3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
2L4AA 3REXA 4GGGA 5LJ5d 2ZFWA 1MJ9A 4NOYA 2E41A 3EFSA 4HX8A 1FSEA 4YCVA 4OIPF 2E1CA 1SRYA 4MTEA 3V8KA 2WC2A 3FJPA 3SXYA 3HUGA 4F7UE 3BDDA 2NNNA 11ASA 5C51B 2V79A 4AVPA 1D3BB 1YB3A 3I64A 3RGLA 2DFIA 4P3PA 1GXQA 3ECOA 5BPDA 3F6VA 5BOXA 3ROUA 2Z5UA 1QZZA 1EH6A 3FF5A 3COAC 2I4NA 1YGBA 5CVUA 3RPQA 2P5LC 3I58A 5D5UB 3L4GA 2GXBA 4C8QD 4U88A 5JVTA 4AD9A 4RCCA 3PCOA 4XTWA 1QE0A 2CFXA 3NELA 2RV8A 1PP8F 1IW7F 1WYDA 3BPVA 3CDHA 3K0LA 2BGCA 1MGQA 3BZ6A 4RGRA 2ETHA 5LHHA 4TTVA 2QHUA 4GCVA 2JTVA 4C92E 1IXRC 3RYRA 3V7RA 2V1XA 1VQZA 4M7AE 4JRIA 5IT3A 1YYVA 1LDDA 4PJOA 1JBMA 4M6YA 5LRSA 4K2EA 1TQMA 3Q5FA 2IA2A 3RYPA 2YPRA 3C3WA 4Q4ZF 2D1HA 5GAOn 4ZIBA 3ZMTA 5F6FA 4M77D 1X56A 1QQIA 4U7BA 3EQLF 2HDCA 4XTYA 2DTIA 3ZN0A 2HTSA 4P75A 1OR7A 1KMMA 4ON0A 2DPDA 1USYC 2VC1A 2DU9A 1ZH5A 3GVAA 3SWNC 4C92C 3T8TA 4J15A 1C0WA 5GMKi 2Z99A 2KJBA 2ALYB 4M7AC 1OPCA 3DSQA 3BY6A 2AMCA 5GMKh 4UV8A 2EWNA 4OIOF 4M78F 2I2LA 2XAHA 4XU0A 2NYXA 1XMKA 4OMZA 1AOYA 3W3SA 4RB3C 2RM4A 2HKOA 3QHSA 1G3SA 1D5VA 5BQTA 3IWFA 3IKTA 4Q5SF 4M7DB 3A5ZA 5LJ3d 3WE3A 2UXXA 1YFTA 3F8BA 2VBXA 1T0FA 4UP8A 1WLEA 2EFOA 3ICAA 3HIFA 3IWZA 3O3KA 1IN7A 2XKPA 4EMKC 4L18B 1Q1HA 3E5UA 2IP2A 3LWFA 1ZG1A 5L3DA 4XQ3A 4HZFA 1J0RA 4HYEA 1B7YA 4PJOE 2ARSA 1PYSB 1KMNA 1EOVA 1W4MA 2IPQX 2KIUA 1U5TA 1FPQA 2HQNA 3RTRA 4RQEA 3E5XA 1DP7P 5C53B 2H94A 4I01A 2HQRA 5LJ5h 1G4DA 5FLXK 2RHSA 2OQRA 4LB5A 4YPFA 2EV6A 4XTVA 3G73A 2JZYA 2XAGA 5HLGA 1FZPB 4PJOC 4F7UB 4M75G 4MQVA 1WQ2A 2RNJA 2WTEA 3HXWA 3N97A 4CHUA 1I4K1 4EQQA 1J75A 5GAMe 4P75C 1FYKA 4YRLA 1QO0D 1R1UA 2P8TA 4GYIA 4ENJA 2G9WA 4ZYGA 1ADYA 2AKWA 3W6KB 3V7SA 4JLIA 4LMYA 5LEKA 4PZJA 1QF6A 3B02A 3QU6A 1Y96A 3E9HA 3HRIA 2KRFA 2BV6A 1S6LA 4M6XA 4LNSA 3I53A 2QHSA 1H4TA 3RESA 3T8RA 2XUBA 2E7WA 4PGHA 5FFXA 4KR2A 4C92B 1P4XA 2FNPA 4CH3A 2TDXA 3I59A 3RERA 3FMSA 2DK8A 2K57A 5D6FA 4O6JA 1QBJA 3F8CA 2IA0A 3K1PA 2FMYA 2FU4A 1TTYA 3UGTA 1HKQA 3IL2A 2QLZA 2ZINA 2O03A 4R79A 2FEZA 4YRQA 3FM5A 1LNXA 1QZYA 4CO8A 5HDKA 4WJ3M 4ENKA 1WKMA 1LQ1A 1IZ1A 1ZRFA 3FZVA 5BMZA 3JAMK 1I1GA 4ESFA 1TQIA 2L4MA 3EETA 4YRFA 1XDSA 3HY0A 4M77F 4C8QG 4QVDA 3E97A 1U5TC 5GAN5 1S8NA 3KEQA 4YFXF 2ACJA 4YRGA 3V8LA 3BJAA 3L4GB 4HLYA 5D4SA 3DEUA 1X54A 4HWPA 3PCOB 2ESHA 2KIMA 1FNNA 3R6SA 2VONA 5HGQA 5DD4A 3I54A 3I5UA 4OU0A 1ZLKA 3REOA 5LJ3h 3RIRA 5LJ5g 3BP8A 2VBZA 1B4AA 5J8FA 5DEQA 2F5FA 4M9ZA 3MF2A 4WJ4A 2CSOA 4XSZF 1EV7A 5L3GA 2HYFA 1SFUA 1XGMA 1L0WA 2Z33A 2HYGD 4CZZA 4KIGA 5ILVA 1KU3A 2GIVA 3KETA 2VOOA 4GYGA 1SETA 4M77G 3LAJA 2YSRA 4PJOB 4H0EA 3RKXA 1NJ2A 1XSVA 4P73A 1ZGJA 3HSBA 2YR2A 4IVNA 4L5IA 5ICCA 2XVCA 5HLHA 5KNNA 4TV7A 3F22A 1LEBA 4ASNA 1E17A 1F5TA 1BOAA 2EV0A 2HZTA 1RI7A 1KOGA 1V4RA 2CYYA 3BJ6A 12ASA 2DQ3A 4UP7A 4WXCA 2DZ9A 3P8YA 3OD1A 3V8JA 4WX9A 3INZA 3LQRA 4XTUA 3GYHX 3GF2A 5GMKl 4YRPA 4DNCA 2ODRC 1IAWA 4CICA 5FFZA 3LSQA 4WI1A 1MKMA 3FB9A 2E3CA 4GXOA 5HVQC 4UNOA 4V2SA 2AMCB 1F4KA 2FE3A 1BJAA 1JXSA 4M72A 1I27A 1YS7A 2YHTA 1R36A 3FIFA 2P5VA 5GANf 2PMEA 3R61A 3MEYA 4L87A 4J6XA 5GAMd 1OKRA 1ZGAA 4RGXA 2ZCWA 1LJOA 2QENA 5GANd 1O3RA 1BBUA 2D1VA 3QO8A 2A61A 1S3JA 3U9GA 1STZA 4M7AF 1FYFA 1QNTA 3M4PA 2LF8A 5KK1A 3HRMA 5ICEA 2ZNZA 3F8MA 4IRIA 3A7AA 3T5XA 1R58A 5EEHA 1FSHA 1B7YB 2JPBA 1M5Q1 4L5JA 2E65A 4PDKA 3ZQ7A 1ZHFA 4KIFA 4YRCA 1PYSA 5L3BA 1ZREA 1EVKA 3IRQA 3KP7A 2K27A 1X01A 4EM1A 1IL2A 1U5TB 3RKYA 1NYRA 2VT3A 1MGTA 3E6BA 4I0AA 1ZLJA 3CMQA 3QP6A 2P6TA 5F64A 1IXCA 2K02A 3R4KA 4YIFA 4M78D 2W57A 2IY5A 3ZN1A 3CLOA 5LJ3g 4XEOA 3HRSA 1R7JA 3ZPLA 5DY9A 2UWMA 2PQ8A 1YO5C 1H0MA 3VODA 4P55A 2ODRD 3E6DA 4OIRF 3KP3A 4P73C 4QVCA 2PFBA 1SERA 5E18F 3M1EA 4P5OA 3NRVA 3BDUA 1GGMA 5JR3A 4P72A 4YRRA 1NJ1A 2V9VA 1I81A 1TNSA 4K88A 4CS2A 3MCZA 2OQGA 3ABUA 2E10A 2VC8A 1E22A 3CO7C 4M7DE 2PG4A 1R22A 2VXEA 1I6XA 1FBQA 5ILUA 1ONVA 1SD7A 4M71A 2D45A 3KP2A 3LC0A 3NQOA 3VU3C 5ED4A 1YFHA 1Y96B 1HC7A 5E1ZB 4WXHA 5ICGA 3JCMb 2ZZFA 1BN5A 3A74A 3GWZA 3GUDA 1TNTA 1B1BA 4U7DA 1BC7C 2I4OA 2ZCEA 2Z9OA 3QPHA 2RVCA 2DI3A 4P3OA 5DD8A 2QQ9A 3HXUA 1GHCA 1KU7A 3EYIA 3DQVC 1KQ9A 3I59B 2FYKA 3ERRA 1X55A 1EIYA 4ENMA 3WGHA 2J5OA 4I98B 2VT2A 2M1BA 3V4GA 1YW7A 4EGZA 1CGPA 1TW3A 2MBFA 3AAFA 1LDKB 4ETSA 1H641 3CUOA 3J81Z 1TQPA 4UXNA 2E64A 4FX0A 3OOPA 3FXUA 4CH5A 3IG2A 3EYYA 4I7HA 5GAN6 5D5WB 4HX4A 2V1UA 4TWAA 2Y90A 4M75B 4N0AC 2ZIMA 4XRFA 4IHSA 2QUFA 1HBXG 3IALA 4Q15A 4NCXA 2RGVA 3KE2A 4YFKF 3QO3A 2RC4A 2RKHA 1KU9A 2HOEA 2XGXA 4LG0A 3TO7A 1P6RA 5LGNA 4M9XA 3WTZA 1X3UA 5JHUA 1YG2A 2QQAA 1G5IA 4YREA 2EJGA 1B9NA 2A68F 4BH9A 5GAMh 3TDZC 1FY7A 5GANh 3J7AO 4HT8A 2JSCA 4A5MA 4DQ2A 1SFXA 2DU5A 4XSXF 6PAXA 2EJRA 4P72C 3QOPA 3WTTC 1NJ5A 1JHHA 5E1WA 2L3DA 4ZYHA 1U1SA 2Y0MA 1HW2A 1HXDA 1ADJA 2DO7A 5ELNA 2CG4A 1HSTA 3NEMA 3UGQA 4G9YA 3E9IA 1H4QA 2DTOA 1J59A 2ZXJA 3ULQB 1G6NA 4CS4A 1OMIA 2QWWA 2F5CA 4M7DD 4HX7A 3W6JB 1RUOA 3QTCA 1Z7MA 3NEUA 3M8FA 2OAZA 2ZTGA 4WK8F 5GAN2 4MHGA 3BPXA 1ZRCA 3FHZA 1JGSA 4A6DA 4KA4A 4HWTA 5GAOr 4QLCU 2A6HF 5TJJA 1USSA 2FOKA 3ISPA 1KGSA 4EJWA 2O0YA 1ULYA 2CJBA 4XU3A 2PMUA 1BI1A 3QO7A 1MDMB 4C8QB 4HF1A 1W7PA 3BROA 4ZZLA 4YCWA 1FP2A 4HWRA 3C1DA 4OINF 3SQNA 1WSUA 3TOAA 2ESNA 3JB9J 2DEQA 2ZMEB 3QPTA 4Y17A 5E3IA 2G7UA 5LJ3f 1FBUA 3WGIA 2O6GE 3K2ZA 3IHUA 1OYIA 3FMQA 3L00A 5DUIA 3DP7A 1U6GA 1TLHB 3BW1A 4NHJA 4BAYA 1UCRA 2OD5A 4RB2C 5GAOl 3KFWX 1T39A 2HNIA 4TQDA 3UFGA 2B0LA 2OZ6A 2ZT8A 1J5WA 2P6SA 3I7FA 3JCMP 4MEXF 1W5TA 2HKXA 4YRSA 2ZR2A 2ZNYA 5F1RA 2CO5A 2XAJA 2FNAA 3L7WA 4S04A 1Z7UA 4GO1A 1JRIA 2YLBA 2EL9A 4YRTA 3HHGA 4KFCA 4M78G 4ZZDA 1LOJA 4KIBA 2A5YB 5K5QA 4XU1A 3PZCA 4KICA 5LHGA 2DZCA 1I8FA 5A2QZ 4NL3A 3T0YA 5GAMg 2Y75A 1T2KA 3V7CA 2IY5B 1EFWA 2VE9A 4L9NA 4BQAA 5GANg 2DQLA 1IN5A 2OU2A 2ISZA 4M73A 3LAPA 3K69A 1BI0A 2L54A 2QZ8A 3MFKA 4H02A 1KU2A 3LA2A 4C92D 1XGNA 2I4LA 2EFQA 1U2WA 4M7AD 2XV4S 4HWSA 4HBLA 1MZBA 2CQKA 3PGGA 2HFHA 2LF7A 2QTXA 1ASYA 3HOTA 3DV8A 2MH2A 4PHCA 3VOEA 2E7XA 5ILSA 4ZH4F 2ARTA 1B76A 1Z05A 4BHPA 1JHFA 2CGHA 3KCCA 2YX4A 3RJPA 3K1NA 1XN7A 3DXJF 4EV0A 3J80K 2O3FA 3BFMA 4YFNF 4LFUA 3QUIA 1XSXA 3TEHA 2BYVE 4EO4A 2YU3A 3I0TA 4EMHA 2XIGA 3JCMQ 4TQFA 2FQ3A 2VBYA 1WU7A 4MGRA 1U8RA 2M87A 2KIFA 3WU1B 3EUHA 3F6OA 1EIYB 2AS5F 3L2ZA 1AWCA 5HDGA 1ZG3A 1HKSA 2RA2A 3SHFA 4H2TA 2K86A 4L0ZB 3KP5A 2CWEA 4UVCA 4H2SA 3MWMA 2DAOA 5E8IA 3L1AA 2KJCA 4EJTA 3WQZA 1G51A 2HEOA 1O3SA 2IJLA 4IXAA 4P74A 2FMLA 4UUVA 3B73A 4LGWA 5DYMA 1EVLA 1KQ2A 3BY7A 4L0YB 4XTZA 3ZMZA 3F8FA 3DKWA 1BBWA 4M75A 4M7DF 4O5VA 2ZZGA 4ESBA 4D0PA 2NNYA 4NL2A 5IT9Z 4MQ9F 4PJOD 3KEOA 2M5WA 4LG0B 2WV0A 2FBKA 2HS5A 4KN4X 2F5EA 3FMRA 4RB1A 3N4MA 1U3EM 4A12A 4BHBA 3CJNA 3GZ6A 3GZ5A 3PFIA 2JN0A 3MEXA 4BYYA 4G84A 1LVAA 4OIQF 2XHKA 4J6YA 1XGSA 4UV9A 3SZTA 2ZNIA 2M45A 5L3EA 3H92A 2RQPA 2R7DA 1XD7A 3VEPA 3HRKA 3E3VA 4EJVA 2O61A 5D8KB 2EV5A 4Z2YA 1D3YA 4M7DG 2R3SA 4WXDA 1Z7NA 1XGOA 4RAZA 1SD4A 4YRNA 1SAXA 2EA4A 4AWXB 4G85A 3JW4A 3R0AA 4R1HA 3M7GA 1CF7A 2VC0A 4HV6A 4F7UF 4G94A 3ABTA 4A5NA 3FWEA 3Q9VA 2PEXA 1D8KA 4PNOA 2Q8KA 3JCMc 3SFZA 1HKTA 4BXUA 4BHCA 2PBIA 1O7LA 1JJCA 4N0BA 2EAYA 1TW2A 4M75E 1YW8A 1ZAOA 5BPIA 2Q7EA 3ZMVA 2P5IA 1W7PB 2MLKA 3MF1A 1RIQA 2ZIOA 1MDMA 4HOBA 4C8QA 1XMAA 3WE2A 1HK9A 5GAMf 3JCMe 2VODA 4HV5A 2RN7A 4PG3A 2ISYA 2DPUA 2ZMEA 5FLXZ 2ZR3A 4H2YA 3P7NA 1MJAA 5JFRA 4O2DA 3UH0A 1B34A 2CGPA 1R1TA 1P4WA 3MQ0A 5E8GA 3A7RA 4P74C 2ZKZA 2FRHA 1QGPA 3GW2A 2IT0A 4H2XA 4F7UG 3M9AA 4MTDA 2CJAA 4RS8A 3JCMW 4C92F 2PI0A 4M75C 2RDPA 3E6MA 2ZXFA 3O6BB 5LEJA 3S2WA 1G3TA 1V3FA 4KDPA 4EMSA 5E20A 2X0LA 1WRJA 3P9IA 4KQEA 3NENA 1LEAA 4RAYA 2QQBA 3HFZB 1H9TA 2XAQA 3HFOA 5BS6A 1E24A 2ZGWA 3M8EA 4JK1X 4M77A 2HR3A 2ZT7A 3FXRA 2JRTA 3WU0A 4KUMA 2E1HA 4X9CA 3QAHA 3A7UA 2IW5A 4A0ZA 1SMTA 3GFLA 3ZMDA 2DW4A 3DPLC 3H3ZA 3KP6A 2Z3YA 1KYZA 3IC7A 3VBBA 2NAZA 5AIPA 4R8HA 5CYVA 2ZT5A 3GFMA 1P2FA 4LJZF 1PP7U 1IF1A 4G7OF 3QNEA 2RHQB 2Q5IA 1FP1D 5HOOA 4I2OA 4C92G 1DPRA 3TGNA 1FYMA 4HW0A 4B8XA 4H2WA 2PJPA 4M7AG 2FBIA 5FGMA 4C8QE 1ON1A 4UVBA 3ML6A 2IA1A 2A3SA 4U0WA 3LSTA 2C7IA 4RQFA 4L9TA 1B8AA 1C0AA 2GXGA 3A31A 3WTXC 2IVMA 2H09A 1J5YA 1HW1A 2K4BA 2V1DA 3WGGA 4PGGA 4YP0A 2KKOA 1L3LA 5F5WA 4A53A 2PMFA 3QO5A 2GAUA 2ZZEA 3KZZA 1EH7A 4EJUA 5K1XA 1UB9A 3JAMZ 3F72A 1U78A 2VN2A 3IRRA 1S7AA 3QU3A 2LDUA 3ZMUA 5D4RA 3HOSA 4PJOF 3BJOA 3REUA 4RGSA 3JCMV 1F9NA 2JPCA 4C8QC 3TEHB 1FYLA 1G3WA 2COMA 4WWCA 4CGZA 4H2UA 4ZTZB 1BBYA 4M77E 2VE8A 3GO5A 4EGYA 1I1SA 4JQFA 4IRGA 3JSOA 1B6AA 2PLYA 1DPUA 4M78B 5GAN3 3TEGA 1LJ9A 1R1VA 1KQ8A 2BE5F 1GVJA 2JT1A 4BNCA 3DFGA 1RNLA 2VXZA 3O2PE 1P4AA 2DTHA 1KQ1A 4A2UA 1QPMA 5K1PA 3JB9H 2DQ0A 4QWQA 3P9KA 5HS9A 1R5HA 1W5SA 4ZYDA 1XCVA 3DF8A 1J2XA 2DLLA 2DK5A 3I4PA 4YROA 4WCGA 3FX3A 2QBYA 4OOIA 4IHTA 2H6CA 4M7AA 4PJOG 4F7ZA 1H9GA 4M77C 2LKPA 3F8NA 1N9RA 2XGTA 3GFIA 4OMYA 4YRKA 1G3YA 4HF2A 2P7CB 3MAJA 2ZBKA 3VFZA 4FHTA 1Z6TA 5D6EA 4YIIA 2K4JA 1SESA 3HTZA 4Q47A 3JCMd 1FOKA 2OA4A 3QRFF 2X4HA 1BI2A 4NB5A 4EM2A 1SD6A 4Q48A 4PCQA 2A07F 4TVWA 1IRFA 3LA7A 4JRKA 3HTSB 4S05A 4A0XA 1Z91A 3JCMX 2QHVA 3GIBA 3VB2A 1B70A 4EMKA 4E51A 5FO5A 5GMKj 4ZYEA 1F1ZA 3ERED 2QYOA 1Y0UA 4M74A 2V6CA 1FWZA 3LSSA 5DDGA 3KLNA 4YRIA 3HY1A 3K1MA 3RI4A 3NETA 2R7FA 4MMLA 2BEOA 2C8MA 1H4SA 3U2RA 3KLOA 1NYQA 4UHTA 2I4MA 4UPAA 2Q7GA 1TBXA 2WWYA 4RGUA 3F3XA 2XRNA 3CTAA 5CAIA 1LDJA 3C18A 3C7JA 3JTGA 1ZN2A 5K1YA 5E17F 5ELOA 1IN4A 2DTRA 3WODF 1CF7B 3D0SA 3ZMSA 4P9UA 4AIJA 3E5QA 3JCMJ 1ATIA 1SD5A 2QHTA 2RB6A 3JB9D 1N9WA 1Z1DA 4XTXA 2FF4A 4HQEA 3DPTA 1JJCB 5GAN8 5CVVA 4G6DA 4I09A 3TO6A 1LNWA 2GA2A 4KT5C 2W84A 4YYEA 2H6BA 2XKOA 4Y13A 2XROA 3CUQA 3KP4A 5ERIA 3TQNA 1O7FA 3H3UA 2IRFG 2HTJA 3KZYA 4XBFA 3IKLA 4IJAA 5L3FA 2FXAA 5HS7A 1FBSA 2DBBA 3QP5A 4J5YA 4NQWA 5IT9K 2XASA 3GXOA 1R23A 4LK0F 4HA8A 3F21A 5LJ5j 4P9FA 3BJUA 3GEZA 3K9TA 4CS3A 2EFNA 4AH6A 2EJFA 1B34B 3TDUC 3HXXA 2P5KA 1O3TA 2K7LA 4N9HA 1S7OA 1K78A 4H2XB 1WQ7A 4RB0A 3JTHA 5DCMB 5AONA 1N9SA 1IN6A 1FX7A 1SMYF 3WTUC 2M30A 3WTYC 1PUEE 5LLQA 2W25A 2DJZA 2DU7A 2L02A 2OZUA 5FD6A 1MD0A 2J3MA 1WQWA 2DKGA 2QVOA 2A69F 3RPUA 3HFZA 5LGTA 4M77B 1KQ0A 4LD5A 3SB2A 1ODDA 2VXFA 1RIOH 1J7KA 5GAOq 3D5LA 4AIHA 3HFNA 2YLCA 4M75F 1KA8A 2EJ9A 3PQJA 2HGCA 4CH6A 2E1NA 2GZWA 5J8CA 1LYLA 4IRHA 1T38A 3HRUA 5K5OA 2RHQA 1O57A 2D2WA 2EFWA 4U0VA 5CVRA 3AHUA 4Y91A 3P9CA 5TRDA 4OP0A 4U0YA 4IF4A 1BIAA 2VOPA 3M4GA 1W66A 4I02A 4XLNF 3EFRA 2MC3A 5I21A 2DVEA 4X9DA 3JCMh 1HW5A 5DV5A 2GA1A 4UP9A 1BM9A 3HSEA 2UZKA 3CUQC 1NHAA 5FD5A 5EEGA 4K86A 2DXTA 1R00A 3P8VA 4MNUA 1OYWA 4YRJA 4L9JA 1IUYA 2P0LA 1T6SA 4YRMA 5GMKm 4J6WA 1HTTA 4H2VA 4ZTUB 5HDNA 1XDUA 3HXVA 5GANe 4AIKA 4YCUA 1ZG5A 1FLIA 1K79A 4TVAA 3IKMB 4KMFA 1REPC 5LJ3j 4M78A 1FT9A 4LB6B 5LGUA 1YIOA 1RUNA 1UFMA 4A54A 4C8QF 2FB7A 3IKVA 1WI9A 1DUXC 1WWXA 3ZP5A 2W24A 3SWNB 2G7HA 2QBYB 3JSPA 1XSDA 5H6RA 1U1TA 5L3CA 4KYWA 1D8JA 4M7AB 2MLGA 1KYWA 2PN6A 2AXLA 3OV8A 1NJ6A 4FX4A 3QSUA 5HLIA 4UVAA 2ZJ2A 2Y48A 1TH7A 2GQQA 3JB9F 4WF2A 3HTUA 3RF1A 2VBWA 4CYDA 3CO6C 3BWGA 5GMKe 1IRGA 3FM3A 5E1XA 5D5VB 5KVRA 1B70B 4EMKB 4XU2A 2Q2EA 1D3BA 1R5GA 5J6XA 1BC8C 5AIQA 4HWOA 4YG2F 3TO9A 4HT9A 3ELKA 2F2EA 3TUPA 4A6EA 2STTA 3HXZA 2DDZA 1W7PD 3R07A 5GAN7 4ESJA 1YQAA 3TOBA 3LA3A 4Y15A 3RDIA 4B09A 1GXPA 4M78E 3JB9G 2MD5A 3GLXA 4DPGA 2XTIA 1YW9A 2H27A 5D5XB 2W85A 3JCMg 1I5ZA 1E1OA 2EFPA 5DUKA 4P71A 5ICFA 1P92A 4HAMA 1ZYRF 3FXQA 3GFJA 3ECHA 3LQQA 2Q7HA 3J81K 1WNLA 1NNHA 5DCFA 2L01A 2DXUA 1YFRA 3CUQB 3R0JA 2FSWA 3F23A 1UHMA 3G3ZA 1MJBA 3R60A 3WTSC 3VQYA 1M8VA 1YFSA 3E6CC 3WG9A 5LJ5e 3M4QA 4IPAA 4M78C 3VQWA 1UHWA 2P4WA 4CH4A 3A5YA 2M8EA 1DDNA 4P3NA 2A6EF 5CLSA 2CJ9A 4M9SA 4EVIA 1IN8A 3VQVA 4FT8A 4EM0B 4O3MA 3WTVC 1NJ8A 2Q0OA 4G7HF 2ZT6A 3HSFA 5LRRA 1K78B 2YX7A 1L0OC 3HXYA 2EB7A 2PMHA 4HDUA 1FC3A 1RZ4A 3G1ZA 2ADUA 2ALYA 5DCMA 4N9IA 3MZYA 2P7VB 1EH8A 5D8LB 3I71A 1X2HA 1XB4A 1EQRA 4KR3A 4P96A 3L2CA 2NRAC 3P8TA 2LSOA 1PDNC 4EJOA 2EA2A 2CW0F 2RD1A 3RKWA 1ZARA 1J9IA 1XCBA 2F5DA 4M7DA 4Q6GA 2ZNJA 4E70A 2DQRA 4HLXA 1E1TA 1HQCA 2Q5HA 2QM3A 1K7AA 3HYIA 5GAOp 1I5LA 3J80Z 1HSJA 3JB9I 5CVJA 2E5AA 3A32A 1B9MA 3U1DA 4EMGA 2HWVA 1Z6RA 4HDVA 4ENNA 2UXNA 2EK5A 1Z9CA 3EDPA 1ASZA 1OYYA 1JE8A 1B59A 1LB2A 5CJ9A 1H4VB 4EX5A 5H6QA 4LLLA 5LHIA 4N0AA 4JBAA 1USTA 4G7ZF 3SZPA 3HFVA 4HVCA 3RUXA 2ARUA 1YLFA 1ON2A 2FA5A 4HQMA 3PQKA 2DT5A 5GAN4 1E2XA 2O8XA 5JI6A 4LLNA 2ELHA 4KNYA 1YCYA 4K87A 3HSRA 3WTWC 1WPYA 2C6YA 4P71C 4TVYA 2RHSB 2J3LA 2XAFA 3KFUA 3RL6A 2G4CA 2BBYA 3T1BA 1SFEA 4RDXA 4RMFA 3GX4X 4MEYF 4G8XA 2MA3A 3RACA 4F7UA 3TKYA 1S29A 1BI3A 3HRTA 1G5HA 5LBQA 1YTYA 5FB2A 1ZRDA 1YS6A 4BWAA 5HS8A 4M75D 5K5RA 2GWRA 5C52B 4A0YA 2AKWB 5LJ3e 4OLFA 3L9FA 4TVAB 2ZO4A 4KMUX 5GAMj 4YDQA 2LNBA 4LLGF 3VQXA 4HF0A 4RCBA 4XLPF 2OBPA 4BW9A 1VTNC 5GANj 3Q9SA 4MMKA 1IXSB 4XEMA 3MZHA 1A04A 3LFKA 1O3QA 5H20A 4JUVA 1BIBA 4X5OA 4CXFA 3L09A 5CVIA 1USYA 1T98A 2FBHA 4LK1F 5A2QK 2MH9A 4I0BA 4CDGA 4L9VA 2J5PA 3SWNA 4C92A 2STWA 5LJ5f 3BOQA 4M7DC 5GAOm 1X2GA 3JCMf 2NS0A 4G6QA 2CIMA 3HHHA 4KN7X 1K6OA
chains in the Genus database with same CATH superfamily
4EEFG 3ZQCA 4NOYA 2K9GA 4ABZA 5AYFA 3DLMA 1YJ9I 3AL0C 3SXYA 3HUGA 4F7UE 4LVMA 1BYMA 1YB3A 3RGLA 3H5RA 1GXQA 2RHIA 3F6VA 5BOXA 3ROUA 2ZZDA 1QZZA 2F5VA 3FF5A 2I4NA 2DRKA 5CVUA 2ATCB 1R5ID 2BZYA 2W00A 4U88A 5JVTA 2GQIA 3I56T 2RV8A 3CDHA 1PD1A 1PYVA 2BGCA 4FW2A 1QVGS 3BZ6A 4RGRA 2YUOA 4C92E 1IXRC 4JRIA 1W1FA 5IT3A 1YYVA 4M6YA 3OYEA 1U0JA 4A3JJ 2YPRA 2CZ0B 2M9UA 4M77D 4XTYA 3ZN0A 1OR7A 1USYC 2VC1A 2E5NA 1Y7XA 5L23A 3GTOJ 2BHZA 3A02A 4C92C 4J15A 1C0WA 4XKWA 5EC7A 2AMCA 4FTHA 2CU7A 1GXIE 3MD2A 2HXOA 1XMKA 1AOYA 2RM4A 2HKOA 4J7FA 1G3SA 4LD6A 5BQTA 4HVVA 1ETYA 5LJ3d 4IHWA 3WE3A 2UXXA 2VBXA 4XQFA 3A1PA 1VQLT 2EFOA 1AZEA 5KCOA 3ICAA 1ERDA 3IWZA 3O3KA 1IN7A 2XKPA 3CF5F 2Z0WA 2DNUA 1ZG1A 1I39A 1J0RA 1WHMA 1QKXA 2R7WA 1WJQA 1RESA 1W4MA 2KIUA 2EVRA 2AZVA 2CS3A 4EIKA 1SHFA 2L7ZA 1WJAA 5EF6A 2J6OA 3T9NA 2V4JC 3I55Q 5LJ5h 5FLXK 5FKMA 2EV6A 4JS4A 3G73A 2JZYA 2XAGA 5HLGA 4PL6A 5EGOA 4LUDA 1PCXA 4CHUA 2RQUA 3OYIA 1J75A 1FIPA 4OF1A 4P75C 2MD0A 1R1UA 4ENJA 2G9WA 2AIRB 1ZTRA 4LMYA 1X1PA 2LT1A 3RSNA 3B02A 3QU6A 3OBYA 1Y96A 3E9HA 2IAIA 3BTJA 2KRFA 2KP6A 2XUBA 4PGHA 5FFXA 4ZNXA 2EPDA 2BY2A 3K4MA 3ASKA 2DK8A 3FK7A 2DL7A 1T0FC 3CCLI 3LGFA 2DYRH 1WJDA 4QPQA 1QWEA 3IL2A 2O03A 2FEZA 4YRQA 3AG1H 2OC6A 2EYZA 1VQ6Q 3ZQFA 3CXCS 4WJ3M 1WKMA 1P9QC 5BMZA 1XDSA 1U5TC 5CQEA 5GAN5 4XOTA 1I07A 3KEQA 4YRGA 2QCOA 1V5FA 5D4SA 2QAZA 5CKBA 5DD4A 5KYXA 4B3AA 1WJRA 1XOVA 3REOA 5LJ5g 3GTGJ 1RAHB 1B4AA 3I55I 5J8FA 2F5FA 3MCAB 4WJ4A 4A4HA 4XSZF 4JJNK 2VJJA 3H0FA 5L3GA 3J81E 3K4NA 2HYGD 5ILVA 2DCEA 1KU3A 2GIVA 3E9FA 2LQNA 2CUDA 4P73A 3HSBA 2YR2A 4IVNA 4L5IA 2XPUA 4CCKA 4TV7A 3RPUD 2M0YA 3CJQB 2F69A 1BOAA 1W2BA 2HPIA 4FL6A 3ZOBA 12ASA 4WXCA 3FXOA 3W3CA 3OD1A 2IVWA 2CP6A 4F92B 1K83J 4DNCA 2ODRC 4XLCA 1IAWA 3L2WA 4MFDA 4WI1A 3CQZJ 2AMCB 2E34A 1F4KA 1ORKA 1I27A 1YS7A 2JUCA 1CKAA 1JB0E 1X2MA 4L87A 5GAMd 1OKRA 4RGXA 3CC4T 1LJOA 2CUEA 3CF2A 2EQIA 2ROLA 2QG9B 1BBUA 1NG2A 3JRHA 2OTLQ 1S3JA 3LGLA 4IUVA 4ZGDB 1LE8A 1I3QJ 3CMMA 3SDGA 1VQ6A 2X1EA 4B47A 2B63J 2F2VA 1R4NB 2DMQA 3HRMA 4AT1B 3J7YJ 4I6ZA 1UFFA 5EEHA 1FSHA 3OBWA 4PDKA 1ZHFA 4KIFA 4YRCA 1RPWA 1PYSA 3FC3A 2K3XA 1ZUKA 3HGGA 2CKKA 1M1KC 3E6BA 4I0AA 2OI3A 1OZ2A 3VSKA 1WYXA 2P0QA 2YRDA 3A1YA 1X4PA 2IY5A 1XQHA 2R7TA 2DBMA 4OVAA 2UWMA 1YO5C 3HHTB 3CC7T 2ODRD 5EGOB 2VVKA 4OIRF 3MJXA 4QVCA 5K7HA 1VQKT 3NTHA 4P5OA 4F52A 1GGMA 5JR3A 4YRRA 3S3NA 4FT4A 1W70A 2M0CA 1VQPA 1TG0A 1E22A 2DYBA 2PG4A 2VXEA 3HKZA 1ONVA 1SD7A 4M71A 1MHNA 2D45A 2V8IA 4KT0E 4LITA 2CV0A 1Y96B 2WA0A 2FPFA 2GBQA 2ZZFA 2XB5A 3ESWB 2DT7B 2DODA 2I4OA 3QPHA 5A2QE 2VGMA 3ZCOA 2QQ9A 2CH0A 1RR7A 3DQVC 1KQ9A 1M3AA 3WGHA 1ZX6A 4I98B 4BU2A 2NVTJ 2M1BA 2KNBB 1VQMA 1CGPA 1TW3A 3VYSB 3AAFA 2X35A 3CUOA 1Z0XA 2RHUA 4UXNA 2E64A 2ZPFB 2OTLI 2LCCA 4CH5A 2VGNA 3M3YJ 2RF0A 5D5WB 4HX4A 2V1UA 4N0AC 3PMIA 1OLTA 2X4XA 3AFHA 2WSEE 4LG0A 5LGNA 2B86A 2BIVA 3WTZA 2XF6A 2HDAA 5EZHA 1G5IA 1KQSS 5BNGA 2MIOA 4CSWA 5IP7J 2EJGA 5CQXA 4C5GA 5KYXB 2A68F 4BH9A 3TDZC 4D8KA 2CH4W 1RAAB 2EKOA 3NTIA 4XSXF 2EJRA 4J9BA 4NC6A 2A3LA 3WTTC 2H3JA 3G6EQ 3QJ6A 1HW2A 2KBTA 1ADJA 2DO7A 1OPLA 3CPWP 3UGQA 3E9IA 2DTOA 1J59A 2ZXJA 3G1MA 2IS2A 1G6NA 3CCEA 1OMIA 2F5CA 4FISA 4OB1B 5M5YJ 3BPXA 4A6DA 4KA4A 1VQ4Q 2M16A 2IGMA 4PUSA 1BI1A 2HOAA 2IXSA 3M8JA 1Y0MA 2JUGA 4BI8B 4OINF 1JJ2A 2ZMEB 3QPTA 4Y17A 2G7UA 1JJ8C 1GT0C 3IHUA 1GCQC 1X6GA 1UUEA 1D5YA 1OX9A 3EGUA 2Z2SB 2X51A 1KD1C 2OD5A 4RB2C 1YI2Q 4HKEA 2O88A 2HNIA 5D6XA 1J5WA 2P6SA 3JCMP 4MEXF 2HKXA 4YRSA 3EGDA 1EJ9A 3GPLA 2ZNYA 2CO5A 5KCMA 4S04A 5TISC 4GO1A 1JRIA 4YRTA 1RADB 4DJAA 4M78G 4ZZDA 2A5YB 3TSWA 3CCVT 2DETA 3VRYA 3PNTA 1I8FA 4NL3A 4BS9A 3N5BB 1T2KA 2IY5B 4BQAA 1AOJA 3M57A 3RDVA 2DQLA 3PM1A 1IN5A 1PRMC 3K69A 2KDSA 1BI0A 4H02A 1RRJA 3G6EI 1XGNA 1DP3A 1PHTA 1GUUA 4M7AD 3GBQA 2EFIA 2KT0A 3M4YA 1W2BS 3DV8A 1JTXA 4N4NB 4AYBA 3VOEA 1BR1A 1D1BA 1UMQA 1Z05A 4BHPA 2K5LA 1JHFA 4G12A 3KCCA 4AUXA 2O3FA 1M2OA 3QUIA 1Y8RB 4HCKA 4E7HA 4F93B 2WV1A 5FU7B 4TQFA 5IYBJ 2FQ3A 1KK7A 4MGRA 1TWAJ 5F0HA 4J19A 2KIFA 3F6OA 2KT1A 2VLAA 1ZG3A 1YHQI 1HKSA 2K86A 4L0ZB 3KYCB 2CWEA 4UVCA 1E7OA 2GCXA 2DBKA 2OCEA 1G51A 1M1FA 1H89C 1GL5A 4N4GA 1YI2I 4M3EA 1EVLA 5M5XJ 1KQ2A 4U87A 1TWHJ 3NGPA 1WA7A 4O5VA 4ESBA 5E3OA 2M5WA 4LG0B 2DXCA 4XNFA 4RTTA 2M7BA 4N4HA 2HOSA 2Y30A 2HS5A 3N4MA 2NYSA 1FJLA 4BHBA 1YITA 3PFIA 2KZGA 1GV5A 3OL3A 4BYYA 2Y2ZA 2M45A 5L3EA 3H92A 2R7DA 3HRKA 4ME7A 3CCMA 4ITVA 2CT3A 1VQOI 3TU4K 1GLNA 4Z89A 5E3NA 4RAZA 1SAXA 4AWXB 2X4WA 5JHFA 4BE1A 4A5NA 4LNPA 4ZC3A 3Q9VA 2PEXA 3SFZA 1HKTA 4HEA2 4BXUA 3J7AY 2PBIA 1O7LA 4M75E 2X3WD 2M1HA 5BPIA 3H0HA 3MF1A 2EIJH 3TQ7P 1MDMA 4HOBA 4BGDA 4GY5A 2RN7A 2E36A 3W2VA 2FD5A 3P7NA 1VQ9A 2LBFA 4O2DA 1SANA 3B6CA 1B34A 1R1TA 3A7RA 5E8GA 3C94A 2VPRA 1S72A 3GW2A 2IT0A 1MBKA 4F7UG 4MTDA 3JCMW 2PI0A 4M75C 3H9GA 1V3FA 1N25A 4EMSA 3GTLJ 3EGDB 3NENA 3TW7A 2V6EA 4KUIA 1E6HA 3HFOA 5BS6A 4JK1X 4KUMA 1QVUA 2JVHA 4X9CA 2EYWA 2DA4A 1PD0A 2H1KA 1LVKA 3H3ZA 3KP6A 2Z3YA 4YRVA 4PK4A 5AIPA 2BKDN 5CYVA 3GFMA 4PJNA 1SF9A 1IF1A 2AQFA 3G2BA 2KPMA 3QYHB 2Q5IA 2RHQB 4I2OA 4C92G 4F14A 2PJPA 4C8QE 2A3SA 2F1LA 3LSTA 4JX6A 4OB3B 3A31A 3WTXC 2NS7A 2V1DA 3WGGA 4PGGA 4YP0A 2P0KA 5DM7R 4A53A 3QO5A 2GAUA 2ZZEA 1EH7A 4EJUA 1I1JA 1U78A 2CZ6B 1ACMB 1UB4A 1OCCH 2HNHA 4C9YA 4RGSA 1WH7A 2JPCA 4C8QC 1V76A 3KPHA 2COMA 4BEHA 1JJ2S 2VE8A 5CKEA 1M2VA 3JSOA 2MABA 4HCCA 3CDLA 2KI7A 3JRDA 1FTTA 5J3BA 2DTHA 4A2UA 1OULA 4QWQA 1W5SA 5IP6A 4ZYDA 5B3SH 6AT1B 1YJ9A 4A3LJ 4IHTA 4M7AA 2LKPA 1ZA1B 1K9MC 1N9RA 2XGTA 4W1UA 1YJWA 1D0XA 4DYCA 3VFZA 1Z6TA 3JCMd 1FOKA 2X4HA 4NB5A 4EM2A 2KXDA 2DT6A 3HTSB 1K73C 4HG2A 3I3LA 5KHDA 5GMKj 4BJ6C 2V6CA 5DDGA 3M1CA 2QK0A 3K1MA 2R7FA 2O01E 2COBA 2P0PA 1IG7A 1YE9A 2E12A 2Q7GA 4RTUA 4RGUA 4PLLA 2PVDB 3OYMA 1Z9ZA 1LDJA 3CC2A 3EUKL 1ZN2A 1VQ5I 1IN4A 1UAAA 1WJBA 2KISA 2V9PA 1AA7A 1QCOA 3S15J 4DW6A 3JB9D 1N9WA 1E3PA 1KD1R 2HSEB 4HQEA 1SSFA 4G6DA 3TO6A 3VYHB 4YYEA 2JA6J 3CUQA 2RI5A 1O7FA 2EQRA 2HTJA 2M9HA 1ZSZC 5L3FA 2FXAA 1FBSA 2DBBA 3DKYA 2IS1A 1VZ0A 4IQJA 4YEJA 1B34B 3SFMA 3HXXA 4KH1B 4BD3A 2K7LA 1K78A 4RB0A 5AONA 1P7IA 2XRLA 3SEMA 3WTUC 5IY5H 2M30A 4HVUA 1PUEE 4FSXA 1M90U 2W25A 3HEFA 1JXOA 5FD6A 3S1QJ 2QVOA 2LQKA 3BTLA 2A69F 1VQNI 1QRYA 1KQ0A 3IV5A 2G0EA 1J7KA 2CT4A 3L42A 5GAOq 3BG5A 3OYDA 3HFNA 2HZYA 3E0JB 4XK8E 3TEEA 1M1KU 4CH6A 5B66C 1SSHA 2E1NA 2GZWA 5J8CA 3KUFA 1D0YA 1VQ6T 1QMCA 2RQWA 4IRHA 5K5OA 2D2WA 1X2KA 1FMVA 2CV1A 2HQEA 2F4MB 4IF4A 1RC9A 4JP0A 2P81A 4PSWA 3M4GA 2OTJQ 3L1PA 3ASOH 3H5AA 2QSGX 2DVEA 5E3LA 1K8AC 2ED1A 2QXFA 2VUBA 5EEGA 3WG7H 2DXTA 3CMEA 3RQ4A 1IUYA 2JK3A 1BBZA 4YRMA 1MH4A 4ZGEB 4ZTUB 3MP6A 3HXVA 2HDDA 4HSRA 3HJEA 5IPAA 4AIKA 1M2VB 1ZG5A 4AFQC 3CCQQ 2F5KA 1HJDA 3AG4H 2V26A 1YX3A 3H36A 4M78A 3CCLA 4FYYB 1NM7A 1UFMA 2DA2A 1YNZA 3BR6A 4BE2A 2CQQA 3ZP5A 2G7HA 1TWFJ 3JSPA 1Q7YU 3ME9A 1D8JA 4M7AB 2B9SA 2ZXHA 2PN6A 5B5EC 4YELA 4UVAA 1MNEA 3O8GA 1SFOJ 2DFUA 1PNJA 4WCIA 2BVMA 1VQMT 3BWGA 2JWTA 3G4SQ 5GMKe 3F70A 5D5VB 1R5GA 2LC2A 1E0EA 3M0RA 4KJZA 4D5CA 4YG2F 1OISA 1W5CC 2ZJPF 2I8DA 1TZLA 4A6EA 3HXZA 1W7PD 4F16A 3CBPA 1NJIC 1QHGA 3LA3A 4Y15A 1NH3A 2JZ2A 2OTJI 1YW9A 2H27A 2KSSA 2IS6A 2KEAA 5I22A 2ID6A 1I5ZA 2V1RA 5FROA 2ZC2A 1P92A 3WVEB 3PO2J 2XGCA 2F2WA 1DQUA 3H0GJ 2O9LA 1UHSA 2IG0A 3CUQB 2J6KA 2WBMA 3R60A 2LRQA 3PUBA 3E6CC 3HDDA 2P4WA 2M8EA 3C2GA 2CQ7A 2I0NA 3A2KA 2X6YA 1NJ8A 3PNVA 4O3MA 3S1MJ 5LRRA 1K78B 1JJ6C 2YX7A 2EB7A 2VV5A 4HDUA 2ALYA 1Z9QA 4N9IA 2P7VB 1EH8A 5D8LB 1X2HA 4LD9K 3CMAI 1EQRA 3P8TA 3QWLA 2Y9ZA 2RD1A 1J9IA 2F5DA 2X3XD 2L0KA 1E1TA 1K7AA 2JS0A 3JB9I 2E5AA 1OYXA 2HBWA 1Q86C 3U1DA 3HG9A 4EMGA 4HDVA 4XRSG 2LQWA 1JE8A 1B59A 2RH2A 5EG0A 2BOLA 2W0ZA 4E6RA 4JBAA 1NEGA 3OYYA 5GAN4 2LT4A 2YUPA 4EATA 2ELHA 2JVVA 1HDPA 3Q3SA 4BXFA 2CZ7B 1NLPC 1SPKA 2RHSB 2J3LA 4XLHA 2EGCA 1PKSA 2XAFA 1C1AA 3T1BA 2DOEA 2HVSA 4RDXA 4MEYF 4F7UA 3VS1A 5LBQA 2D9TA 3EH1A 5FB2A 2QA4Q 4RM3A 5HS8A 3F0CA 4DZPA 2AKWB 4OLFA 1ABOA 4LLGF 3VQXA 4HF0A 4RCBA 2FRYA 4BW9A 3V42A 4MMKA 3G1OA 3F9KA 3MZHA 1A04A 3LFKA 4MFEA 2CQNA 1K73R 3TW6A 5FWBA 1BIBA 4IL6C 1USYA 2FBHA 3QDRB 1VQ4T 2MH9A 2LREA 4CDGA 4L9VA 2WY7Q 3HC7A 2J5PA 3K4KA 4C92A 2STWA 2HQ5A 4M7DC 1X1CA 2DDAA 4G6QA 1PM3A 5LJ5d 1N6AA 1SRLA 5FKKA 2E41A 3EFSA 1WGSA 5IOYA 4QTRA 1K1ZA 1SRYA 3V8KA 2RN8A 2LG4A 3P8DA 3FJPA 1MNMC 4C30A 3KBGA 11ASA 2V79A 4KGXB 2X48A 5IAYA 2DFIA 3VDXA 1MBGA 1IHVA 3RPQA 5CKHA 2EZHA 3L4GA 1JKOC 4C3JJ 1QE0A 2HQXA 2M8GX 4N4OB 1PP8F 1IW7F 1PKTA 3C0CA 2HOTA 1MGQA 1SEUA 3OS5A 5LHHA 4J9IA 4TTVA 4JS5A 4GCVA 2F4IA 2JTVA 3RYRA 1VQZA 4IOCF 3A0BC 2KY9A 5LRSA 4DYQA 2L2OA 3Q5FA 2IA2A 3C3WA 5GAOn 2LD5A 5IT9E 4U7BA 3EQLF 2HDCA 2H8WA 2HTSA 2OAUA 4P75A 4JZ4A 1ZH5A 2ECZA 3META 3AT1B 2RI3A 3SWNC 2KJBA 2ALYB 1OPCA 3MPUB 3DSQA 1NEBA 2H3EB 2EWNA 3BT9A 2NOJB 4IUQA 2I2LA 4XU0A 4RB3C 3M5AA 2SEMA 1D5VA 2R7ZJ 3A5ZA 3QXEB 4ZGJB 1T0FA 4UP8A 3ER0A 3G1LA 3M58A 3HIFA 2BE7D 1K8AR 3WHCA 1Q1HA 5GP9A 4H4KC 3JV3A 4E6KG 3WHBA 4XQ3A 3HOUJ 3CDIA 5EZGA 2EQKA 3DWLE 2L7FP 4PJOE 5EG0B 2ARSA 5CCAA 2RJDA 2WAQN 1EOVA 2IPQX 1AHJB 1U5TA 3RTRA 1V5GA 2HQRA 4JLGA 1KIKA 2MFZA 5FLVA 5KE3A 2OQRA 2NUTA 4YPFA 4XTVA 2PMZN 1FZPB 3K4JA 3H9QA 4PJOC 4F7UB 4M75G 3OWTA 2RNJA 2NVYJ 3HXWA 3N97A 5FU6C 1I4K1 4ZDPA 1NZ9A 5M3MJ 1FYKA 4YRLA 1QO0D 4GYIA 4A3GJ 4JLIA 2HL5C 2DA5A 4CRIA 4CCJA 1R9TJ 1EF4A 1V1CA 3QOEA 1YHQA 1S6LA 5D7UA 2ID3A 3T8RA 3A8MB 4PJMA 5A0GA 1HA8A 2WAEA 2M0MA 4C92B 1P4XA 2FNPA 2TDXA 3I59A 1VQLQ 4O6JA 2V1NA 1QBJA 1SC7A 2IA0A 1X3ZB 2FU4A 1TTYA 4C2UA 1HKQA 2ZINA 2HU9A 1G59A 1EX4A 4BKXA 1BKBA 4ENKA 1R49A 1LQ1A 3FZVA 2E5ZA 2CS7A 2R92J 1I1GA 3EETA 1G2BA 4FE4A 3HY0A 2OUMA 4C8QG 1QP3A 3L2RA 3TSZA 1NBEB 3I56I 1YJWT 3BJAA 3L4GB 2ZJQF 4HWPA 1N27A 2FQ4A 1VQOA 2KIMA 2XSJC 2VONA 3LOCA 2ENMA 3I5UA 1ZLKA 2V8JA 2XICA 4OMPA 5B1AH 2A36A 3ZQGA 1EV7A 2HYFA 1SFUA 3S2HJ 4CZZA 1UJ0A 1UGVA 3KETA 2VOOA 4GYGA 3LAJA 2YSRA 3GMEA 2AXTC 3RKXA 5KCHA 2MC4A 1XSVA 2YRCA 4XK4A 3CEYA 1NYGA 5KNNA 1LEBA 3OYJA 1UJ8A 1W36D 4LXCA 3CC2T 2XF5A 3ABMH 2DYIA 3P8YA 3V8JA 3INZA 2AT1B 3LQRA 3GYHX 3GF2A 1Y57A 1Q86R 1TWBA 3LSQA 5FWCA 2FX0A 5HODA 4GXOA 1Y56A 3EGXB 4AG1C 2H1LA 1BJAA 2VKNA 2YHTA 1R36A 3NAUA 2C06A 2PMEA 3R61A 3MEYA 1HD3A 4J6XA 3S8PA 1VQLI 1ZGAA 2ZCWA 3A5ZB 2DMOA 1O3RA 2K9NA 2QGUA 2D1VA 1WI7A 1ZK8A 4RUGA 2JT4A 3U9GA 1STZA 3CCSA 4M7AF 1QNTA 4KGZB 3M4PA 2LF8A 5KK1A 5FKLA 2GOXB 2E4HA 5ICEA 2MPXC 2ZNZA 4IRIA 1M5Q1 4L5JA 2E65A 3ZQ7A 4A93J 3LW5E 1ZREA 1YRNA 2I10A 1X01A 1FTZA 1I6HJ 2CW8A 1U5TB 1VQ7Q 2J05A 1ZLJA 2P6TA 2K02A 4EPCA 2W57A 4M3BA 3CLOA 1VIFA 2NUTB 2M2EA 3HRSA 3ZPLA 1QKWA 4DBFA 2PQ8A 5EEAA 1IRZA 3VODA 3E6DA 2A28A 3TBIA 4LVLA 2XB0X 4RTYA 2RNAA 2XIDA 2V9VA 4CCMA 1I81A 1RR8C 4K88A 2OQGA 2E10A 2VC8A 1RUWA 5F1JA 1NTCA 3LX7A 1R22A 1Y0NA 1FBQA 4AM3A 2RREA 1UGQB 3NQOA 1BCOA 2K3YA 4BACA 4WXHA 1XJWB 3JCMb 3K4BA 3A74A 2FL7A 3JRGA 3ULRB 3KEYA 3GWZA 4XRSA 2DMUA 3FXMA 1B1BA 1BC7C 4DOVA 3VS7A 2QEXQ 3CMET 5EG2A 2RVCA 1TC3C 2XI9A 2DI3A 3CC4Q 3L2UA 5DD8A 3HXUA 2C0TA 3I59B 1X55A 2KL4A 1CKBA 4ENMA 2K5IA 2VQCA 4Z6YA 4EGZA 2JTMA 1LDKB 1H641 1BK2A 4JX5A 1JKPC 4ESRA 1GCQA 2B7EA 3CCLT 1X6BA 5GAN6 1M8MA 2IEKA 3GNGA 4X0GA 2Y4XA 3IAM2 4XRFA 3IALA 4Q15A 2RC4A 1KU9A 2XGXA 1W6XA 3OIQA 3EG0A 3TO7A 3ABKH 4BBRJ 1R0CB 2QQAA 1IDYA 3BQZA 1NJIU 1B9NA 2QI2A 4GDFA 1VQ5A 5GANh 3J7AO 1VQKQ 2JSCA 1QP2A 1YIJQ 2DU5A 4J01A 3K4LA 4P72C 3QOPA 2KT8A 3RZDJ 1H3ZA 2L3DA 1EKEA 1Y1WJ 3PIPA 1U1SA 2MF2A 2KGTA 2DL5A 2CREA 4CC7A 1IDZA 1HXDA 3NMZC 2QKMB 3NEMA 4LOCA 3QPSA 3A01A 4BQNA 1QU3A 3GTPJ 4HX7A 3W6JB 1RUOA 3QTCA 1Z7MA 3NEUA 3M8FA 2OAZA 2ZTGA 1MBJA 1BJZA 2ZXWH 5GAN2 2GQVA 2V8KA 3NWTA 1USSA 4LVJA 3ISPA 4EJWA 1D09B 2O0YA 1PUFB 2QSHX 2O4XA 2MMPA 1FP2A 3C1DA 3SQNA 3CC4I 5IHNA 2DEQA 5HKCA 5E3IA 1FBUA 3DLLA 3WGIA 1OYIA 3L00A 3G71I 3CCQT 1VQNA 3DP7A 3D7SB 4NHJA 3MP1A 1QVTA 2ZT8A 4AFZC 1ENHA 3QWYA 1W5TA 2ZR2A 3CCRQ 3OR1C 2XAJA 2L3RA 4V2FA 4XKCA 4GBQA 2YLBA 1YRNB 1XMXA 1QA6A 3HHGA 4FW1A 2E5KA 4XU1A 3VS3A 5GTHC 4IKFA 2RQTA 4AC0A 3ZGKA 2LY9A 3CC7I 3HOXJ 2VE9A 1EFWA 3G4ST 5FLXE 5GANg 1VQKI 2M0OA 4YTLA 4XM3A 1KU2A 3HOWJ 1IZ6A 2XV4S 5HNHA 1Q1VA 3PGGA 2HFHA 2LF7A 4XLEA 3MVPA 1ASYA 2EIKH 3I4MJ 2O9SA 1OR7C 1BR4A 2ARTA 4ZH4F 1B76A 2RQQA 4PJ0C 2DD4A 3BFMA 2A7YA 2JA2A 2E6ZA 4LFUA 3C95A 1I50J 3TEHA 2AKKA 4EO4A 3OL4A 1UGSB 5GADJ 3JCMQ 1N5ZA 2KMUA 4UY8I 1U8RA 1FEXA 4PKCC 5HDGA 1QVFP 2R5ZA 2LY1A 1D0ZA 3KP5A 3THKA 3PO3J 1RETA 2K9MA 2HEOA 4E4HA 1LPQA 2ZPBB 4QQGA 4UUVA 4LGWA 3E9GA 3S17J 1ZELA 3F8FA 3DKWA 4W97A 4M75A 4D0PA 5KYNA 2OAWA 2DO3A 5IT9Z 3HB9A 4B4CA 2COYA 1KHIA 4KN4X 4RB1A 4BY7J 4J83A 3DB3A 4BB7A 4ELYC 3GZ6A 2JN0A 3MEXA 4G84A 2DA9A 2AQEA 2E71A 1IV8A 3D5SC 2FZKB 2XHKA 1UE9A 1K4TA 3VEPA 3CCJQ 2LNHB 2O61A 5D8KB 2LK2A 1D3YA 4M7DG 2F4OB 8AT1B 1HF0A 1Z7NA 4AFUC 4IQ4A 2A08A 2PQWA 4YRNA 2EA4A 3M0PA 3VPRA 4OMMA 3M7GA 4HV6A 4BY1J 4F7UF 4DBHA 4CUGA 2MGQA 2RK1A 1D8KA 2Z1DA 1JXMA 2PTKA 1YJNQ 4BHCA 2D0QB 4E2FB 2EAYA 3UA6A 2O4XB 3VSLA 4C8QA 2A0FB 3WE2A 1T08B 4HV5A 2QA4T 3M0TA 1AWXA 3CMAA 5A0DA 1BA5A 1BOBA 3M59A 1RLQC 1B8IB 3S14J 5JFRA 1AEYA 4XOPA 1P4WA 4P74C 5CQYA 5EDNA 2CJAA 3R6OA 2DRMA 4C92F 1WIEA 2BTTA 3E6MA 2ZXFA 3M9QA 2CW7A 3M07A 2DMTA 4FCYA 1LEAA 4RAYA 5CQGA 4IHVA 1XX5A 4B43A 2JRTA 1X6OA 2NUPA 3CCVI 1E6GA 4RTZA 4X6AJ 2IW5A 4A0ZA 1MH3A 3ZMDA 2EPFA 1C6VX 2PUKB 1KYZA 3VBBA 3HTRA 4R8HA 2ZT5A 1P2FA 1PP7U 1WXTA 3QNEA 3CQTA 2KDOA 2DAQA 1DPRA 1FYMA 1QCFA 4B8XA 2KK4A 2FBIA 2JMAA 1OOTA 2IA1A 3Q0VA 4L9TA 4RG8A 2HKQB 1C0AA 2GXGA 3UWNA 1HW1A 2K4BA 2HEQA 3VYTB 2KKOA 3EFOA 3MKYB 3SHWA 2PMFA 4FSSA 1UB9A 5HLTA 3JAMZ 2E1MC 2VN2A 3G1JA 3IRRA 1S7AA 1KC8R 2FO0A 3TEHB 1FYLA 1G3WA 2ZMEC 2JXBA 4NS5A 4M77E 5IXBA 1WXUA 3IQLA 1JUMA 3SZGA 2DOAA 4IRGA 2RNGA 3LSGA 1B6AA 1JEGA 1N78A 1ZSZA 2R5ZB 2BY0A 2GXAA 1R77A 1QPMA 5K1PA 3JB9H 3P9KA 3CD6A 5HS9A 1JTYA 1R5HA 3HL2A 3PNWC 3DF8A 1J2XA 2DLLA 1UG0A 4WCGA 3FX3A 1JUPA 4PJOG 3FKIJ 3BR0A 4F7ZA 4M77C 2X6WA 3GFIA 4OMYA 1G3YA 3MAJA 3JSCA 4OWRB 2DM1A 3HTZA 3QRFF 1SD6A 4PCQA 1IRFA 2MCNA 4S05A 4A0XA 3GIBA 3K70D 4EMKA 5KE2A 4E51A 5FO5A 3ERED 2QYOA 1Y0UA 4M74A 3LSSA 5LD2C 4JYKA 3HY1A 4MMLA 1H4SA 3KLOA 2I4MA 1TBXA 4C0DB 2XRNA 3CTAA 2FJ1A 3C7JA 5K1YA 5ELOA 1LPLA 2HAXA 3ZMSA 4P9UA 1WHKA 5K7ZA 3OSFA 3JCMJ 4RM2A 1OCPA 3ZQHA 1DU6A 5CVVA 3N05A 4KT5C 2H6BA 5FU7C 5ERIA 3H3UA 1K6YA 2IRFG 2RMOA 5IOZA 3KZYA 4IX7A 3IKLA 3OW2A 1QLYA 3QP5A 4J5YA 4NQWA 3QPLA 2ESWA 1R23A 2E2HJ 4LK0F 1D1AA 3LFUA 3BJUA 2M3AA 4RBOA 1E3OC 1RAEB 1WQ7A 1N9SA 1IN6A 1SMYF 2CUZA 2DK3A 3G7ZA 1AU7A 3GLLA 2DJZA 2L02A 3J7AF 3FXJA 3BE3A 4JOMA 2J3MA 4E7SA 3HFZA 1A5JA 1ZQ3P 3CPWS 2RHXA 4AIHA 2XPWA 2KIQA 3UA7A 2HGCA 3TREA 3CCST 2LH9A 4CCLA 3JCUC 2FG0A 3D1NI 1O57A 2EFWA 4U0VA 3AHUA 4Y91A 1M1EB 4U0YA 3M0UA 3U1KA 4D7MA 1BIAA 1W66A 3EFOB 2A37A 3EFRA 2EQJA 4XN0A 1S5LC 5DV5A 2GA1A 1DJ7B 5CKTA 1BM9A 3HSEA 1SRMA 2CSQA 5J1UA 2UZKA 3PMTA 4AU7A 4MDXA 3A8OB 1R00A 4MNUA 4J9DA 2BZXA 4KBMB 1T6SA 5GMKm 4J6WA 5E3MA 5HDNA 1XDUA 5GANe 1T0HA 1Q82U 3OYFA 2CSIA 3TEDA 4YCUA 3PE0A 2MWPA 4TVAA 3IKMB 1REPC 5I11A 1ZSZB 5LJ3j 5J4YA 4GFBA 2KQRA 5ECAA 4C3HJ 3QYEA 1RUNA 2GLOA 4A54A 2FB7A 3IKVA 1WI9A 2Y9YA 3UPUA 1GV2A 1WLPB 2W24A 3HBLA 1CQTA 1A36A 1KYWA 3AG3H 1FOYA 3I35A 4BXXJ 2MOXA 2WB1A 2Y48A 2GQQA 3LMMA 1RL2A 4WF2A 3HTUA 3I56A 4CYCA 4IURA 5FW9A 1BR2A 3HUGB 1IRGA 5J40A 5KVRA 1TT0A 2DDBA 4EMKB 5J6XA 1H92A 4XL9A 5AIQA 3CZ6A 5IP9J 4HWOA 2DA1A 3TO9A 2LOOA 3FXKA 3SYTA 1ZUUA 1X2NA 2DDZA 3OYHA 5GAN7 1MMDA 2DJIA 2DIQA 2BVLA 2ZCFB 3TOBA 2R5AA 3RDIA 4LDVA 4B09A 3QBYA 2MD5A 2DFEA 1VQ7T 1K0XA 2DERA 5J39A 1MBFA 5DUKA 2FRWA 1KZHA 4HAMA 4E7KA 3ECHA 5IHKA 2Q7HA 1Z77A 1OCRH 1WJSA 2FSWA 3F23A 1VQPQ 1UHMA 2GBYA 1MJBA 3G3ZA 4BUGA 3WG9A 3VQWA 4NQWB 1UHWA 2P4TA 3IH3A 1M1GA 5C4JJ 4P3NA 5KYWA 4FETA 4M9SA 3BG7A 2DFFA 2OJ2A 1AVZC 2Q0OA 3HSFA 2LCSA 1KHCA 2ADUA 4XR6A 3TVTA 4ZN1A 5DCMA 4J9EA 3DTIA 4JZ3A 2A05A 3I71A 3OMYA 5GAEJ 4KISA 2QEXT 1PDNC 4EJOA 5IXFA 1VQMQ 1WHHA 2IIMA 4M7DA 2Q5HA 2VKHA 4OGCA 2QM3A 5GAOp 3J80Z 5CVJA 3BTCA 1I5OB 1VQ6I 1Z3XA 2EK5A 3OYBA 4GRIA 2VI6A 2JM9A 5CJ9A 5LHIA 4G7ZF 3OIPA 1BB9A 4HVCA 2ARUA 1YLFA 3FJ5A 5GJVB 2FA5A 1VI0A 3PQKA 2EW3A 2DT5A 5GTIC 1N8RR 2O8XA 4AVZA 1YCYA 5IN1A 3HSRA 4Z88A 4OMLA 1EFNA 3QZ5B 2ZPEB 3LH0A 2MA3A 3S6WA 1KG1A 4V2GA 5KAIC 3PIPF 3ABLH 5J47A 1YTYA 1YIJT 4LE9A 2P84A 5K5RA 3CCEQ 4A0YA 5LJ3e 2MSYA 4TVAB 2ZO4A 5GAMj 1SVLA 2OBPA 1VTNC 3BR5A 1B72A 3Q9SA 1O3QA 2ECBA 3UNGC 2RK2A 4X5OA 4CXFA 2KRMA 1A0NB 3DTEA 5JLXA 1LUJB 4I0BA 2J6FA 1M4ZA 3SWNA 2A8EA 3D5RC 2EZKA 5LJ5f 1IJWC 2V9KA 2YRVA 5GAOm 2NS0A 3HGYA 4XAXB 1K6OA 2L4AA 1JT6A 1VQMI 3MKWB 2WSCE 4HX8A 2VKVA 1ZLMA 3AG2H 4MTEA 5DLQE 1TOVA 2QQRA 3S93A 2NUZA 2WC2A 5CR2A 3RQIA 1XNIA 3BDDA 4AVPA 4B9XA 1TUCA 3LSHA 3I64A 2UV1A 4P3PA 4OB0B 1FMWA 2GFUA 2Z5UA 1NPRA 1YGBA 1MMAA 1NE8A 3CCRT 5D5UB 2L7MP 1JT0A 3PCOA 4RG2A 4XTWA 1MSEC 3NELA 1WYDA 2ETHA 3TP0A 1WFXA 2DXIA 5CPRB 3LWIA 2OPTA 2V1XA 1VQ8A 1K9AA 4M7AE 4RMNA 2FZCB 1LDDA 4PJOA 1JBMA 2YXYA 1LFBA 3A98A 2BZ8A 4K2EA 4AFSC 1TQMA 4KULA 4Q4ZF 4ZIBA 2HXIA 1QQIA 5KYWB 2K2MA 3VYRB 2DU9A 5A0LA 3G71A 1OEBA 2X4YA 5FLMJ 3LSKA 5GMKi 2Z99A 4II3A 4HVWA 4M7AC 2EKHA 3BY6A 4E7JA 5GMKh 2SRCA 4UV8A 2XPVA 4OIOF 5IYCJ 1U06A 3NARA 2NYXA 3M56A 2EQUA 1PG5B 3DCFA 2CUBA 3CLQA 1MBEA 3I5RA 4Q5SF 4M7DB 1RLPC 3IAS2 2WAQA 1YFTA 3F8BA 4B44A 1LE8B 3M53A 4XLFA 2IP2A 3K10A 2AO9A 4A3IJ 1U9OA 4HYEA 3CC7A 1PYSB 4ZN3A 2PMZA 2CZ1B 1YITQ 1FPQA 2HQNA 2RJFA 1DP7P 5C53B 2VASA 2VXDA 2HVQA 2MW8A 4XKVA 4QSHA 4DOWA 3CCMQ 5C44J 4CC2A 4M6VA 2YUQA 2OJED 4OMFB 1WQ2A 2WTEA 3VKIA 1Y71A 3CCJT 4EQQA 5M5WJ 1Q81U 4HNVA 1WDXA 3KYLA 3S2DJ 5GAMe 3I9V2 4XICA 3RR6A 4PFOA 4ZYGA 1ADYA 3W6KB 5KYUA 1QF6A 2EYXA 5H2FC 1VQ4I 2KYMA 4M6XA 1GVDA 4LNSA 1UGPB 4I76A 3I53A 2ZB9A 1XPXA 2QHSA 3RESA 1YJNT 2E7WA 1QW1A 2PU9B 2NOGA 1Y07A 4D7NA 3FMSA 1VQ9Q 3FXLA 3F8CA 3K1PA 2FMYA 1F43A 4CC4B 1S72Q 2FVUA 4RLFA 4KITB 1MMGA 1WCMJ 4P1WA 4R79A 4X1VA 1XC5A 2XG8D 2K9QA 1FXXA 2Q1ZB 1IZ1A 3CD6T 2XDPA 1ZRFA 3JAMK 1BW6A 4ESFA 2L4MA 4YRFA 2EYYA 2CQXA 2EGAA 2NVXJ 3E97A 1S8NA 2KQWA 4RTWA 2WAFA 3SDBA 3DEUA 1GCPA 3H6ZA 3PCOB 3SJMA 2KE9A 1IGUA 1X1BA 3BP8A 1GBRA 5DEQA 5B1BH 2CSOA 2H8RA 4LIVA 4A4KA 4KIGA 1SETA 4M77G 4PJOB 4H0EA 1NJ2A 3I5SA 3U21A 2GM4A 2PJRA 2LCLA 5FU6B 2XVCA 5F27A 3F22A 1E17A 2QGGA 3NPFA 2EV0A 2HZTA 1TU0B 1KOGA 4UP7A 1OJLA 4XTUA 2F6CA 4CICA 1MKMA 3FB9A 2KRSA 2E3CA 5HVQC 4UNOA 2FE3A 1JXSA 2JN6A 3FIFA 2E3IA 2P5VA 3CCUA 3KXTA 3EHRA 2K7AA 2K5FA 1WVRA 5GANd 2XDBA 3QO8A 2A61A 2K5CA 3CCVA 2E5QA 3X24B 1YFNA 4C2MJ 1YJ9Q 5KYYA 3OW2P 3RNJA 1YJWQ 3IH2A 3LSPA 3A7AA 1SKUB 3T5XA 2JPBA 2XC7A 4F55A 3HKSA 5L3BA 3H3VK 3ERMA 3S1RJ 2K27A 1NYRA 3RKYA 2XSDC 1Q82R 3TP3A 4LDYA 2XDVA 3CMQA 3QP6A 1WGXA 5F64A 1IXCA 3R4KA 4M78D 3MZ8A 3ZN1A 1JI8A 4XEOA 1R7JA 3RMQA 3FIWA 2VUMJ 4P55A 3FK6A 2FHDA 2PFBA 1O4XA 5E18F 1ACIA 3NRVA 4P72A 5JLWA 4FYXB 3CC2Q 2AHJB 1TNSA 1YWOA 3MCZA 4PFPA 4J00A 3ABUA 3CO7C 4OMQA 4NC8A 4UUTA 3KP2A 3VU3C 4WTOB 5ED4A 1HC7A 5E1ZB 5ICGA 2E35A 4BUPA 1BN5A 1TNTA 2QSFX 4CCOA 2ZCEA 4XONA 4P3OA 1TUDA 1GHCA 1VIEA 2FYKA 3ERRA 1Z21A 3OY9A 1EIYA 2DE0X 2DL3A 2J5OA 4UB6C 2VT2A 3V4GA 1YW7A 3BCAA 4ETSA 3J81Z 1TQPA 1R71A 2LFBA 3FKJA 3OOPA 4HXJA 3EYYA 4LG3A 4TWAA 2Y90A 5L8RE 2ZIMA 1YJWI 4IHSA 4NCXA 2CV2A 3KE2A 4YFKF 1R0BG 3EAEA 4BBSJ 1X3UA 1YBYA 5JHUA 1YG2A 2LMDA 4YREA 1WJEA 2CFOA 1O75A 1EIFA 4J7IA 4UB8C 1SEMA 1QQJA 1QPIA 2AKLA 4QQ6A 1X1DA 4A5MA 3PVQA 2BE9B 4D1QA 1HSQA 2DVJA 1JHHA 5E1WA 4C5IA 4ZYHA 2RJEA 2Y0MA 4DBRA 5ELNA 2CG4A 2PJRB 4G9YA 3QWXX 3CC2I 1IO6A 2GGRA 3ULQB 4CS4A 2QWWA 4L5EA 4WK8F 1W1WE 2YUNA 3FHZA 1JGSA 3CMEQ 5GAOr 4C2TA 2A6HF 2FOKA 2XF7A 3I9QA 1F1BB 4XU3A 2PMUA 3QO7A 1MDMB 1T3LA 2A6TA 4HF1A 4ZZLA 4YCWA 4HWRA 2Y69H 1WSUA 3TOAA 2KROA 2CP7A 1I0CA 4RTVA 2LBFB 3CCLQ 3X26B 3FMQA 4D6WA 4XLAA 4QIWN 2KRNA 1BCMA 2R5MA 1U6GA 2L0AA 3BW1A 4BY6B 4MIMA 1UCRA 2LMJA 4TQDA 5KYYB 2B0LA 2OZ6A 3DEWA 1ZBJA 1JGGA 1WX6A 1T0JA 4L5GA 1H8KA 1EA3A 5F0CA 3U23A 2EL9A 1NLOC 1YWPA 5IH2A 1LOJA 4KIBA 1M27C 5K5QA 3PZCA 5LHGA 2DZCA 5IHIA 5A2QZ 3T0YA 4Z02A 2K9LA 1KQSA 4L9NA 2EH3A 3GTKJ 1UZCA 2OU2A 2ISZA 4A3CJ 2HL3A 2C0OA 2L54A 2QZ8A 3MFKA 2MK5A 1UECA 3LA2A 4C92D 1MUZA 1J09A 2EFQA 1U2WA 4HWSA 4HBLA 4Y4RA 2QTXA 2YU9J 3HOTA 2MH2A 4AMCA 2A5WA 2E7XA 5ILSA 2HCKA 3RJPA 2K40A 1X58A 2DL4A 1XN7A 3DXJF 3J80K 3CMEI 4YFNF 1K0SA 3CESA 1XSXA 3HXLA 2C0IA 2BYVE 4BEHB 4LIUA 3I0TA 4EMHA 3HM5A 3S1NJ 2YSQA 2R7VA 3CBOA 2VBYA 1WU7A 1AKHA 1VQPT 3S32A 3WU1B 4CC3A 1EIYB 3L2ZA 1AWCA 2RA2A 3SHFA 3L2VA 5KNLA 3MWMA 3GP8A 5DLOA 5E8IA 3WQZA 2KJCA 4EJTA 4DYRA 1O3SA 2IJLA 3WU2C 1CSKA 4FIBA 4IXAA 1DU0A 4P74A 3B73A 2DMPA 2TRTA 3BY7A 4L0YB 4XTZA 3PSIA 2VYTA 2LQ8A 1WHLA 4M7DF 3MEUA 2XGDA 3NFCA 3H0IA 3CP8A 4MQ9F 1QWFA 4MO7A 2QKLB 2WV0A 1N75A 3TMOA 2FBKA 3FMRA 2VJ4A 1U3EM 4KUDK 4A12A 2L3QA 2BZTA 1YX5A 1NK3P 3RCOA 2VL8A 1XTAA 1LVAA 2WB1N 3JRCA 1JU5C 2B8AA 3I55A 3VUBA 1XGSA 3SZTA 1A6QA 1WHUA 2ZNIA 2E2JJ 1ITYA 3OQ5A 2RQPA 4BI4A 1XD7A 2R93J 3E3VA 1UHCA 2QYZA 2EV5A 2EINH 2R3SA 4WXDA 3ZEHA 3RMSA 5CK9A 3P5JA 3BZCA 3PSFA 1YOVB 2DF6A 1ZGWA 3JW4A 3R0AA 4OAYA 2EGEA 1CF7A 5HCKA 1VA7A 3ABTA 3FWEA 4ZTFA 4PNOA 2Q8KA 5GPAA 1WHJA 2VB6A 1JJCA 4N0BA 1TW2A 1ZAOA 3EUHC 3ZMVA 2P5IA 2MLKA 1RIQA 1VQ8T 1XMAA 2Y0SA 3OB9A 3JCMe 3CCQI 2GNCA 1BW5A 2ISYA 2ZMEA 3CCET 2NVQJ 4H2YA 2JA7J 2JS2A 4XMYA 3BCBA 3BG6A 5GAHJ 3MQ0A 1M3CA 2DA6A 2ROTA 4A3MJ 1QGPA 3E2UA 4RS8A 1KD1U 2RDPA 3G71T 5LEJA 3S2WA 1M90C 2BXZA 1WRJA 4M3DA 2COZA 1AZGB 2F2XA 2ZSIB 2QQBA 2KDZA 2IS4A 1H9TA 1OU8A 2XAQA 2JTFA 3DU6A 2ZGWA 3M8EA 4M77A 2ZT7A 2HR3A 3FXRA 1Q81R 2LJ3A 1SAUA 1WXBA 1SMTA 3GFLA 3DPLC 3PIOA 4JX4A 3G4SI 1T3SA 1BU1A 2NAZA 1OZ3A 4LJZF 1IXDA 4G7OF 1FP1D 2J06A 3TGNA 4H2WA 4M7AG 7AT1B 1ON1A 2C7IA 2EZLA 1B8AA 3OYLA 2L9VA 1HYOA 2IVMA 2H09A 1J5YA 3HOYJ 3UF4A 5F5WA 4ZDOA 1HCRA 1X75C 1S7EA 1QVFA 3HL8A 3QU3A 2LDUA 4IIMA 3HOSA 4PJOF 3BJOA 2PVGB 4PLIA 3LSMA 5J26A 3DBHB 4WWCA 4ZTZB 3PUFA 1YN8A 4NDLA 1BBYA 2R0QC 2BY3A 2OF7A 4JQFA 1AKHB 3VS2A 2PLYA 3EH2A 1DPUA 2LNVA 4M78B 4DGWB 5GAN3 3OYAA 3TEGA 1LJ9A 1KQ8A 1LFUP 2L9SA 1UG1A 2QF7A 4FT2A 4AIDA 3LNQA 4KRTA 2X1CA 2LDMA 2VXZA 3X2QH 1QVGP 3MEWA 1P4AA 1KQ1A 5D6WA 3ZRGA 4JJCA 2DQ0A 3ZL7C 2OTLA 1Q7YC 2DK5A 3I4PA 2QBYA 4OOIA 4C3IJ 4Y33A 1H9GA 1GRIA 3OYNA 1A31A 3FBIB 4PJJA 3MKDA 1SESA 1ZQ1A 4Q47A 4FQGA 4Q48A 4TVWA 1D1CA 5J4VA 3NWSA 2VPLA 3HZJA 1Z91A 4BQOA 3VB2A 1OCOH 2L9RA 4ZYEA 4YRIA 4R55A 3RI4A 4A3FJ 3NETA 3OIOA 1MV0B 2C8MA 2E6NA 2LRDA 1M30A 2M51A 1NYQA 9ATCB 5HK3A 3F3XA 3C18A 1R4MB 1YITT 1CF7B 2W1OA 1ETWA 3QG1A 3E5QA 1ATIA 2RB6A 1Z1DA 2FF4A 5FKNA 3DPTA 1JJCB 5GAN8 2E1MB 1LNWA 2GA2A 3CCMT 2XROA 3M54A 2QA4I 4RDUA 5HY6A 2BXYA 4BDYA 3MP8A 2ICWG 4IOAF 3QDFA 4HA8A 5LJ5j 1PSFA 1YHQQ 1ETQA 3GEZA 4CS3A 2EFNA 4AH6A 2EJFA 3TDUC 2P5KA 3H9NA 2O31A 4N9HA 2K9SA 1S7OA 3JTHA 2O8KA 2KR3A 1FX7A 3RKQA 3WTYC 1ZHIA 5LL6S 1WQWA 1G5VA 4ATOA 3RPUA 4M77B 3CCUT 4LD5A 1POGA 3SB2A 1ODDA 2VXFA 3ZBDA 1RKTA 1VQ9T 5JVGF 2LC4A 1W0TA 2LTOA 2YLCA 1S72T 1KA8A 2EJ9A 2IGNA 3PQJA 4CCNA 4XN3A 4MZPA 2PNIA 1W4SA 3AL0B 1LYLA 3CCYA 1IC8A 4AG2C 4IZZA 4J9HA 2RHQA 1MNDA 5CVRA 4OP0A 3FEOA 1VQOQ 3G6EA 3H41A 2VOPA 5C4XJ 4I02A 4XLNF 5I21A 5GPCA 2R7UA 1OCZH 4X9DA 3CXCP 2KFDA 2EBPA 3H1CA 2XKOC 2R7SA 5KAFC 1NHAA 2V1QA 4FU6A 4A69C 3OYKA 3P8VA 4HCZA 1OYWA 1VQ4A 4YRJA 4L9JA 3BZKA 1V55H 1Q95G 1FOWA 2CP5A 1IGQA 4A63B 1K79A 3HP9A 3JR9A 4UC4A 1FT9A 1TP4A 1VYUA 3FDYA 3EHQA 2KRHA 1DUXC 4IEJA 4JDSA 1YI2A 2QBYB 1U1TA 5L3CA 4KYWA 2MLGA 3DLAA 2JW4A 1W36C 2AXLA 1NJ6A 1K9MU 3QSUA 5HLIA 1TH7A 1NYFA 2CUJA 1VUBA 3IH4A 3CCSQ 2HDWA 4CYDA 3CO6C 1VNDA 4E7LA 1K73U 2MWOA 4XU2A 4YIRX 2Q2EA 3OSGA 1D3BA 4JRPA 4KGVB 1YJ9T 1BC8C 3HOVJ 4J9CA 1OU9A 4HT9A 2MG4A 3TUPA 2K4YA 2STTA 3EG2A 2JRMA 3R07A 3NHNA 3FRNA 1T8IA 4A3EJ 3JB9G 3GLXA 4LVIA 4DPGA 3EG9A 5D5XB 2W85A 3EPZA 3DKXA 1E1OA 1QVFS 2EFPA 5ICFA 1ZYRF 3FXQA 3GFJA 1KJWA 3J81K 3VUZA 2D6FA 2L01A 2DXUA 4RLQA 1M90R 3JRIA 2PZ1A 4DOZA 1MMNA 3VQYA 4CI0C 1XG1A 3I4NJ 1YFSA 5LJ5e 3M4QA 2PUOB 1SFKA 4CH4A 4LUEA 2CJ9A 3BQYA 3TCJA 2X85A 4EVIA 3VQVA 4FT8A 2K3BA 4EM0B 2JOYA 3WTVC 2X9HA 2ZT6A 2MI6A 1WZ2A 2COWA 1M1KR 1ZKGA 2CRGA 1RKWA 2IBDA 1L0OC 2AZSA 1H88C 2E60A 3MZYA 1PRLC 5FRMA 2R7RA 1WHGA 2ABLA 5EJCA 4IHYA 1UELB 5FJ8J 3L2CA 1TL8A 1F36A 2EA2A 4BJTA 3RKWA 2K79A 1ZARA 1XCBA 4L59A 2ZNJA 4HLXA 1HSJA 3CCSI 2HWVA 4JPBW 1Z6RA 2LP5A 1ASZA 2FPEA 1LB2A 1GFDA 1H4VB 4EX5A 5H6QA 4N0AA 3SZPA 4A3DJ 4IHXA 1ON2A 4C0DC 1E2XA 1AWJA 8ATCB 4LLNA 4LN2A 1OFCX 4KNYA 4K87A 1TUGB 2XAUA 3WTWC 5HK0A 1WPYA 3GCMA 1WI3A 4IUTA 4P71C 1VQ5Q 3KFUA 3RL6A 2G4CA 1TS9A 1K8AU 1SFEA 4RMFA 1YP5A 3GX4X 3MMYB 4G6TB 4ELZC 2XMFA 1S29A 2PX9A 1BI3A 5F0FA 3HRTA 1I3AA 1Q7YR 2VQGA 1YS6A 4BWAA 4M75D 4F17A 2GWRA 1KQSP 2IGOA 2JJ7A 4KMUX 1U3OA 2RJCA 4YDQA 1X4OA 4XLPF 3GTQJ 1IXSB 5H20A 5CVIA 5A2QK 4CZCA 3A4CA 5HNFA 4E7IA 3DTKA 3BOQA 1OCTC 2HPMA 1UJYA 2RQRA 3JREA 3EG3A 4II2A 3HHHA 1VQNQ 3REXA 4GGGA 3MO8A 2ZFWA 1MJ9A 4UUSA 2K6DA 1KC8C 1FSEA 4YCVA 4OIPF 2E1CA 4M4ZA 4IO9F 3DBRB 3MN2A 2HYJA 4J9FA 2EBIA 1TSFA 5C51B 2NNNA 2KHMA 2G3RA 1PWTA 2Q2EB 1D3BB 2DLPA 3FHNA 3PJRA 3SEQA 3QJYA 3ECOA 2W82A 5BPDA 1EH6A 1X19A 5DS9A 3COAC 1V54H 2D8JA 2P5LC 2ME0A 3I58A 4K11A 2GXBA 4C8QD 5CKDA 1VQ7I 4AD9A 4RCCA 2ZPHB 2CFXA 3BPVA 3EG9B 3K0LA 1VFCA 3VJPA 3BLYA 2H8HA 1ZBXA 3A8HB 4X1EA 2O7OA 4BI3A 2QHUA 1MBHA 3I55T 2NWMA 3UR3C 1R8OB 3V7RA 1RAFB 2WSFE 3Q0WA 4QKUA 1OQKA 2K3FA 3SFIA 3PFYA 4M3GA 3RYPA 2V7FA 2D1HA 3ZMTA 5F6FA 1X56A 4B9WA 2DL8A 2DTIA 1KMMA 4ON0A 2DPDA 3DPUA 2R4GA 2ZFUA 3VWBA 3GVAA 1SHGA 3T8TA 1G8XA 2QQSA 3K2AA 2QEXI 4M78F 2XAHA 4OMZA 3W3SA 3X20B 3QHSA 2DTZA 1W2BP 3IWFA 3IKTA 4IUPA 4LVKA 1WLEA 3A03A 3UATA 4EMKC 1Q86U 4L18B 2LLKA 3E5UA 1XS9A 3LWFA 5L3DA 4HZFA 2O5RA 3OYCA 4M3FA 1B7YA 1KMNA 1UG2A 2QGFB 4NBQA 4RQEA 3E5XA 1PVEA 5LFAA 2H94A 4I01A 1W0UA 3IP4B 3E19A 1G4DA 2RHSA 1OV3A 4LB5A 2G6FX 2GF7A 1YIJI 3Q0UA 2ZSHB 1U8BA 4VUBA 4MQVA 3GNFB 4OMNA 3P8BB 2VIXA 3P8HA 1S1NA 4NNJA 5CO7A 3C2BA 3JRAA 4Y52J 4FYVB 2JTEA 3PL8A 2P8TA 2AKWA 3V7SA 3ZQQA 2LKXA 5LEKA 4PZJA 3K4CA 2CMPA 4CA0A 2FOWA 3CBMA 4JJBA 4PJLA 3HRIA 2BV6A 3HPWA 4F91B 1H4TA 2ME6A 5DM6F 2RQVA 1B3QA 3DBLB 4KR2A 3E1SA 2P0WA 3S16J 2XD0A 3CMAQ 2QTVA 4CH3A 4RTXA 3ZFJA 3RERA 2K57A 5D6FA 5E79C 1RAGB 4UUSB 1IHWA 1FOXA 1QZEA 3UGTA 1TWCJ 2DA7A 2QLZA 2W4SA 3FM5A 1MIJA 1EZZB 4Y7NJ 1IRXA 1LNXA 1QZYA 4CO8A 5HDKA 4GLKA 4FYWB 3HPHA 5I2MA 2OTLT 2VJIA 1TQIA 3QYBA 4M77F 3CCRI 5J1YA 4QVDA 1RABB 4C0GA 4YFXF 2ACJA 4L6V5 3PIOF 3V8LA 3A8LB 1UTIA 3BDLA 1HC8A 4HLYA 1X54A 2ESHA 1FNNA 3R6SA 5HGQA 3I54A 1KSWA 2OTJA 3QYGB 4OU0A 3BG3A 2WACA 1ABQA 5LJ3h 3RIRA 2VBZA 2LP0A 2JVGA 3E7LA 2L3PA 4M9ZA 3MF2A 2YS9A 2W48A 1XGMA 1L0WA 2Z33A 4OAZA 1IB8A 3ZQLA 4IUUA 3M55A 2CJJA 4V19K 3JRBA 1ZGJA 3A01B 2D1XA 5ICCA 5HLHA 4ASNA 2JNGA 3FISA 3VS6A 1F5TA 4EDUA 1RI7A 3CCQA 4A3BJ 1ZR2A 1V4RA 2CYYA 3BJ6A 2DQ3A 1ETOA 2DZ9A 4WX9A 2DA3A 5GMKl 4YRPA 4B3XA 5FFZA 2XK0A 2L9NA 2E3HA 4LDWA 5J1RA 4V2SA 4M72A 2GIZA 2L8DA 4GLMA 4DZJA 3BTIA 5GANf 2JUFA 5D6YA 2E1OA 2QENA 1DGWY 2JSPA 3CD6Q 2X4JA 1Z67A 4ORZA 1QHHD 2Y0SN 1FYFA 3G4SA 5TGTA 2LVMA 2BUDA 3F8MA 1JJ2P 1U5SA 1R58A 1B7YB 1PSEA 4QPOA 1TT5B 3IUOA 3OS0A 1EVKA 3IRQA 3VS4A 2HVRA 3KP7A 1LKXA 4EM1A 1IL2A 4MDWA 4P5NA 3VYUB 2CP0A 2EIMH 2VT3A 1MGTA 4YIFA 2DILA 2DJNA 5LJ3g 4J9GA 5DY9A 2ELJA 1H0MA 1Y39A 3CCJI 1QCNA 2HMAA 3KP3A 4P73C 1SERA 3M1EA 4HPQA 1WH5A 1HLVA 3BDUA 1WJ5A 1NJ1A 4ZDLA 2YDLA 4CS2A 1K9MR 2NS8A 2E70A 3K70C