3RKWA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkwA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkwA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkwA02
2QZ8A 4HQMA 3JCMP 4KN4X 4LG0B 1D3BB 5FB2A 1ADYA 3CJNA 1LEAA 3JB9F 4HWTA 4I02A 3O2PE 3OD1A 1J2XA 5CLSA 3QHSA 1EOVA 2IVMA 3KLOA 3EYIA 1WKMA 4H2UA 1G3TA 3GFLA 5L3BA 4EJVA 4WX9A 3DXJF 5E1ZB 4ON0A 4L9TA 3DQVC 3LSTA 2EV0A 4Z2YA 4IPAA 4G8XA 2L4AA 2A3SA 3EQLF 4ENMA 4YFXF 4L9VA 4OP0A 5GANg 1B70A 4YFNF 3QRFF 2QBYA 3BJ6A 1WQWA 2DI3A 3P8TA 3QUIA 4NCXA 5GMKl 3I7FA 1R1VA 3A31A 4UVBA 3M7GA 2ZKZA 4HX8A 4RB2C 4QVCA 1B1BA 1YGBA 4IVNA 4OOIA 4C8QF 3ZMUA 2WC2A 1KU9A 5LGTA 5GAMj 3IRRA 1IXRC 4M78F 3TO6A 4XQ3A 1BC7C 1ZREA 2OAZA 1CGPA 2ODRC 5D8LB 1ZLKA 1E24A 1U1SA 3EDPA 3J81Z 5K1YA 3TEHB 2V1UA 4M7AE 1R22A 3V7CA 4NL3A 4J5YA 3ZPLA 2ESHA 4A53A 5L3CA 5E3IA 5GAOn 1XDSA 2DU7A 3MAJA 2FOKA 5IT9Z 3CUOA 1YO5C 5LEKA 3IWZA 2GZWA 4P96A 3F8CA 3CUQB 5L3GA 2OU2A 3GZ6A 1NYQA 2Q7GA 2E10A 2STWA 3NQOA 4P55A 3JSPA 2ELHA 1K7AA 4ZYGA 4YRQA 1IN6A 1XSXA 2DK5A 1VTNC 3INZA 2V6CA 5JHUA 5GAN3 3L9FA 3G73A 2LSOA 2MH9A 4N0AC 2J5OA 2C7IA 3KEOA 5ELOA 3WTWC 4HT9A 4ZZLA 3SWNC 2I4LA 3HUGA 1BI2A 4NL2A 1BM9A 1P6RA 4HV6A 5GANh 2ZCEA 5I21A 4KDPA 1QF6A 5TJJA 1TBXA 1DPRA 2LNBA 3IKTA 4P71A 2RVCA 3K1NA 1ON2A 1JJCA 4YCWA 4D0PA 3ML6A 2HKOA 4Q4ZF 5LRSA 4CH3A 4ENKA 2H09A 1XDUA 3DV8A 3KP6A 1PDNC 4KMFA 1B34A 4ESBA 3JB9D 4Q15A 3M1EA 4EV0A 2DW4A 1Y0UA 1STZA 3K1PA 2CGPA 4JRIA 2ZIMA 5DYMA 3RJPA 1DPUA 5GAOr 2ZCWA 2IA1A 3CTAA 1LEBA 5GAMd 2Q5IA 2XGXA 1B34B 2ZNJA 1USSA 2CO5A 4M6YA 1I27A 2OZUA 2QLZA 5FFZA 3T1BA 1U3EM 4LB5A 4U88A 3DFGA 4HAMA 2E65A 2I2LA 1FYKA 2EK5A 4YRPA 5GAOq 3RESA 1ATIA 4RGUA 4YG2F 4P74A 3O3KA 1HKQA 4OMZA 1WWXA 5HOOA 5LJ5g 5KNNA 1MD0A 1V4RA 4KUMA 5DY9A 2EL9A 5HLGA 2LKPA 3E97A 5DUIA 1WQ2A 3K1MA 5F6FA 4M74A 2DKGA 1USYC 1YFSA 4YIFA 2GA2A 2PMUA 1LVAA 2DJZA 1KU2A 4IHSA 2FQ3A 1PYSB 1EV7A 2IRFG 4PJOG 1B9NA 1LB2A 4M9SA 4M78D 5KK1A 4Y13A 3HY0A 1B7YA 1HW5A 5C52B 3FMRA 2XIGA 2YLBA 3R60A 3NETA 4DQ2A 1BI1A 5D5UB 6PAXA 4HDUA 3JCMh 2I4NA 2GA1A 2H6CA 2VC1A 1S7OA 2H94A 2O8XA 5GAMf 5GAN4 3JTHA 2KIUA 2MD5A 2KKOA 3I5UA 1Z05A 2VBYA 2XASA 1T0FA 1WQ7A 4UHTA 4PHCA 5LGNA 2DTOA 3Q5FA 4L5IA 3IKVA 4A5NA 3HTSB 1USTA 1BC8C 5L3EA 5DD4A 5F1RA 2XHKA 4IHTA 4C92A 2E3CA 5F5WA 1WSUA 3HRMA 5IT3A 2Q7HA 1G4DA 4JRKA 3MCZA 1L0OC 2PI0A 4ZYDA 3HXWA 4N9HA 3TOBA 1J75A 1ZHFA 2D45A 4P73C 2CWEA 3ZMDA 4YRJA 3TO7A 2L02A 2QUFA 2H6BA 3GWZA 5BOXA 1X54A 2W85A 5CYVA 3JW4A 4PCQA 4M77G 1BBUA 3HOTA 2RHQB 1R5GA 3JCMQ 4OU0A 4PJOF 1J9IA 1SFEA 3KP4A 4M75C 4LD5A 2ADUA 4EM2A 4XRFA 3NRVA 1FLIA 1G3SA 1U5TB 5LRRA 4RB1A 4RB3C 2IA2A 3M4GA 1ZG5A 5HS9A 5K1XA 2VOOA 4YRGA 1HBXG 4F7UE 5DCFA 3C1DA 4F7ZA 2DQ3A 2DLLA 1XMKA 1BBYA 3ERED 3IALA 4EX5A 2YX7A 3LAJA 1TQPA 3HXZA 5DCMB 4IRIA 5EEHA 3UFGA 2CFXA 1W5TA 5AONA 1MJBA 2IP2A 4M7DC 1KQ1A 3IHUA 3PCOB 1IN8A 4XTZA 1BN5A 4EMSA 3L2ZA 2VE9A 1KOGA 4OLFA 2K57A 3I59A 5D4SA 5BPIA 4KFCA 3DP7A 1J59A 5K1PA 5K5OA 2PMHA 3MZHA 3R07A 4HW0A 3SZPA 1ZGJA 1P4AA 3J80Z 1RNLA 4AIKA 3JCMX 1EIYA 3P8YA 4U7BA 2ZMEA 3R0JA 3LSQA 3BJUA 3H3ZA 4M77F 1SD6A 3RUXA 5LHIA 1R00A 3TDZC 3HFZB 4CYDA 2PG4A 4XEMA 3JB9I 2VC0A 4MHGA 5GAN6 3H92A 4KT5C 1FP2A 1F5TA 4F7UA 3F23A 3JCMW 1I4K1 1I1SA 2V1DA 5H6QA 1MDMA 3VQWA 1YYVA 1BIAA 1R5HA 3KE2A 4HWPA 5GAN8 4UV9A 1FSHA 1OYYA 1R7JA 1FY7A 2L54A 2DDZA 4PDKA 1ZYRF 2NS0A 1R1UA 5GANe 2FMYA 4M71A 1SFXA 4RGSA 3LAPA 2FXAA 2D1HA 1FT9A 2CQKA 1TQIA 3R6SA 4ZTUB 2Y75A 4ENNA 1Z7NA 1MDMB 1MKMA 2PFBA 2CG4A 3FXQA 5GAN2 3HXYA 4M75E 3ZMTA 3W6KB 3VEPA 5J8FA 2VXZA 4PJOD 4CH5A 3PZCA 2RHSA 2EA2A 3NELA 2DEQA 1FOKA 2FYKA 3IL2A 5FO5A 3L2CA 3WODF 4EQQA 1Q1HA 3HIFA 1ONVA 5D5VB 2BYVE 1IN4A 4HF2A 4WCGA 3VB2A 4LFUA 4M7DG 1XGSA 2P5IA 5GAMg 5LJ5d 2EV6A 5LGUA 2ZT8A 3NENA 2IY5A 4G7HF 3L1AA 1R36A 1IL2A 4NOYA 3FB9A 4M7DE 1MZBA 1KGSA 1P4WA 1TH7A 4WF2A 2ZT7A 1TNSA 3TQNA 4YCVA 4UVCA 1G3YA 2PBIA 1IRFA 3DPLC 2G9WA 2QENA 4GGGA 1YG2A 1ZRCA 3HFVA 5EEGA 2YR2A 1WU7A 1C0WA 4HVCA 5GMKi 2XKOA 3FMQA 4P71C 4NHJA 1BIBA 3LC0A 1RIQA 1I5LA 1B76A 2IPQX 3REOA 2VN2A 4KA4A 2IJLA 1WYDA 3GZ5A 1AOYA 4M75A 3HHGA 4K2EA 3I58A 4EGYA 4YRTA 1GXQA 3ZMSA 1QGPA 2C8MA 1LJOA 2ZZGA 3BY7A 2VT3A 5JI6A 3WQZA 3RL6A 4M77D 3V7RA 2K4BA 3ERRA 4HLXA 1QE0A 1EH7A 1FX7A 5HLHA 5LJ5f 4GO1A 4I0AA 2PLYA 3SFZA 1QNTA 2V1XA 5J8CA 4HZFA 1FYMA 1E17A 4ZZDA 4HF1A 3N4MA 3ULQB 3T8RA 1F1ZA 2JSCA 2Z5UA 1XSDA 3IKLA 4LLGF 4P74C 1FSEA 4M6XA 2VT2A 4M9ZA 1IW7F 1ZAOA 2O61A 3RI4A 4G9YA 4L9NA 2EJ9A 4UV8A 4LG0A 2P6TA 4EMKB 1LNXA 3T5XA 3QO8A 4U0YA 3RERA 1RIOH 3GYHX 2ALYB 3JSOA 3GXOA 1U2WA 3E6CC 4XTUA 3GFMA 4MEYF 4CZZA 5LJ5e 1FBSA 2CSOA 4U0VA 4K88A 2ZNIA 3FHZA 3BWGA 2XUBA 3TOAA 4KYWA 2Y0MA 4UPAA 1EH6A 4YRRA 4UNOA 1KA8A 4L0ZB 4LGWA 3J81K 3WTXC 3EUHA 3HRSA 5E1WA 3U2RA 2DU5A 2KRFA 1W7PD 4L5JA 1KMNA 2ZFWA 2RC4A 5IT9K 2CYYA 3TDUC 2Y90A 3A74A 1R1TA 1W4MA 3WU1B 4MMLA 4C92C 5D8KB 2EA4A 2QHSA 4FT8A 1IXSB 4L9JA 2OQGA 4YROA 1QO0D 5BMZA 2DXTA 3BDUA 1SMTA 3FZVA 1ZARA 4ETSA 3FM3A 4A6DA 4BHCA 5HDNA 4EJTA 4M72A 1XGMA 3TEHA 5E8GA 1EVKA 3EFRA 4M7AG 1T6SA 3ZQ7A 4KIFA 5BS6A 2ZT5A 2C6YA 1X2GA 4N0BA 4G6QA 3VQXA 4BHBA 3D5LA 5D5XB 4U7DA 1XCBA 3CUQA 2XRNA 5E17F 1YW9A 3IC7A 2VE8A 2E1HA 4I0BA 4RGXA 4ZH4F 3HSBA 1JHHA 3GFJA 2E7WA 3IRQA 2DO7A 1EVLA 1J0RA 4G94A 3HRUA 5DDGA 1ADJA 4C8QB 3CO7C 3M9AA 4LMYA 3KFWX 4M78B 1HXDA 1EFWA 2E1NA 3RKWA 4E51A 1W66A 2M1BA 4UP9A 4HWRA 4WXHA 1XGOA 5C53B 2NNYA 3A5YA 1OR7A 1LJ9A 3J7AO 1S8NA 4HDVA 4WJ4A 4TVWA 3JB9J 4WJ3M 2DPDA 4EO4A 1ZRFA 4I98B 3UH0A 3L7WA 4XU1A 1BBWA 3GFIA 4G7OF 3PGGA 1S3JA 2XAQA 3BJAA 2WTEA 4P9UA 2EFWA 2RNJA 1LQ1A 2G7UA 4YRFA 2ZBKA 3ZN1A 3RGLA 5CVVA 2QHVA 3WGIA 3QP6A 3K2ZA 2A6EF 2MA3A 4M7AF 2EV5A 4Y17A 1HTTA 3A7AA 4M9XA 5ICFA 4Q47A 2JT1A 4TWAA 1P2FA 4WK8F 1Z7UA 2YX4A 1HW2A 4C92G 4P72A 3F21A 5CVRA 2Q5HA 4L87A 3B02A 3SXYA 1HKSA 1OKRA 4CXFA 2M87A 5C51B 5FLXZ 4C92E 2D2WA 4QVDA 4AH6A 2FBKA 2RKHA 1PYSA 1G3WA 4YREA 4Y91A 2P7VB 5DD8A 2VXEA 4EM0B 2RDPA 3SHFA 4YYEA 2UXXA 4KN7X 4OMYA 4L0YB 2HS5A 3F6VA 4TV7A 2BGCA 4C8QD 2K02A 3R61A 1DDNA 2VXFA 1ZG3A 2YPRA 3EYYA 3QSUA 4RS8A 5BQTA 4XSZF 3LQRA 3TUPA 2HEOA 5ED4A 2DAOA 4XTXA 2ZR2A 2YU3A 1JGSA 2JPBA 4XU3A 1H4TA 1IRGA 1WNLA 3V7SA 1IN5A 1YFHA 2HNIA 3G1ZA 2A69F 4XU2A 1F9NA 3ZMZA 3VOEA 1O57A 3QU3A 4GYIA 2EJGA 2ZNZA 1NJ6A 2PMFA 2YLCA 2ZINA 2FBHA 4PG3A 3KCCA 2Q7EA 3GEZA 5ICCA 3JAMZ 4OIQF 1KQ9A 2J3LA 1YW8A 3QO3A 2IW5A 3LQQA 4JQFA 1D8JA 3QAHA 2X4HA 2UXNA 4XLNF 1W5SA 2I4MA 4S04A 4MGRA 2RHQA 3MQ0A 3GO5A 4HF0A 2JN0A 1ASYA 2TDXA 5GAMe 1TLHB 2RQPA 1RUNA 4XTYA 2MBFA 2QYOA 5LJ5h 2DZCA 1IUYA 5CVUA 4X9CA 3R0AA 1B4AA 1SD7A 2MLKA 4BAYA 2DTHA 2I4OA 1U5TA 3F72A 4ZYEA 4XTWA 3ICAA 2GQQA 1E2XA 3TGNA 2DK8A 2STTA 2ISYA 4M7AD 4MQ9F 4KNYA 2ISZA 4CICA 3FXUA 3QTCA 2ZZFA 3BP8A 1JRIA 4B09A 1UFMA 4F7UG 3GX4X 2V79A 3RDIA 1V3FA 2F5CA 1H641 3U1DA 4K86A 5DCMA 12ASA 2W24A 4PJOA 3BDDA 1HSJA 3J80K 2CIMA 3PCOA 4H2XA 1H9GA 4RDXA 5DEQA 4EMKC 4A0YA 4OIOF 1FBQA 2QQ9A 3EFSA 4K87A 3SZTA 4PJOB 3WTSC 4HWOA 2XTIA 4H2XB 5LJ3j 2FBIA 3MWMA 3W3SA 1ASZA 3T8TA 2R7FA 5GAOl 3W6JB 2KIFA 4A12A 2CW0F 2DZ9A 1XB4A 4EJUA 1GXPA 2A68F 4H02A 2NYXA 1L3LA 4EM1A 1YCYA 5GMKj 3HFZA 4TTVA 4S05A 3F8MA 4J15A 3F8BA 3HRTA 4UP8A 3KLNA 2P5KA 4HOBA 1JBMA 1UB9A 2KJCA 2IT0A 1KQ0A 1G5IA 1N9WA 4H2WA 3F6OA 4TVAB 2PN6A 1PP7U 1WPYA 2ZGWA 2M45A 1E1TA 2AMCB 3E5UA 4J6WA 4RB0A 4AIHA 3LA3A 2GXBA 1HKTA 3FJPA 2LF8A 2HR3A 5GAN7 1X55A 4N9IA 2QWWA 3V8KA 5AIQA 3AHUA 1NYRA 3P9KA 3P7NA 1QBJA 3RPUA 2EB7A 1I81A 3OOPA 2E41A 3JCMJ 4M75G 1U78A 4M77B 5DV5A 1HQCA 3CO6C 2ODRD 4AIJA 4KR2A 2ZXFA 3JCMd 3CUQC 4X9DA 3Q9SA 1B6AA 3L4GB 5JR3A 4WXDA 5J6XA 1SRYA 1NJ5A 3QO7A 3I54A 3V8JA 4O2DA 2P5VA 1YW7A 1QZYA 3WE3A 4M78C 4BQAA 2PEXA 3OV8A 3E5QA 3LA2A 3M4PA 1ZRDA 2O6GE 3GF2A 2ZNYA 3RKYA 5LJ3d 2E5AA 4BWAA 4J6XA 2V9VA 4UXNA 1JXSA 4YRCA 2YSRA 4A2UA 5LEJA 5ICGA 2ZO4A 4MEXF 1P4XA 4LLNA 4ESFA 1SERA 2WV0A 5JFRA 3T0YA 1Z91A 1ZG1A 1R58A 2HQRA 3ZN0A 1B59A 3HHHA 3Q9VA 3MFKA 3ABUA 2ARSA 5LBQA 4O5VA 2M30A 3JCMf 3P9IA 4HX7A 2JPCA 1QPMA 2HTJA 4EVIA 4A0XA 1W7PB 2BV6A 3KETA 4RAYA 4M75F 1FWZA 2VC8A 5FFXA 4JLIA 4O3MA 4P75C 5CAIA 3JB9G 3FF5A 5LJ3f 3I64A 1E1OA 2E1CA 3QO5A 3ZP5A 1B9MA 4RGRA 4P72C 3E6DA 4HQEA 4RQEA 5H20A 3HSRA 2EFPA 1HC7A 3M8EA 2HKXA 5E18F 1VQZA 2XKPA 2VBZA 4I2OA 3M4QA 2RD1A 2A5YB 3TKYA 3V8LA 3RYPA 2PQ8A 4HV5A 4Q6GA 3BPXA 3QPHA 4EMKA 3RACA 3JCMc 4YFKF 2DU9A 2LF7A 4QWQA 3HXVA 1IZ1A 2ALYA 4MTEA 2O0YA 4M7DF 5L3FA 3RIRA 4TQDA 2HTSA 2MLGA 5GAMh 2F5DA 2OD5A 2P7CB 4H2VA 4EMGA 2ZZEA 3IKMB 3QPTA 1FNNA 4WWCA 3GVAA 3VU3C 2NAZA 4C8QE 1TW3A 4HBLA 1H4SA 5F64A 2HOEA 1LDKB 1QQIA 3QNEA 5HVQC 4M78E 5A2QZ 4ESJA 3KP3A 2Y48A 3DEUA 2P8TA 1OPCA 2DPUA 5D6EA 1KMMA 3LSSA 2FF4A 2VODA 1DUXC 3TO9A 3UGQA 3WGHA 1Z6RA 2F5EA 2XROA 2ARUA 2NNNA 4M7DB 5GAOm 3HFOA 1T39A 3REXA 3KEQA 1WRJA 2A61A 4WI1A 2ZR3A 1H9TA 1AWCA 2B0LA 3ROUA 3WGGA 3HRKA 2PJPA 2R7DA 4JBAA 1I1GA 1LOJA 5D6FA 2FEZA 1RI7A 3WTVC 4CS3A 1ZN2A 2FA5A 4P5OA 5FD6A 2VBWA 1O7FA 2W57A 4OINF 1FPQA 5FD5A 1O7LA 1X3UA 1U8RA 5JVTA 3QP5A 3FX3A 1YTYA 2EJFA 1FYFA 1Y96A 2CJAA 3U9GA 2JZYA 3HOSA 1Z7MA 4IXAA 5HDKA 1MJAA 4AWXB 1P92A 2RGVA 1YFRA 2CJBA 1E22A 4HA8A 1Y96B 2FSWA 3KFUA 1B70B 1S7AA 1U5TC 1FBUA 2GAUA 3HSFA 3JB9H 4L18B 3H3UA 2QBYB 3E6BA 4M75D 4C8QA 3JTGA 3RF1A 2PMEA 2K27A 5HGQA 4CDGA 4HYEA 5TRDA 4M78A 4UP7A 3WTYC 3EETA 3WE2A 3L00A 2RN7A 1I8FA 2ARTA 3CLOA 1XN7A 2FE3A 4HWSA 5BPDA 1IN7A 4BH9A 2EAYA 4PNOA 3I71A 4XTVA 4YDQA 2G4CA 2YHTA 1M8VA 1EQRA 3RYRA 1XCVA 4PJOC 3V4GA 2OQRA 3UGTA 1SFUA 4RCCA 5CVIA 3WTZA 3BROA 1LDDA 3VBBA 1D8KA 5CJ9A 2WWYA 2NRAC 2ZTGA 1EH8A 5HS7A 3P8VA 3E9HA 4OIRF 1O3QA 1H4VB 4DPGA 1QZZA 4PZJA 3A7UA 4GXOA 4WXCA 1NJ1A 3HYIA 4M7DD 2R3SA 5FLXK 5ILUA 1SETA 1D3YA 3N97A 1T98A 1KYWA 1R23A 1I5ZA 4ASNA 2Z9OA 1WLEA 1U1TA 3BOQA 3HTUA 3A5ZA 1Z9CA 2FNAA 5LHHA 2AKWA 4J6YA 1KQ2A 2XAHA 3C3WA 3HXXA 2DXUA 2QQAA 2HQNA 3MF1A 2XAFA 3JCMg 2ZT6A 1FC3A 1YFTA 1Z6TA 4P75A 3F8FA 2DQLA 2UZKA 3MF2A 1IXCA 2AKWB 2RA2A 3GIBA 4JUVA 2Q0OA 3GLXA 4YRSA 3FWEA 1KYZA 3CMQA 4YCUA 1KU7A 3ABTA 1T38A 1SESA 2K86A 3MEYA 3KZYA 2J3MA 3IG2A 1OYIA 5CVJA 3DF8A 1B8AA 3HFNA 4M7AA 1XMAA 3VFZA 2ACJA 1X56A 5LJ3g 4A5MA 1JJCB 3NEMA 4PGHA 3NEUA 2QTXA 3BPVA 3ELKA 4A0ZA 4CO8A 2QVOA 4KICA 3LWFA 4M77C 2DT5A 4YPFA 2OA4A 4G84A 1MGTA 2EFNA 3AAFA 4Y15A 4YP0A 4M7AB 1UCRA 2XAJA 1X01A 1OMIA 3PFIA 4Q48A 2FMLA 3JAMK 1K78A 4P9FA 4GYGA 4RAZA 1O3TA 5HLIA 3MEXA 2GIVA 4I09A 1TQMA 3B73A 1SD4A 1K78B 1D5VA 5E8IA 5GANj 4YRMA 2VONA 3M8FA 2JTVA 2FB7A 2XV4S 2AXLA 1PP8F 3O6BB 4YRIA 3P9CA 2UWMA 4LK1F 4NB5A 2HGCA 3RTRA 3BZ6A 4PJOE 5L3DA 1C0AA 3K0LA 3K69A 4KQEA 3MZYA 5DUKA 2RB6A 4B8XA 1ON1A 1YIOA 3S2WA 2DVEA 3L09A 1B7YB 3GW2A 4C92F 2P5LC 4XBFA 4KIBA 4RCBA 3PQKA 5LHGA 4R8HA 3WG9A 4LNSA 2Q8KA 2IA0A 2HDCA 3DKWA 4AVPA 1XGNA 5LJ3h 2DBBA 4KR3A 1K6OA 2DTRA 1YS7A 1O3RA 2D1VA 5H6RA 1WI9A 2EWNA 1SD5A 1FZPB 5GAOp 4XU0A 4LLLA 2XGTA 2FU4A 3REUA 1CF7A 2ESNA 2ZXJA 5GMKh 2E64A 1NJ2A 4C92B 2LDUA 1L0WA 3LA7A 3HXUA 2W84A 3TEGA 1ZH5A 1XSVA 4A6EA 1CF7B 5GMKm 4P3PA 1H4QA 3E6MA 4CH6A 2Z33A 3G3ZA 1BI3A 4CS4A 3ECHA 4M77E 4YRKA 4FX4A 3GUDA 1YLFA 1J5WA 1A04A 1TNTA 11ASA 4XSXF 5GANd 4BW9A 1YS6A 4BHPA 2L4MA 3WTUC 1YB3A 3A7RA 3JCMV 4GCVA 5ELNA 4YRLA 4E70A 4H2YA 1OYWA 1YQAA 3HTZA 1SMYF 2DQ0A 2EFQA 5ILVA 1HK9A 1BOAA 4YRNA 5ICEA 1TW2A 1M5Q1 3I4PA 2ZJ2A 1KQ8A 4N0AA 5E20A 2QHUA 4JK1X 5GAN5 2F5FA 1G5HA 4ZYHA 3FM5A 3FXRA 3SWNA 2ETHA 4IF4A 1GGMA 3E3VA 2QQBA 1KU3A 2DFIA 4FX0A 4G6DA 4TVYA 1ULYA 3KP2A 4R1HA 4TVAA 2BE5F 2KJBA 5ERIA 1FP1D 4R79A 3IWFA 2AMCA 1LDJA 4NQWA 3I0TA 1FYLA 2Z3YA 3SWNB 1ODDA 3SB2A 5LJ5j 1JHFA 2Z99A 2DTIA 1GHCA 5D5WB 2FNPA 4LB6B 2XVCA 4AD9A 1S29A 4ZIBA 1TTYA 2OZ6A 4PGGA 3BY6A 2M8EA 3I59B 1N9SA 1I6XA 2BEOA 2MC3A 4F7UF 4UVAA 1HW1A 3F8NA 5GANf 4LK0F 1G6NA 4C92D 4M77A 1IF1A 3D0SA 3E9IA 2Q2EA 4Q5SF 4QLCU 3DSQA 3BW1A 3WTTC 2CJ9A 1EIYB 4G85A 2ZMEB 4FHTA 2L01A 3L4GA 1ZGAA 2DQRA 1MJ9A 4H0EA 2AS5F 3HRIA 2O03A 3FIFA 4XLPF 4CGZA 1MGQA 1ZLJA 4TQFA 3RKXA 1BJAA 3K9TA 3C7JA 1U6GA 4G7ZF 1USYA 2KIMA 1JE8A 3C18A 3F22A 5HDGA 4F7UB 4C8QC 3A32A 3PQJA 3DPTA 1O3SA 2O3FA 3VQYA 1NHAA 3KP5A 4BYYA 1REPC 2E7XA 1S6LA 5E1XA 1XD7A 4EMHA 4RMFA 1PUEE 1RZ4A 1IAWA 3R4KA 4A54A 1GVJA 3ZMVA 2EJRA 2P4WA 3RPQA 3E5XA 2A6HF 4IRGA 2HFHA 1SAXA 4O6JA 4P3OA 5FGMA 4KIGA 2QM3A 4EGZA 2MH2A 2HYFA 2X0LA 3SQNA 3BJOA 2H27A 1K79A 3COAC 2RHSB 3FMSA 2VBXA 1W7PA 3ECOA 1G51A 4XEOA 1NJ8A 4P3NA 4ZTZB 3CDHA 2ZIOA 5K5QA 2FRHA 3KZZA 4V2SA 2OBPA 4YIIA 4MTDA 4OIPF 5AIPA 2BBYA 1DP7P 2HZTA 2IY5B 4IJAA 2F2EA 3ISPA 2K7LA 4UUVA 2L3DA 3I53A 5K5RA 1X2HA 1N9RA 2GXGA 4CH4A 2RM4A 4P73A 1J5YA 4EJWA 2G7HA 1Z1DA 2QHTA 4BXUA 3VODA 4BNCA 2P0LA 3QU6A 2XAGA 1LYLA 3VQVA 4RQFA 1J7KA 3F3XA 3KP7A 3HY1A 3LFKA 2HWVA 5A2QK 5LLQA 3JCMe 4M7AC 4H2TA 2RV8A 1H0MA 2JRTA 1UHWA 4ENJA 2HYGD 3HSEA 4KMUX 3WU0A 1T2KA 4CHUA 3BFMA 2CGHA 4X5OA 2EFOA 4HX4A 4MQVA 1RUOA 2P6SA 4M75B 4EJOA 5HS8A 4MNUA 5ILSA 2W25A 2J5PA 1NNHA 2K4JA 4H2SA 4IRHA 4C8QG 1HSTA 5LJ3e 4I01A 4DNCA 1F4KA 1BI0A 4M78G 4M73A 2VOPA 3QOPA 1UHMA 5KVRA 4CS2A 4LJZF 2A07F 3JCMb 2M5WA 4HLYA 2COMA 4U0WA 4M7DA 4I7HA 4HT8A 5GMKe 1D3BA 5D4RA 4MMKA 2GWRA 1LNWA
chains in the Genus database with same CATH superfamily
2QZ8A 1QP3A 5IHNA 5FRNA 2NXNB 3CCYA 2JTMA 2MFZA 1LEAA 3EH1A 4I02A 4XM3A 1J2XA 3F70A 3LWIA 3OL4A 4R55A 1WKMA 4PKCC 1G3TA 2LTOA 2JVHA 4EJVA 5E1ZB 4ON0A 3LSTA 3D5SC 5L8RE 2ELJA 3KYLA 2HEQA 4KGXB 1FOWA 3QUIA 2FVUA 4NCXA 2FQ4A 5CKFA 1QVUA 3M7GA 2K2MA 2LJ1A 4HX8A 4RB2C 1YGBA 2V4JC 2WC2A 1KU9A 1W0TA 4JX4A 3IRRA 4M78F 3TO6A 2LP5A 1KQSS 1U1SA 2VB6A 1M3BA 4J5YA 3PTAA 4B4CA 2ESHA 1XDSA 2KQRA 4QPOA 1D0XA 3K2AA 3CUOA 5LEKA 3IWZA 3CUQB 5L3GA 3GZ6A 3CC4I 2STWA 1SSFA 3ZQLA 2RNGA 2ZPBB 4ZYGA 4A3DJ 2C0TA 4YRQA 3INZA 4JJCA 2V6CA 5JHUA 5KE2A 2LSOA 2C7IA 3CCEQ 3C2HA 3SWNC 5LFAA 2VUMJ 4NL2A 4Y33A 1QF6A 5TJJA 1WGXA 2P0WA 4P71A 2RVCA 2L9NA 3VS7A 3ML6A 4Q4ZF 3I5SA 3AT1B 4CH3A 5CIUA 2JTEA 4ZGJB 1RKWA 4ESBA 2G0EA 3CCEA 3OMGA 2CGPA 5GAOr 2ZCWA 3CCLQ 5GAMd 2XGXA 4MZTA 1FYNA 1I27A 2QLZA 2CP6A 3DFGA 4HAMA 2CREA 1FYKA 3HL2A 5GAOq 3RESA 1ATIA 3MQZA 1NJIU 4OMZA 5LJ5g 5HOOA 1ETVA 3CCVQ 4Z89A 2EL9A 2LC4A 3ZXSA 2L89A 1WQ2A 3CCRQ 4XKVA 5F6FA 1MBJA 4S0HB 2DKGA 2DJZA 1LVAA 4IHSA 4C3HJ 4LDVA 2IRFG 4PJOG 4M78D 2A8EA 3CCLA 3HY0A 2QEXT 5E3LA 5C52B 3FMRA 3FIWA 1HA8A 1X1DA 4ZTJA 5D5UB 6PAXA 1VQMQ 4IURA 2XSJC 2I4NA 1IZ6A 3CCVA 1S7OA 5GAMf 3CCRA 2MD5A 2GNCA 2KKOA 1XS9A 2XASA 1WQ7A 3BCBA 1SRLA 4Y52J 2PU9B 3Q5FA 2M4GA 3IKVA 2DJIA 1USTA 5L3EA 5F1RA 1R0BG 1WSUA 1VQMA 3UDCA 4JRKA 2PI0A 3J7AF 4N9HA 1DGRM 3TOBA 1ZHFA 1U5SA 2HQAA 5IY5H 3BE3A 5F0HA 1K4TA 3ZMDA 3TO7A 2LCCA 3CCJI 5BOXA 3GWZA 4XRSG 2W85A 1K9MU 3HOTA 2F2WA 5F0FA 2O88A 4PJOF 4M75C 4LD5A 3K10A 4L6V5 3HEFA 1VQ6Q 1I0CA 1F1BB 1YFNA 5KYWB 4RB1A 3VS1A 1X4OA 4RB3C 3M4GA 3OS0A 3TBIA 4LVIA 2DQ3A 2DLLA 2L3RA 3PSIA 1BBYA 2CUDA 4OB2B 5DLOA 1TQPA 5DCMB 2LTPA 5E3MA 4W97A 2AZVA 4X34A 3HOZJ 1IN8A 3L2ZA 1NG7A 2VE9A 2VXDA 4HG2A 1VQ6A 4BE2A 3DP7A 1J59A 4LUEA 1ETQA 2IGOA 1P4AA 2W48A 1QHHD 1ZKGA 4CCLA 4U7BA 5DS9A 4BEHA 4ZYAA 1R00A 1XNIA 3HOYJ 1CQTA 1YITQ 4YELA 4XEMA 3JB9I 4MHGA 4KT5C 1F5TA 1QU3A 4F7UA 1JJ2A 2GTOA 3RKQA 2IGNA 4NBQA 4XONA 1IREB 1BIAA 3KE2A 4HWPA 3FKJA 2FPEA 1WLPB 2NS0A 1R1UA 4M71A 3LAPA 2D1HA 3Q3SA 3R6SA 4ENNA 4Y92A 4ZGEB 3FXQA 3JREA 1YITA 3ZMTA 2KISA 1FIAA 2RJDA 3VEPA 4M3FA 2E2JJ 2X1EA 4PJOD 2KT0A 2YWWA 3NELA 3FBIB 2FYKA 2EQMA 2LY2A 2Y9ZA 5FO5A 2OTJI 2OTLI 2NUZA 1Q1HA 3TP3A 3UPUA 2MG4A 3HIFA 2BOLA 2AO9A 3G4SI 1FOYA 5CKTA 3NENA 5LGUA 2ZT8A 1LPQA 1IXDA 1IL2A 4NOYA 3FB9A 4M7DE 1YCSB 2RQRA 1Q86U 5KYYB 1MIJA 1P4WA 1TNSA 3BR1A 4UVCA 2DOFA 1A5JA 3G1OA 4GGGA 3A8GB 1YG2A 3HFVA 3META 1C0WA 5GMKi 3IH4A 3SFIA 3LC0A 1RIQA 2MMPA 2IPQX 3REOA 2XK0A 1WYDA 2R7WA 3HHGA 2EQJA 3NPFA 3I58A 4EGYA 3MEAA 2E35A 2B9SA 3WQZA 3RL6A 3V7RA 2RH2A 1U3OA 3KYDB 2J06A 2K85A 4HLXA 2PJRB 2YUNA 4GO1A 4I0AA 4RTWA 3SFZA 1SC7A 3I55T 2DBMA 1TUDA 3N4MA 2JSCA 2KDOA 4P74C 4M6XA 4M9ZA 1IW7F 1ZAOA 4MDWA 4H4KC 1GBQA 1OZ3A 3RERA 2O2OA 3JSOA 5FKLA 3GFMA 4MEYF 5LJ5e 1RESA 1FBSA 2RI3A 4A3FJ 5GAEJ 4LVKA 3BWGA 2XUBA 1X43A 2ZPIB 3DTKA 3K70D 4UNOA 2OPTA 4L0ZB 1IUFA 4MIMA 1Y71A 3JSCA 3ZFJA 1W7PD 4L5JA 2A0FB 2XI9A 2RNAA 3E1SA 3VYSB 3TDUC 2DXBA 2PVOB 3WU1B 1IXSB 4L9JA 2OQGA 1KHIA 1X27A 5FKKA 1ZARA 4A6DA 5HDNA 3OW2P 2PVDB 1ARKA 3KX2A 1EVKA 3ZQ7A 1D1BA 1X2GA 3VQXA 6AT1B 1VQNT 3URGA 1XCBA 3CUQA 2X9HA 3QJYA 3I9V2 1TL8A 2X4YA 2QTVA 4ZH4F 2HXIA 3IRQA 1EVLA 2MD0A 3M3YJ 3QWYA 4G94A 1ADJA 2CQQA 4C8QB 3S32A 5J4YA 2CZ7B 2DIQA 2LNVA 2ZJRF 3RKWA 4FW1A 4E51A 1JUSA 2RJEA 4M4ZA 1Q7YR 7AT1B 1OR7A 3TVTA 1S8NA 4WJ4A 1RETA 3JB9J 3UH0A 3M53A 2RK1A 1VQ8Q 1BBWA 3GFIA 3JRGA 5K7HA 3PGGA 4PSXA 2WTEA 1E3PA 1LQ1A 3ZN1A 4HT4A 1QP2A 3RGLA 2DFEA 1AWWA 3BT9A 1OFCX 3CC2T 5CVVA 1UE9A 1U0JA 4A4KA 4LE9A 1KFZA 3MP8A 1HTTA 2CT3A 3EG3A 1P2FA 2YX4A 3F21A 1VQ8A 2L3PA 3SXYA 1HKSA 2WBMA 4ANJA 1OKRA 2CUZA 4B1RA 3I9QA 2VGMA 1VUBA 2H8HA 4YREA 5DD8A 2VXEA 1QWFA 3SHFA 4YYEA 5J3LA 3VWBA 3E0JB 2BGCA 4C8QD 2K02A 1VQ5T 4CYCB 2YU3A 3Q0UA 2JPBA 3PIOF 4ZJZA 3V7SA 1IN5A 3QYFA 1NEGA 4WCIA 2V9KA 3FHNA 4AFUC 1YFHA 2HNIA 1OI1A 4XU2A 3C95A 3JRDA 3ZMZA 1O57A 5CKEA 4OVAA 2JM9A 2EJGA 2LC2A 3CPFA 1NJ6A 1PC0A 2FBHA 3KCCA 1K4SA 2IW5A 3H5RA 2F4OB 1EFNA 2EPFA 5I2MA 3QAHA 2VVKA 2R93J 2UXNA 2XDBA 1TP4A 4XLNF 3CDIA 1TS9A 1S9HA 4S04A 4MGRA 2CYZB 1AEYA 3K4MA 2DD4A 3EAEA 2QYOA 2HYJA 5CVUA 1B4AA 2MLKA 4BAYA 4MLOA 2PUKB 2I4OA 2GQQA 1HLVA 1GVDA 5KYWA 3P8BB 4RMNA 4MQ9F 5KHDA 2ISZA 3R6NA 4CICA 1JRIA 3OMYA 3GX4X 4RTXA 5DCMA 12ASA 1X2QA 5FRMA 3W6VA 4PJOA 1DU6A 1MBEA 3X20B 4IUUA 3UT1A 4K87A 4HNUA 1FMWA 1WJ5A 2XTIA 2BZ8A 3DKMA 2NVQJ 3W3SA 2KK4A 1OX9A 3T8TA 2R7FA 2KXDA 2DOAA 1XJWB 3W6JB 2KIFA 4A12A 2RQQA 1OX8A 1S72Q 1GXPA 2A68F 4JJNK 1L3LA 4EM1A 1YCYA 2XHCA 2EZLA 1RLPC 2P5KA 3E19A 4HOBA 1X1CA 1AHJB 1JJ2S 1UB9A 2KJCA 3J7YJ 2IT0A 1G5IA 4TVAB 1PP7U 3OW2A 3ZBDA 3LA3A 1HYOA 2HR3A 5FKMA 1X55A 3V8KA 3M0UA 3P7NA 4NDLA 1QBJA 2J6FA 3U21A 1R4MB 1U78A 4M77B 1ZHIA 2Q2EB 3CO6C 4AIJA 3JCUC 3M55A 4X9DA 2E5KA 4DA4A 1QKWA 2VJ4A 5EG2A 1YWOA 2OJED 5GJVB 1OQYA 2DA1A 1NJ5A 3QO7A 3SEQA 4O2DA 3CJQB 2AIRB 1QZYA 5CQEA 3WE3A 2PEXA 3TEEA 3M0TA 1VQ7I 2QSFX 3M8JA 1YX3A 5LJ3d 4BI8B 4BWAA 1SVLA 2V9VA 1SVOA 5KYYA 1BW5A 4YRCA 2YSRA 5ICGA 3AKZA 3VDXA 2ZO4A 1P4XA 4LLNA 2HAXA 2GOXB 4P5NA 4RA2A 3T0YA 1Z91A 1H8AC 2QEXQ 5EG0B 2VQLA 1M1EB 4OB0B 4BY1J 1OU9A 3OA6A 2DT6A 3P9IA 4HX7A 5M9OA 1OU8A 4A0XA 1ITYA 4RAYA 4B43A 3CC7T 2XF7A 5J40A 4IZZA 5CAIA 3JB9G 2ECBA 2EQKA 2QEXA 5LJ3f 4FYXB 4OMLA 4RGRA 4RQEA 2M4KA 5AT1B 2WADA 1VQZA 2XG8D 4ELZC 4I2OA 2CUEA 3TKYA 1DGWY 3RYPA 2PQ8A 2E60A 4L59A 2JVGA 3PNTA 3JRFA 2X4WA 2BW3A 4ZDPA 4YFKF 3HOXJ 1JT0A 2E1MC 2AKLA 4MTEA 4LDWA 1NLPC 5KH6A 4R0KA 5L3FA 4TQDA 2HTSA 1VQ9T 2OD5A 2P7CB 1AKHB 4AT1B 1G59A 1X3ZB 3QPTA 4OGCA 3GVAA 1ORKA 1TW3A 2CDTA 1QQIA 1JUPA 3QNEA 5J3BA 4M78E 4ESJA 3KP3A 2Y48A 5D6EA 1IGNA 4JRQA 2YSQA 1DUXC 1Z6RA 4CCKA 2XROA 1D09B 3REXA 3KEQA 2LKSA 2XC7A 2QSGX 4WI1A 3TP0A 2LRQA 1AWCA 2EZIA 3WGGA 2LYCA 4XKBA 4JBAA 3TQ7P 1D0YA 1IO2A 1MHNA 1ZN2A 4P5OA 1O7FA 3GTGJ 4EPCA 1UELB 3K4LA 2CQXA 2GTJA 2M0OA 1YTYA 2JUFA 1Z7MA 3HOSA 4IXAA 3PNWC 2VKEA 3HZJA 2HU9A 1YFRA 2EW3A 3BTIA 2XGEA 3TREA 1U5TC 1FBUA 3U23A 3H3UA 4C8QA 3RF1A 1C1AA 3HPHA 4HYEA 3PFSA 3EETA 4E7ZA 1GFDA 2QA4T 2ARTA 3CLOA 4A3MJ 5BPDA 1IN7A 4BH9A 1WPKA 3S16J 1UUEA 1VQPI 3MMYB 4XLAA 1XCVA 3V4GA 3L2UA 2OQRA 1SFUA 3WTZA 3BROA 3ULRB 2O8KA 1D8KA 5CJ9A 5A0GA 2NRAC 2XDPA 2ZTGA 2KRNA 3P8VA 2EIMH 3S1NJ 1H4VB 2HDWA 4LN2A 1JKPC 5FLXK 1T98A 1KYWA 1WLEA 1Z7LA 3BOQA 3HTUA 1Z9CA 2VYTA 2FNAA 5KAIC 5LHHA 1X3WB 2AKWA 1WDXA 2XAHA 3GZNB 3JCMg 4P75A 2UZKA 3LSRA 1OV3A 3MJXA 1IXCA 5KYNA 4F55A 2RA2A 3VYHB 4YRSA 2CP3A 3FWEA 3CMQA 1SESA 1N8RC 4E6KG 5CVJA 3DF8A 1B8AA 3HFNA 4FSXA 1LCKA 1XMAA 1B72A 2TRTA 1JJCB 4HCZA 3MKYB 2HSPA 2QTXA 4AG1C 4CO8A 3V42A 2QVOA 4A69C 3O5ZA 1GCQC 4CYCA 4G84A 2DL7A 4M7AB 3CCUQ 1UCRA 1X01A 3ESWB 1OMIA 3PFIA 5EDNA 3CD6Q 3A03A 3JAMK 1K78A 1GUUA 3RCOA 3OSFA 1NM7A 2R5YB 4BY6C 3RBBB 2F2VA 2FB7A 5H2FC 3P9CA 1YJ9Q 1DU0A 4OWRB 4OMPA 1Y0NA 5KCMA 3CCUA 2NYSA 4PJOE 4ZN1A 3CD6A 3G2BA 4BJTA 3PIOA 1W0UA 3EGUA 4DZPA 1ON1A 1YIOA 4C92F 4RCBA 2HDCA 3I56T 4AVPA 1YJ9A 1XGNA 4M3GA 5LJ3h 2DYIA 3P8DA 1YS7A 2D1VA 1KHCA 2EWNA 5GAOp 1SD5A 1Q7YU 3RZOJ 2MAMA 2XGTA 4L5GA 2JA8J 1W1FA 4C92B 2LDUA 3LA7A 2LR8A 1QZEA 2Q1ZB 5M5YJ 5GTHC 1NLOC 3L2QA 2EIFA 1G83A 1J5WA 5J47A 4F52A 5IH2A 11ASA 2Y31A 3WHCA 1PCXA 3WTUC 1YB3A 5ELNA 3JCMV 5FLMJ 4F16A 4PJ0C 3A8HB 4YRLA 2KRSA 4F93B 1YQAA 3CCMI 2DQ0A 3OL3A 2EFQA 1HK9A 1TW2A 2QHUA 2JUCA 1G5HA 4ZYHA 4LD6A 4Y3OA 1GGMA 3BTLA 1KU3A 2DFIA 2NOGA 4TVYA 3KP2A 4TVAA 2BE5F 3A0HC 4LG3A 4WTOB 1OISA 3SWNB 2ZC2A 1V55H 5LJ5j 1JHFA 1GHCA 2LVSA 4AD9A 1BR2A 1S29A 4DOWA 4NQWB 2OZ6A 4PGGA 3BY6A 2RHIA 1N9SA 1MH4A 2BEOA 2MC3A 4UVAA 3F8NA 4LK0F 4C92D 4M77A 1IF1A 3D0SA 1UJ8A 2Q2EA 3E9IA 1WFWA 3IQLA 2COYA 1TWCJ 4HNTA 1EIYB 2L01A 2BZXA 4H0EA 3HRIA 2O03A 4XLPF 1Z3YA 4QSHA 2QXFA 3RKXA 3EUAA 1TSFA 2DILA 3QPLA 3C7JA 3GLLA 5CKHA 1U6GA 1QWEA 1USYA 1PJRA 3F22A 4BI4A 2A5WA 3A32A 3DPTA 3VQYA 3GPLA 5CQGA 4BYYA 2CH4A 3HOUJ 4KULA 4RMFA 1PUEE 1QVPA 1ACIA 3DWLE 3CC2A 4Z8AA 4C0GA 3BG3A 2A6HF 1SAXA 5EG0A 5A0DA 4P3OA 2RI2A 4KIGA 1BOBA 3N05A 2QM3A 2YT6A 3CCQI 2MH2A 2HYFA 4B3XA 4QIWN 2H27A 5GAGJ 1K79A 2XDDA 1ZTRA 4J19A 4QT7A 2M0CA 4IHYA 1NJ8A 4P3NA 2KP6A 2DF6A 2M0YA 2ZIOA 2WSFE 3CMEQ 2KGTA 1DP7P 2IY5B 2TCTA 3FXMA 4CH4A 4P73A 4LITA 3QWLA 4UB8C 4BXUA 3VODA 1WH7A 2P0LA 1MSEC 3QU6A 2XAGA 1SPKA 2IGMA 4EIKA 2DMTA 3KP7A 4M3BA 3HY1A 2WACA 2HWVA 3CMEA 2CRGA 3JCMe 2A08A 3S14J 2RK2A 1XTDA 3X26B 1UHWA 4ENJA 2F5VA 2F4IA 4KMUX 2AT1B 2VASA 1T2KA 1OCTC 1AKHA 2EFOA 2P6SA 4M75B 4EJOA 1ZUUA 2J5PA 2HDDA 1BBZA 1RAHB 5KCOA 4H2SA 3VYTB 4I01A 2WY8Q 5M5XJ 2W00A 2VOPA 5KVRA 4MZPA 2COMA 4U0WA 1D3BA 3BG6A 5D4RA 2NUTB 2GWRA 1WXBA 1DP3A 1MMDA 4CRIA 3CJNA 1T3SA 4HWTA 3O2PE 3OD1A 5CLSA 4UC4A 1EOVA 1S1NA 2IVMA 3KLOA 3EYIA 3CCRI 2XGCA 4RLQA 3GFLA 1T0FC 1ZR4A 2L4AA 1ZUYA 1QVGA 4V2FA 3LFUA 4B47A 2ROLA 4YFNF 3NARA 1WQWA 1ZR2A 2DI3A 1YHQQ 5GMKl 3I7FA 1AWOA 1UHFA 1ZK8A 4IVNA 1JQQA 3QBYA 4FISA 1IXRC 2VKHA 1CGPA 1E24A 1WGSA 3TEHB 2V1UA 1WJQA 1RPWA 3V7CA 5IT9E 5L3CA 5GAOn 3LMMA 2DU7A 2FOKA 1YHQA 5IT9Z 4CC7A 4R56A 2OU2A 4FM4B 1ZELA 2Q7GA 1N6AA 1GV5A 2LJ3A 2YRCA 3QJ6A 1IN6A 1XSXA 1VTNC 3EGDB 5GAN3 2M7BA 3L9FA 3FK6A 4N0AC 2ZAEA 3KEOA 2MOXA 5ELOA 1Q82R 4ZZLA 2I4LA 2PMZA 4XMYA 1P6RA 1ZA1B 4JP0A 2MWOA 1VQ6I 1DPRA 3IKTA 1PRMC 3K1NA 2A6TA 2EYXA 1JJCA 2X3WD 3UR3C 2EGEA 4J8OA 1R6RA 5LRSA 4E7HA 5IXFA 1XDUA 4IEJA 1VF9A 4Q15A 3M1EA 4EV0A 1Y0UA 2ID3A 5J26A 2NWMA 3CTAA 1VQKQ 1B34B 2ZNJA 1B7TA 2Z1DA 5M3FJ 1U3EM 3T1BA 3BR6A 3OYYA 2I2LA 1X2MA 1OQKA 3O3KA 5KNNA 1MD0A 1XX5A 1EJ9A 3CCJT 5DUIA 3DBLB 3T9NA 4E7IA 1KU2A 1EIFA 1PYSB 2KZVA 1UJ0A 5KK1A 4Y13A 1YX5A 1YITI 2LFBA 2KEAA 3NETA 2WAQA 1NK3P 2H6CA 1VQOI 3QQAA 2KROA 3DEWA 1BKBA 2H94A 5F1JA 3RDVA 4UHTA 2RF0A 5LGNA 2DTOA 2J7IA 1ZGWA 4L5IA 2CUJA 1BC8C 3UKGA 2KXCA 5DD4A 4C92A 2DTZA 4N4OB 2E3CA 2ECCA 1B8IB 2H1LA 2HQHA 2D45A 1UTIA 1PSFA 2R7ZJ 2XDVA 4LNPA 4CCOA 2XKOC 1IV6A 4FT4A 1BBUA 1NPRA 4OU0A 1J9IA 3KP4A 2XF6A 3M9QA 4F17A 3GOXA 1FTTA 2ADUA 3BLYA 3CF5F 1MBFA 4XRFA 1FLIA 1MNMC 1ZG5A 2VOOA 5DCFA 3UA7A 1XMKA 3IALA 4EX5A 2YX7A 3G71T 3LAJA 5E3OA 4IRIA 1CSKA 5EEHA 3VUZA 3QIIA 4J7IA 5AONA 1MJBA 2IP2A 4M7DC 3PCOB 2K9QA 2W4SA 1BN5A 1AHDP 1KQSP 2LX9A 1VIFA 4V19K 1JJ6C 3M5AA 1QRYA 2OTJT 2OTLT 3J80E 3MZHA 1K0XA 4HW0A 3SZPA 1ZGJA 3A1PA 3J80Z 3G4ST 3JCMX 5KYUB 1EIYA 2M7AA 4J9FA 1YRNB 1K9AA 3RUXA 1UAAA 4NS5A 2K3XA 4DYCA 5L23A 2LKXA 2PG4A 2O31A 1DJ7B 2QGFB 2VC0A 1WJDA 3H92A 1NPPA 1WH5A 4GDFA 5C3EJ 1I4K1 2V1DA 1U8BA 1MDMA 3VQWA 1YYVA 1R5HA 2BKDN 4UV9A 2L7FP 1FSHA 1OYYA 3CBPA 2DDZA 4PDKA 1SFXA 2FXAA 1FT9A 4ZTUB 1FIPA 4C3JJ 4QQDA 3FXOA 5GAN2 2XICA 2YXYA 1X4PA 5FKNA 2KVQG 2HBWA 3SFMA 5J8FA 2KI7A 2VXZA 2XPUA 3EGXA 1T56A 2EA2A 3OIPA 2X35A 2DEQA 4UB6C 1FOKA 1H8KA 4IUTA 2ID6A 3HKZN 3WODF 2BIVA 2G3RA 2KMUA 4BKXA 3VB2A 4LFUA 3IH2A 4M7DG 5GAMg 5LJ5d 2IY5A 1RAEB 3H9GA 1YI2I 1KC8C 1R0CB 1TH7A 1M1FA 1OCRH 2V26A 2OC6A 4BGDA 1UEBA 1X58A 1IRFA 4JX6A 2ZCFB 2QENA 1ZRCA 1TTHB 1WU7A 4HVCA 1Y57A 4P71C 2ED1A 5K7ZA 2J6OA 1HD3A 3A8MB 2OAWA 3BG9A 2VN2A 2IJLA 4ME7A 1AOYA 4M75A 1UGSB 4K2EA 1GXQA 9ANTA 1QGPA 5FLVA 1LJOA 3BY7A 1QVTA 4LVLA 4XIDA 1QE0A 1EH7A 2L7KA 5HLHA 5LJ5f 2LP0A 4BBRJ 3MEWA 4NC8A 4RTUA 4HZFA 1FYMA 2CQ7A 3CMAQ 4HF1A 2BHYA 4BY7J 3M0RA 3I4MJ 3T8RA 2NUTA 4IOCF 2XD0A 4F04B 3IKLA 2ICWG 1WHGA 2VT2A 2XIDA 3E2UA 2O61A 3RI4A 4G9YA 4UV8A 1LNXA 3QO8A 4U0YA 1RIOH 2OX7A 2QDYB 2X51A 2KL4A 5B3SH 4CZZA 2MW8A 4U0VA 4K88A 2MSYA 4BUGA 1Q81R 1RI0A 3FHZA 2Y4YA 1IJWC 1QVGS 5IN1A 4RTVA 4C0DC 5F0CA 4KYWA 4YRRA 1JKOC 1KA8A 1T08B 3EUHA 3HRSA 2O5RA 5E1WA 4BE0A 3TMOA 4RM2A 3U2RA 1SRMA 1OCPA 2Y90A 2YRDA 1XOVA 3LW5E 3DLLF 1QVFA 4I76A 4YROA 4X1EA 1LFPA 1SMTA 4EJTA 3TEHA 3EFRA 1O75A 1T6SA 4KIFA 5BS6A 2ZT5A 2C6YA 4BHBA 5D5XB 1VQ4I 2K5FA 1YW9A 2VE8A 3TSWA 3HSBA 1V5GA 3GFJA 2E7WA 1X6GA 2KLOA 5DM6F 3HRUA 1WCMJ 2EQUA 4C2UA 3I3LA 2QKMB 3KFWX 3OYNA 5KAFC 2H3EB 1KQSA 3GTLJ 4HWRA 4WXHA 4XR6A 3A5YA 1WZ2A 3J7AO 1OCCH 3HKZA 5J1UA 3OSSC 2D0QB 4DW6A 2PTKA 2LQ8A 2K9SA 4FT2A 4IHXA 2XAQA 2RN8A 2EFWA 3DKXA 1M90C 2O7OA 1PM3A 2ZBKA 2W10A 3NFCA 3QP6A 5I11A 4Y17A 3A5ZB 3A7AA 4M9XA 4L5EA 2JT1A 4TWAA 4FYVB 4WK8F 1KD1R 4JOMA 3CBOA 2HSEB 5EF6A 3QWXX 2XAUA 3B02A 2WSCE 2KE9A 1R77A 4CXFA 2M87A 2VUBA 5C51B 3G1LA 4C92E 4YRVA 3TU4K 4AH6A 1S72I 1PYSA 2V8IA 4Y91A 3IUOA 2IPOB 5FWCA 4KN7X 3LH0A 3G6EQ 2HS5A 3F6VA 2UV1A 1DDNA 1WHJA 2YPRA 3EYYA 4RS8A 2FOWA 3TUPA 2HEOA 4N4IA 2DAOA 4XTXA 1JGSA 3JR9A 4XU3A 1H4TA 3IAS2 4BJ5C 5IP7J 1O4XA 2K2VA 3X2QH 2O4XB 3PFYA 3C0CA 3G6EA 3VOEA 2ZNZA 2YLCA 1PYVA 3M59A 2XPWA 1KQ9A 3HXLA 4JQFA 1OULA 4IUVA 1W5SA 2I4MA 3CC4Q 4BACA 4HF0A 3TCJA 5GAMe 4HCKA 4AMCA 1TLHB 1K73C 3HJEA 1RUNA 2A7YA 1X1AA 4XTYA 2MBFA 2EYYA 5LJ5h 1R5ID 1SD7A 1Q82U 4KT0E 2DTHA 4ZYEA 3ICAA 2STTA 2ISYA 3OS5A 1KIKA 2FRWA 5CPRB 1QA6A 1UFMA 2M2EA 4F7UG 2V79A 3RDIA 5K7FA 3CC4A 1V3FA 1I50J 4K86A 1A0NB 2I5UA 4RTZA 1TWAJ 5B1AH 5J1RA 3ZOBA 1JXOA 2CIMA 3PCOA 4H2XA 2BY0A 4RAGA 5FKOA 4EMKC 4A0YA 3OR1C 4HWOA 3S93A 2HXOA 3MWMA 1OOTA 1V5FA 4AFSC 1K4US 4LDUA 1ASZA 2DK3A 4VUBA 1VQ7T 3X24B 2CW0F 3CP8A 1XB4A 4C5IA 2NYXA 4S05A 4J15A 1E0EA 3F8BA 3K7AJ 1PNJA 5CO7A 2X48A 4Z02A 2Z0WA 3F6OA 1JO8A 5B1BH 1WPYA 2ZGWA 2M45A 3E5UA 4RB0A 4U87A 3SDGA 2DXCA 2GXAA 3SYTA 5AIQA 4AVZA 3GNGA 4XNFA 1NYRA 2E3HA 3P9KA 4KGZB 3RPUA 5FU6C 2E41A 1AWXA 2I10A 2YRVA 3P5JA 1P7IA 5DV5A 2ODRD 4KR2A 1SANA 4J9HA 3CUQC 3Q9SA 2M9HA 3L4GB 2DRMA 3Q0WA 5JR3A 1K83J 1UGRB 1SRYA 3I54A 3V8JA 4KRTA 2K5IA 3M4OJ 4M78C 2HKNA 2LT4A 3LA2A 3HB9A 2PUOB 1IHWA 5TISC 1WHHA 1PUFB 2BHZA 4A2UA 2ZXWH 3EUKL 4DIQA 1MV3A 4OF1A 1OR7C 3H9NA 2O9VA 3ZN0A 2LK2A 2ARSA 3O8VA 1QCOA 1BW6A 2JPCA 3DBHB 1QPMA 2X6OA 2GBQA 2QAZA 3BC8A 3OSVA 1W70A 4HKEA 1YOVB 4D5CA 3BCAA 2D8JA 3LSIA 5FFXA 4O3MA 4IIOA 1X1PA 3JRCA 5EYRA 2LX7A 1B9MA 1M8MA 5H20A 3HSRA 4J9IA 3M8EA 3AG2H 5EC7A 4GLKA 4RDUA 2MWPA 3M4QA 2JMAA 2RD1A 1M30A 2GOMA 2MGQA 2CFOA 4PJLA 1ETYA 2JN6A 1UDLA 3DU5A 2LF7A 2O0YA 2B7EA 1HOMA 3HPGA 4B44A 4H2VA 3IKMB 1FNNA 2E3IA 3VU3C 1YBYA 2IG0A 1UB4A 4HBLA 2A37A 2DLPA 5F64A 2HOEA 2D1XA 1TWHJ 5A2QZ 1UG2A 1N5ZA 3SZGA 3DEUA 2V9PA 2P8TA 1OPCA 5CR2A 1VQPT 2K9NA 3WGHA 3DTIA 3M0PA 3HFOA 3C12A 4PJNA 3CD6I 1QVFS 2KQWA 3K4JA 4XOTA 2DDAA 3RNJA 4X6AJ 2PJPA 5D6FA 2FEZA 2FA5A 2VBWA 3H35A 3BQZA 1YJ9I 1K8AR 4E2FB 3FX3A 2EJFA 4JYKA 2F1LA 4LUDA 1RKTA 3L2VA 1OCOH 2OCEA 3DLLA 4HA8A 1Y96B 1B70B 2QBYB 3E6BA 4Z6YA 3JTGA 2ZJPF 1W1WE 5HGQA 4CDGA 2CW8A 3K4CA 5FU7B 3WTYC 3L00A 1JJ2P 3DU6A 1WJAA 3MVPA 1XN7A 2OTLA 3OYCA 3VKIA 3G4SA 2G4CA 2YHTA 1M8VA 4PJOC 5KYXB 3A2KA 3OS1A 2CZ6B 2EKHA 3UGTA 4RCCA 2H3JA 1SG5A 2WWYA 3HTRA 4M3EA 3OYHA 1EH8A 5HS7A 3H41A 4BBSJ 1QZZA 2ZPEB 3HYIA 2COWA 4JJBA 1SETA 1D3YA 3N97A 2GFAA 1I5ZA 1HC8A 1U1TA 3A5ZA 2F6CA 3S1QJ 4J6YA 1HDPA 1KQ2A 3C3WA 2DXUA 2QQAA 2HQNA 2XAFA 2ZT6A 1Z6TA 1YJWQ 2Q0OA 1KYZA 3ABTA 1T38A 4D1QA 2LREA 1Q81U 4HVUA 3MEYA 3IG2A 2ZXHA 3LSGA 2F5KA 3VFZA 5IOZA 1X56A 5LJ3g 3OIOA 4D9JA 1D0ZA 2DT5A 4YPFA 4B9WA 1MGTA 2EFNA 2XAJA 1YJWA 1YJNT 3VS0A 2FMLA 4P9FA 2MABA 2RMOA 5D6XA 1O3TA 2GLOA 2O4XA 3M07A 4I09A 2Z2SB 1TQMA 3B73A 4PLLA 2QDLA 4FSSA 1N27A 1I07A 5E8IA 2XV4S 1PP8F 3O6BB 2E71A 3RMSA 4LK1F 4NB5A 4D8KA 3RTRA 3BZ6A 3G1MA 4CH7A 1LFUP 2ZZDA 4A93J 1RABB 1KG1A 1C0AA 3K0LA 3K69A 1ZBXA 5DUKA 3QZ9B 2VLAA 4F14A 4B8XA 3S2WA 3JV3A 3K70C 4CCNA 3GW2A 2R7SA 4A4FA 2P5LC 3CCMT 2HKQB 5LHGA 2IA0A 2K5CA 1VQLQ 4XLFA 1O9SA 3DKWA 3W2AA 2MF2A 5CCAA 2DTRA 1O3RA 2K9MA 1GDTA 3OYBA 2E5ZA 1CF7A 1WHMA 3HOVJ 2COZA 5GMKh 2E64A 2GFUA 3B6AA 2HL5C 2L7ZA 2O9LA 2DJQA 5E79C 3TEGA 1XSVA 1VQLA 3FISA 3KXTA 4A6EA 4P3PA 3GP8A 3E6MA 3I4NJ 4CH6A 3G3ZA 3ZQHA 3SD4A 4F92B 3QZ5B 4YRKA 3DCFA 2NUPB 4FX4A 3GUDA 1KD1U 3FDYA 2WY7Q 1TNTA 4XSXF 5GANd 4BW9A 4ESRA 2L4MA 3A7RA 4GCVA 2PNIA 5ILVA 2FHDA 1WHUA 5ICEA 1AZEA 5GAN5 1VI0A 2DPPB 4AUXA 3AG3H 3CXCS 3FXRA 2JK3A 2QQBA 1ULYA 2ROTA 2KJBA 4R79A 2JSPA 3H0IA 2Z99A 4FE7A 5CK9A 5D5WB 2RHUA 2OUMA 2XVCA 3CCQT 1TT5B 2KNBB 4D6WA 2M8EA 3I59B 2HVSA 1I39A 1W36D 1HW1A 3WU2C 5GANf 1GCQA 2DETA 2L9SA 1BU1A 3WTTC 4G85A 3FEOA 1RAFB 3QDFA 2ZMEB 3L4GA 2DODA 1MJ9A 2BXZA 2CV0A 5JLWA 1ZLJA 4TQFA 2AHJB 1BJAA 3K9TA 2ZPHB 3ZL7C 1VIEA 2KIMA 4D7NA 2R7TA 3WVEB 4C8QC 1Y7XA 1O3SA 3G71I 2I0NA 3KIOA 1PUFA 1ZBJA 3CCET 2IS2A 2E7XA 1S6LA 2L2PA 1QW1A 5E1XA 1XD7A 3MP1A 4EMHA 3K4KA 4A54A 2DA6A 2EJRA 3GTMJ 3HKSA 4N4HA 3RPQA 3E5XA 1YHQI 1QLYA 4O6JA 1MBGA 4EGZA 3SQNA 5HY6A 4KGVB 3COAC 3FMSA 2VBXA 3ECOA 1G51A 4ZTZB 5GPCA 3KZZA 3HBLA 2XB0X 3LL7A 4ZTFA 3H5NA 4FIBA 4YIIA 2X4JA 4OIPF 3D1NI 2BBYA 3PUFA 2E2IJ 4Z88A 1Y6IA 2HZTA 2F2EA 3ISPA 2K7LA 2L3DA 1J5YA 1ZUKA 4BNCA 3CCRT 4BQQA 3PNYA 3THKA 3HC7A 4H2TA 2RV8A 2DA9A 1H0MA 2ZB9A 1R49A 1TU0B 4PLIA 2CZ1B 4CHUA 2CGHA 4X5OA 1T3LA 4HX4A 1RUOA 3IH3A 5ILSA 3ZR8X 1PHTA 4ORZA 2K9LA 2R7QA 3X28B 1NNHA 1UG1A 1K1ZA 2K4JA 1SFOJ 4IRHA 4C8QG 5LJ3e 1F4KA 2FJ1A 1NH3A 1NJIC 3JCMb 2M5WA 1JKRC 4DGWB 4HLYA 2R5AA 2CP5A 1PD0A 1T8IA 4XRMA 5EGOB 2DVJA 1VQKI 2R5ZB 4HQMA 1QKXA 1PWTA 4LG0B 1OEBA 2DFUA 1ETKA 1IHVA 1VOMA 2ZJQF 3L42A 3QHSA 5LD2C 1QHGA 4H2UA 5L3BA 1XPXA 2EV0A 2EINH 3UATA 4G8XA 3G7ZA 1UG0A 4HVVA 3EQLF 1JUMA 4OP0A 1B70A 2OJ2A 3QRFF 2QBYA 3P8TA 1IRXA 1VQ6T 1X1BA 2FEIA 1SHGA 2ENMA 4QVCA 5D7UA 2HL3A 4C8QF 5HNHA 3ZMUA 2E5QA 5GAMj 3OY9A 4J01A 1SAUA 4JDSA 1OPKA 3J81E 3VRYA 4OAZA 5KYXA 1ZLKA 1VQ7A 3EDPA 3PT9A 3J81Z 2DL8A 1W2BS 1K9MC 3ZPLA 2O9SA 1D1AA 1XG1A 2OI3A 3LNQA 4NNJA 1NYQA 3PM1A 2E10A 3JSPA 2L0AA 2ELHA 1K7AA 4Y4RA 3HPWA 5HKCA 2DK5A 2E5NA 3G73A 1M1KC 2QK0A 1LKXA 2CUBA 2J5OA 3KYCB 3WTWC 2EQRA 4BUPA 1Z77A 3LGFA 4XAXB 1YITT 1IDZA 4A3EJ 4HV6A 5GANh 1P9QC 2ZCEA 3EG0A 5I21A 1TBXA 3A8OB 2PZ1A 1E6GA 1ON2A 1VQOT 4YCWA 3PVQA 4D0PA 4ENKA 3ERMA 4RM3A 1Z0XA 3KP6A 2MC4A 4KMFA 2H8RA 3H8ZA 5DYMA 3RJPA 5KNLA 4LOCA 1DPUA 2X85A 4IUPA 2BUDA 1USSA 2OZUA 4U88A 3DB4A 2CQNA 2EK5A 2M3AA 4RGUA 4YG2F 2LZ6B 1HKQA 1WWXA 3VYUB 1V4RA 2YUPA 4IHVA 5HLGA 1SHFA 2LKPA 3E97A 3PJRA 2P84A 3A02A 1USYC 4YIFA 2GA2A 2PMUA 3DTEA 1K8AU 2FQ3A 1K61A 1HW5A 2XIGA 3R60A 4DQ2A 1BI1A 4HDUA 5IHKA 3JCMh 1GXIE 2F5TX 4OMQA 5HODA 3MZ8A 2KIUA 4DEXA 2VBYA 2KYBA 1T0FA 2GCXA 4PHCA 4C0DB 2YS9A 4A5NA 3HTSB 2HMAA 4ZN3A 3ABKH 2GGRA 2XHKA 1VQPQ 5F5WA 3HDDA 2RHXA 1G4DA 3MCZA 1L0OC 1Q86C 1JT6A 4A3KJ 4BS9A 1Q95G 4RTYA 4P73C 4YRJA 2L02A 3FC3A 2H6BA 1WJSA 1UHCA 1X54A 3DKYA 5CYVA 2DA2A 4PCQA 3JRIA 4JRPA 4M77G 1RAAB 2NUPA 4UUSB 1SFEA 3SEMA 1H88C 2LH9A 2RQWA 1VQPA 3AFHA 2QQ8A 1TWBA 2F69A 4EM2A 3NRVA 5BNGA 4AIDA 4RG2A 2IA2A 5HS9A 4F7UE 1Y8RB 2KYMA 1H3HA 4F7ZA 4ZGDB 2Y2ZA 3NTKA 1SEMA 4J9GA 5KCHA 3QYBA 4OMMA 3UFGA 4CSWA 2CFXA 3HGYA 5FROA 3CJRB 1KQ1A 2RJCA 3IHUA 1KSWA 1P7JA 4XTZA 4XKWA 4EMSA 3J7ZI 4OLFA 2KFDA 3I59A 1JKQC 2LG4A 4KFCA 2C0OA 3ZQCA 2JMCA 4MO7A 3CMAI 4CC4B 3R07A 4FYYB 1TUGB 1RNLA 2WB1N 4AIKA 3P8YA 2ZMEA 3R0JA 2M1HA 4M77F 3RSNA 2QF7A 5LHIA 1YI2T 3ASNH 3TDZC 1J09A 2V1QA 1AWJA 1IG7A 1FP2A 1X19A 2BY1A 3F23A 3JCMW 4MFEA 1I1SA 4RTTA 5H6QA 2LY9A 2EZHA 5GAN8 2AK5A 1UJYA 1FY7A 2L54A 3OYEA 4DEYA 1FJLA 2LQKA 1Y56A 2JW4A 2CQKA 1TQIA 5F08A 2Y75A 2R7VA 2E12A 2RHZA 2PFBA 1UGPB 2L9RA 4DBFA 3HXYA 4QQ6A 2XF5A 3S8PA 3W6KB 1VQ8T 5EJCA 4AC0A 5GPAA 4ATOA 1UZCA 3DEEA 3IL2A 3L2CA 1UECA 4EQQA 3TSZA 1OCZH 2CV2A 1ONVA 2BYVE 1IN4A 4WCGA 4C2TA 1IDYA 1XGSA 2P5IA 2EV6A 5CKDA 4G7HF 3CCSI 1ERDA 2OCCH 4FW2A 4C0FA 4I6ZA 4KH0B 1TWFJ 2JMWA 2O01E 3TQNA 3H9QA 2G9WA 1VYTA 2NVUB 2YR2A 2XKOA 2R7UA 1I5LA 1B76A 3BZKA 2YUOA 4KA4A 1KZHA 3TW6A 2M8GX 2PJRA 2ZZGA 2VT3A 4M77D 4PK4A 3OMCA 1VNDA 3ONQA 1MSFC 2F2XA 2PLYA 1QNTA 4AFZC 2V1XA 1E17A 3ULQB 1F1ZA 1M3AA 3OYJA 2B63J 2KDSA 5EGOA 1FSEA 1LFBA 2R5ZA 1RAGB 2R7RA 1VFCA 2EJ9A 1VQ4T 1TUCA 4LG0A 4J83A 1KK7A 2D6FA 4EMKB 2JA5J 2DRKA 3T5XA 2ALYB 3GXOA 1U2WA 3E6CC 3AG4H 2ZNIA 2Z16A 2D8HA 1Z9ZA 3PL8A 2JJ9A 3EG1A 2VQCA 1EH6A 3G6EI 4JLGA 4OB3B 4LGWA 3WTXC 3S17J 2DU5A 1BCOA 3OR2C 3VUBA 5IT9K 2CYYA 2WB1A 3A74A 4IHWA 1R1TA 1W4MA 3OYGA 4C92C 4F91B 5D8KB 3ASKA 2QHSA 4FT8A 1QO0D 4Y7NJ 2DXTA 3BDUA 4JX5A 3FZVA 3LSJA 4ETSA 3FM3A 4C5EA 1XGMA 5E8GA 3CCQQ 1EKEA 3S2HJ 1RI9A 4M7AG 3RR6A 2YUSA 3S3NA 4N0BA 4G6QA 5FU6B 2XRNA 1BYMA 1WA7A 2K3BA 4I0BA 5JLXA 4RGXA 3GTOJ 2GM4A 2L0KA 2BY3A 1S72T 3CCQA 4CC2A 3CO7C 4V2GA 3M9AA 4LMYA 2UUZA 4M78B 1EFWA 3RQ4A 2JOYA 3OOUA 1W66A 4J9DA 2VKVA 1S7EA 4TVWA 3BTJA 2CZ0B 2DPDA 5GADJ 3S1MJ 2ME6A 1ZRFA 5FWBA 3L7WA 5JVGF 4XU1A 5IYBJ 2D0NA 4PFZA 1S3JA 3JRHA 2RNJA 3KPHA 5C0MA 4YRFA 1YIJI 2W7NA 4KH1B 2CMPA 2QHVA 2EFIA 3WGIA 2A6EF 4M7AF 2RQVA 2R4GA 1X75C 2CP7A 5ICFA 3MEUA 4Q47A 3KZIC 4C92G 2J05A 4P72A 2Q5HA 4PSWA 4L87A 3GBQA 4CCJA 2ATCB 2YDLA 3BG7A 4KT6A 3EH2A 2ECZA 2EPDA 2Y9YA 2D2WA 4QVDA 2FBKA 1POGA 2WV1A 4K11A 2RDPA 4OMYA 3R61A 1G5VA 2VXFA 4XSZF 4JS4A 3A4CA 2DFHA 2P4RA 2IAIA 1N8RR 2E34A 4DYRA 1HCRA 1IRGA 1E6HA 1WNLA 3K4BA 2VPLA 4LDYA 3I55Q 4E7LA 2CV1A 1AZGB 2DYBA 3DLAA 3G1ZA 4ZDOA 3MPUB 4AU7A 2R57A 2EIKH 3QU3A 4GYIA 1ZSGA 3M0SA 5ICCA 4OIQF 1K0SA 3QO3A 1R71A 1T95A 1D8JA 1NEBA 3GTKJ 3NTIA 3I55A 2WSEE 3FKIJ 3MQ0A 2KHMA 2JN0A 2DN0A 4DOVA 4C0ZA 4UUSA 5IXBA 2RQPA 2VQHA 1GT0C 2JNGA 2W0ZA 3HGGA 1TOVA 1IUYA 1Q1VA 3W3CA 2SEMA 1YJNI 3F72A 1E2XA 3TGNA 2DK8A 2NVYJ 1QVGP 3LH5A 4M7AD 2K3YA 3FXUA 2CS3A 1JU5C 2RJFA 2HDAA 3BP8A 1MNDA 2F5CA 1H641 3U1DA 3AL0C 1M1KU 1HSJA 3J80K 2DJNA 1PD1A 1QMCA 4MDXA 3J7AY 1PSEA 1AOJA 3WVDB 3H5AA 3CPWS 1VQNQ 1FBQA 1Y8QB 3EFSA 1FEXA 4PJOB 3WTSC 5ECAA 3S3OA 3REAB 5LJ3j 2KRMA 3UF4A 3L1PA 3IV5A 5B5EC 3F9KA 4EJUA 4H02A 1MMNA 1UFFA 4TTVA 2M0MA 1PKSA 3KLNA 4LIUA 3TW7A 1VQNA 2BVLA 1JBMA 1ACMB 2IIMA 4H2WA 1KQ0A 3EUHC 3BQYA 1NZ9A 2CSIA 1E1TA 4J6WA 2L8DA 4QW2A 4AIHA 4XICA 1HKTA 2LF8A 5GTIC 2GIZA 2OV7A 5F04A 1RADB 1F36A 1G2HA 1VQOQ 3MKWB 3B6CA 2NOJB 3CC2Q 3CBMA 1I81A 5DM7R 3JCMJ 4M75G 1EX4A 4XL9A 3WHBA 1HQCA 1BR1A 2RAEA 3E9FA 2ZXFA 3BR5A 1B6AA 3UWNA 5F27A 2P5VA 1YW7A 3GMEA 4BQAA 1VQOA 3OV8A 3M4PA 3H0GJ 2VIXA 2IGKA 2O6GE 3RKYA 1M27C 4J6XA 2M9UA 1HJDA 1JXSA 3O8GA 1E7OA 3OIQA 5LEJA 2JA6J 1VQ5Q 4MEXF 4C30A 2WV0A 1TG0A 1A31A 3PO3J 2PMZN 1ZG1A 1RR8C 2HQRA 3Q9VA 2QQRA 4BDYA 2XRLA 3S6WA 4O5VA 2JRMA 1N25A 2HTJA 3PSFA 4OMFB 3VYRB 1W7PB 3CF2A 3CCUT 2NS7A 4XKCA 4M75F 2VJJA 1VQ5A 3CD6T 2DT7B 2L5QA 3VSLA 2V6EA 1Z9QA 3ZP5A 2E19A 3E6DA 3LSPA 4FTHA 2EFPA 2HKXA 5E18F 2X6XA 1YJ9T 3CCEI 3SEZA 4HV5A 3BPXA 4EMKA 2KBTA 2ALYA 2HBPA 1YJWI 1LE8B 4DBQA 2DMPA 2MLGA 5GAMh 2BW3B 2F5DA 2ZZEA 2MYSA 3M57A 4WWCA 4IL6C 1I5OB 4C8QE 2WAQN 1SEUA 1BJZA 4NUBA 1KMMA 3CCLI 2COBA 2FF4A 3QDRB 3MKLA 3F0CA 3UGQA 4HEA2 2A28A 1T39A 3BDLA 1T0HA 2CP0A 1H9TA 4IIMA 4A3LJ 3ZQQA 3CQTA 3CCVI 3ROUA 5IP6A 1FMVA 2RI5A 1I1GA 2P0PA 3RZDJ 2FZCB 3OSGA 2W57A 4OINF 1FPQA 5FD5A 1O7LA 3CJTB 1X3UA 1M3CA 1CKBA 2CH0A 3QP5A 1FYFA 4RAFA 3U9GA 2JZYA 2DA7A 5HDKA 1MJAA 1ABQA 1P92A 3NGPA 4CA0A 2WAFA 1E22A 1VQMI 4FETA 3OBYA 1Q7YC 1YI2Q 4IQ4A 3KFUA 1S7AA 4L18B 4M75D 2A36A 2HD0A 3BG5A 1D5YA 2MI6A 1MMAA 5TRDA 4M78A 2H8WA 4UP7A 1VQLI 2RN7A 1I8FA 1TXQA 2FE3A 4BJ6C 3OYKA 4HWSA 3ZRGA 4LD9K 2DA4A 4JPBW 1EQRA 4YEJA 1YI2A 1LDDA 2NS8A 2LQNA 3E9HA 4OIRF 1O3QA 2LLKA 4DPGA 3A7UA 4GXOA 4DBRA 2R3SA 1NE8A 2FX0A 4FL6A 4ASNA 2Z9OA 1UMQA 2IVWA 2IXSA 4OGEA 9ATCB 3HXXA 3MF1A 3F8FA 1T33A 3MF2A 2DX1A 2AKWB 3HUGB 1H92A 1I3QJ 4YCUA 1KU7A 4FASD 4CUGA 5I22A 4M7AA 2ACJA 3ZQIA 3NEMA 4HRIA 3HM5A 3CMMA 3NEUA 1YN8A 3BPVA 2LQWA 2CU7A 2EVRA 1IO6A 4MZMA 4Y15A 4YP0A 1B72B 3GTJJ 3UNGC 4DJAA 2R5YA 3CC7Q 4CI0C 4RAZA 5HLIA 3MEXA 3IP4B 4XN3A 1U9OA 5AYFA 3O8HA 3PNVA 1SD4A 1K78B 4IOAF 2DA5A 1D5VA 2DBKA 4YRMA 3CMET 2VONA 3M8FA 3QXEB 2AXLA 1DQUA 4GY5A 4AFQC 2UWMA 2QGGA 3CC7A 3QOEA 4KQEA 1VQ4Q 2E6NA 4KUIA 2RB6A 2RHYA 1W5CC 4OMNA 2DVEA 1VQ9Q 1B7YB 5A0LA 4KIBA 1FMKA 1WJRA 4LNSA 4HSRA 1Y39A 2VJIA 1ZSZC 4KR3A 1WI9A 4XU0A 4LLLA 1VQ4A 3REUA 1VQ9A 1YE9A 2ZXJA 4G12A 1NJ2A 5GAHJ 2ME0A 2ZPFB 1L0WA 4AG2C 3HXUA 4QPQA 5GMKm 1QVFP 1H4QA 3MN2A 1BI3A 2VI6A 4CS4A 3ECHA 4EEFG 4M77E 3HP9A 2QSHX 1YLFA 3H9JA 2P0KA 1A04A 5J39A 4E70A 2M34A 1OYWA 3HTZA 1R4NB 1SMYF 3MKZA 4BDZA 1BOAA 1JEGA 2LBFB 3I4PA 1M5Q1 4D5FA 1KQ8A 5E20A 4LXCA 4JK1X 3K6GA 3FM5A 4XLEA 3SWNA 2QA4Q 2VQGA 4FX0A 1B07A 5ERIA 1FP1D 3D5RC 3IWFA 3GTPJ 4NQWA 3I0TA 1YHQT 4BQOA 2Z3YA 3SB2A 4IX7A 2AKKA 2DTIA 1N8RU 4LB6B 3LSKA 1XQHA 4ZIBA 1OJLA 1Y07A 2FG0A 4XRSA 4BXFA 1EZZB 3BR3A 2L3SA 2QA4A 3CQZJ 2VL8A 1S72A 2LT1A 3M0QA 2LCSA 3LYIA 1XMXA 4QLCU 3GBGA 3LOCA 2CJ9A 4FHTA 1ZGAA 2DQRA 4J9CA 2AS5F 3FIFA 5E3NA 3H1CA 2XSDC 1JE8A 2RPNA 2IS6A 1FOXA 3PQJA 1FXXA 2O3FA 1U06A 3KP5A 1UGVA 3RMQA 4CC3A 2JJ7A 1REPC 1WX6A 1N75A 1KJWA 4BD3A 1RZ4A 3R4KA 2JS2A 1IRZA 3ABLH 3H0FA 4IRGA 1I1JA 2HFHA 3CEYA 2ZSIB 3KEYA 1AT1B 2X0LA 2ZFUA 3M58A 3BJOA 2F4MB 2DOEA 2RHSB 1W7PA 4A63B 4XEOA 3LGLA 3CDHA 2FRHA 1RACB 4RUGA 4V2SA 3BR2A 4MTDA 3VS2A 1VQKT 2LNHB 3OYIA 4PFOA 4IJAA 2F48A 2MIOA 2V1RA 1X2HA 3LWHA 2RM4A 4J00A 2JWTA 1Z1DA 4UUTA 1RLQC 1SSHA 3VQVA 4RQFA 1J7KA 3F3XA 2R58A 3LFKA 5A2QK 3S15J 3I56Q 1KC8R 1LE8A 2L3QA 2CP2A 2BZYA 3EHQA 4KUDK 1VQ8I 4MNUA 3RPUD 2VGNA 2W25A 1WI3A 3EHRA 1X69A 2AQEA 1IV8A 4D8DA 4M73A 4CZCA 4LJZF 2A07F 1WJCA 2DE0X 3I56A 3SDZA 4I7HA 3M4YA 4HT8A 5GMKe 1ENHA 4MMKA 1D1CA 2JXBA 2LVMA 1LNWA 1OPLA 3JCMP 2BZTA 4KN4X 1D3BB 5FB2A 1ADYA 5C4JJ 4KBMB 3FDRA 3JB9F 1BB9A 4A3IJ 4GFBA 1WIEA 2EKOA 2FO0A 4WX9A 4BL0B 3DXJF 4L9TA 3DQVC 1JGGA 3A98A 4Z2YA 4IPAA 5GJWB 2A3SA 4ENMA 4YFXF 4L9VA 1IC8A 5GANg 3BJ6A 3SHWA 1JTYA 3AG1H 1R1VA 3A31A 4UVBA 3CXCP 2ZKZA 1B1BA 4OOIA 2K7AA 4RKUE 5LGTA 2DDBA 4XQ3A 1BC7C 1ZREA 2OAZA 3VS5A 2LRDA 2ODRC 4HPQA 5D8LB 1PVEA 2KDZA 1X2NA 5K1YA 1OLTA 4A4GA 4M7AE 1R22A 4NL3A 4A53A 1WZOA 5E3IA 4BXXJ 1BK2A 2E6ZA 3MAJA 4LVJA 2FUG2 1YO5C 4P96A 2GZWA 3F8CA 4Y28E 3EGDA 2LY1A 2P81A 3NQOA 2JTFA 4P55A 3MD2A 4ZDLA 1T0JA 5B66C 2MH9A 1VYUA 4HT9A 5HLTA 8AT1B 3HUGA 2DAQA 1BI2A 4J7FA 2X1DA 4ABZA 1BM9A 2CS7A 3W2VA 4KDPA 2RO0A 4FYWB 2LNBA 2K79A 2X9DA 3H36A 2D5VA 2HKOA 2JM8A 3P8HA 4A4EA 1AU7A 3H0DA 2H09A 3M56A 2PX9A 3DV8A 1PDNC 1B34A 1M2OA 3JB9D 2DW4A 3ASOH 1STZA 4N4GA 3K1PA 4JRIA 1LPLA 2ZIMA 3S3MA 2LJ0A 2IA1A 3GCMA 1MV0B 1LEBA 3HL8A 2Q5IA 3M1CA 1R9TJ 3NHNA 2FPFA 2CO5A 2DYSH 1X6BA 4M6YA 5FFZA 4LB5A 2E65A 4JZ4A 3PUBA 4FE4A 4YRPA 5D6WA 1M90R 2HNHA 4DYQA 3Q0VA 3QYGB 4P74A 3S1RJ 4KUMA 5DY9A 4I99C 2KRHA 3K1MA 4M74A 1YFSA 5IHIA 4A4HA 1EV7A 1ZLMA 2C0IA 1B9NA 2E1MB 1LB2A 4M9SA 2DCEA 3REBB 1B7YA 2X6YA 2X1CA 2YLBA 3ZQGA 2E1OA 5LL6S 3E7LA 1IGQA 2GA1A 2FZGB 3UA6A 4TVRA 2VC1A 2LD5A 4G6TB 2K3PA 5GAN4 2O8XA 3JTHA 1APLC 3I5UA 1Z05A 2JA2A 2V7FA 4RMOA 3BTCA 1B8IA 2BXYA 5HNFA 2OAUA 5IPAA 5TGTA 4IHTA 2CKKA 3HRMA 5IT3A 2Q7HA 2KZGA 2CJJA 1NBEB 4ZYDA 3HXWA 1J75A 4J9EA 1FTZA 1C0MA 2EILH 3CMAT 1RRJA 2CWEA 2QUFA 2ELKA 3JW4A 3FXLA 3VS6A 2RHQB 1R5GA 3JCMQ 2QASA 3JRAA 4JS5A 2QEXI 2JVVA 1G3SA 1U5TB 5LRRA 2LBFA 2VJ5A 1GLNA 5K1XA 4YRGA 1HBXG 1K73R 3C1DA 3ERED 2Y4XA 1RC9A 2DL3A 3OS2A 4M6VA 3HXZA 4HNVA 1W5TA 3OW2S 1UHSA 1E3OC 2EIJH 1KOGA 2K57A 3ZQFA 5D4SA 5KYUA 5BPIA 1YRNA 1W6XA 5K1PA 5K5OA 2PMHA 1W2BP 2RREA 2HCKA 3ZEHA 2EBPA 5IYDJ 1JJ8C 1I3AA 3LSQA 3BJUA 3H3ZA 1SD6A 5IYCJ 4OB1B 1M1GA 4OAYA 3CXCA 4XOPA 3CCST 3HFZB 2DYRH 3OBWA 4CYDA 3W2WA 3A8LB 5GAN6 3FBNB 2FD5A 1LVKA 5HK3A 5FU7C 3FJ5A 1R7JA 1ZYRF 5GANe 2FMYA 4RGSA 2DXIA 2YU9J 4ELYC 1Z7NA 1MDMB 1MKMA 2CG4A 4M75E 2NVTJ 2R7XA 2P0QA 5JHFA 3FXKA 4CH5A 3PZCA 2RHSA 3H0HA 4QTRA 2KAFA 4BY6B 2G6FX 2OF7A 5D5VB 4HF2A 3EGXB 3CCJQ 1NG2A 1K76A 2BE9B 2CW7A 1KONA 2L2OA 3L1AA 1R36A 3LSMA 1MZBA 1SF9A 1KGSA 4WF2A 2ZT7A 2QG9B 4YCVA 1G3YA 2PBIA 4BQNA 1GCPA 3DPLC 1RUWA 5EEGA 3NMZC 3FMQA 3QG1A 4NHJA 1BIBA 2IS1A 3CCJA 3HOWJ