1Z7MA 3HSBA 3QO8A 2X9DA 3EFRA 3ICAA 2CP3A 2KPMA 1ZR4A 1QBJA 4J9BA 1OCPA 1IHWA 1WFWA 4NUBA 1Q81U 2KK4A 4ZTJA 1YP5A 3BR2A 1VQ9I 4HG2A 3CC7I 1I8FA 2K5LA 2RHYA 3I5SA 4EMGA 7AT1B 2DDBA 3M07A 2A3SA 3RKQA 4O3MA 3IUOA 1P4AA 2K9SA 2DD5A 4M78C 4BHPA 2KBTA 3E2UA 3VYHB 1O57A 3HGGA 3WGHA 4I98B 2LJ1A 1UECA 4XQFA 3ZQGA 1B72B 4PJOF 2OJED 4JPBW 1T95A 2R7UA 3JCMV 2DA2A 3IP4B 2DU9A 4EJWA 3HOWJ 2HZYA 2QK0A 1FBQA 3ZQCA 2GBQA 2E64A 1ZYRF 4OMFB 2XU8A 2IP2A 1EJ9A 2L4AA 4I09A 2E5NA 1N27A 2E10A 2XC7A 2XGEA 1O9SA 4IHVA 5CR2A 1T56A 1OQKA 2F6CA 2A28A 4P1WA 4HQMA 4C5EA 5E1XA 2KE9A 1ON1A 4PFOA 4YEJA 3J7AY 1W1FA 3ONQA 5GANh 1WX6A 2J7IA 4XLNF 3LWHA 3B6CA 4FE7A 1HA8A 3OS1A 2MMPA 4QVCA 2IPOB 1KSWA 4PK4A 4A3JJ 4RAGA 2KDOA 2YPRA 4C30A 3PSIA 4CCMA 2GIZA 2VODA 1KC8U 3CC2A 4RCBA 4FYXB 5FD5A 4AFQC 2IAIA 1H8AC 4BY6B 3M5AA 5C6SA 3VYSB 3JTGA 4L9TA 2IS2A 4HCCA 2VXZA 3INZA 3WVDB 2FEZA 4PFZA 3CCLA 2P0QA 5LRSA 1ZG5A 2XPUA 4Q5SF 3R60A 5FWBA 3GP8A 3NENA 2ATCB 2NVUB 3OIOA 1PYVA 2KSSA 1REPC 2P0KA 3L2VA 2JJ7A 4ZGDB 2LY1A 1MV3A 4J8OA 1VQ5T 2CV0A 1OJLA 3CCRI 1PD1A 3M4QA 2DTOA 5IYDJ 4CH5A 2P5VA 1XN7A 4FT2A 3A8OB 2ED1A 1YX3A 1SVMA 2A6HF 4KDPA 1TUCA 2UXXA 4V2GA 4E7ZA 1OISA 2Q2EA 1BK2A 2CKKA 3KBGA 3CD6I 4GY5A 4IUPA 3UATA 1IN7A 3DCFA 1AKHB 3GTLJ 3QP5A 2FMYA 2R7SA 5C53B 3ZMTA 4RQEA 1D0YA 5FROA 3V8JA 1HC8A 1VQMQ 1YI2A 5F64A 4X0GA 2B8AA 2LJ3A 2QHTA 1UB4A 3HTZA 2RHQA 3MKWB 3CCRT 2WV0A 3VQXA 4BH9A 1Y57A 4KICA 1RAIB 3P8VA 4UP7A 1H4TA 5HK0A 3CCQQ 2DI3A 3F3XA 4A0YA 3T0YA 1I1JA 3WU1B 3UPUA 2X35A 1XQHA 1GT0C 3DEWA 3CLQA 3FMRA 4R56A 3P8YA 4IUVA 3RGLA 4KR2A 2M02A 2GBYA 2LQ8A 2QI2A 2JMAA 3BY6A 4BJ5C 3EG1A 2OTLI 3WE2A 3RKYA 4K86A 1SEUA 3CTAA 1V4RA 2F5DA 4C9YA 4NQWA 1LJOA 3P8HA 1M5Q1 1W66A 2XV4S 1QQIA 3FBIB 3HB9A 3BW1A 5B1BH 3K4LA 1G59A 3OYAA 3RBBB 5M5WJ 2PVDB 1R0BG 2R7FA 2EV0A 3S32A 5J6XA 1R49A 4DOWA 2XGDA 2UXNA 3OW2S 2LBFA 3GLLA 1NLOC 1NLPC 2NS0A 3MKDA 1W2BS 1BBUA 2ZZEA 1EH7A 2CSOA 4KIFA 4P5OA 2X6WA 2HEOA 1ZUKA 2EBIA 2KROA 3U1DA 4KGVB 2DA3A 1RAEB 4NDLA 5IXBA 3WHCA 2MGQA 5C4XJ 1B7YA 2EFOA 4UVBA 2K9MA 1W70A 4M77D 2ESHA 3OS0A 2AZVA 1X1PA 3K4MA 1P4XA 2VL8A 2OJ2A 1NYFA 3KZYA 4DBRA 1BW5A 1B34B 3KEQA 2OTJQ 2QBYB 2MG4A 2PVOB 3RMSA 3X25B 1Q7YC 1P2FA 5K1XA 2CYYA 1USTA 2CP6A 1ADYA 2I4OA 3QO5A 1BM9A 4HKEA 3HOSA 2D1XA 1BJAA 2R7QA 3S1MJ 1VQ7I 5I21A 3QNEA 2JUFA 2QCOA 3WU2C 3G6EI 2X3WD 3REAB 2DMQA 1ONVA 2O2OA 3BDDA 2RK2A 2XICA 1N9WA 3HXXA 1ZTRA 1Z7NA 1PKTA 1X1BA 3WTUC 4ZYGA 3BJAA 2EIJH 2O4XA 5KAIC 2M0MA 2DMUA 1T3LA 2V9KA 2L8DA 2RKHA 1QHHD 3HKZA 1JUPA 1IXDA 1PUFB 4G94A 3O6BB 4M9SA 1C6VX 2NUZA 4HA8A 3P9IA 3UT1A 4LXCA 3JCMb 2LYCA 3JRAA 1VQ4Q 4NCXA 3A03A 4FX0A 3TGNA 1XSDA 2COYA 3QO3A 4M75D 3FBNB 3P8BB 4PUSA 3S2HJ 3L4GA 5GAOl 2FNPA 4A4FA 3VYTB 3J7ZI 1MMGA 1VQKI 4ESBA 3NRVA 1K4TA 2ELKA 3KETA 1QVGS 1YIJT 1VIEA 3CP2A 2C0TA 2EIMH 2VC8A 1B9MA 1M8VA 2ME6A 4ZYDA 1D8KA 3EFSA 3REXA 2EQIA 4OU0A 3E7LA 5D6XA 1IO2A 1IN6A 2Z1DA 1B72A 3R0AA 4TQFA 1UMQA 3BG9A 3GPLA 2LD5A 2DZ9A 3RI4A 4ZTFA 1FTTA 3P5JA 4M9ZA 1H9TA 2PJRA 5D8LB 2M9UA 4BXUA 4M7AB 2A3LA 2LSOA 1FYKA 4BHCA 2JRMA 4MFEA 4RB1A 5LJ5f 4UB6C 5GAN5 1OU8A 3FXJA 4Z6YA 4DBFA 2F5VA 4PJLA 1O3SA 1OX9A 2J6FA 4FT4A 2CWEA 3U9GA 3HOZJ 4TWAA 3L2WA 5GAHJ 4CICA 2AKWA 2ZT5A 2LP5A 3VS0A 2FBHA 1SSFA 3MEAA 1TOVA 1QP3A 2ZJPF 4ZIBA 4P96A 4IX7A 3QWYA 4PHCA 2ACJA 4M78G 2OZ6A 1UHCA 3JW4A 2BW3B 3E97A 4WCIA 2DFEA 2XSJC 3IKVA 1FEXA 3F0CA 1R8OB 3F8BA 1VQ4T 3JCMf 4LIUA 2B0LA 1DU0A 1ZGAA 2D5VA 4CYCB 3F22A 2YX7A 1JGSA 2W1OA 2DT5A 2CFXA 4PJOB 1S72T 2JTEA 2K2MA 1WCMJ 3HTUA 3ZMUA 2EBPA 1Z67A 3DEEA 2DPUA 1EV7A 1B6AA 3LLRA 2LRDA 4OMPA 3QTCA 1D09B 2M8GX 1B07A 2QUFA 2NYSA 2WAQA 3WHBA 3COAC 1GFCA 4BI4A 1YG2A 4RBOA 4XLFA 3M8EA 1ZLJA 2MW8A 3S3MA 2E2HJ 2MCNA 4Z89A 1ASZA 2PZ1A 2Z9OA 4XSZF 3BTIA 4PJMA 2VONA 4WX9A 4XU1A 4XTUA 4L9VA 1Q82R 5LHGA 4C0ZA 1Q7YU 5E20A 2MD0A 2YR2A 4KJZA 1JBMA 3QU6A 4GCVA 2XKOC 2V7FA 4ZC3A 3AT1B 1Z77A 2I0NA 1T6SA 5CVVA 3A2KA 1K1ZA 2EILH 2QGGA 2PNIA 4P74A 2QQRA 3BP8A 1M2VB 1KU2A 1P4WA 4MGRA 1S6LA 4A6EA 2OX7A 3J81Z 5LJ3f 2RH2A 3E1SA 1BI2A 3M4OJ 1A31A 1EZZB 2XD0A 3NELA 3OS5A 3A1YA 3C18A 5LBQA 1I6HJ 2ZNIA 2IY5A 3C94A 5FD6A 4M3BA 5LJ3j 4PSWA 1OPLA 3FXUA 3JSCA 2DN0A 2ESNA 3WGGA 3SJMA 3K4JA 3CO7C 2HFHA 2YU9J 1PWTA 1SVLA 3LFUA 3E3VA 3KZIC 3S2DJ 5F1RA 4HNUA 1MNMC 2LLKA 2QASA 1YHQI 2BE9B 2JUCA 2HTSA 2JSCA 4NQWB 2EFIA 5E3IA 4IF4A 2EGEA 2WAQN 1EH6A 5EYRA 4D8KA 2DKGA 2FD5A 2GOXB 3WG9A 1RR8C 1B76A 1X1DA 2LKSA 3D5SC 3ERRA 1M3BA 1VQ5A 2F2EA 3TW6A 3BFMA 2O01E 3ZMVA 3CCJI 1YO5C 4U0YA 2Y4YA 4C0GA 2ZBKA 3CC7T 2M4GA 1XSVA 4PLLA 1S72A 2L9RA 2Q8KA 3S3NA 1UTIA 2DOFA 2ZJRF 2STWA 1FXXA 3EHQA 3LYIA 3TEDA 3HUGB 2I4NA 2KJBA 1Z9ZA 4BACA 1J2XA 2ID3A 4F52A 3L1PA 3F8CA 2DXBA 2VPRA 2RD1A 4LB6B 2VASA 5FB2A 3QPLA 4C3HJ 2ZB9A 2RDPA 1IGQA 3HP9A 2XAJA 5TISC 2JA2A 1W1WE 4L0ZB 5GAMe 3CXCP 1QCOA 1Q82C 2C8MA 1YNZA 5BQTA 4XKCA 3OYBA 2D0NA 3LQRA 4RLFA 2K3YA 3TQ7P 1H3HA 5LJ3d 2IGKA 5LD2C 1FYMA 1X54A 3DBLB 2DJIA 4FYWB 2O8XA 4JDSA 1W6XA 2CQNA 2KISA 1Q95G 4J9DA 2HL5C 2XF5A 2QA4I 3S1NJ 4OB1B 1U5TC 1AWOA 2Q7EA 5FLXK 5EEGA 2R92J 3CCJQ 5DUKA 1I27A 1KYWA 1N78A 4L59A 1VIFA 1QVGP 4K87A 5CJ9A 2JVGA 2YUSA 1UGQB 1X75C 2CS7A 3CO6C 4ABZA 3SYTA 4P3NA 3K2AA 4X9CA 1IGUA 2BGCA 2K85A 5LFAA 2QSFX 4G9YA 1R5HA 4OWRB 2DXUA 2WSEE 5FU7B 1YJNQ 3F8MA 4P9FA 4AD9A 2EYQA 5J4VA 2OD5A 2HBPA 2LTOA 2OPTA 1YOVB 2MBFA 2JXBA 2RB6A 3IQLA 4AG1C 1XS9A 4YRGA 4HNTA 3CCUI 2WSCE 3KUFA 1RNLA 2Z16A 5HK3A 3IHUA 1H88C 2L9NA 4J6XA 2RN7A 4IOAF 4BAYA 4XU2A 5LJ5h 5HNFA 2W57A