3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
3TDZC 3CTAA 4HDVA 3L1AA 4Q5SF 2GZWA 3V7CA 1AOYA 2D45A 4WCGA 1STZA 2HDCA 2DTHA 2FYKA 2JT1A 2LNBA 1Z7UA 4WJ3M 3DSQA 4P9UA 3VQWA 3HY1A 4C8QA 4RCBA 5C52B 5E8GA 3NEUA 3D0SA 3F8CA 1WNLA 2M5WA 4EJWA 1U5TB 1AWCA 4EGZA 1D3BB 5HS8A 2VBYA 3DFGA 4S04A 3AAFA 4K88A 5IT9K 1NJ1A 4G94A 5D8LB 3QRFF 4M75F 4M73A 3B73A 3HXWA 4H2YA 4L0ZB 1LDKB 4M6YA 1B8AA 2ARTA 4P73A 4F7UF 2A07F 1M8VA 4F7ZA 1OKRA 4RB1A 5FD6A 2DTOA 1TNSA 1S8NA 2HGCA 3T5XA 1ODDA 2DJZA 1ZAOA 1B7YB 1BI3A 5K1XA 4P72C 4I0AA 4KIBA 4PG3A 5GAOq 2B0LA 1X54A 3HRUA 4ZYHA 2GA1A 4RGXA 4I02A 5L3GA 2OAZA 1U5TC 2MLGA 4I2OA 3DF8A 2UXXA 3HXXA 3Q9VA 3E6CC 1HSJA 3U9GA 1R22A 2GWRA 4OIOF 3I5UA 4M78B 3KCCA 1XMAA 1R23A 4G6DA 2GXBA 4MTEA 3KE2A 1SD7A 1OYIA 3WTXC 2K57A 4H2SA 3Q5FA 3UGQA 2UZKA 3TO7A 3I7FA 5JHUA 1FBUA 1NYQA 4HLYA 1N9RA 2EFQA 4XRFA 2L01A 4RCCA 1S7AA 4YROA 3BDUA 1ULYA 2QZ8A 3CUOA 3GFJA 4CS3A 2DLLA 4M78D 2FNPA 2KIFA 3L4GA 2FA5A 2KKOA 2KJCA 3DPTA 4C92B 4RQFA 2IA2A 4M77F 3K1PA 4BW9A 5L3BA 3EYIA 3E97A 4H2UA 4NL2A 3J80Z 1Z1DA 1HW2A 1YFSA 5DYMA 4IHTA 1YW8A 5DD4A 2ISYA 1QF6A 2IP2A 2LF8A 5LHGA 3WGHA 4Y15A 3MCZA 3JCMV 3I0TA 2RQPA 1FLIA 3TDUC 3L2ZA 4HX7A 3RDIA 3KP4A 3KP3A 1KQ1A 5TJJA 2DTIA 4M7DB 2F2EA 4NQWA 2GIVA 1W7PB 2P8TA 2ZT6A 2HS5A 3R6SA 4N0BA 1PP7U 4IF4A 2EAYA 3KP2A 2RB6A 3T8TA 1N9SA 1F1ZA 1EFWA 3QOPA 1I1SA 4YIIA 4LMYA 5EEGA 4C92C 4KNYA 2FB7A 1X56A 2DQLA 2HTJA 1R1VA 4BHBA 4DQ2A 1EH8A 1O7FA 1IN5A 2J5PA 2QTXA 2JPCA 2DU5A 4OOIA 2XAJA 4QVDA 4ESJA 1V4RA 4UP8A 5JVTA 1KU3A 4WXCA 4IRHA 3VFZA 1W7PD 2EL9A 3VEPA 4HWPA 4YCVA 2RN7A 2K4JA 1ADYA 1DP7P 3RYRA 3RYPA 4M75A 3REXA 4N9IA 4MEXF 4M7DC 2XV4S 1KU7A 2H6CA 5CYVA 3ZMZA 4Q6GA 4EM1A 4M78E 4F7UA 1EIYA 1HTTA 4CH4A 1J7KA 4YRLA 3L9FA 1SFXA 4Q47A 2M87A 3JW4A 4BH9A 3OOPA 3I59B 1KQ8A 4OLFA 3SWNB 3QTCA 3F23A 3R61A 3LAJA 4A0XA 2DQ0A 2XAFA 5ICEA 2K7LA 2P0LA 2QHVA 2AMCB 1ADJA 1JXSA 3RKWA 2ZNYA 3LFKA 5E17F 5GAMj 5LGTA 2YX4A 2RHSB 4H2VA 2IA1A 2QHUA 4M9ZA 1B4AA 4IXAA 2HTSA 1OYYA 1U2WA 4RGRA 1WWXA 4AIHA 4E70A 3CDHA 3CUQA 1ON1A 3V4GA 2QBYA 4RGSA 1F9NA 1G4DA 5FLXK 3QUIA 4EO4A 4UV8A 3GUDA 1ASZA 4XTYA 3QAHA 4I98B 1REPC 3PZCA 4HYEA 4A5NA 2CGHA 1E17A 5HLIA 4G8XA 1ZG5A 3HFOA 3FXRA 3ZN0A 2YHTA 1HW5A 3IL2A 4QVCA 2ALYA 1BBUA 4ZIBA 4EM2A 3GX4X 1Z7NA 1TQMA 2A6HF 2DT5A 4M77A 4UVBA 4M7DG 3HY0A 2ZJ2A 3J80K 1ZYRF 3EDPA 1MGQA 3ECHA 4HX8A 4PJOF 1EQRA 1IN7A 1D5VA 4YIFA 2G4CA 4HVCA 1WQ7A 3MF1A 4CXFA 5HDGA 4EMGA 2JZYA 2M30A 1Y96A 2VXFA 1ZGAA 2ESNA 3EYYA 1VQZA 5DUIA 1BC8C 3H3UA 3EFSA 3KETA 4HF2A 3CO7C 1WKMA 4L5JA 2Q2EA 2DU9A 3LA7A 4UUVA 5CVUA 4LJZF 1U1TA 2AKWB 4L87A 1KU9A 4PNOA 1IL2A 1FNNA 3NQOA 3JB9J 5IT3A 3WE2A 2V9VA 3ISPA 3JCMh 1LDJA 5EEHA 3RIRA 1R00A 4HOBA 4EMKA 4YRJA 3IKVA 2ZNIA 2Z5UA 5GAOr 2CWEA 3A7RA 3FHZA 3HXZA 3A5YA 3VODA 4UNOA 1IN4A 1O3SA 1FWZA 5ILSA 1FZPB 4Z2YA 3IRRA 3QU6A 2DVEA 2QHSA 2IJLA 4PZJA 4XEOA 1USSA 3UH0A 1R36A 1H9TA 2RC4A 3JSPA 3JCMP 3NRVA 3AHUA 1I27A 3RERA 5GAOl 2EA2A 4L0YB 4GO1A 4YRIA 3E9IA 5LJ5d 2ZIOA 4C8QB 1UFMA 3K9TA 5GMKm 1SFUA 3LA2A 4K2EA 1I81A 4RAYA 2Y0MA 4M72A 4HAMA 2J3MA 1U8RA 5KNNA 2A69F 2HQRA 5ICFA 2F5DA 5DDGA 4YCWA 1H4QA 4YRPA 3GO5A 2OBPA 1E2XA 2JTVA 2MH2A 4GYGA 2E7WA 4E51A 4M7AF 1YYVA 2P5KA 3WTUC 3ZN1A 3A74A 1J5WA 3HYIA 1K79A 1F4KA 2CW0F 2X0LA 1ZREA 5I21A 1E1OA 2Q7EA 3WU1B 3P9IA 2W57A 3RESA 1HK9A 4KICA 4WXHA 4IRGA 1R1TA 3ZP5A 3R07A 4C8QC 3BJAA 1EH7A 1XDSA 4HWRA 1B70A 5HS9A 3M4GA 4CYDA 5E1XA 3R0AA 4WF2A 2PJPA 1NJ6A 1QNTA 3ULQB 4PJOG 2ZR2A 2FBHA 2YLBA 5C53B 3DEUA 3F8FA 4BXUA 2NAZA 3VB2A 2Z9OA 3FWEA 4YRKA 5LRRA 1T2KA 3V8KA 3QPTA 4OIQF 4ZYDA 1R7JA 4P3PA 2H09A 4P73C 1FP1D 2I2LA 1S6LA 4HX4A 2QVOA 2P4WA 3BJOA 2O6GE 3HTSB 2MH9A 1SMTA 4ZH4F 1Z9CA 5LJ5f 4PJOA 2F5FA 3DXJF 4OMYA 4TVWA 4MQ9F 4A5MA 1HC7A 5DD8A 3JCMe 1YG2A 4IJAA 3KP7A 2V1DA 5LBQA 2LDUA 1J59A 4MQVA 1FPQA 1LJ9A 3L4GB 2IY5A 4YRMA 1EOVA 2IW5A 3I58A 5HVQC 3ROUA 4UP7A 3K1NA 3SQNA 5K1YA 3NELA 4IVNA 2WWYA 1P4XA 1FT9A 3LA3A 2ZMEA 1R5HA 1RUNA 5JR3A 3GEZA 4H2WA 3LAPA 2VC1A 2FU4A 2W25A 4EJTA 5GAOp 1O3TA 4CH3A 1K78A 3BJUA 1YFHA 2ZTGA 5GANh 3LSSA 1S29A 1LEAA 1D8KA 3PGGA 5AIQA 4Y91A 1YW9A 1J2XA 2XAQA 4YYEA 3JCMb 4L9NA 5HLHA 4XTWA 5E3IA 1P2FA 1SMYF 2DEQA 2OD5A 2JN0A 1SD6A 3L09A 4AD9A 4XTZA 3JCMJ 1YW7A 3TGNA 3QP6A 5CVJA 3RACA 2PFBA 4FT8A 5TRDA 4LLNA 2DAOA 4FX4A 3V7RA 2E1NA 3REOA 2ZINA 4YDQA 2CJAA 1HKTA 2HYFA 4H2TA 3FMRA 5F1RA 4EM0B 4H0EA 2VODA 4YRSA 3IG2A 4M75B 3KZYA 4G7OF 1BC7C 1Z7MA 2AS5F 2FOKA 3O2PE 1ZG1A 1RZ4A 5FB2A 4F7UB 1ZHFA 3GVAA 4M7AA 5LJ3e 5D8KB 1B34A 2H6BA 2F5CA 5GAN5 4CS2A 3NEMA 4TVYA 1LDDA 4IHSA 5GAMh 2DK5A 3WU0A 2A68F 5LRSA 1NYRA 3HSRA 5CAIA 1RNLA 1KYWA 2C6YA 3RPUA 2V1UA 3JCMd 2HNIA 3RJPA 3O3KA 1IUYA 1Q1HA 3P7NA 4XTXA 5LGUA 3KP6A 4P3OA 1O57A 3B02A 3FM3A 5CLSA 1JHHA 2UXNA 4QLCU 1SETA 4XLPF 4M75C 4HV6A 2K02A 2NYXA 3U1DA 4OP0A 1G3WA 2XHKA 4P74A 3KEQA 1MJAA 2DXTA 3W6JB 3E5QA 3WGGA 2ODRC 1I5LA 2K4BA 3A7AA 4JUVA 1TBXA 3CUQB 4LG0A 5FLXZ 4J6YA 4HWSA 2FSWA 5LJ3j 2L4AA 2VXEA 3BDDA 2I4MA 3G1ZA 3F8BA 2J5OA 3CO6C 5D4RA 4M78F 1B6AA 3WTWC 3I71A 2M1BA 1T39A 3QU3A 4L18B 3BP8A 2ZNJA 2PI0A 5BMZA 2YU3A 3BPXA 4L5IA 2P5LC 1E1TA 1W4MA 5D4SA 5GANe 2NS0A 2CQKA 3CJNA 5LHHA 5BPDA 2UWMA 4HW0A 4YPFA 1J75A 3JCMg 2XAGA 4UXNA 3V8JA 3D5LA 1A04A 1HW1A 3VBBA 3F3XA 4A53A 4WWCA 2QHTA 3CUQC 4GCVA 3WTVC 5J8FA 2JSCA 4UP9A 3HHGA 2ETHA 4K86A 3JCMf 3JB9F 4PHCA 1WQWA 1B59A 4HA8A 3HSFA 4JRKA 4CH5A 1DPRA 2HKOA 5DCFA 3F72A 3IKTA 3HFVA 1LEBA 4C92D 3HRKA 5BQTA 1BM9A 3WE3A 2OQGA 2HFHA 3MF2A 1N9WA 2PMEA 3K1MA 1X3UA 4FHTA 4BQAA 1YIOA 3TOAA 1DPUA 3G73A 4M75G 3HFZA 1KMNA 4M77C 2A6EF 4KR2A 1IRGA 3U2RA 4YRQA 4YP0A 4ETSA 5AONA 1X55A 4EMKB 5ELOA 4R1HA 1G5IA 2KIUA 4EMHA 2XROA 2CO5A 4F7UG 5GANj 2O03A 5F5WA 3BY6A 2CG4A 2ZZGA 3BW1A 5GAMe 3WGIA 1OYWA 2FRHA 1LNXA 4S05A 4M7DD 2QWWA 4RMFA 4WI1A 2ZCEA 2DXUA 1OPCA 4JBAA 4GGGA 5J8CA 4YRCA 2VC8A 1QBJA 2ZCWA 1TNTA 4WXDA 4XU0A 1KGSA 5FFXA 5HDKA 1IN8A 4ASNA 4AIKA 4A12A 3WG9A 3CLOA 2VC0A 1FY7A 1XD7A 3HTUA 4ENJA 4KIFA 3M1EA 1JJCA 2CJBA 2EJGA 1L0OC 3KLOA 4O5VA 1C0WA 4LLGF 2EFOA 4EMKC 1W5TA 4YREA 3BY7A 1BI0A 2VT2A 3IHUA 1OR7A 1Y0UA 3UGTA 4XBFA 3ZPLA 4CICA 3JSOA 2QQAA 1X2HA 3TQNA 4QWQA 4JLIA 1B7YA 3GFLA 1YFTA 2Q7HA 4ON0A 4C92E 4G84A 1W66A 2DK8A 1ZH5A 3HRIA 2QQBA 2A61A 2MLKA 3Q9SA 1BJAA 1P92A 2PMHA 3I53A 3GZ5A 4CZZA 4OIRF 4HF1A 2RNJA 2CIMA 2DPDA 3K2ZA 4M77G 5GAOn 1B70B 3HRTA 4FX0A 4KMUX 4EGYA 2CGPA 2HWVA 1BIAA 4XEMA 4CS4A 2LF7A 4XLNF 2E1HA 4AVPA 3KEOA 4EJVA 4HT8A 4M7DE 3M4QA 3C1DA 3WTTC 1GGMA 1H4SA 1E22A 2HR3A 3JB9G 1XN7A 1IZ1A 1V3FA 4LGWA 1YO5C 2E3CA 1WYDA 1FOKA 2MD5A 5D6FA 4BAYA 4J6XA 5GMKj 3ICAA 1ZLJA 4PJOB 4TWAA 1BI2A 3OD1A 3ECOA 1HQCA 1BIBA 1UB9A 1UHWA 3ZMSA 5ICGA 3HOSA 4TQFA 3P8YA 4U0YA 5GANg 2RHQA 1RI7A 4UVAA 5K5OA 3A31A 1B9NA 2IY5B 5GAN2 3T1BA 5ILVA 3K0LA 3LSTA 3E6MA 5ED4A 3ABTA 2PMFA 2ZKZA 3FM5A 2ZMEB 1UHMA 1XSDA 1H4VB 3M8FA 2XKOA 3HFNA 4XU3A 1W7PA 2HYGD 1L0WA 1QQIA 1K78B 1MKMA 1T98A 4PJOC 2VT3A 4WJ4A 2ACJA 3FIFA 2E5AA 2Q5IA 1TW2A 3I4PA 1LOJA 1GVJA 5BOXA 2DW4A 2BBYA 2F5EA 1EV7A 1KQ0A 1LB2A 1FSEA 2DI3A 4RDXA 2O3FA 1YCYA 1EH6A 4YG2F 12ASA 2STTA 2W85A 2I4NA 1G5HA 1Z05A 1M5Q1 2XTIA 4H02A 2JRTA 1ZRFA 3RI4A 5GAMg 1IW7F 3CMQA 2OZ6A 4TVAA 4CHUA 1D3YA 5JFRA 5LHIA 2O0YA 1KU2A 4P75A 2ISZA 3TEGA 2P7CB 1IXRC 3FZVA 5GAMf 3W3SA 1BBWA 5D5WB 4ENKA 2BYVE 4MMLA 1H4TA 2VONA 4HQEA 3BOQA 4RB2C 3M9AA 1P6RA 2MBFA 4ZYGA 2EV5A 4LK0F 5L3EA 3HHHA 2K86A 4GYIA 3V8LA 4XU1A 3LC0A 2EFNA 1JGSA 1KQ9A 3TO9A 3SWNA 1B34B 3RTRA 2PG4A 2W24A 1QZYA 2MC3A 3NENA 3C18A 4CDGA 2HEOA 4C8QD 1R5GA 1KOGA 1YS6A 4P96A 2E7XA 3IKMB 3C7JA 5D6EA 5FGMA 4WX9A 1T6SA 2Q7GA 3QPHA 4NL3A 2VBXA 2Z3YA 3ZQ7A 1KA8A 11ASA 4NCXA 4LK1F 5GMKi 2O61A 3E5XA 2IVMA 2JPBA 5LJ3h 2ZFWA 3PQKA 5BPIA 2ZNZA 2VE9A 1YGBA 1ZN2A 2QUFA 3M4PA 1FYMA 1CF7A 1JBMA 1KQ2A 5LLQA 2DZ9A 1NJ2A 3HOTA 4M7AC 2L4MA 4LG0B 3TEHA 1MGTA 2PMUA 1TW3A 4HLXA 4BWAA 3EUHA 3MAJA 4MGRA 1LQ1A 4M74A 1E24A 1SD5A 2ZZFA 3QHSA 2ZO4A 3VQXA 1U6GA 1WI9A 4AIJA 2Q0OA 1IXSB 4CH6A 2L3DA 2QYOA 1MDMA 2X4HA 2YSRA 1RIOH 2CFXA 1FX7A 2R7DA 3E6DA 3VQVA 4ZTUB 1MJ9A 4KDPA 4P74C 1B76A 4Y13A 1YLFA 4YFNF 1XGSA 3GF2A 3HXVA 3IALA 1EVLA 3JTGA 3R0JA 1TQIA 4PDKA 4C8QE 3EQLF 3A7UA 1MZBA 4EQQA 2RDPA 1X2GA 3QO5A 3FJPA 2AXLA 3GW2A 6PAXA 1USYC 2O8XA 2AKWA 1HXDA 2VOPA 5HS7A 1F5TA 5JI6A 3A5ZA 2K27A 5AIPA 4U7BA 4KMFA 4XTUA 4XSZF 5ELNA 5D5VB 3MEYA 2FBIA 3REUA 4NOYA 4MNUA 2KIMA 4J5YA 1HKQA 2HOEA 3GFMA 5HGQA 1C0AA 3VU3C 2EV0A 1WSUA 3HRMA 4G7ZF 4M7AG 4KR3A 2QM3A 1HSTA 4HBLA 1SESA 4M71A 3WTZA 2D2WA 1ON2A 4A0ZA 5D5XB 4H2XA 1WU7A 1NHAA 2ADUA 1H641 3DV8A 3G3ZA 1XCVA 2DKGA 5F64A 4UV9A 4KIGA 3MQ0A 5DV5A 2FMYA 2Z33A 2RD1A 4CO8A 3L2CA 1G3TA 1KYZA 2ZGWA 2OU2A 5C51B 3HSBA 4YRTA 3L00A 3BROA 1O3QA 2DBBA 1EIYB 4UHTA 3INZA 4JK1X 1NJ8A 1YFRA 3J7AO 4IRIA 4G85A 3BWGA 4B09A 1JJCB 3I64A 3FXQA 5BS6A 2ZXFA 2D1VA 2EWNA 1T0FA 5E1ZB 4X9DA 1LYLA 4OMZA 4YRRA 4UVCA 4Y17A 3ZMTA 2Z99A 2BE5F 3DQVC 1RIQA 4Q48A 4KFCA 2CJ9A 1XCBA 3HXYA 2ESHA 3SXYA 4M75D 5HLGA 1K6OA 1U1SA 1ATIA 1DDNA 5GAOm 2XGXA 4L9VA 3IRQA 1ZGJA 3GYHX 1CGPA 3QO3A 3HSEA 2DFIA 3N97A 1WPYA 2ODRD 5DCMA 4I09A 4KYWA 5K1PA 2DDZA 3RF1A 3RPQA 2DTRA 1BI1A 1G3SA 3O6BB 5GAN6 1SRYA 2XUBA 4N0AA 4M9SA 5FFZA 4HWOA 1R1UA 1IXCA 4KUMA 4AWXB 4ESBA 2QBYB 5FD5A 4XSXF 3VQYA 4X9CA 4LFUA 1LJOA 3UFGA 4ENNA 1USYA 4NB5A 2OQRA 3QSUA 1PUEE 5GMKh 4OINF 3GIBA 4OIPF 3ZMDA 2P7VB 2C7IA 4RB0A 2DO7A 2G7UA 2ZBKA 3JB9I 5LEJA 3GWZA 4YCUA 3BJ6A 4HZFA 5A2QK 2ALYB 4AH6A 4P9FA 1TQPA 4K87A 2BGCA 4M77B 2BEOA 1YQAA 1IN6A 1XGNA 2Y90A 2VBWA 2FMLA 5K5QA 3F8MA 3ZMUA 2ELHA 2GA2A 3N4MA 2RM4A 2NNNA 3J81K 2NRAC 2DZCA 2EV6A 4IPAA 1B9MA 4C92F 1I1GA 3R4KA 3P9CA 2XVCA 5LJ5h 1IAWA 3WODF 1PYSA 4GXOA 5D5UB 1JRIA 1Z91A 3KP5A 4P71C 1Y96B 5L3FA 2RHQB 4M78C 2ZT8A 4YFXF 3PCOA 5ERIA 3RKYA 4M75E 2KRFA 1D8JA 4ZYEA 3JCMc 1K7AA 3M7GA 4M77D 5LJ3d 4BHCA 5H6RA 3JCMQ 1KMMA 1B1BA 5LEKA 3S2WA 4F7UE 3ERRA 1JHFA 3E5UA 5K5RA 1H9GA 4WK8F 1TLHB 1ONVA 3QO7A 1MD0A 4XQ3A 3JAMK 1XSXA 4M7DF 2QQ9A 5GMKl 3JCMW 4TTVA 2DU7A 3FXUA 1I4K1 4LLLA 3JB9D 1UCRA 3LSQA 4DNCA 2EB7A 2P6SA 3HRSA 4KT5C 2CSOA 3H92A 5H6QA 4ZZDA 4EJUA 5GAN4 2ZZEA 4KN4X 2NNYA 2DQ3A 2Y75A 4L9JA 2H27A 2A3SA 4P72A 2R3SA 2LKPA 2V79A 1SD4A 2XASA 1U5TA 3C3WA 1D3BA 2EFPA 4TVAB 2QLZA 2BV6A 4BYYA 1QE0A 3RL6A 3KZZA 1FYKA 3GXOA 2FF4A 2VXZA 4G9YA 4RS8A 3F6VA 1J0RA 3A32A 3JCMX 4V2SA 3SFZA 5LJ3g 2STWA 2PBIA 3TUPA 3JTHA 3T0YA 3RKXA 4L9TA 2YPRA 5GANd 2I4OA 5GMKe 2FBKA 4M78G 2OZUA 5LGNA 1O3RA 5LJ3f 4M77E 4HWTA 2XIGA 1WRJA 3RGLA 1U3EM 4TQDA 3F6OA 4RQEA 1OMIA 4A6EA 4JQFA 2GQQA 3ELKA 2Y48A 1QO0D 1NJ5A 3FX3A 2C8MA 1G6NA 2Q8KA 3LQQA 4A2UA 1IRFA 5E18F 1FBSA 4P75C 1FP2A 3F21A 4P71A 4P5OA 1G51A 4M78A 3FB9A 2A5YB 4YRNA 4ENMA 1QPMA 1WQ2A 1I8FA 5FO5A 4O3MA 3HTZA 5DEQA 4C92G 4U7DA 5LJ5e 1FC3A 5E8IA 1QGPA 3I54A 1GXPA 4ZTZB 1CF7B 5E20A 2TDXA 5CVIA 3P8TA 2IA0A 1FSHA 1MJBA 2ZIMA 3GZ6A 4R8HA 3SWNC 1ZG3A 3BPVA 2YX7A 5GAN7 5ILUA 4O2DA 3H3ZA 3TEHB 4ESFA 1EVKA 1HBXG 2L54A 1XMKA 2ARUA 4LB6B 2XGTA 1YTYA 3TKYA 2YR2A 3E3VA 5GAMd 4YRFA 4CGZA 4EMSA 4RGUA 3L7WA 2FXAA 4YRGA 2EJ9A 3WTSC 3WTYC 2WC2A 4C92A 3PQJA 1O7LA 4EJOA 2PQ8A 1L3LA 5KK1A 4O6JA 1BBYA 2YLCA 1MDMB 3K69A 2COMA 4JRIA 4U88A 2WV0A 3MZHA 1ZRDA 5L3DA 3BZ6A 5GANf 1J9IA 2IPQX 4A0YA 2M45A 4P55A 4PGHA 1ASYA 3GLXA 1VTNC 4J15A 4I7HA 4KQEA 2P5IA 4PJOD 1TTYA 4J6WA 5LJ5j 2QENA 5GAN8 4M7DA 3E9HA 5DY9A 3MWMA 3BFMA 1W5SA 1USTA 1DUXC 3LWFA 4U0WA 1GHCA 1NNHA 4N9HA 2HZTA 4MTDA 5CVRA 2GAUA 1PP8F 3HUGA 3MEXA 2VBZA 1PDNC 2XKPA 2EFWA 1XSVA 3SHFA 4A6DA 2PN6A 1XDUA 2J3LA 4I01A 1ZRCA 3ERED 2ARSA 4OU0A 3IWFA 4U0VA 3E6BA 3PFIA 4MMKA 2L02A 3FMSA 1T38A 4PGGA 3KFUA 2WTEA 4H2XB 4D0PA 3HIFA 2PLYA 2XRNA 5DUKA 3MFKA 2EK5A 1HKSA 1Z6TA 3TO6A 1H0MA 2CYYA 4UPAA 2I4LA 3DKWA 4KN7X 4C8QF 1RUOA 2HKXA 3I59A 4EV0A 2LSOA 4LNSA 4M7AB 4I0BA 4P3NA 5HDNA 4HF0A 5IT9Z 2E10A 3IKLA 5F6FA 5HOOA 3ABUA 4EVIA 3EFRA 1BN5A 1FYLA 2AMCA 2E64A 3RUXA 5KVRA 1SERA 1J5YA 2RKHA 4Q15A 4PJOE 1SAXA 3KLNA 4B8XA 1S3JA 2HQNA 1QZZA 1SFEA 3T8RA 2RHSA 2VOOA 4HQMA 3P8VA 4DPGA 1P4AA 2OA4A 2XAHA 1GXQA 4HV5A 5H20A 3F22A 2EA4A 3F8NA 2DQRA 2G7HA 5DCMB 4M7AD 4LD5A 3ZMVA 4HDUA 5GAN3 2RVCA 4NHJA 4RB3C 1XGOA 3SZPA 1JE8A 1I6XA 2E65A 2FQ3A 1G3YA 2P6TA 2P5VA 1XGMA 3VOEA 1LNWA 1YB3A 2RGVA 3HXUA 2ZT7A 3MZYA 2W84A 3QNEA 2GXGA 3LQRA 4M9XA 5LJ5g 4LB5A 4RAZA 3SB2A 2FEZA 4MHGA 5CVVA 1P4WA 2E41A 5A2QZ 3IC7A 4ZZLA 2Q5HA 2IT0A 4BNCA 2RA2A 2E1CA 3OV8A 3FMQA 3JB9H 4EX5A 3R60A 4M6XA 3NETA 5L3CA 1FBQA 1YS7A 4G6QA 2EJRA 2V6CA 4A54A 2D1HA 2DPUA 2M8EA 3EETA 3QO8A 1S7OA 3TOBA 1FYFA 1XB4A 2RV8A 3ML6A 4XTVA 3WQZA 2VN2A 4XU2A 4N0AC 4X5OA 3J81Z 1LVAA 2R7FA 3V7SA 5ICCA 3SZTA 2FNAA 2G9WA 3GFIA 2V1XA 2KJBA 3W6KB 2ZXJA 3DPLC 1PYSB 4TV7A 3KFWX 3QP5A 3PCOB 1WLEA 4G7HF 4MEYF 2VE8A 2MA3A 2ZR3A 3DP7A 2ZT5A 5CJ9A 2FE3A 3COAC 3M8EA 4M7AE 3FF5A 4PCQA 3P9KA 1IF1A 3HFZB 1R58A 3JAMZ 5J6XA 1I5ZA 1Z6RA 2IRFG 2EJFA 4BHPA 1TH7A 4YFKF 4C8QG 1X01A 1U78A 1ZARA 2PEXA 4Q4ZF 4HT9A 5E1WA 2H94A 3IWZA 4KA4A 1BOAA 4R79A 1ZLKA
chains in the Genus database with same CATH superfamily
3CTAA 4HDVA 1X6OA 4KT6A 4Q5SF 5FU6B 2QQRA 4IX7A 1QMCA 2D45A 4WCGA 2ED0A 3DSQA 3HOUJ 2KPMA 1WJFA 3D0SA 1WNLA 4EJWA 1U5TB 4BJTA 2RHXA 2DN0A 4JX4A 4K88A 4G94A 2K9NA 4FETA 1B8IB 4A3IJ 3HXWA 4H2YA 1B8AA 1D1AA 2A07F 1XX5A 4RTVA 1CKAA 1TNSA 1S8NA 1E6GA 3QYHB 3I56Q 1ZAOA 1FTTA 1DP3A 5A2QE 1RAEB 4PG3A 2B0LA 3HRUA 4RGXA 4I02A 3M0QA 3HBLA 1QCFA 2VXDA 2UXXA 2JM9A 4GLKA 1U9NA 2HOTA 2KYBA 4JPBW 1OZ3A 1D0YA 4OIOF 3I5UA 4M78B 3KCCA 5FJ8J 3OY9A 1XMAA 3BDLA 1WJ5A 1SD7A 3C94A 4XKWA 3I7FA 3OYNA 1KHCA 3JR9A 2QSFX 2EFQA 2RHZA 2KY9A 5F27A 5JLWA 1ULYA 2QZ8A 2H8HA 3QPLA 4TVRA 4DOZA 3J80Z 1X2NA 3EPZA 5DYMA 3A8MB 1EIFA 3EUKL 2LNHB 3G1LA 4I99C 3JRAA 2IP2A 2FRWA 4KITB 2X35A 4NUBA 4Y15A 3HXLA 3JCMV 1FLIA 2LJ1A 4HX7A 2YUQA 5TJJA 1Z0XA 2DTIA 3X2QH 4NQWA 2GIVA 4KUDK 2RB6A 1JO8A 1I1SA 4YIIA 2LD5A 5EEGA 4Z6YA 1NEGA 2HYJA 4KNYA 4L59A 1X56A 1S1NA 2FD5A 3EAEA 4BHBA 2GF7A 1Q82C 2X48A 5JVTA 3VYGA 4IRHA 1IXDA 1VQMQ 3H1CA 2DFEA 4HWPA 1ZK8A 2LRQA 1MV3A 4OGCA 3I56I 1KU7A 2H6CA 5CYVA 3ZMZA 4F7UA 1JJ6C 4NNJA 2PVGB 1HTTA 1GL5A 2CREA 4YRLA 3L9FA 2HI3A 1KQ8A 2YSQA 4X1VA 3QYBA 3SWNB 3F23A 2DQ0A 4ZN3A 1G8XA 2P0LA 3HC7A 2QHVA 5JVGF 2CT3A 3RKWA 2ZNYA 5E17F 5EG2A 2OTJQ 2W1OA 1BK2A 2XPVA 1V29B 2L7FP 2HTSA 2ZSHB 1OYYA 1U2WA 4PK4A 1WWXA 4E70A 5GPCA 5J39A 4KH1B 4RGSA 2V4JC 4XTYA 3DWLE 4G8XA 4ATOA 3FXKA 3HFOA 1HW5A 4QVCA 2ALYA 1BBUA 1Z7LA 4A93J 3GX4X 1Z7NA 4HRIA 4UVBA 1W2BP 3G6EQ 2W82A 4BQNA 5EZGA 3EDPA 1YWPA 5D6WA 1OQKA 2DMQA 1EQRA 1IN7A 4YIFA 2G4CA 1ZBXA 3MF1A 3NHNA 1RL2A 2MC4A 1VQZA 1SEUA 4R0KA 3CCUQ 3CO7C 2DU9A 1TXQA 2WAQN 2D0NA 4C5GA 4HT4A 3JB9J 4OB3B 2V9VA 3RIRA 1GT0C 3IKVA 2Z5UA 2CWEA 3HXZA 3A5YA 2JMWA 1KK7A 3QU6A 1H9TA 2RC4A 3JCMP 5C4JJ 2CUJA 1I27A 2EA2A 5LJ5d 5GTHC 2P4RA 1SFUA 3LA2A 1AWWA 4K2EA 3FEOA 2E5ZA 4XRMA 4A4HA 1U8RA 2OTJI 3CCSQ 1V76A 1H4QA 3BG5A 5HCKA 4YRPA 4ZYAA 2R7SA 2YRCA 4HVUA 2E1OA 2E7WA 4E51A 4OWRB 3WTUC 3MKZA 2X1CA 3HYIA 2X0LA 2DMPA 1E1OA 2BE7D 2EGCA 4KICA 4WXHA 4IRGA 2CZ7B 4CYDA 4IIMA 2PJPA 2KFDA 1DJ7B 3A8OB 2A7YA 2IS2A 5C53B 3G6EI 2E3IA 3FWEA 5JLXA 1N27A 4YELA 4OIQF 1S6LA 2QVOA 4KGVB 2MH9A 3CCJQ 1T3SA 3O8HA 1QVGP 3DXJF 4MQ9F 1HC7A 2EINH 4UUTA 3ZQFA 3KP7A 2ECBA 2V1DA 2LDUA 4MQVA 2DBMA 1H3ZA 5HVQC 2M8GX 3ROUA 4UP7A 1BA5A 5K1YA 3NELA 2WBMA 4IVNA 4F17A 4QIWN 2RQVA 3LA3A 4BS9A 2X6OA 1RUNA 3LAPA 1VQ6I 4EJTA 2B8AA 4CH3A 3CJRB 4ZTFA 2DIQA 3H41A 2OV7A 1YFHA 1LEAA 1WDXA 1OU8A 5IP7J 1QVUA 4L9NA 4XTWA 1GXIE 4RTUA 2GTOA 4RKUE 2JN0A 4FYXB 2DYIA 1YW7A 5CVJA 3AFHA 3PUBA 5IN1A 1AA7A 3V42A 3CCSI 3REOA 2ZINA 2J6FA 3FDYA 2HYFA 4UUSB 4H2TA 2A0FB 2DL4A 3KZYA 2W48A 3KYLA 1Z7MA 2AQEA 1ZG1A 3J7AY 3OIOA 5KH6A 1UTIA 1WJRA 4M7AA 1B34A 1ORKA 2F5CA 4CS2A 3NEMA 3IAS2 5GAMh 2DK5A 2A68F 3VYUB 1NYRA 2AHJB 5CK9A 3HSRA 2VQHA 6AT1B 1RNLA 2K40A 4CA0A 1KYWA 1WJAA 1YX5A 3ZL7C 1Q1HA 4XTXA 4JRPA 5LGUA 4P3OA 1VQNQ 1O57A 1JHHA 3MEWA 2R5YA 2UXNA 1MH4A 3HL8A 3M55A 1SETA 3G4ST 2K02A 2NYXA 3U1DA 4DJAA 1AOJA 1UHFA 3CCJI 3G71Q 2ODRC 2K4BA 1SFOJ 2I10A 2V6EA 1N78A 2IS1A 2MIOA 3Q1JA 1TWGJ 2F48A 1LUJB 3KEYA 1YI2Q 5D4RA 4M78F 1B6AA 1YITA 3OW2A 4L18B 2CP6A 3OS5A 2ZNJA 2PI0A 5B5EC 3I35A 3WVDB 3WHCA 2L89A 2P5LC 4L5IA 3A8GB 1W4MA 4FSXA 5D4SA 2UWMA 4HW0A 4YPFA 3EH2A 3K4LA 1J75A 2K3BA 2K5LA 2RK2A 4A53A 4GCVA 3VUZA 1X6BA 2CFOA 2NUTB 1YJ9I 2ICWG 1X2KA 4HA8A 4JRKA 1DPRA 1QHHD 2QXFA 2YT6A 3K6GA 4C92D 3HRKA 3RCOA 2C06A 1K73C 2FQ4A 1ETYA 2DDAA 3A1YA 1N9WA 3K1MA 1X3UA 2PZ1A 5HK0A 4W1UA 3SDZA 1WFWA 4EMHA 4NBQA 1KFZA 4F7UG 5GANj 3ASNH 3LNQA 2NVTJ 2EBIA 3BW1A 5GAMe 1LNXA 3CC4Q 3CJQB 3ZGKA 4M7DD 3CPWP 1OPCA 4JBAA 3BQYA 2ZCWA 1B07A 4XU0A 3PFSA 2L3RA 2QSHX 3HGGA 2TRTA 1VQ5I 1WH5A 3CLOA 2VC0A 3HTUA 4KIFA 2BY2A 2XF5A 1ZA1B 3HJEA 1FMKA 3KLOA 1VQNI 1X4OA 2O9SA 1UMQA 2NS8A 4YREA 2COWA 3BY7A 4OAYA 1BI0A 2VT2A 3IHUA 2K85A 1R0CB 2YRDA 3UA6A 5C4XJ 3ZPLA 3JSOA 3I5RA 2LJ3A 1X2HA 3DTIA 1QVFS 4C92E 4G84A 3HRIA 2HPMA 2A61A 2P0QA 3A4CA 3Q9SA 1YI2I 1TWHJ 4CZZA 2QEXI 4OIRF 3LSRA 4D6WA 3VS3A 1WLPB 1ETVA 4FX0A 3D5RC 1BIAA 2L3PA 2DCEA 4AVPA 4EJVA 4M7DE 4W97A 1H4SA 2XMFA 1XN7A 1V3FA 1OJLA 4FT2A 1YO5C 2E3CA 3WU2C 4OF1A 2MD5A 2IVWA 3HKSA 4LN2A 1TWAJ 1BI2A 3OD1A 1YJNQ 2M34A 4F91B 1UB9A 1UHWA 3VYHB 2K9GA 1HDDC 3EGUA 2RHQA 2XF7A 5K5OA 3T1BA 3K0LA 2JOYA 4A4FA 3E6MA 4BE1A 2M4GA 2LP0A 3H35A 4LUEA 1JTYA 2ZKZA 4PL6A 1ETWA 2ZMEB 1UHMA 2RN8A 2XIDA 2GCXA 3M8FA 1KD1U 3UATA 1W7PA 4HCBA 1K78B 3PIPA 4B9XA 1LCKA 2D1XA 2ACJA 2E5AA 1TUDA 1LOJA 1GVJA 2BBYA 2F5EA 3QZ5B 3H5NA 2KDZA 3I55Q 1FSEA 1IC8A 2O3FA 1PD0A 1EH6A 12ASA 1JU5C 2XTIA 1ZRFA 1Z3YA 5GAMg 2RNGA 1IW7F 4MDWA 2OZ6A 1VOMA 1GBQA 4C0DC 2OCCH 4FW2A 2Y9YA 4MMLA 1H4TA 5IYDJ 2JUGA 4RB2C 1A6IA 1P6RA 4ZYGA 4XM3A 1WVRA 3HHHA 2K86A 4GYIA 1SHFA 3V8LA 1OCOH 3LC0A 2EFNA 1AWJA 1JGSA 2MSYA 1KQ9A 2PJRB 5EZHA 2KP6A 2W24A 1QZYA 2MC3A 2O31A 4C5EA 2ME0A 4C8QD 1KOGA 1ZHIA 3IKMB 3E19A 2VBXA 1I6HJ 2O61A 1SSHA 2KBTA 4PKCC 2ZFWA 3PQKA 3G4SA 2AZVA 4XRSA 2F5KA 3A98A 4IHVA 2LDMA 3M4PA 4CC7A 1JBMA 1KQ2A 3M4YA 3ZQCA 3HOTA 4M7AC 5F0HA 3E1SA 1MGTA 4IUTA 4PFZA 2LMDA 1LQ1A 4M74A 1UDLA 4AYBA 1H88C 2ZSIB 1NLPC 2JS2A 1WI9A 1IXSB 1MDMA 3A0HC 4GFBA 4C0FA 3E6DA 3VQVA 2L7ZA 1OU9A 4KDPA 1B76A 4YFNF 1QVPA 2LMJA 1WHKA 2Y2ZA 5HNFA 2O4XA 2YXYA 4C8QE 2RDPA 3ME9A 1X2GA 3I55I 2AKWA 2ZPIB 4NQWB 3X20B 5HS7A 1F5TA 5JI6A 3A5ZA 5ELNA 2A08A 2ZCFB 5D5VB 3M4OJ 2X6YA 4ZN1A 2Y0SA 1NYGA 3DLLF 2F1LA 1SKUB 5F0CA 1AU7A 5F08A 3VU3C 2HVSA 4G7ZF 4M7AG 4KR3A 1SESA 4OB1B 3WTZA 2IBDA 3LX7A 2RJDA 4A0ZA 5D5XB 1I07A 2ADUA 1H641 1VQLA 2DKGA 4UV9A 4KIGA 3MQ0A 2XPWA 3ERMA 4S0HB 2RD1A 1M1EB 4BY7J 2ZGWA 2OTLQ 1O3QA 2DBBA 4JK1X 1NJ8A 3G2BA 1JJCB 4LD6A 2D1VA 1T0FA 4YRRA 4Y17A 1WIEA 1QWFA 2CJ9A 1XCBA 3PIOF 3HXYA 3BCAA 1PRMC 4L9VA 3IRQA 1UG0A 2EQRA 2DFIA 5DCMA 5EGOA 2BIVA 2JVHA 4FE7A 1HSQA 2KQRA 5GAN6 2VB6A 4N0AA 4KUMA 3OL4A 4ESBA 2M51A 3FLGA 4XSXF 3VQYA 2HVRA 2LX7A 1M1KR 4RB0A 5J40A 3OA6A 1NK2P 2ZBKA 5LEJA 2E2IJ 2ALYB 1M9SA 2GBQA 4JS4A 2Z2SB 4ZGJB 3BZKA 2W0ZA 2QGUA 5K5QA 1PYVA 3F8MA 3ZMUA 3OR2C 1S7EA 3J81K 1UUEA 4CCJA 2VJ4A 2EV6A 3VUBA 4JYKA 1IAWA 3BT9A 1A5JA 1YHQQ 1Z91A 3KP5A 2ZT8A 2KHMA 1D0XA 1Y1VJ 1D8JA 1YP5A 4M3GA 2R7ZJ 3M7GA 5F1JA 4BHCA 3JCMQ 1KMMA 5J3BA 3ERRA 1JHFA 2ELKA 2KMUA 5EDNA 1EFNA 1VZ0A 1S72T 3CMYA 1XSXA 3AG2H 4KULA 2QQ9A 1RACB 3JCMW 2B7EA 4OAZA 2HBPA 4LLLA 3JB9D 2KLOA 2LG4A 1PJRA 3MQZA 4KT5C 2DVJA 3H92A 5H6QA 3QDFA 5GAN4 1H3HA 4FTHA 4P72A 3JRBA 2NVUB 3LSGA 3S15J 2AKKA 1SD4A 3DKXA 1UECA 3I9V2 3H6ZA 1BW5A 4XICA 4TVAB 4BY1J 3P8BB 4PSXA 2JMCA 2M0MA 3GXOA 4J9FA 2E1MB 1D0ZA 2XGEA 3F6VA 3EHQA 3JCMX 4X6AJ 4N4OB 4J9GA 3AL0B 4N4GA 1VQ7Q 3GTLJ 5HODA 2PBIA 1APLC 3JTHA 4L9TA 2OCEA 4WTOB 5LGNA 5LJ3f 4Y52J 4HWTA 1R4MB 1EF4A 1U9OA 1OLTA 2F2WA 4JQFA 2GQQA 5B3SH 2Y48A 3GBGA 3DTEA 5KYNA 2M7BA 1ABQA 4P71A 2HD0A 4IHYA 3BTJA 1OCRH 2RQUA 4UB6C 2M3AA 2Y4YA 3HTZA 4C92G 4U7DA 5KAFC 1CKBA 3I54A 2TDXA 1FSHA 4LIVA 1N5ZA 1YITQ 1ZG3A 3LSHA 5GAN7 1YWOA 3VYSB 3H3ZA 4GY5A 3TEHB 2HQ5A 3TKYA 1BL0A 3GZNB 4YRFA 3SEQA 4CGZA 4EMSA 3CCEQ 4RGUA 3PQJA 1O7LA 5GJVB 4EJOA 1QP3A 1L3LA 2YLCA 2LRDA 1ITYA 1YRNA 2R58A 3MZHA 1IZ6A 2V26A 1LKXA 2FEIA 4J7IA 1J9IA 3HPHA 3Q0VA 2M45A 4PGHA 2CS3A 5IPAA 3GLXA 4CYCA 4C0DB 2QENA 5GAN8 3OS2A 1Z77A 3E9HA 2HDWA 5DY9A 4LXCA 1W5SA 2HZTA 3CD6Q 3SEZA 1K4US 5CVRA 1M1GA 1PP8F 3UPUA 3TQ7P 3HUGA 2AQFA 3DBHB 2E70A 1BR1A 3VS7A 3KXTA 1Y7XA 4Y92A 2X4JA 3EG0A 4OMMA 2ARSA 1VQ7I 3IWFA 3PFIA 2YUPA 3FMSA 4H2XB 3HIFA 2JMAA 1SEMA 2DNUA 1IO2A 1HKSA 1I3QJ 4ANJA 4CCNA 3EG9A 2CYYA 4J01A 1G59A 4AG2C 1Q82U 2LSOA 4LNSA 4M7AB 3KPHA 3FK6A 2QQSA 3EFOA 4HF0A 2W7NA 4XRSG 3IKLA 1TUCA 4EVIA 1BN5A 2E64A 3RUXA 1J5YA 4Z88A 3CEYA 1S3JA 1X19A 1SFEA 3T8RA 2O5RA 4A4EA 4GDFA 3P8VA 4DPGA 2ID6A 5H20A 1YITI 1M3CA 2G7HA 2DBKA 3ZMVA 1LFBA 2KRCA 3SZPA 1A35A 2P6TA 1XGMA 2YUSA 1QRYA 1IG7A 3RPUD 1T0FC 4F3QA 2NUPB 3HXUA 4M9XA 5CQGA 4JRQA 4MHGA 5CVVA 5A2QZ 3QDRB 2IT0A 3CC2Q 3OV8A 3JB9H 1FBQA 5K7ZA 3S93A 2D1HA 2DPUA 2M8EA 3EETA 2E5KA 4MIMA 3TOBA 4FL6A 2F6CA 3ML6A 1ZSZB 2M7AA 4N0AC 3IH2A 2JA6J 1Y6IA 2R7FA 2FOWA 2VJIA 2LCSA 5ICCA 2J6OA 3HOZJ 1PYSB 4HVVA 2GBYA 4ABZA 3U23A 1BU1A 2WB1A 4LUDA 1SANA 5CJ9A 1QCOA 4RMNA 4Z8AA 3FF5A 2IS4A 1S72A 3MHXA 1R58A 2F5TX 1Z6RA 4BHPA 4C8QG 2DL8A 2LX9A 3CCRA 2PEXA 2LY9A 4J00A 3NWTA 4KA4A 1BOAA 2JS0A 3MKWB 3ZQIA 2LYCA 1AOYA 4D8DA 3TMOA 4A4KA 2DTHA 2FYKA 4A3FJ 5DM7F 2JT1A 1UAAA 5TISC 4P9UA 4Y28E 5E8GA 3L2VA 3NEUA 4M3DA 2GLOA 1BCOA 2M5WA 1AWCA 4N4HA 1D3BB 5HS8A 3MP1A 2XPUA 3AAFA 5AT1B 1NJ1A 5D8LB 4PLLA 3B73A 3DLAA 4L0ZB 1VQ8Q 1LDKB 2WSFE 1QLYA 1D5YA 4P73A 2VASA 4F7UF 1VQOT 1R6RA 4F7ZA 5FD6A 4N4IA 3T5XA 3LFUA 2DJZA 1QCNA 1BI3A 4P72C 4I0AA 4NC7A 2RAEA 2FZKB 2OAZA 2DJQA 4I2OA 1KQSP 3ABMH 4ZDOA 2RF0A 1R22A 2GWRA 1SPKA 4Y3OA 3CPFA 2QSGX 1M4ZA 1ZLMA 2QGGA 4XK8E 1R23A 3FHNA 1QW1A 2HNHA 3ZBDA 3WTXC 2K57A 4XLCA 4H2SA 4CCMA 3QXEB 2UZKA 4G12A 3TO7A 2PMZA 2LP5A 8ATCB 3SEMA 4RAFA 4ZDLA 1IRXA 4YROA 3CMAT 3MCAB 1RUWA 3BDUA 1F43A 4M78D 3L4GA 1BYMA 5CKFA 4C92B 4RQFA 2IA2A 4BW9A 2JQ7A 3VDXA 4H2UA 1HW2A 1YFSA 4DBHA 5EYRA 2DA2A 3FXOA 1E3PA 3G1MA 2VQLA 3WGHA 2HU9A 1JJ2A 3RDIA 1KQ1A 4M7DB 2F2EA 2ABLA 2V8IA 2EVRA 1W7PB 4IF4A 2YRVA 3KP2A 1ETOA 1N9SA 1WGSA 4ZC3A 2WV1A 2DM1A 4G6TB 1X3WB 2LR8A 1HF0A 1YJWT 2HXIA 1WJEA 2HTJA 3SZGA 3E9GA 2DA9A 3F70A 1EH8A 1O7FA 3TSZA 4V19K 1IN5A 3QYEA 2JPCA 2XAJA 1VQLQ 1VQPQ 5CIUA 1KU3A 2CP7A 4MZPA 3VEPA 5GAGJ 1ADYA 1DP7P 2FPEA 4M75A 3REXA 2XSDC 1TG0A 1E0EA 4XKBA 3PE0A 4Q6GA 3FK7A 4EM1A 1PUFB 4M78E 3C12A 4RM3A 1EIYA 5FRMA 1J7KA 3TEEA 1YIJT 3OYBA 1SFXA 4Q47A 3CZ6A 2M87A 2DL5A 4BH9A 3G4SI 3OOPA 3I59B 1ZTRA 4OLFA 3CCMQ 2CP3A 2VVKA 1BBZA 2AMCB 2DMNA 4ZGDB 2CYZB 2YX4A 2KYMA 3BR0A 2COYA 3DLMA 4XL9A 2LH9A 4H2VA 2LJ0A 3GNFB 4RGRA 2DMOA 2V8JA 3CUQA 2BUDA 2QBYA 5J4YA 3QUIA 4EO4A 4B6MA 1ASZA 1AKHB 1REPC 4DYRA 3VS5A 4A5NA 4B9WA 4BE2A 3FBNB 2NYSA 4ZIBA 3J7AF 1TQMA 2A6HF 3H0GJ 1NBEB 2ZJ2A 1ZYRF 3EGXA 3HP9A 2HDDA 3HOYJ 2K3FA 4HVCA 4CXFA 5HDGA 3EH1A 2VXFA 2E71A 2XG8D 5DUIA 1BC8C 3H3UA 4IHXA 1X58A 2I5UA 4HF2A 1WKMA 4L5JA 3LSJA 3LA7A 5FLMJ 2AKWB 4L87A 1IL2A 1FNNA 3NQOA 5DLQE 5KAIC 1VQLI 3CCYA 1GVDA 3W6VA 2P84A 4EMKA 4YRJA 3LGFA 2IGNA 5GAOr 4ELZC 2FG0A 3OYIA 3VODA 3NTKA 1IN4A 4Z89A 5M9OA 3UF4A 2DVEA 2L9SA 4AIDA 4XEOA 3UH0A 1VIFA 1R36A 2R7TA 3JSPA 1VUBA 1GRIA 1PSFA 4AU7A 2VI6A 3RERA 5GAOl 3KYCB 4L0YB 4GO1A 2LOOA 1EKEA 4C8QB 1UFMA 5GMKm 5GTIC 5J1UA 2HSEB 1JKPC 1I81A 5CKHA 2Y0MA 3S1NJ 2WA0A 4HAMA 2J3MA 4LD9K 2A69F 2KZVA 1YFNA 1WXUA 1DGWY 2JTVA 2MH2A 3JRFA 1VQOA 3TW7A 4NC8A 1TWFJ 4M3EA 2XDVA 4M7AF 1FEXA 1LVKA 3A74A 1BW6A 4KRTA 2VGNA 3IH4A 2GFUA 1E7OA 3M3YJ 2W57A 1HK9A 3LL7A 2FRYA 4Y7NJ 4RDUA 4HWRA 1MMNA 1B70A 4QSHA 1V54H 3JRCA 4WF2A 5B1BH 1QNTA 3ULQB 4F92B 1Q82R 3DEUA 3F8FA 2NAZA 2Z9OA 5LRRA 3V8KA 2CQNA 4CCKA 1R7JA 4P73C 4HX4A 3TREA 4JLGA 3HTSB 2RJCA 4ZH4F 4B43A 4XMYA 5LJ5f 4PJOA 2KGTA 1X3ZB 4OMYA 1FTZA 4A5MA 2XD0A 3CMAA 3MPUB 2MABA 3CESA 3ER0A 1EOVA 2IW5A 1W2BS 4BJ6C 2X6WA 1K61A 2D8JA 2BW3A 4A3KJ 4II1A 2LC2A 4LVIA 2VC1A 3FBIB 3P8HA 3FXLA 5IYCJ 4E7KA 2EIFA 4EATA 2DFFA 3BJUA 3SDBA 2ZTGA 3ONQA 3PT9A 2GGRA 1D8KA 3PGGA 2WAQA 3K4BA 4YYEA 5E3IA 1P2FA 2OD5A 1SD6A 3D1NI 4AD9A 2ZJQF 4XN3A 4XTZA 3JCMJ 3QP6A 3MEAA 1YJWA 2PFBA 1XTDA 4AVZA 1JUPA 2KIQA 1W1WE 3O5ZA 4KT0E 3LWIA 2M1HA 1WYXA 2DXBA 4YDQA 2CJAA 1HKTA 1MBHA 5F1RA 4EM0B 4H0EA 3K4JA 2VKHA 2VODA 1FYNA 4G7OF 1BC7C 3OR1C 2FOKA 3O2PE 1Q95G 1RZ4A 1ZHFA 5LJ3e 1YIJA 2H6BA 1HYOA 4TVYA 3WU0A 2RQTA 2Y4XA 2HKQB 4A3EJ 5CAIA 1YE9A 2R0QC 1JUSA 4BDYA 5FU7C 3H5RA 5FKOA 2RMOA 1ZR2A 3HM5A 3FM3A 2B9SA 4QLCU 1VQ4T 4M75C 2R5ZB 4LDXA 2XHKA 3K4MA 3OMCA 2DXTA 1G5VA 1I5LA 5KYUA 3A7AA 4IL6C 4LG0A 3CDLA 4J6YA 3RMQA 3M8JA 1NK3P 4HWSA 2FSWA 3NGPA 3TEDA 3CXCP 2L4AA 3QWXX 2I4MA 3G1ZA 2J5OA 2A8EA 3I71A 2R57A 1A0NB 2EZKA 3M54A 1WA7A 3R6OA 5EJCA 2AIRB 5LHHA 2PUOB 1PVEA 4OB0B 3V8JA 4UXNA 1QVGS 1HW1A 1MUZA 3F3XA 3CUQC 1KD1C 5J8FA 3HHGA 1PWTA 4Y33A 4CYCB 5IOZA 1PCXA 1WQWA 3X25B 4D7NA 1E6HA 1UGQB 2Q2EB 5BQTA 3K70C 3WE3A 2OQGA 2PMEA 2EQJA 1DPUA 5M5YJ 4M75G 3HFZA 2EQIA 4KR2A 1KZHA 1IRGA 4YRQA 5AONA 1X55A 3CCRQ 1G5IA 1O4XA 2XROA 3PIPF 4JZ3A 5F5WA 3BY6A 2FRHA 2XB0X 1MBEA 2QWWA 2ZCEA 2WACA 5J8CA 1UGVA 2JN6A 4JDSA 4YRCA 2VC8A 1QBJA 1TNTA 1KGSA 5HDKA 1AWXA 3DB4A 4ENJA 2EILH 4LLGF 4EMKC 2QA4Q 1W5TA 4BQOA 2AHQA 5FLXE 2DT6A 3UGTA 4XBFA 2KSSA 1FIAA 2QQAA 3K4NA 1B7YA 3GFLA 2ZZDA 2Q7HA 4ON0A 2DK8A 2LC4A 2QQBA 3UKGA 2ENMA 4OMOA 3QG1A 2X9HA 3I53A 2KROA 2DPDA 3TVTA 1Q81U 1XJWB 4HNTA 2HBWA 4XEMA 4D8KA 2LF7A 2E1HA 1ZQ1A 4HT8A 1BJZA 3C1DA 1KONA 2A5WA 4RG8A 4LGWA 2KI7A 3EGDB 4J6XA 2LBFB 2ZPBB 2CUEA 4TWAA 2RI2A 4C2UA 3CMEA 3ZMSA 2CDTA 3P8YA 1S72I 2VYTA 5DM7R 1RI7A 2RHUA 2MD0A 2COBA 3I3LA 1RADB 1B9NA 2R7UA 2IY5B 2MAMA 3CCRI 1VQ9T 4LDWA 3NTIA 3LH0A 4A3JJ 3RR6A 1RABB 2XKOA 3HFNA 1KIKA 2HL5C 2KISA 4BXXJ 1WHUA 3AG4H 1T95A 1L0WA 4J9EA 3P5JA 4A3BJ 4PJOC 4HSRA 4D5FA 3ZQHA 3CC7T 1LFUP 2DW4A 1ABOA 1IREB 2W85A 2I4NA 1G5HA 1Z05A 4H02A 2JRTA 4XLFA 4FSSA 3RI4A 2JK3A 3J7ZI 1D3YA 5JFRA 2EGEA 4J9CA 4J9BA 1C6VX 5DM6F 4FYWB 2P7CB 3FZVA 5GAMf 3CPWS 3W3SA 5IOYA 1O9SA 4CZCA 2BYVE 2VONA 3OWTA 4HQEA 4LK0F 4XU1A 2XDDA 2DOEA 2H3EB 2CUBA 3S2DJ 3RTRA 2PG4A 2CV2A 2BVLA 1K73R 3RMSA 1AEYA 2Y30A 2EYQA 2DTZA 2VKNA 1T6SA 2Q7GA 5KYXA 4NL3A 1KA8A 3A01A 11ASA 4LK1F 5GMKi 5EF6A 3E5XA 1VQ4A 2IAIA 4WCIA 5HY6A 2ZNZA 2M4KA 1IGQA 2DLPA 1ZN2A 4DOVA 1I5OB 2PMZN 4BWAA 1JKRC 3EUHA 3QHSA 1UHCA 3VQXA 3CF2A 4BI4A 4AIJA 2Q0OA 1I0CA 4E7LA 2R4GA 2YSRA 1FX7A 2DF6A 4GBQA 1MJ9A 3TP0A 3HXVA 1XGSA 3IALA 2O01E 3H9JA 3EQLF 3A7UA 3C2BA 4EQQA 2M0OA 2QDYB 3QO5A 2DA6A 4NC6A 2LVMA 2MOXA 1USYC 3PNWC 2MF2A 2L2PA 1QHGA 3BG6A 2VOPA 2EYXA 3H9NA 1NE8A 4PFPA 4XTUA 1RLQC 2XC7A 1VYVA 3BG3A 2FBIA 3UT1A 4NOYA 4OMNA 4MNUA 1OX9A 3IH3A 4DW6A 1C0AA 5FLVA 1K4TA 2NXNB 1WSUA 3HRMA 2F4OB 2K3XA 4HBLA 2D2WA 1DU0A 1WU7A 1NHAA 3DV8A 3OL3A 1T0HA 1Q1VA 5DV5A 2CP2A 2SRCA 1Q7YC 1G3TA 5LD2C 1UGPB 1TL8A 2RHYA 3CCVA 5C51B 3L00A 2DOAA 1N8RC 1EIYB 2CW8A 4UHTA 3ZEHA 1ZUYA 4RTWA 2ZXFA 5E1ZB 2L8DA 4OMZA 2WSEE 2K5CA 2Z99A 4KGZB 2BE5F 3I56T 1NJIC 2L0KA 2ESHA 1ZA2B 3SXYA 5HLGA 1MNEA 1ATIA 3S14J 1RAAB 1DDNA 3GYHX 1CGPA 1UZCA 1WJCA 1X27A 2ODRD 1D1BA 4KYWA 5K1PA 3RF1A 2MI6A 1K76A 2DTRA 1BI1A 5B1AH 2XUBA 4HWOA 1R1UA 3BTIA 2QBYB 1JKQC 3LSKA 5IHIA 1LJOA 3FKIJ 2LNVA 3QSUA 2ID3A 5LL6S 1PUEE 4OINF 2EQMA 3GIBA 3ZMDA 2C7IA 1WJBA 2G7UA 5FW9A 3QYGB 4RG2A 1JT0A 3BJ6A 5A2QK 3OSSC 4AH6A 1W70A 4P9FA 1TQPA 5GADJ 1PC0A 1IN6A 2VBWA 4C3JJ 2PU9B 3SYTA 2ELHA 1QKWA 2RM4A 4D5CA 4E6KG 1JJ8C 3A2KA 4LDUA 5LJ5h 2KEAA 2P81A 3WODF 1WZOA 4GXOA 1JRIA 4M3BA 3LW5E 4E7ZA 4ZYEA 5JHFA 3JCMc 1VQ9A 2E12A 1K7AA 5H6RA 1B1BA 5LEKA 2JUCA 4F7UE 3E5UA 3UA7A 5K5RA 4WK8F 3MVPA 1G2HA 3QO7A 2MK5A 4XQ3A 2WADA 5FRNA 5H2FC 3OYHA 3FXUA 3CC7A 3LSQA 4DNCA 5M5XJ 2EB7A 2P6SA 4JX5A 1QVFA 1FOWA 4EJUA 2V1NA 3OYAA 2TCTA 4L9JA 2DRKA 1VQMT 2A3SA 2QCOA 1NG2A 2GM4A 3NAUA 4YEJA 3CQZJ 1X1BA 1U5TA 3C3WA 1LPQA 1E3HA 3GBQA 3PTAA 3TCJA 2VUBA 3RL6A 2R93J 3KZZA 2XKOC 2FF4A 1YX3A 4RS8A 3A32A 1J0RA 2XB5A 2MFZA 1XQHA 2STWA 1RETA 2CP0A 3RKXA 2YPRA 5GANd 2FBKA 5CQYA 2OJ2A 1U0JA 5ECAA 2E34A 3BR6A 2XIGA 1WRJA 2RI5A 3BR3A 2OTJT 4RTYA 2VQCA 2D6FA 1OMIA 2XDBA 3QZ9B 3ELKA 1QO0D 1IRFA 1RAGB 4P5OA 5KCMA 2DMTA 1G51A 4M78A 3ASOH 3C95A 4ENMA 1QPMA 3QJ6A 4GLMA 2CH0A 4CI0C 3CMAI 1WQ2A 1I8FA 4O3MA 3H0FA 5J26A 2DL7A 2ATCB 2MGQA 5DEQA 2F2XA 5LJ5e 1CF7B 2G0EA 3P8TA 3MEUA 2JA2A 3GZ6A 2QYZA 1WFXA 3BPVA 3U21A 4O2DA 4ESFA 1EVKA 1HBXG 1WX6A 2ARUA 2P0KA 2XGTA 3K4CA 3L2WA 3G6ET 1RC9A 3VYRB 4DYCA 5M3MJ 4BBSJ 3L7WA 3WTSC 3WTYC 2WC2A 2DERA 1JB0E 1OCTC 2PQ8A 3IAM2 3IQLA 1ERDA 2LZ6B 3LOCA 4JRIA 2WV0A 2HVQA 1VFCA 2X6XA 3CCUT 5DS9A 2IPQX 4P55A 2HQXA 3CCLQ 2R7WA 1TTYA 4J6WA 2JA5J 1UEBA 3GCMA 1EZZB 4X0GA 4NS5A 3CCQQ 3ZXSA 4R55A 3EUHC 1USTA 1VI0A 1GHCA 1NNHA 2V9KA 4N9HA 3ZCOA 4MTDA 2F4IA 1S5LC 2GOMA 2JXBA 1AHDP 5KYWB 3MEXA 2VBZA 1MBJA 2CQ7A 5E79C 2XKPA 1PDNC 2EFWA 4A6DA 3I5SA 3H8ZA 4I01A 4DEYA 1VQ6Q 1M1KC 4DGWB 4OU0A 5CKDA 4QQ6A 1K4SA 1VA7A 3E6BA 2W00A 3E9FA 3KFUA 3ZR8X 2HEQA 4RBOA 3BZCA 3MFKA 5L23A 4F52A 3CCST 4IOAF 1RUOA 3LSPA 2HKXA 2LVSA 1ZBJA 1Y39A 3M0RA 2LLKA 2E10A 1VQKQ 1SERA 2RKHA 2JM8A 5KCHA 1YOVB 2VOOA 4HQMA 1DGRM 2ROLA 2F2VA 2KRHA 1HCRA 3OYDA 4M7AD 5GAN3 2L9VA 3DKMA 4E4HA 3GTOJ 1GUUA 9ANTA 1I6XA 5KYUB 3L1PA 4XOPA 2RGVA 3MZYA 3CCJT 5LJ5g 4LB5A 2FEZA 3N5BB 2Q5HA 3CCLI 3HGYA 2E1CA 3FMQA 4M6XA 3OYLA 1EA3A 3REAB 3CMEQ 2EJRA 2V6CA 4A54A 3CCQI 4ESRA 3QO8A 1S7OA 4XK4A 2EFIA 1FYFA 3D5SC 5CPRB 3SZTA 2FNAA 2CV0A 3GP8A 5IHKA 3QP5A 3PCOB 1LE8B 4YRVA 1WLEA 4MEYF 2FHDA 2VE8A 3F0CA 3OW2P 2MA3A 2ZR3A 3SHWA 4M7AE 4DYQA 3P9KA 3HFZB 1R0BG 4BU2A 1TH7A 4YFKF 1WJDA 2DXCA 2Z16A 4HT9A 5E1WA 1YJ9Q 3IWZA 5GPAA 2D8HA 1AVZC 2GZWA 2HOAA 3V7CA 1GLNA 1VQMA 4L5GA 2JA8J 1STZA 3GMEA 2HDCA 1Z7UA 1MW7A 1YN8A 3VQWA 1VQKI 2HSPA 1OI1A 2VBYA 3DFGA 4M75F 1SFKA 1M3BA 1FMWA 4FISA 1JXOA 5I22A 2X51A 3LYIA 3PL8A 2R7OA 3ABKH 2G6FX 2DA5A 1NZ9A 2HAXA 4A3GJ 2EQKA 5FU6C 1VQ5Q 1VQNT 1B7YB 5K1XA 3HEFA 1GBRA 4LVKA 4KIBA 2VGMA 4QT7A 4D1QA 1XPXA 4ZYHA 2OTJA 1RR8C 2J6KA 1U5TC 2MLGA 3G71T 3DF8A 1M2VB 3ULRB 3HXXA 3U9GA 1Y71A 4DZJA 2XGDA 1O75A 4GRIA 2BVMA 3CMEI 2DJNA 1YI2T 3AG3H 3MP6A 1F36A 4MTEA 1OYIA 1M90C 3EUAA 3Q5FA 2DA3A 4FCYA 1SVMA 1HDPA 2JT4A 4HLYA 2QEXQ 2XAUA 4XRFA 2L01A 1S7AA 3GFJA 3JAME 1UELB 2FNPA 2KKOA 3DPTA 1T33A 3C2GA 1XC5A 2HKNA 2KAFA 3K1PA 2E2JJ 4IHTA 2ISYA 3CCUA 3M53A 3S2HJ 2LF8A 5LHGA 3NARA 3ZQQA 2RQPA 3KP4A 5IXBA 4HCCA 2KZGA 2DJIA 2KT1A 1XTAA 2YS9A 2ZT6A 1R4NB 3DBRB 3R6SA 4KBMB 2QK0A 4IUPA 1JTXA 2NS6A 1EFWA 3QOPA 2ECZA 2K9SA 2HZYA 4AG1C 5KNLA 3CC4T 1R1VA 1K8AC 3K7AJ 3MJXA 2BHZA 4V2GA 2BY0A 2CU7A 3PMTA 2DU5A 2L3SA 4OOIA 4QQGA 4QVDA 4UUSA 4WXCA 2DMUA 1W7PD 3LMMA 2K4JA 3RYRA 3RYPA 2K3PA 5KYYB 1ZGWA 4MEXF 3CCVQ 2EZHA 1NTCA 2LTPA 4CH4A 3PIOA 3CCSA 1VQ4I 2E3HA 2VJJA 1W0UA 2OAWA 3QTCA 4C0ZA 5ICEA 2AT1B 4ITVA 2FPDA 1JXSA 1QWEA 3LFKA 4UB8C 5D6XA 2RHSB 1OCPA 1OOTA 2A6TA 1FOXA 1B4AA 2QG9B 4AIHA 4C9YA 1ON1A 1P7JA 4B3XA 1G4DA 1BOBA 1VYTA 2MWPA 4I98B 2RQWA 3PZCA 2CGHA 4IQ4A 1KQSS 4UC4A 1E17A 2OUMA 5HLIA 4BJ5C 3WVEB 1SC7A 3FXRA 4A4GA 2YHTA 3WHBA 3DU5A 3IL2A 2QGFB 3CCJA 2COZA 4RTXA 4IHWA 2DT5A 4M77A 2CJJA 2YWWA 3HY0A 1YJNT 1ZUKA 2XHCA 4DIQA 1MGQA 1I39A 2GXAA 3WG7H 4HX8A 4PJOF 2NUTA 2JZYA 4LE9A 5FKLA 2M30A 2ESNA 3KETA 4OMLA 4UUVA 2DD4A 1U1TA 4PNOA 3WE2A 4I76A 3ISPA 1OX8A 3JCMh 1LDJA 3ESWB 4IKFA 2O8KA 4HOBA 2SEMA 2OF7A 1IGUA 2ZNIA 3GTPJ 3A7RA 3FHZA 3CCVI 3I55T 4UNOA 1FZPB 4Z2YA 1XS9A 3OYMA 3OSGA 2QHSA 1MBKA 4PZJA 3LSMA 1USSA 2KRNA 3T9NA 2XSJC 3S16J 3NRVA 1UG2A 2IEKA 4YRIA 1R49A 2ZIOA 3WXMB 3K9TA 3SDGA 4A3LJ 2EW3A 5A0GA 4RAYA 2E36A 3KYDB 2CZ6B 4RLFA 4KGXB 5DDGA 4YCWA 2DX1A 4N4NB 1E2XA 2VQGA 1Y07A 1YYVA 2P5KA 3VSKA 2JTMA 3ZN1A 4C2TA 3K10A 1K9MC 1K79A 2K9MA 2DO3A 3KZIC 1F4KA 2CW0F 1V1CA 3P9IA 5A0LA 1UGSB 4XIDA 2FZCB 1R1TA 1EH7A 5HS9A 1TTHB 3ASKA 3G71A 3C4SA 5E1XA 3QWYA 4E7IA 5KE3A 2YLBA 3VB2A 1X2MA 4YRKA 4CC3A 1XMXA 1NLOC 4P3PA 2H09A 3KUFA 3GLLA 1MSFC 3BJOA 2VKEA 1Z9CA 2GOXB 1BCMA 2F5FA 4TVWA 3SFMA 2CRGA 3JCMe 1OFCX 4IJAA 2KVQG 5LBQA 4M3FA 1FPQA 1LJ9A 2KK4A 1MIJA 4YRMA 4J19A 3I58A 4FIBA 3CC7I 4F55A 1XG1A 4PLIA 3VRYA 4U87A 3SQNA 1FT9A 3KX2A 2ZMEA 1X69A 1DQUA 2K2VA 5JR3A 3H0DA 4H2WA 4XAXB 5GAOp 1O3TA 1K78A 4RA2A 4ZNXA 4XQFA 1S29A 4CCLA 3UDCA 5AIQA 2NLUA 5J1RA 2IPOB 1R71A 5FWBA 3L09A 3QQAA 3TGNA 2L3QA 3CC4A 3H0IA 3M0TA 2DDBA 5TRDA 4B3AA 4LLNA 3FJ5A 2E1NA 3FC3A 4BI3A 4MLOA 2OTLT 3CBPA 4YRSA 2JWTA 3EG3A 5BNGA 1U8BA 4PJJA 4F7UB 4AFUC 5IYBJ 4AFSC 5D8KB 2PJRA 4MZMA 5LRSA 3NMZC 2V1UA 3JCMd 3O3KA 1IUYA 1Q81C 3ABLH 2OC6A 3KP6A 3B02A 1TSFA 5CLSA 4HNUA 1W4SA 2RO0A 4HV6A 1IHWA 1EJ9A 3OIPA 3W6JB 3E5QA 1RLPC 1OQYA 1Z3XA 2UV1A 3W2VA 5FLXZ 3M58A 5LJ3j 2PNIA 2VXEA 3CO6C 4X34A 3WTWC 5IAYA 2M1BA 3LH5A 2DFHA 1T39A 3QU3A 3VS0A 5BMZA 4XNFA 2YU3A 3BPXA 5E3MA 1YJNA 3X26B 5BPDA 3JCMg 1YHQT 2X4WA 3VBBA 2EYYA 4UP9A 2ETHA 1M27C 3JB9F 1U5SA 1B59A 2EYZA 3HSFA 4CH5A 2HKOA 3F72A 3IKTA 1B72A 1BM9A 4EPCA 2L2OA 4BQAA 1YIOA 3DBLB 3TOAA 3G73A 1KMNA 4M77C 2A6EF 3S6WA 1V5EA 3U2RA 5K7HA 3ZRGA 4YP0A 1HA8A 5ELOA 4R1HA 2M0YA 1IO6A 2KL4A 2KIUA 2M9UA 2CO5A 3ZFJA 3I55A 2O03A 1N77A 5EEAA 3WGIA 1OYWA 4DBRA 2BZXA 2HXOA 2DXUA 4M6VA 2Q1ZB 4GGGA 5B66C 4X1EA 1NPRA 5FFXA 2B86A 3M1CA 1IN8A 2EIKH 4AIKA 3WG9A 1K0SA 1JJCA 2CJBA 2EJGA 1VQ7T 4C2MJ 2CMPA 3L2UA 1OR7A 1Y0UA 3MZ8A 4J9HA 4XLHA 1Q7YU 3NTHA 3GPLA 1N8RU 3MMYB 4F93B 4MO7A 3TQNA 2VV5A 1TT0A 5IHNA 2P0WA 2CQQA 2FJ1A 2R7XA 2MLKA 1BJAA 4A3CJ 2CUDA 2PMHA 3VPRA 3GZ5A 4HF1A 3DPUA 2CIMA 2D9TA 3K2ZA 2KR3A 4M77G 1NJIU 2JJ9A 2YUNA 1AZGB 3HRTA 4KMUX 2HWVA 2H8WA 3S1MJ 4CS4A 3HZJA 3HKZN 3KEOA 2F5VA 1YITT 3M4QA 1V5FA 1GGMA 1FJLA 1WPKA 4XN0A 1E22A 2HR3A 1IZ1A 5C3EJ 2RK1A 1WYDA 1FOKA 3CCET 5HK3A 4MFDA 1GFDA 5GMKj 3VS2A 1IDYA 3CXCS 2HZDA 1UG1A 1ZLJA 1WJSA 5E3NA 1ZUUA 2XICA 3ECOA 1HQCA 1BIBA 3HOSA 5GP9A 5CKBA 2LT1A 2FUG2 1QA6A 1JI8A 5L8RE 2PX9A 1AZEA 5ILVA 2VIXA 1HC8A 1ZX6A 1NG6A 1MV0B 2BKDN 3QIIA 3I4MJ 3JRDA 1XSDA 1H4VB 3D7SB 1VQMI 3CD6T 4XU3A 4FYYB 1MKMA 1T98A 2PVDB 5EC7A 1WCMJ 4CH7A 2Q5IA 1TW2A 3PVLA 3I4PA 1YBYA 5CKEA 5BOXA 2WY7Q 3BG9A 2PQWA 1EV7A 1KQ0A 3M56A 1G83A 5HNHA 1LB2A 1TT5B 1M5Q1 1A6QA 1TS9A 3CMQA 4TVAA 1UE9A 1UJYA 5LHIA 1XOVA 3RZOJ 2ZMEC 3ZQGA 2GNCA 4P75A 2ISZA 1RPWA 3TEGA 2OTLA 1IXRC 2EPFA 1BBWA 3ZOBA 5D5WB 4D7MA 1E3OC 2X9DA 1KD1R 4JZ4A 2MBFA 2EV5A 5TGTA 5L3EA 3BC8A 1B34B 3G1JA 4XLEA 4LVMA 4DBFA 1RR7A 3HOXJ 3O8GA 1R5GA 1YS6A 4P96A 3C7JA 5D6EA 2ELJA 5FGMA 1MNMC 1FOYA 2CT4A 2ZJRF 3H36A 3QPHA 2Z3YA 3ZQ7A 4NCXA 1W36C 4L6V5 1W2BA 3HL2A 4QKUA 3K2AA 2NVYJ 2R5YB 5BPIA 3DTKA 2VE9A 1YGBA 1FYMA 4BDZA 4XKCA 1H8KA 3S1QJ 1NJ2A 4J9IA 2L4MA 3LWHA 3TEHA 4PSWA 2H1LA 2PMUA 4HLXA 4MGRA 3CC2T 3OS0A 1KC8C 3CCUI 1E24A 2ZZFA 2ZO4A 2NWMA 1U6GA 1PHTA 4CH6A 2QYOA 2X4HA 1RIOH 2CFXA 1OYXA 4HVWA 1UJ8A 1IV6A 1T8IA 3GF2A 2LKXA 2M16A 1EVLA 1YHQA 4IUUA 1TQIA 4PDKA 1C1AA 2AKLA 2V1RA 4HNVA 1MZBA 2DL3A 4KUIA 2AXLA 1W5CC 2O8XA 3RZDJ 3HOVJ 2K27A 4KMFA 4XSZF 4J83A 3M57A 3MEYA 2ZXWH 3REUA 1H89C 1PSEA 2KIMA 4J5YA 2HOEA 3GFMA 1WXBA 2EV0A 1MMDA 2X85A 1RAIB 3TL4X 4M71A 1GCQA 4H2XA 1YNZA 1WI3A 1XCVA 2DYSH 1JJ2P 3LGLA 5F64A 4CUGA 1WXTA 1JKOC 4BACA 3L2CA 1WZ2A 2JUFA 3KFVA 1VQ8T 4B09A 1M1KU 2OAUA 2DE0X 1VQ7A 3FXQA 5BS6A 2OI3A 4X9DA 2LQNA 3ZMTA 5FKKA 3DQVC 4Q48A 4KFCA 3O8VA 2QASA 4M75D 1K6OA 2DOFA 1ZGJA 3HSEA 2LTOA 1Z9ZA 3CJTB 1QVGA 4I09A 2BHYA 5EG0A 2AXTC 2DDZA 3HTRA 3RPQA 1G3SA 3MN2A 1SRYA 4HG2A 5CKTA 3G4SQ 4M9SA 5FFZA 4I6ZA 1IXCA 4AWXB 3JRZA 1IHVA 5FD5A 2EKOA 4X9CA 2NUPA 4RUGA 4LFUA 3UFGA 4NB5A 2OQRA 2P7VB 1OR7C 3GWZA 3LSIA 4YCUA 4D9JA 4LIUA 1SAUA 3CCEA 2JSPA 4M77B 1TWBA 1Q86C 1V55H 1XGNA 3W2AA 1ZSZA 1TWCJ 3META 4QPQA 2NNNA 4AMCA 2NRAC 2DZCA 4IPAA 1B9MA 3R4KA 1Y0MA 2XVCA 3OOUA 1PYSA 4P71C 4RTZA 3K70D 2RHQB 3BR5A 4M75E 2KRFA 1PM3A 1Z9QA 4JJDA 2H1KA 3S2WA 3CF5F 2KT0A 1A36A 1TLHB 2E4HA 1ONVA 3CD6A 1MD0A 2NS7A 4NDLA 3VRZA 2K9QA 5GMKl 4TTVA 1F1BB 4IIOA 2FZGB 3REBB 3A02A 4C3IJ 2CSOA 4BBRJ 4ZZDA 4KN4X 1VQLT 1VQPT 8AT1B 2H27A 3QYFA 2NUZA 2R3SA 2LKPA 3CP8A 2V79A 2XASA 1MNDA 1D3BA 2BV6A 4BYYA 2X4XA 1FYKA 1I50J 4R56A 1H8AC 2VXZA 1OPKA 4G9YA 4HPQA 1MH3A 3CCMT 2CZ1B 3G71I 4LVJA 1P9QC 2NVXJ 2OZUA 3OMYA 1MMGA 1O3RA 4AUXA 1U3EM 2ZPGB 1Y8QB 4TQDA 3F6OA 1X6GA 4RQEA 3URGA 4ZTJA 3FX3A 1JT6A 2X3XD 5E18F 3RKQA 1SSFA 4QVZA 4P75C 1FP2A 1RI9A 3HDDA 3VYTB 3M0PA 2E1MC 4KH0B 2EPDA 5DLOA 2A5YB 4YRNA 3AL0C 4J9DA 5FO5A 3OQ5A 2P0PA 1FC3A 5E8IA 2IA0A 1MJBA 4R8HA 2YX7A 1Q7YR 1N25A 1XMKA 3VJPA 1N8RR 3CC2A 3L42A 3E3VA 5GAMd 2FXAA 4C92A 2RHIA 3JREA 5IH2A 1MDMB 1M90U 3L2RA 3F9KA 1NJIR 1ZRDA 5L3DA 5GANf 4A0YA 1D09B 3CPWA 4J15A 4I7HA 1MSEC 4KQEA 2P5IA 3CC4I 4PJOD 5LJ5j 2O4XB 4M7DA 2DA1A 2RI3A 3DCFA 1Y8RB 3MWMA 1OPLA 1DUXC 3LWFA 2EZIA 4JJBA 1ETXA 4FM4B 1WH7A 3A5ZB 1B3QA 2GAUA 1OCZH 2X3WD 3CBMA 1XSVA 2K7AA 2PN6A 1XDUA 1VYUA 3M5AA 2J3LA 1ZRCA 3M0UA 3PNYA 4U0VA 2L02A 1T38A 4PJ0C 2KXDA 4OMQA 4D0PA 2PLYA 5DUKA 1PUFA 2VJ5A 2EK5A 4HKEA 1K8AU 2KRSA 3EG1A 3TO6A 5K7FA 3VKIA 4UPAA 4KN7X 3W3CA 3A03A 3I59A 4EV0A 1VQ8A 2A36A 4P3NA 2RJEA 5HOOA 2HL3A 3ABUA 3EFRA 4C30A 4HSTA 5C6SA 2AMCA 1X1PA 4PJOE 3KLNA 4E7HA 4B8XA 1QZZA 2M02A 3RQ4A 4OGEA 1GCQC 2OA4A 2XAHA 1GXQA 3B6CA 2E60A 2QDLA 5DCMB 4C3HJ 5EGOB 4LD5A 4HDUA 4NHJA 1XGOA 1JE8A 1AKHA 2E65A 2FQ3A 1N75A 1G3YA 2K9LA 1YJNI 3VOEA 2LK2A 4BY6C 4FYVB 1YB3A 2ZT7A 2W84A 3QNEA 2GXGA 3LQRA 2EZLA 3RNJA 2AO9A 4RAZA 2VPRA 4P5NA 1P4WA 4IOCF 2E41A 4LOCA 4ZZLA 2RA2A 1MBFA 1QKXA 1BKBA 3R60A 4BL0B 1BB9A 5L3CA 1YS7A 1MBGA 4A3DJ 1JEGA 2RV8A 4F16A 4XTVA 2JVGA 3WQZA 3NFCA 2VN2A 4XU2A 1LVAA 3BTCA 3V7SA 4MZTA 2V1XA 2KJBA 3W6KB 3DPLC 4MFEA 3KFWX 4FASD 2YUOA 1RKTA 3NWSA 1B72B 3PJRA 3DP7A 3A8HB 2DODA 1IF1A 2VLAA 1HOMA 3JAMZ 2EJFA 3S3MA 2A37A 1ZSZC 1ZARA 4Q4ZF 5IT9E 2DEUA 1PKTA 3QOEA 3TDZC 3L1AA 2Z0WA 4EIKA 2HOSA 1VQPA 1BR2A 5J1YA 2CSIA 4F14A 2JRMA 2LNBA 4WJ3M 2WAFA 3BCBA 1W6XA 3HY1A 4C8QA 4RCBA 5C52B 4XONA 3F8CA 3DKYA 4EGZA 5C44J 4BXFA 3RQIA 4S04A 2FPFA 2IG0A 5IT9K 3QRFF 5IY5H 4M73A 5DTDA 2R7RA 1LFPA 4M6YA 4EDUA 2ARTA 3CCMA 1M8VA 2RJFA 1OKRA 4RB1A 1DU6A 1ETQA 2DTOA 2CQXA 2HGCA 3MKYB 1WHHA 1ODDA 3N05A 5C0MA 1K83J 5GAOq 1X54A 1J3TA 3G1OA 2GA1A 4ELYC 3HG9A 5L3GA 3QPSA 1TOVA 3Q9VA 1CQTA 3E6CC 1HSJA 1OISA 1BR4A 1K9MU 2K3YA 2XF6A 1B7TA 3J81E 4G6DA 1R5ID 2GXBA 2ESWA 3KE2A 4E7JA 3M9QA 3UGQA 3MO8A 4AC0A 3CBOA 4ZDPA 2CSQA 5JHUA 1FBUA 1NYQA 1N9RA 4IQJA 4RCCA 5E3OA 3CUOA 4CS3A 1SF9A 2DLLA 3Q0UA 2BY3A 3KIOA 2KIFA 3SJMA 2FA5A 2GFAA 2KJCA 4M77F 1KSWA 5L3BA 3EYIA 3E97A 3PUFA 4NL2A 1Z1DA 4IO9F 1YW8A 5DD4A 1YRNB 4AM3A 1QF6A 2KE9A 3MCZA 3I0TA 3TDUC 2ZXIA 3L2ZA 3KP3A 2DYBA 4Z02A 2P8TA 1LPLA 2HS5A 4N0BA 1PP7U 2K6DA 2ZPEB 2EAYA 4MDXA 3T8TA 3CCRT 1F1ZA 2XDPA 1S72Q 2OTLI 2JA7J 4LMYA 4C92C 3OW2S 3U1KA 1SG5A 2FB7A 4A3MJ 1NEBA 2GIZA 4LNPA 2DQLA 3HUGB 3R6NA 4DQ2A 3LLRA 2J5PA 2QTXA 1RKWA 4ESJA 1V4RA 4UP8A 2IXSA 2IGMA 3VFZA 1M3AA 2EL9A 4YCVA 2RN7A 1Z67A 5GAEJ 3QWLA 3OYYA 4N9IA 1JGGA 4M7DC 2YU9J 2V7FA 2XV4S 2WSCE 2QA4T 1PNJA 1T0JA 3EG9B 2CZ0B 3JW4A 3EFOB 3R61A 3LAJA 4A0XA 5CQXA 9ATCB 2XAFA 4BI8B 2K7LA 4CRIA 2XU8A 2DK3A 4FQGA 1ADJA 4UY8I 2O9LA 2M0CA 2ZFUA 5GAMj 5LGTA 2C0OA 2R5ZA 1S9HA 3MKLA 4J8OA 2IA1A 2QHUA 3IUOA 4LG3A 4M9ZA 4IXAA 2XI9A 3VV0A 2LQKA 2F4MB 1PKSA 3CDHA 3V4GA 4JOMA 5FLXK 1F9NA 3J80E 1WGXA 4UV8A 3GUDA 2MW8A 3QAHA 4HYEA 1ZG5A 2R7QA 4FW1A 2JW4A 2KXCA 3ZN0A 1YHQI 2PVOB 2NOJB 4EM2A 4XLAA 2VKDA 4M7DG 5FWCA 3J80K 2QF7A 3ECHA 1D5VA 1C0MA 4J7FA 1WQ7A 4EMGA 3H3VK 2L0AA 5CR2A 1Y96A 1ZGAA 3EYYA 2X1EA 3EFSA 3TU4K 3DEEA 2BY1A 2Q2EA 2ME6A 5CVUA 1SRLA 4LJZF 1R9TJ 1KU9A 5IT3A 5EEHA 1R00A 2ZPHB 4YIRX 3X24B 5HKCA 3GOXA 1O3SA 4BGDA 1FWZA 1M90R 5ILSA 1IV8A 3OBYA 3IRRA 1K9AA 4FT4A 2O9VA 3UNGC 2IJLA 2LT4A 2DETA 3AHUA 2R5AA 2O2OA 1U06A 2IGKA 3E9IA 1UJ0A 3W2WA 5D7UA 3L2QA 4M72A 3MEVA 5KNNA 2HQRA 4BY6B 5ICFA 2F5DA 1POGA 3GO5A 2OBPA 2DA7A 4GYGA 4E2FB 3S1RJ 4XR6A 5HLTA 3FXMA 5J47A 1X1AA 1J5WA 3C2HA 4CSWA 1ZREA 5I21A 2RREA 4DOWA 2Q7EA 3WU1B 2MMPA 2DYRH 3RESA 5EG0B 2C0TA 3R07A 3TBIA 3ZP5A 2DIGA 4C8QC 3BJAA 1XDSA 3S8PA 3CCEI 3M4GA 1K8AR 2IIMA 3R0AA 3A1PA 1NJ6A 4CC2A 4PJOG 2ZR2A 2FBHA 4BXUA 3BLYA 2LQWA 3VSLA 1T2KA 3QPTA 4ZYDA 3H9QA 1AD5A 1HJDA 1FP1D 2I2LA 3M0SA 2P4WA 3EGDA 2GQVA 2O6GE 3DU6A 1SMTA 2LBFA 1QZEA 1I3AA 3CQTA 1X43A 3H5AA 2H3JA 2HCKA 2MYSA 5DD8A 1MMAA 1YG2A 2RH2A 3CD6I 3B6AA 4OMPA 1J59A 3L4GB 2IY5A 2FVUA 1GV2A 4EEFG 3K1NA 3I9QA 3OBWA 2WWYA 1UGRB 2PTKA 1P4XA 2J06A 1UHSA 3OYEA