3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
4UXNA 1IN7A 3HTZA 2A3SA 4RQEA 2A69F 4P9FA 3VOEA 1IN5A 2ZZGA 3INZA 4YRTA 4G84A 5FLXK 4GYGA 1B70A 2KIMA 3F3XA 3LFKA 5TJJA 5JR3A 3T5XA 1UB9A 3I59A 2DW4A 2IA2A 2Z5UA 2YHTA 3I59B 1D3BA 1ULYA 4WWCA 4P3PA 3L1AA 4IHSA 4AIJA 2EA2A 1RIOH 4M78D 3GLXA 3GYHX 3PCOA 1HBXG 1FSEA 1D5VA 4MNUA 4L5JA 3DKWA 4O3MA 3FB9A 5LJ3j 4LFUA 4M75C 3RERA 2FBKA 4L5IA 1FBSA 5D4SA 4P5OA 1I1SA 2FNAA 4YPFA 4M7DE 1MJ9A 5FB2A 3DSQA 4U0YA 2CJ9A 1P4AA 4LLGF 3DPLC 1I4K1 2F5EA 1M5Q1 3GZ6A 2V9VA 2R7FA 2XUBA 4ASNA 4MHGA 4BHBA 4K88A 2VN2A 1SD6A 5H6QA 1ASZA 4LK1F 1YS6A 3ZQ7A 1D3BB 4ETSA 3RJPA 4BW9A 2EV6A 3M4PA 3L4GA 5LJ3g 2VC8A 4NL3A 3GFMA 1KMNA 2QTXA 1ZN2A 2E41A 4LG0A 3IRRA 2C7IA 3E6BA 1BBYA 1B8AA 5FGMA 4M6XA 3WTZA 3M8FA 3HTUA 5HOOA 5HVQC 2RHSA 3KP5A 1R36A 4MQ9F 1Z91A 1JJCB 4M75G 1QZYA 2DJZA 2QBYB 4HV5A 2WWYA 4RAYA 3IL2A 1XD7A 4G85A 2IP2A 3HSBA 4GYIA 4PJOF 5GANf 3WG9A 1K7AA 5GAMd 2QZ8A 1EIYA 5LJ3f 2LSOA 1SFEA 4YRPA 3QO7A 2EB7A 2J3MA 4M75B 2RA2A 2H6BA 3IKMB 1YIOA 5DUIA 3J7AO 2FBIA 2YX7A 3BZ6A 3LWFA 3K1NA 5JHUA 1D8JA 5E1WA 2VOOA 4WCGA 1STZA 2MC3A 3MZYA 2DTIA 5K5RA 4IRIA 4J6YA 2VOPA 1YO5C 4L9JA 5LGUA 1EH6A 4HVCA 1QPMA 2QHUA 3TO9A 3TQNA 5DYMA 5LEKA 2FNPA 3OV8A 4C92F 2WC2A 2VE8A 1KU7A 4KR3A 5E3IA 1IAWA 3HOTA 1W7PD 1L0WA 4C8QG 5H6RA 3UFGA 4EMKB 3NEUA 3SZPA 3GX4X 1EVKA 1N9SA 1YG2A 3V8JA 4X9CA 4J15A 1EFWA 2O3FA 1OYYA 2IA1A 2NYXA 1X2GA 3HFZA 4UHTA 3FX3A 2OZUA 1OYIA 3MWMA 2OQGA 4S05A 3JSOA 1R1TA 4M7DC 5E17F 2EV0A 4JUVA 4Q6GA 2DQLA 3J80Z 3BJ6A 3E3VA 2FU4A 1XMAA 3D5LA 4C92D 1X56A 1GXQA 5D8KB 2LF7A 1AOYA 3JB9F 3TEGA 5GANg 2PMEA 2QUFA 4YRQA 5F1RA 4M7AD 2L3DA 2ZGWA 2Q5HA 3ICAA 4KNYA 2O0YA 3ZP5A 4E70A 1J59A 3WTSC 4JRKA 3I5UA 3HUGA 1CGPA 2PG4A 1N9RA 3R07A 2MLGA 4I7HA 3Q9VA 4CICA 3JB9I 4GCVA 3CUOA 4R8HA 5DUKA 4M75F 3NRVA 1HQCA 2I4MA 2YLCA 1JE8A 2Q0OA 5GAOn 1I6XA 2XASA 4ZTZB 1XGSA 2ESHA 2E1NA 1B1BA 1KQ2A 1QE0A 2IVMA 5GAN2 4U0WA 5K1YA 2EA4A 3HRKA 1XB4A 2M30A 2ARUA 1WPYA 3P7NA 3HXXA 5F5WA 3I4PA 3HSFA 3HRSA 4M7DF 4PGGA 1K6OA 4KQEA 4YDQA 2DQRA 4N0AC 4ZIBA 4U0VA 4C8QA 2FSWA 1USSA 1NJ1A 1FP2A 3L00A 2XAQA 1FPQA 1C0AA 1ZHFA 3DV8A 3TO6A 3BROA 2EK5A 4CH5A 4F7UG 2R7DA 1IN4A 2Z3YA 1NJ2A 1MDMA 3IKLA 1YYVA 4P73C 5DD8A 1RUNA 3V7RA 2L01A 2XGTA 4CH4A 3SXYA 3L4GB 4UUVA 3WODF 2EL9A 3OOPA 5CLSA 5GMKe 2E7WA 2DK8A 2FB7A 2P6TA 4UP7A 1LJ9A 4NOYA 2X4HA 1FBQA 3HRIA 1IN8A 2K4JA 2KIUA 4I01A 1HSJA 4TTVA 5GAN6 4ESBA 4BYYA 2DI3A 4KN4X 2J3LA 2YU3A 1U6GA 3R60A 1X01A 5LJ5e 1XN7A 4A2UA 3J81K 2CWEA 4TVAA 1HK9A 4YFNF 1IW7F 4RGUA 2C8MA 2KJBA 1IUYA 2FOKA 3RDIA 2IPQX 3VB2A 1ZLKA 4NHJA 1SETA 1YB3A 4ZH4F 1KQ0A 3T8RA 2L4AA 2EFQA 5H20A 1OPCA 3KEQA 1P4WA 2HOEA 2ZIMA 1EH7A 4RQFA 1G6NA 4RGXA 2H6CA 3RPQA 1GHCA 5D6EA 1IF1A 5GAN3 1KGSA 3V7SA 3HFZB 4Q5SF 4BNCA 1Z1DA 2ZNYA 4Z2YA 4JBAA 1ZG1A 3ELKA 4FHTA 5ELNA 1B34A 5BMZA 3QNEA 3IWFA 3DFGA 4P72C 5HS8A 2EJRA 2BV6A 2JRTA 4UV9A 1KYZA 1B4AA 1SD4A 1C0WA 2E64A 3HXWA 2O03A 4HDVA 4EGYA 2ZFWA 2GIVA 2AXLA 4RCCA 4YG2F 1IXCA 5GAOp 4LG0B 1YW9A 3W3SA 3CTAA 4QWQA 4M72A 3KP2A 2V1DA 1R5HA 3IHUA 3CMQA 2E1HA 1G5HA 5D5VB 2G9WA 1RUOA 2STWA 4YFXF 1JHHA 1I81A 3E6DA 4EJVA 3K1PA 4M77B 2I4OA 4TVYA 4M75A 3HXYA 5DV5A 2DPUA 3QO3A 4JQFA 2COMA 2QM3A 4CS3A 1SERA 2RNJA 1T0FA 3BDDA 2MA3A 3QSUA 4I0BA 2FBHA 3BWGA 2A6EF 1E1OA 1EH8A 2VBXA 2Y75A 3E5QA 2W84A 2EFWA 2ZNIA 2P7CB 3JCMh 2ADUA 5ICGA 3NETA 1V4RA 1Z6TA 3VBBA 1H4TA 3KLOA 3JCMX 4ZYHA 4WXHA 3A7UA 4GO1A 4OIQF 1S7AA 3LSSA 4YRMA 2DZCA 1J2XA 1HW2A 3ERED 4NB5A 4X5OA 1ZRCA 3LA3A 1LVAA 1XDUA 4WJ3M 4YREA 1USTA 4L9NA 4M7AF 1MKMA 1WQ2A 1J5YA 1XSXA 1L3LA 1O57A 3BOQA 5E1ZB 4LK0F 2VXZA 3W6KB 1O7LA 2RHQB 1NHAA 2ZR3A 4P74A 4KR2A 1ODDA 2VBYA 3RF1A 5HLGA 4P72A 3S2WA 4YRNA 2M8EA 3PGGA 2E3CA 2JPCA 4TQDA 5D4RA 4OP0A 4WXCA 3SFZA 2O8XA 2CG4A 4N0AA 3BJOA 3ABUA 1H641 2UXNA 3SWNA 3JB9G 3QUIA 1YS7A 3B73A 1BI1A 2J5OA 3KP7A 2P0LA 2K02A 3E6MA 1PYSB 2HDCA 2IA0A 4M78C 2HKOA 4XTZA 2VODA 3BJUA 2CGPA 1F4KA 2XAJA 2NNYA 4M77F 6PAXA 1R1VA 2V6CA 1O3QA 4KYWA 4EJUA 1I27A 1EOVA 1ZREA 2QBYA 1TTYA 3DPTA 4C8QB 1IXRC 2NRAC 4TVWA 2HYGD 3HFNA 3FZVA 1XMKA 2EAYA 1ZAOA 3JB9D 4H2YA 4MTEA 4YIIA 4A6DA 1YFSA 3C3WA 4EMGA 4PG3A 5JVTA 3WTTC 2DTHA 4PJOB 3RKXA 1G3TA 4HQMA 4OIRF 4QVDA 1F1ZA 4V2SA 5EEGA 3IKVA 2DDZA 2DK5A 1LJOA 3ECHA 4WXDA 1ZLJA 4P55A 3N97A 4RCBA 5JI6A 3E6CC 2KKOA 2DZ9A 3LAPA 4EX5A 3KE2A 1RIQA 3RIRA 5K5OA 2O6GE 1FSHA 2XGXA 1PUEE 4C8QF 2YLBA 2DAOA 4M73A 2Z9OA 1GXPA 1LNXA 1WKMA 1UHWA 1F9NA 3HSEA 3J80K 5GMKh 5GAMg 5ILUA 3JCMf 1OKRA 3VODA 4XQ3A 2ZMEB 4C92A 1JGSA 1FNNA 2MD5A 4Y17A 2HQRA 1R5GA 2HZTA 4G6DA 3HOSA 2JN0A 3EUHA 4ENMA 2E65A 2ZZFA 3HHHA 2H94A 4HZFA 3K0LA 2ARSA 2XAFA 3WQZA 2XKPA 5HS9A 3KLNA 1U2WA 4YRKA 2YPRA 4HLYA 2OU2A 1ZH5A 4YRCA 2CQKA 2XRNA 2ZT8A 3FWEA 3IC7A 1P4XA 4EMKA 3F8MA 3HRTA 1U3EM 1JJCA 1ADYA 4FT8A 5IT9Z 3ERRA 3GFJA 3HXZA 1H4QA 4EJWA 3JB9J 4OMYA 4RGRA 3NQOA 3R6SA 1Z7UA 1PP8F 4C92G 2A6HF 2ODRC 2QHSA 2F5DA 4C92B 1D8KA 3F21A 2JSCA 1G3WA 5DCMB 2PI0A 2AKWB 1YW8A 3F6OA 3TEHB 3I7FA 4XLPF 3E97A 4R1HA 2DQ3A 2DT5A 1NYRA 5TRDA 3GF2A 3ZMSA 5GANd 4EMHA 1UCRA 1TW2A 1B7YA 4H0EA 1O7FA 2ZT6A 4P73A 1JBMA 1P6RA 3Q5FA 4H2XB 2O61A 2E5AA 4Y15A 4AD9A 1GGMA 1JHFA 1QGPA 3F22A 2FMYA 1OYWA 4ZZLA 4P9UA 2IY5B 1Z05A 1B59A 2EJFA 4XSZF 5GANj 2W25A 11ASA 3G3ZA 3JW4A 3F6VA 2K27A 1LYLA 5EEHA 1RZ4A 4J6WA 2KJCA 1BBWA 3A32A 4L18B 3W6JB 2DBBA 2PN6A 4G6QA 1J0RA 1FT9A 4L0YB 2M5WA 1GVJA 2ZT7A 3KP4A 1REPC 1E22A 5A2QZ 2BYVE 3FMSA 1U5TB 3QOPA 3GO5A 2ZBKA 3KZYA 1S29A 1RNLA 3TKYA 1BBUA 3CO7C 3SZTA 4M78F 3I0TA 3LSQA 4M7DD 2AS5F 4P74C 4PHCA 3I64A 3MF1A 2FE3A 3MEYA 5K1PA 3M8EA 3U2RA 4Q48A 4ZTUB 1XCVA 1I5ZA 1B9NA 4I2OA 4YROA 1LDJA 4PNOA 4LNSA 1ZGAA 1QZZA 1XSDA 4KA4A 1WQ7A 4H2SA 1W4MA 1BI3A 2GXBA 2V79A 5ERIA 3MEXA 3RUXA 1SMTA 4KMUX 5GAN5 3TDUC 2A68F 5LJ3e 2CJBA 4UVCA 3R0JA 2FXAA 3J81Z 4H2VA 4KICA 3RYPA 4A6EA 5BS6A 4E51A 3KFUA 4WJ4A 4A54A 2K4BA 2XROA 3DEUA 2Q7EA 3LC0A 4PJOE 2TDXA 3K1MA 3LAJA 4ENJA 4K2EA 4HF1A 2Q8KA 2PMFA 1E1TA 3QTCA 4F7UB 2BBYA 5GAN7 1DUXC 3REXA 4N9IA 2ALYB 3G1ZA 1BOAA 2ETHA 2ZINA 5HLHA 4HWTA 4Y91A 3I53A 2MBFA 5GANh 3HYIA 5FFXA 3WTVC 3JSPA 1K78B 5D5XB 4DNCA 1JRIA 1WQWA 4PDKA 2RM4A 3NEMA 3MF2A 2QYOA 1J7KA 4LMYA 2Y90A 2ZKZA 4XU0A 2ZO4A 1TQMA 5LHGA 2VXEA 1X3UA 5D5UB 1XCBA 5F64A 2GAUA 3FM3A 2YX4A 1WNLA 1W7PA 4QVCA 3VEPA 3TOAA 1G3SA 3KFWX 1R00A 5A2QK 5LEJA 5D6FA 2HYFA 3FF5A 3H92A 2R3SA 2FF4A 2OA4A 2VT3A 4YCUA 2Z33A 2RQPA 1G3YA 1VQZA 4K87A 4ZYGA 3I71A 1FLIA 1UHMA 4CO8A 4AWXB 3ML6A 3FM5A 1PDNC 3D0SA 1MZBA 1XGNA 4ZYEA 2ISZA 4M6YA 2P5LC 2HQNA 5FO5A 2LF8A 1DPUA 4RMFA 3VQXA 5GMKj 2Y0MA 5J8CA 4LLNA 1MGQA 4RS8A 2D45A 1BJAA 3IKTA 4EVIA 4IRHA 4XBFA 4RB3C 2A07F 4KMFA 4TQFA 4BQAA 1B7YB 3EDPA 4M9SA 3ZMTA 4OU0A 1AWCA 4JLIA 3RI4A 4M7DA 4XU1A 2EWNA 4MEXF 3I58A 1I1GA 4NQWA 4C8QD 1XDSA 2CO5A 3TO7A 1WU7A 3M1EA 12ASA 3VQVA 4OIPF 5D5WB 3QAHA 2E7XA 3QPHA 3DQVC 1EVLA 2I4LA 3AAFA 1NJ8A 1SAXA 2GA2A 1WLEA 1FC3A 3GVAA 5AONA 1K79A 3WGGA 4ENKA 4ZYDA 5FD6A 3WU0A 2EFPA 3P8TA 4YIFA 1R58A 3EYIA 2IW5A 4CYDA 4MEYF 4H2WA 4DPGA 4LB6B 2ZNZA 3UGTA 3GIBA 4AIHA 2K7LA 5ICFA 3JCMc 3ISPA 1OMIA 1ZRDA 4LD5A 2W24A 3BW1A 4B8XA 4YP0A 1HW5A 2DFIA 1MDMB 2IT0A 1R23A 1BC8C 4C92C 1S6LA 1G5IA 1IZ1A 2FQ3A 3E5XA 1WSUA 4BAYA 1JXSA 2UZKA 4EJTA 1LEBA 3A7RA 4XEMA 5GAMj 4ENNA 4BHCA 4I0AA 4UP9A 2ZJ2A 3CLOA 2VC0A 5LHIA 4IF4A 1ZGJA 5KNNA 1WYDA 1ZG3A 4XTVA 1DP7P 2ZT5A 2FMLA 1KMMA 2GWRA 4EO4A 3BDUA 5CVVA 3RESA 4L87A 3A74A 1KQ8A 3LSTA 5LJ5h 1E2XA 5CVUA 4MMLA 1ZYRF 2PLYA 3GWZA 1G51A 5L3GA 4HDUA 3F72A 2E1CA 4F7UE 4Y13A 4R79A 1D3YA 3CDHA 4YRRA 4CDGA 4YCWA 4XTUA 1OR7A 4HA8A 2HNIA 1FOKA 5CVJA 5GAMh 5CVIA 3SQNA 3JAMZ 1SFUA 3PQKA 4M7AG 3TUPA 1IXSB 2JZYA 1H4SA 4B09A 1N9WA 1X54A 4M71A 2D2WA 3K69A 1TNSA 5E20A 4AH6A 4M78G 5C53B 2DKGA 1IN6A 3A7AA 3BP8A 2RHQA 2CW0F 3OD1A 1NJ5A 3QU6A 1HW1A 3KP6A 3LA7A 4FX0A 5HDKA 4RGSA 1FBUA 1B70B 3HRUA 3TGNA 3FIFA 3BJAA 1HSTA 5IT9K 4UVBA 4KFCA 2CFXA 3TOBA 1HKTA 4XU3A 2AMCA 2HR3A 4P3OA 4KDPA 3A31A 2I2LA 1USYA 3WTXC 5HGQA 1SRYA 1H9TA 1ATIA 5E1XA 5E18F 3JCMP 1KU2A 5LJ5g 1HKQA 1YQAA 2W85A 4U7DA 2JPBA 1SD5A 4A0ZA 1YLFA 3VQWA 3TDZC 5HS7A 2DEQA 5CVRA 3ABTA 3REOA 4PZJA 3QHSA 4M9ZA 4EM1A 2VONA 4HLXA 1LOJA 2XTIA 5CYVA 2MLKA 1DDNA 3LQQA 1I8FA 1U78A 1TLHB 4G7ZF 2G4CA 3AHUA 3R0AA 2UWMA 3R61A 4F7UF 2ZXFA 2BEOA 1J9IA 2HKXA 2ARTA 2M45A 1SD7A 1EQRA 1LB2A 4A12A 5F6FA 4J6XA 2DU9A 4XLNF 1YTYA 3GW2A 3HFOA 4P96A 2EV5A 1ZG5A 4UVAA 5DCFA 5DY9A 2XVCA 4I09A 4XRFA 3HXVA 1E17A 4OOIA 3ZMVA 5GAOq 2L02A 5LJ5j 4TV7A 3UGQA 4YRGA 4BHPA 2JTVA 4YRFA 5KVRA 1TH7A 3FHZA 3GUDA 4G7HF 1KQ1A 3M4QA 4M77A 3F23A 1FWZA 4Q47A 2F5CA 3RYRA 3GFIA 2RGVA 5E8IA 3CUQB 2J5PA 4EQQA 1Y0UA 2VT2A 1R22A 3HRMA 4XU2A 2QHVA 5BPDA 2P5VA 2Q5IA 2ZNJA 3WTUC 1J5WA 4H02A 1ASYA 5GAMf 4EMKC 3DF8A 1PP7U 4X9DA 2CJAA 4LLLA 5BPIA 1FYKA 1Q1HA 4HV6A 1IL2A 4BXUA 2ACJA 4YRIA 5ICCA 4ESFA 3I54A 2ZCEA 2P6SA 3CUQA 5DDGA 2A61A 1MJBA 2V1XA 3RL6A 4K86A 3MFKA 5CJ9A 4CS4A 2C6YA 3QP5A 3PCOB 1J75A 1T39A 1Z6RA 3FXUA 3RKYA 5HLIA 1LDDA 3H3ZA 1FYMA 4G8XA 3L7WA 3F8NA 2M1BA 5GAN4 3JCMJ 2F2EA 4KIFA 3PZCA 1W66A 2RDPA 3L2ZA 2ZR2A 4M78A 2QLZA 2FYKA 4LB5A 3UH0A 4JK1X 4C92E 1S7OA 3U9GA 1SFXA 2FA5A 1I5LA 1L0OC 4PJOG 5GAOl 1IRFA 3IWZA 4PJOD 1Y96A 1TNTA 3WGHA 3MCZA 1T38A 4M7DG 2NS0A 4G7OF 3O2PE 4HYEA 2MH2A 1SESA 5LHHA 4A0YA 4KUMA 5GAN8 4HWPA 5LRSA 4YRLA 2B0LA 2KRFA 1B76A 1T98A 4D0PA 1NJ6A 4YYEA 4OLFA 3KP3A 4HQEA 2HTJA 4CGZA 1HKSA 4M77D 3F8BA 1Z9CA 3PQJA 3HY1A 5HDGA 3QP6A 3KEOA 3QO8A 3JCMb 2QENA 2XIGA 3QPTA 4AIKA 1W5TA 4HWRA 3GZ5A 3E9HA 3P9IA 4EM2A 4GGGA 4HT9A 4UNOA 5L3DA 4QLCU 2ZIOA 3WE2A 2CIMA 5HDNA 4P71C 4WI1A 1Y96B 3WE3A 1QF6A 2L54A 3QU3A 2DTRA 5FLXZ 1EV7A 5LRRA 4BWAA 1FYLA 1V3FA 4PJOC 3WU1B 2I4NA 1T2KA 4UPAA 2YSRA 2PMUA 1HTTA 1TQIA 1XGMA 4P75C 4OMZA 5L3FA 1U5TA 1YGBA 4RB0A 5AIQA 4HF2A 4DQ2A 4HF0A 3N4MA 1M8VA 1F5TA 4O2DA 2DTOA 3P8VA 3RACA 5LJ5f 1BC7C 2EFNA 2OQRA 4CHUA 3K9TA 4O5VA 3CUQC 2DPDA 3RKWA 1YFTA 2ZTGA 2DXTA 3KCCA 1IRGA 2VBWA 2WV0A 4H2UA 1FYFA 1SMYF 2HFHA 4UP8A 3B02A 4C8QE 3L9FA 2AKWA 1VTNC 1HC7A 3JTHA 3E5UA 1MJAA 4EJOA 3M4GA 1MGTA 4HAMA 4LGWA 3EFSA 2P5KA 3V7CA 4XTYA 5CAIA 5C51B 3G73A 2PQ8A 5L3CA 1ON2A 5BQTA 3LA2A 2VC1A 3BPVA 4AVPA 4TVAB 2X0LA 1FP1D 2XKOA 4XTXA 4OINF 4ZZDA 1ZARA 2G7UA 1R7JA 3FXRA 2XAHA 4M7DB 3REUA 1H0MA 3EYYA 3MAJA 4N0BA 3V8LA 3GFLA 3IG2A 3C18A 3GEZA 2A5YB 4IRGA 2FRHA 4KIGA 3SHFA 2QWWA 2VBZA 2G7HA 4I02A 2DU5A 3O3KA 2RV8A 1BIAA 5J8FA 2EJ9A 5D8LB 1S8NA 2NAZA 2ZZEA 1NNHA 5I21A 1R1UA 4ESJA 5LLQA 2F5FA 4P71A 2QQ9A 4PGHA 3PFIA 3EQLF 4RAZA 1ADJA 1ON1A 2LDUA 3ZMUA 4KIBA 2QVOA 1TW3A 3FXQA 2D1HA 5GMKi 1BN5A 3V8KA 5L3BA 2E10A 4YRJA 1B34B 3P9KA 3A5YA 4M7AE 4RDXA 5GAOm 2GZWA 3A5ZA 1DPRA 1U5TC 1XSVA 3T1BA 1T6SA 4S04A 4M7AA 1H9GA 2UXXA 4HBLA 5ICEA 1LEAA 2ESNA 1RI7A 2RVCA 3NELA 4U7BA 3EFRA 5K1XA 2H27A 1O3SA 4XSXF 1USYC 4M78E 4CH6A 4IPAA 5FFZA 5L3EA 5C52B 4WK8F 2LKPA 1Z7MA 2WTEA 1K78A 1KQ9A 5DCMA 1QO0D 4OIOF 2D1VA 4NL2A 4XTWA 5LGNA 2Q7GA 1Z7NA 5ELOA 1U1SA 2ALYA 4NCXA 2GA1A 5LBQA 3QRFF 4F7UA 1LQ1A 2V1UA 4WF2A 1UFMA 1WRJA 3FMRA 2PJPA 1LNWA 4IXAA 5GAOr 4CZZA 2RHSB 2P7VB 2AMCB 4G94A 4BH9A 1QQIA 3JAMK 2GXGA 1QBJA 3HTSB 1BI2A 1NYQA 3LQRA 4GXOA 1P92A 3T0YA 4EGZA 2L4MA 2HTSA 2XHKA 3IALA 3U1DA 4N9HA 2RD1A 3FMQA 2RB6A 2OAZA 3JCMd 2ZCWA 5ILSA 1KU9A 2OZ6A 4EMSA 2XAGA 4M75D 4P3NA 4M75E 4XEOA 3H3UA 3RTRA 2ZMEA 2DO7A 4F7ZA 2IY5A 1FX7A 1TBXA 1YW7A 2PBIA 3WTYC 5AIPA 4Q15A 2VXFA 2DU7A 1W7PB 2FEZA 1KYWA 1O3RA 2LNBA 4A5MA 4LJZF 3V4GA 4IVNA 3MZHA 3L09A 4HWOA 3VFZA 2Z99A 5GANe 2OD5A 4U88A 3HHGA 2EJGA 5K5QA 3HIFA 4MQVA 3ECOA 3VU3C 1BIBA 2QHTA 4J5YA 4Q4ZF 5LJ5d 5IT3A 4C8QC 3RGLA 2PMHA 4YCVA 3SWNB 3JCMe 3BFMA 1U8RA 3IRQA 3T8TA 2IRFG 1TQPA 4M74A 2RN7A 4M7AB 1G4DA 3BY6A 4EV0A 1FY7A 3CO6C 5GMKl 3ZN0A 1ONVA 3KETA 1CF7A 3SB2A 4CS2A 3CJNA 4RB2C 4M78B 3P9CA 5LGTA 3HY0A 5ILVA 2W57A 2OBPA 3K2ZA 2DXUA 1B9MA 2P8TA 3L2CA 1W5SA 4H2XA 2M87A 1YFHA 3C1DA 2HWVA 2KIFA 1KOGA 2Y48A 3GXOA 4MTDA 2PFBA 5KK1A 2RKHA 4HX4A 2GQQA 4ON0A 2ELHA 1BI0A 3JCMV 1PYSA 2PEXA 4MGRA 4CXFA 4I98B 1O3TA 3DXJF 4HT8A 4M77E 2ZXJA 4L0ZB 1LDKB 3TEHA 1BM9A 4IHTA 5DEQA 5DD4A 4HW0A 2ISYA 1X55A 5LJ3d 2IJLA 4KT5C 4M9XA 4A53A 1A04A 3RPUA 3O6BB 1X2HA 3HXUA 3JCMQ 4YFKF 1ZRFA 3R4KA 3F8CA 4IJAA 2ODRD 4HX7A 4TWAA 2BGCA 4WX9A 5J6XA 1E24A 3JB9H 3M9AA 4G9YA 1YCYA 2YR2A 5ED4A 4M77G 3NENA 3VQYA 3E9IA 4YRSA 3ZN1A 2HS5A 4M7AC 4HX8A 1WI9A 1FZPB 4MMKA 3F8FA 4UV8A 1QNTA 1XGOA 2DVEA 3EETA 5E8GA 5GMKm 4L9TA 4EM0B 3JTGA 3KZZA 3FJPA 4PJOA 2DLLA 3COAC 4PCQA 1WWXA 3ZPLA 2BE5F 2EFOA 4H2TA 2K86A 3ULQB 2H09A 1CF7B 2DQ0A 3SWNC 1P2FA 3BY7A 3P8YA 4CH3A 1YFRA 1H4VB 1KA8A 2JT1A 2XV4S 2QQBA 4KN7X 2VE9A 5BOXA 3DP7A 3JCMg 3HSRA 5LJ3h 2NNNA 4FX4A 2P4WA 2P5IA 1S3JA 2MH9A 4L9VA 3ROUA 1KU3A 2HEOA 1U1TA 2CSOA 4P75A 2RC4A 2QQAA 4M77C 4HOBA 2HGCA 3MQ0A 4RB1A 2CYYA 4O6JA 2Q7HA 3Q9SA 3BPXA 1HXDA 3HFVA 3QO5A 4A5NA 1EIYB 2STTA 3ZMZA 3JCMW 2K57A 4HWSA 3WGIA 2CGHA 1B6AA 3WTWC 1MD0A 3C7JA 5GAMe 3M7GA 4A0XA 3ZMDA 5FD5A 4JRIA 5JFRA 2Q2EA
chains in the Genus database with same CATH superfamily
2KEAA 5C0MA 1KFZA 4UXNA 4CSWA 1IN7A 2I5UA 1JKPC 4E6KG 1BCMA 4A4FA 3H0HA 1VQ6A 3HTZA 2A3SA 2E5ZA 2I0NA 1I3QJ 4RQEA 3MD2A 2A69F 1IO2A 5K7HA 4P9FA 3Q0UA 4D1QA 4A3CJ 1VYUA 3VOEA 1IN5A 3IH4A 2ZZGA 3INZA 2CQQA 4V2GA 2E5QA 4YRTA 4G84A 5FLXK 4GYGA 1B70A 2EKOA 2KIMA 4RTUA 1QVFS 3F3XA 3LFKA 2KIQA 5TJJA 4C2MJ 3U23A 5JR3A 4D8KA 3CCST 3T5XA 1UB9A 1MMNA 2KVQG 3QIIA 4LDVA 1VQOA 4XK8E 3I59A 1Z7LA 4ELYC 2DW4A 2IA2A 2Z5UA 2KZGA 4RBOA 2YHTA 3PFSA 1WLPB 3I59B 4MFEA 1ZK8A 3JSCA 3CF5F 3CC4A 1D3BA 1WJ5A 1ULYA 1AWWA 2CQ7A 4WWCA 2F69A 4P3PA 3CC2Q 3L1AA 1SAUA 2ZJRF 1QWEA 4ZDPA 4IHSA 9ANTA 1OYXA 4AIJA 1RI0A 2EA2A 2PJRA 4KRTA 2L7ZA 1RIOH 3GLXA 1K6YA 3FIWA 3GYHX 4M78D 1ZSZC 3PCOA 3RBBB 3BTCA 1HBXG 5M9OA 1VQPA 1FSEA 1D5VA 4MNUA 1NK2P 4L5JA 3BG5A 3DKWA 1YJWI 4O3MA 1WJBA 4A3BJ 4S0HB 1OZ3A 1VQ7A 2OCCH 3LSKA 3SDGA 4LFUA 3FB9A 3KEYA 4M75C 5LJ3j 3RERA 3FBIB 2EIFA 3S8PA 3CCUQ 2R7UA 2FBKA 2CH0A 3CD6A 1K83J 4L5IA 1FBSA 1N25A 4P5OA 5D4SA 1AU7A 2FNAA 1I1SA 3H5AA 4JP0A 2OAUA 4FSSA 1MJ9A 2O4XA 1XMXA 2R58A 1V5EA 3CCYA 3G4SI 1EX4A 1ZSGA 2ZPGB 5FB2A 1HF0A 3OR1C 2LCLA 2R7RA 3DSQA 4JX5A 4CYCA 4U0YA 3CCMA 2CJ9A 2K2MA 4XRSA 1FIPA 3NMZC 3VUBA 1P4AA 4LLGF 3DPLC 3CMAT 2DBKA 2QGUA 1I4K1 4CC3A 2F5EA 3EH2A 1M5Q1 1ZKGA 2O5RA 3GZ6A 2ZJPF 2GXAA 3H9NA 2V9VA 3OYYA 2R7FA 2AHJB 3OYLA 1VQ7I 2L89A 2XUBA 2Y9ZA 1R0CB 4BI3A 4ASNA 4MHGA 3K4BA 1KQSP 4BHBA 2X9HA 4K88A 1LE8B 2GM4A 3O8VA 1W36C 2VN2A 4KUDK 1X3ZB 2EQKA 2CYZB 1SD6A 5H6QA 3W2VA 1ASZA 2O2OA 3WU2C 4LK1F 3E1SA 1FEXA 1YS6A 3J7AY 3ZQ7A 1D3BB 4ETSA 3RJPA 3ZOBA 2VWFA 2A6TA 2EV6A 1CQTA 1NPPA 1M2OA 3HKSA 4OGEA 3L4GA 3M4PA 4LDWA 3BG3A 2XGEA 3RQ4A 5LJ3g 4DBRA 2FEIA 2IVWA 2VC8A 2DE0X 1IO6A 4II2A 2RHIA 4DGWB 3GFMA 2MMPA 5CCAA 4NL3A 3D1NI 3MKLA 2QTXA 4FL6A 1ZN2A 3CCQA 1KMNA 2ZXHA 2E41A 1LFBA 4LG0A 2PNIA 3IRRA 1Q86R 2C7IA 3E6BA 2JXBA 3K70C 2OTLI 3RDVA 1BBYA 2YRDA 1NJIU 2V9PA 1B8AA 5FGMA 2G3RA 3PIOF 4M6XA 3WTZA 5EG0A 2W48A 2R7XA 2K7AA 5I22A 3M8FA 3HTUA 2DEUA 2RK2A 5HOOA 5HVQC 2LREA 2XGCA 3IP4B 4FW2A 1E22A 3KP5A 2RQQA 1R36A 2F1LA 4MQ9F 2X4JA 3EGXB 1Z91A 3Q3SA 1JJCB 4M75G 1QZYA 1W6XA 4F04B 4FISA 1IDYA 3PZCA 2DJZA 5J1RA 2CP2A 3QJYA 1UGVA 2Y9YA 2QBYB 2AKKA 2LQWA 4HV5A 2WWYA 4RAYA 3IL2A 1XD7A 3ZQCA 2BOLA 2IP2A 1UHCA 4KJZA 2MCNA 4GYIA 4PJOF 3UF4A 5GANf 1CSKA 3I55A 3UA7A 3RQIA 1LKXA 1VUBA 2CP6A 1RETA 2P81A 2W82A 1ETKA 4XK4A 3WG9A 4HCBA 1K7AA 5CQXA 4PLIA 4B47A 2D6FA 3S32A 5GAMd 3LOCA 4IEJA 2QZ8A 1OX8A 2DVJA 5LJ3f 1EIYA 2LSOA 1YI2Q 4NUBA 1SFEA 3META 3I9V2 5I2MA 5J3BA 2IGNA 2EB7A 3Q1JA 4BXXJ 3ME9A 4M75B 4RTVA 2J3MA 3QO7A 2E1MC 2RA2A 5D6WA 1RAGB 4M77C 2H6BA 3IKMB 1YIOA 5DUIA 3J7AO 1G8XA 3HL2A 1X43A 2BUDA 2ED0A 2BVMA 3L42A 5HY6A 1Q7YR 4BBSJ 2FBIA 2YX7A 2V1NA 3BZ6A 3K1NA 3LWFA 4U87A 4XM3A 5JHUA 1PUFB 5E1WA 1D8JA 2VOOA 4HEA2 5CKDA 3HOZJ 4WCGA 4FETA 1STZA 2MC3A 3MZYA 4QPQA 4ITVA 1XJWB 5K5RA 2DTIA 4D5CA 3GMEA 4IRIA 4J6YA 1WHMA 2VOPA 1YO5C 4L9JA 3I3LA 5LGUA 2XDVA 2QSHX 1V76A 3G6EI 2O9SA 2HAXA 1EH6A 3AG2H 5FKNA 4AIDA 1NG6A 4HVCA 2R4GA 2V7FA 3TQ7P 1QPMA 3I55T 4JX6A 2QHUA 3TO9A 2GOMA 3ZQHA 2VQGA 3BR2A 5DYMA 5F04A 2FNPA 2CFOA 3TQNA 5LEKA 3HUGB 1B8IA 1KSWA 3VWBA 3OV8A 2L3RA 3GOXA 4LVKA 2HPMA 4C92F 1JTYA 2ZZDA 2ZSHB 2WC2A 2VE8A 3K70D 3E19A 2VGNA 1KU7A 1ETOA 4KR3A 3EHQA 5E3IA 1VF9A 1KJWA 2RQWA 3RR6A 1IAWA 3HOTA 1W4SA 1W7PD 1L0WA 4C8QG 3VSLA 2CRGA 1GVDA 5H6RA 2E2IJ 4YTLA 3UFGA 3CJRB 4EMKB 5IP7J 4D5FA 2DFHA 4MFDA 3OY9A 2F6CA 3NEUA 5FKLA 3SZPA 2CS7A 2M3AA 3GX4X 3GNFB 2IXSA 1EKEA 3DTKA 1O75A 1UTIA 1EVKA 1DU6A 1OI1A 3M9QA 1N9SA 1YG2A 3V8JA 2B63J 4X9CA 4J15A 1EFWA 2ELJA 1SFKA 2O3FA 1OYYA 2CQXA 2IA1A 1ZQ3P 2NYXA 2K40A 2CUJA 2FVUA 3CCUI 4LVIA 4NC6A 1X2GA 3HFZA 2HQHA 4UHTA 3FX3A 2OZUA 1OYIA 5KCMA 3ZRGA 3MWMA 2X4XA 3UT1A 1QVFA 2OQGA 4LOCA 2CUFA 1JT6A 4S05A 1Z67A 3LSMA 2V8JA 1X1PA 1R1TA 3JSOA 1YI2I 2E3HA 4M7DC 1SHFA 4Y3OA 4BDYA 2EV0A 5E17F 4JUVA 4Q6GA 1A5JA 2FJ1A 2DQLA 3J80Z 1ZQ1A 3JRBA 3BJ6A 3EH1A 3E3VA 1TTHB 1XPXA 3CCJT 2FU4A 2KROA 1B72B 1XMAA 3D5LA 4X0GA 1PHTA 2JUGA 4C92D 1X56A 1GXQA 3QDFA 2CW8A 5D8KB 4II1A 2LF7A 1AOYA 3ABMH 3JB9F 2D5VA 3TEGA 1MMDA 5GANg 1YE9A 4AG2C 3CBOA 2M02A 2E2HJ 2PMEA 1I50J 2QUFA 2ME0A 4BEHA 1SANA 4C3JJ 2R93J 5D7UA 2MWPA 3EGXA 5F1RA 4YRQA 1GXIE 3UR3C 3HM5A 3CMYA 4M7AD 2L3DA 3LSHA 4IHWA 2ZGWA 2Q5HA 3ICAA 3PE0A 2DMQA 5EZGA 5KYYA 2O0YA 3ZP5A 3HPGA 1LFPA 4E70A 2HVQA 4KNYA 3P8DA 1J59A 3WTSC 3MF1A 3BG7A 3I5UA 2LTOA 3HUGA 4JRKA 2C0TA 5HKCA 3G6ET 1CGPA 4ZJZA 1Y7XA 3S1NJ 3L2UA 3AG4H 2PG4A 4BI8B 3IAS2 1N9RA 2V6EA 4ZYAA 3R07A 2MLGA 1QA6A 4I7HA 3Q9VA 4CICA 1KZHA 1M9SA 3JB9I 1RAFB 4GCVA 1LPQA 3CUOA 4R8HA 5FKOA 5DUKA 3IV5A 1XTDA 4M75F 2CREA 1YITQ 3NRVA 1HQCA 2MIOA 3TEDA 4J01A 2I4MA 3ZQFA 2YUQA 1TWFJ 2P4RA 2YLCA 1JE8A 5FKMA 4N4OB 4XQFA 2Q0OA 2BE7D 3SDZA 4AFSC 3CCVA 1NH3A 2R7VA 5GAOn 1I6XA 2JZ2A 2P4TA 1RADB 2I10A 2HQAA 2XASA 5L8RE 1XGSA 5KYUB 2ESHA 2E1NA 1B1BA 2WY8Q 1X6BA 1KQ2A 1QE0A 5D6YA 2PX9A 2IVMA 3TCJA 1VQLQ 5GAN2 1M3BA 4U0WA 5K1YA 2CUDA 2GF7A 2EA4A 3HRKA 1UMQA 4N4IA 1OQYA 3H41A 3VS3A 2WAEA 4G12A 2F2WA 1QVGA 2OAWA 1XB4A 2M30A 1MBKA 1K76A 2NVXJ 2N8GA 1NLPC 2CKKA 2ARUA 1WPYA 3X26B 3OIOA 1VQ4T 2GBYA 3P7NA 4N4HA 1RESA 1IRZA 3KUFA 3CCEQ 3HXXA 5F5WA 2LNHB 2EH3A 3VQYA 4F92B 5J39A 3I4PA 5IHKA 1MBHA 3HSFA 3HRSA 5KNLA 4J9BA 2ZPIB 5KYYB 1YIJT 1VQLT 4M7DF 4PGGA 1K6OA 2QQ8A 1W36D 3EG9A 1MSEC 4KQEA 4YDQA 2DQRA 4N0AC 4ZIBA 5C4XJ 3OIPA 4U0VA 4PJMA 2H1LA 4C8QA 3HOUJ 2FSWA 5IT9E 1USSA 5KH6A 2XK0A 3V42A 2EQMA 2ECBA 2V1RA 1NJ1A 1FP2A 3L00A 1QQJA 2XAQA 4OMNA 1FPQA 1IV6A 2FPEA 3PIOA 1C0AA 3OYBA 1ZHFA 3DV8A 3TO6A 2EKHA 3BROA 3M53A 1Y0NA 2EK5A 3OSSC 1TUGB 4CH5A 2FPDA 3W2AA 2EGAA 2R7DA 4F7UG 1BA5A 1IN4A 3FDRA 5IP9J 2Z3YA 3MP6A 1NJ2A 1MDMA 3IKLA 4XKWA 1YYVA 4P73C 5DD8A 1RUNA 3V7RA 2L01A 2XGTA 2WAQA 4CH4A 3SXYA 3L4GB 4UUVA 2CH4A 2CUZA 3WODF 4GLKA 2EL9A 1RC9A 3JRFA 1T0FC 2JRMA 1OCZH 5KYUA 2KRHA 3SZGA 3LL7A 3OOPA 1N8RR 1YIJA 5CLSA 4FIBA 5GMKe 2E7WA 3CCJI 2BXYA 2LNVA 2DJIA 3W3CA 1RL2A 2DK8A 4F91B 1R8OB 2FB7A 4OAZA 2E6ZA 2DA5A 2P6TA 1M90U 4UP7A 4ZTJA 3DU5A 4H4KC 4A3FJ 3OYNA 2IS6A 4B6MA 1LJ9A 3KIOA 4CUGA 1G5VA 1OQKA 4NOYA 2X4HA 1NTCA 2KE9A 1FBQA 4HPQA 1PKSA 5DS9A 3HRIA 2AO9A 2KRSA 1IN8A 1Q81R 4C0DB 2K4JA 4XICA 5M3FJ 1I6HJ 3VKIA 1VQMT 2KIUA 4I01A 1HSJA 2X35A 5GAN6 4ESBA 1QP2A 1MBJA 4BYYA 4OB2B 1VQ4A 4TTVA 4CYCB 2EZIA 2DI3A 4KN4X 4E2FB 2J3LA 5GAN4 2YU3A 1U6GA 3R60A 1X01A 5LJ5e 3DBRB 1XN7A 4A2UA 3J81K 3M0SA 2CWEA 3QPLA 3CESA 2A08A 1IUFA 2ZFUA 1QVPA 4TVAA 1HK9A 3KYCB 2WSEE 4PL6A 3S17J 4YFNF 2LD5A 1A35A 1IW7F 2MFZA 4BQNA 4RGUA 4R0KA 2C8MA 1QMCA 1SG5A 2KJBA 3HC7A 1ITYA 2FQ4A 1AKHB 1IUYA 2FOKA 2VQHA 1M2VA 3RDIA 1TUCA 1BU1A 5GAEJ 2IPQX 3VB2A 1ZLKA 4NHJA 1SETA 2BY0A 4YP0A 1YB3A 4ZH4F 2R5YA 4BDZA 1QCNA 3RMSA 1KQ0A 2RAEA 3T8RA 2L4AA 2RHSA 1JKQC 2EFQA 5H20A 2Z2SB 1OPCA 2F4MB 2QEXI 1B72A 1M27C 3KEQA 1JT0A 2RQUA 1CKAA 1P4WA 2HOEA 4XRMA 2ME6A 1GCQA 2ZIMA 1EH7A 2P0KA 1G6NA 4RGXA 4XORA 2H6CA 3IQLA 4RQFA 3RKQA 3RPQA 1GHCA 5D6EA 1ACMB 4A63B 5TISC 1YITA 5CQGA 1IF1A 5GAN3 5F0FA 1W1FA 2ID3A 1BJZA 2YDLA 1KGSA 1RABB 2V8KA 1R6RA 2IPOB 3V7SA 1M90R 4IQJA 2K9QA 3KZIC 3HFZB 2R7TA 4NDLA 4Q5SF 3VV0A 4BNCA 1Z1DA 2ZNYA 1MHNA 3R6OA 3NWSA 4Z2YA 4LVLA 2M51A 3REAB 1GV5A 4JBAA 1ZG1A 4XOPA 3S2HJ 1FMKA 3BCAA 3ELKA 4KT6A 4FHTA 2RF0A 1B34A 5KAFC 5ELNA 2Q2EB 5BMZA 1ADJA 3IWFA 3HXZA 2K3YA 3QNEA 3DFGA 2KXCA 4P72C 4CCJA 5HS8A 2EJRA 2BV6A 2JRTA 4UV9A 2RJCA 1KYZA 3CCRT 1B4AA 1OX9A 4KUIA 5E3MA 5IH2A 4E7IA 1SD4A 1D5YA 2GFUA 4LDUA 4AT1B 2AHQA 5IYBJ 3WHBA 1C0WA 4FE7A 1PG5B 3CZ6A 4IX7A 1MNMC 2E64A 3MEAA 2E4HA 1J09A 5DLOA 3CPWA 3HXWA 4UC4A 4E7SA 2O03A 2EYZA 1BR1A 4HDVA 2XSJC 2E70A 1J3TA 4EGYA 2ZFWA 4OMOA 2GIVA 4FE4A 2AXLA 2LY9A 4YG2F 1IXCA 4RCCA 4LG0B 2WA0A 3PNWC 5GAOp 3CCRQ 1YW9A 3OYDA 1VQKI 1VQ6I 2R5MA 3CPFA 3MCAB 4EPCA 3W3SA 3CTAA 1WJFA 4QWQA 2F5VA 4M72A 3OB9A 2Y4XA 2HVRA 3KP2A 2V1DA 1R5HA 1WJRA 2LDMA 1N75A 3IHUA 3GNGA 1IG7A 2MWOA 3LGFA 4K11A 2E1HA 3UPUA 1S72T 5D5VB 1G5HA 2G9WA 5EZHA 3GTMJ 3OSFA 3CCQQ 5HK3A 1EA3A 1RUOA 2STWA 1JXMA 1HOMA 4YFXF 1VQNQ 1JHHA 4YRVA 1I81A 2PUOB 3FLGA 3E6DA 4EJVA 2B86A 2EIMH 3K1PA 2DYSH 1RUWA 2MD0A 4M77B 5CKFA 1VQ9T 2I4OA 4M75A 3HXYA 1FTZA 1K8AR 4TVYA 1OCTC 1KHIA 5DV5A 1UGSB 3X20B 1GLNA 3A0HC 2DPUA 2HU9A 1X27A 3QO3A 4JQFA 2COMA 2X3WD 2KR3A 1OCPA 2QM3A 4CS3A 1SERA 1M1EB 2RNJA 4ME7A 1T0FA 3BDDA 2MA3A 4DZJA 1VQPQ 1K9MU 1A36A 3C94A 1GRIA 4I0BA 2FBHA 3BWGA 1TOVA 2A6EF 2DIGA 3QSUA 5DLQE 4AUXA 1E1OA 2LT4A 1EH8A 4BEHB 4BUGA 1VQ9Q 4WTOB 1A0NB 4EIKA 2VBXA 2QXFA 4BJ6C 2Y75A 3E5QA 1QCOA 2W84A 2EFWA 5GJVB 1X1CA 1P7IA 2ZNIA 2K9NA 2P7CB 3JCMh 2ADUA 4RTZA 5ICGA 3NETA 5GPCA 1V4RA 5EC7A 1Z6TA 3VBBA 1T3LA 1TWBA 1H4TA 3KLOA 3JCMX 4M6VA 4ZYHA 4J7FA 5J26A 1UZCA 4WXHA 4BJTA 2RI3A 3NARA 2AXTC 4GO1A 1S7AA 3S3NA 4OIQF 1WHGA 2DZCA 3VS7A 4BS9A 3LSSA 2DXIA 4B3AA 1J2XA 4C0FA 3NWTA 1GUUA 1HW2A 3ERED 4NB5A 4DW6A 1TT0A 2XF7A 2J05A 3FXJA 1ZRCA 4X5OA 3LA3A 1LVAA 1YJWQ 3PFYA 4FU6A 1XDUA 5IN1A 4WJ3M 4Y52J 1WHHA 2A05A 3DB3A 1OLTA 1USTA 5FU7B 1B76A 4L9NA 1U5SA 1MKMA 2FHDA 4M7AF 4YREA 1VQ6Q 1WQ2A 1J5YA 1XSXA 3IH3A 1L3LA 4UUTA 4B4CA 1DU0A 4HXJA 2QA4Q 4F17A 4YPFA 2G0EA 1O57A 3G4SQ 3BOQA 4OMFB 3OW2S 5E1ZB 4LK0F 3ULRB 4XMYA 1WHJA 4EDUA 4M7DE 2VXZA 3W6KB 2M0OA 2DMOA 3QDRB 1O7LA 2RHQB 1NHAA 2CSIA 3LNQA 1HYOA 4B9XA 1AZEA 2ZR3A 2AT1B 1Y39A 3LX7A 3I56Q 1QWFA 1UJ0A 4P74A 2HQEA 4KR2A 2DX1A 5JHFA 1ODDA 2VBYA 2K9GA 3RF1A 3EG3A 5HLGA 3H5NA 3L2QA 3S2WA 4P72A 4YRNA 1H8AC 3KYDB 2M8EA 1W70A 3PGGA 1JEGA 4X1VA 1TWAJ 2E3CA 3AL0C 3HOVJ 2RJFA 2JPCA 4TQDA 2EZKA 5D4RA 3EGDB 1QHGA 1M3CA 4HCZA 4WXCA 3SFZA 4OP0A 4AFQC 1SKUB 5FLVA 3MZ8A 4NC7A 2O8XA 4RKUE 2V26A 2CG4A 1K4SA 4N0AA 3BJOA 3ABUA 1H641 1RLQC 4HNVA 4Z88A 2UV1A 2IS1A 2IS4A 3A8OB 2UXNA 4RTYA 3SWNA 2LC4A 4MDWA 2Z0WA 2QEXA 3JB9G 4LVMA 3ZQLA 4A3LJ 2QSFX 3QUIA 2XDBA 1YS7A 4Y4RA 4XRSG 4MZMA 2CH4W 1M8MA 3B73A 1BI1A 1AHJB 3EFOB 4LG3A 2KRMA 2J5OA 3URGA 3KP7A 2JTMA 1GBRA 2P0LA 2K02A 3E6MA 3FBNB 1JGGA 4KH1B 1D1CA 4C0DC 1PYSB 1D1AA 2HDCA 1VQOQ 4BY6C 2CW7A 2OF7A 4W97A 2IA0A 4IUUA 1RAEB 4M78C 5FU6C 1R0BG 2HKOA 4XTZA 2LKSA 4RTTA 3VYGA 4FYYB 5J1YA 2BZTA 5C44J 2VODA 3BJUA 2CGPA 1F4KA 4BY7J 3JRCA 3QYBA 1A31A 2XAJA 2NNYA 2NLUA 1ETQA 2R0QC 4M77F 2M4KA 3A8MB 6PAXA 1R1VA 3TU4K 2V6CA 3UKGA 1YCSB 1K9MC 2DMPA 2R7WA 1O3QA 2JUCA 2M0CA 4KYWA 4EJUA 1I27A 4KISA 1EOVA 4DBQA 3M56A 1EZZB 1K0XA 2VL8A 4OB3B 1ZREA 3ZXSA 2QBYA 3G71A 2ZB9A 4XKCA 2RHUA 3DLLA 1YHQT 3CMMA 3GCMA 1TTYA 1VQMI 3DPTA 2DA4A 4B43A 1RKWA 2KRNA 3HTRA 4C8QB 1IXRC 2NRAC 4TVWA 2HYGD 3OYJA 3HFNA 1H88C 1WJCA 3FZVA 4BJ5C 1YOVB 1XMKA 2DA6A 2EAYA 1ZAOA 2KDZA 5GAGJ 2L9SA 1APLC 2L0AA 3JB9D 4H2YA 1VYVA 4MTEA 2XF5A 4YIIA 4A6DA 2LMJA 1YFSA 3C3WA 5GTIC 3FK7A 4G6TB 4JS5A 4V2FA 1QPIA 4FYWB 4EMGA 2EPDA 1BB9A 5JVTA 3WTTC 4PG3A 2DTHA 4PJOB 3HG9A 1Q86U 3RKXA 2LK2A 1G3TA 2ZXIA 3PNYA 4HQMA 2NVQJ 1ABOA 4HT4A 4OIRF 2KMTA 1F1ZA 4QVDA 4V2SA 2Q1ZB 3TREA 5EEGA 3IKVA 4A3GJ 1T3SA 2HBWA 3DKMA 2NUPA 2DDZA 2VKHA 2DK5A 2JNGA 2P0WA 1ENHA 2PU9B 4XKVA 3ZR8X 1LJOA 5F0HA 3ECHA 4WXDA 1ZLJA 1VIEA 3GPLA 4YRPA 2EIJH 4P55A 3N97A 2R57A 2MG4A 5JI6A 4RCBA 3J80E 3OYGA 1DP3A 3E6CC 2FO0A 4D9JA 1G2BA 2KKOA 3GTJJ 1ZBXA 2DZ9A 5I11A 3K6GA 3LAPA 3KE2A 3EFOA 1IHWA 4EX5A 1RIQA 3RIRA 5K5OA 4HVUA 5CQYA 1VQOI 2O6GE 2QGFB 2OC6A 1FSHA 2PMZA 3DEWA 2XGXA 1PUEE 2Y4YA 2R7ZJ 4C8QF 2IEKA 4C0GA 4LITA 4B3XA 2F2VA 2YLBA 1HSQA 4BE0A 2DAOA 1QP3A 4M73A 2Z9OA 1GXPA 1LNXA 2X1EA 2JVVA 2BZYA 3A7UA 2EQJA 1WKMA 2VJ5A 2M9HA 3WVEB 3VPRA 3CF2A 1UHWA 4P1WA 1HDDC 1F9NA 4PJLA 2OTJQ 3HSEA 2BZ8A 1S5LC 2MAMA 1WX6A 3J80K 5GMKh 5GAMg 3CXCP 2KQRA 1MSFC 5ILUA 4JZ3A 3JCMf 4J00A 1TXQA 1OKRA 3VODA 3MKDA 4XQ3A 3QG1A 1B8IB 2A0FB 3OR2C 3HDDA 2ZMEB 4C92A 1JGSA 3EUKL 1FNNA 2MD5A 3SEQA 3SEZA 4Y17A 2A28A 4IKFA 2JOYA 3MEVA 5AYFA 2HQRA 2GLOA 1R5GA 2HDAA 2HZTA 3LMMA 4Y33A 4ZGDB 4G6DA 2MPXC 3HOSA 2JN0A 3CEYA 1V5GA 4RUGA 2X6YA 1LPLA 3EUHA 4ENMA 4JJCA 2XF6A 2E65A 3C12A 5FWBA 3VYRB 1JI8A 4CCLA 1Z0XA 3KYLA 3OL3A 2XB0X 4PSWA 1PUFA 1BK2A 1MV3A 4PJNA 3HHHA 2H94A 4HZFA 3HOWJ 4LXCA 2ZZFA 3K0LA 2ARSA 2ZXWH 2XDPA 2XAFA 5GTHC 1YIJI 3F70A 3A1PA 2XKPA 5HS9A 3WQZA 4AFUC 3KLNA 2GTJA 1U2WA 2YU9J 4YRKA 3TL4X 3EG1A 4JLGA 2YPRA 4P5NA 3HB9A 3PSIA 4HLYA 3BQYA 2OU2A 3K4LA 4A3KJ 1ZH5A 4YRCA 5KYWA 2L9VA 2CQKA 1ZELA 1UB4A 2XRNA 2ZT8A 3FKIJ 3FWEA 3OS5A 5EYRA 3TW6A 2HD0A 4II3A 4ZTFA 5FW9A 3IC7A 1JJ8C 5IXFA 1IB8A 1P4XA 2Y0SA 1IJWC 4EMKA 2LQ8A 3H9QA 3CLQA 1X6GA 3F8MA 3HRTA 3GTQJ 1YITI 1XC5A 1U3EM 1IGQA 1JJCA 2HBPA 4FT8A 1ADYA 5B5EC 1ETYA 4AVZA 5IT9Z 1PWTA 3GFJA 2HDWA 3MVPA 2XU8A 2EQIA 2YUNA 1OCOH 4EJWA 3L2VA 2QQSA 1N77A 3H3VK 3ZBDA 3GZNB 3CPWS 4OMYA 1MMSA 3JB9J 4RGRA 4I6ZA 3CP2A 2Y0SN 3K7AJ 3NQOA 1Z7UA 3R6SA 2FRWA 2X1DA 1PP8F 2M0YA 4C92G 1VQKQ 2A6HF 4LDXA 2ODRC 2QHSA 2DA7A 2F5DA 1ZUKA 4C92B 2WADA 1D8KA 2QDYB 2K9LA 3F21A 2DA1A 3H0IA 2NVTJ 2JSCA 3CCLA 3LWIA 1G3WA 2E60A 3CMQA 5DCMB 1GL5A 2HVSA 2PI0A 1RKTA 2AKWB 2X3XD 1YW8A 4A3DJ 4LUEA 1JKRC 2CUEA 3BZKA 3F6OA 5CR2A 3J81E 2DERA 3I7FA 3TEHB 2LFBA 4XLPF 2DL5A 3E97A 1OPLA 4R1HA 2DQ3A 2YT6A 5KCHA 2WB1N 2DT5A 1VQNI 3M0TA 3B6CA 1NYRA 2L3SA 5TRDA 4QQGA 3GF2A 2VQLA 3ZMSA 2K3BA 3ZL7C 1KD1R 4QT7A 2R5ZA 4BB7A 4YIRX 5KCOA 5GANd 2YSQA 4XL9A 4EMHA 1UCRA 1KHCA 1VQ7T 1TW2A 5I2SA 2M34A 1Q7YC 3G71I 1B7YA 4B44A 1N78A 3TSWA 4H0EA 5BNGA 1O7FA 1AHDP 2HNHA 4FM4B 1JBMA 4LN2A 1P6RA 1YJ9T 3CD6T 2ZT6A 4P73A 1X4PA 3LSIA 3Q5FA 2O61A 4H2XB 3CQZJ 4Y15A 4AD9A 3MKWB 3DB4A 2E5AA 3OBWA 3LH0A 1JHFA 2ELKA 1GGMA 3S93A 1JQQA 1QGPA 2R7QA 2KDSA 4NBQA 4PK4A 2OI3A 1D0ZA 3F22A 2FMYA 1OYWA 4ESRA 2ZC2A 3AG3H 4NNJA 2GNCA 2VASA 3O8HA 4ZZLA 2NVYJ 1YWOA 3CD6Q 4P9UA 2IY5B 1YJ9Q 2KT8A 2ECZA 1Z05A 3DU6A 3M4OJ 1SEMA 1B59A 2EJFA 2VKNA 2DBMA 3LSGA 4XSZF 1ABQA 2DFFA 3M5AA 5GANj 1X4OA 2W25A 11ASA 1AOJA 3CP8A 3G3ZA 1BR2A 2GOXB 3DTEA 4IQ4A 4BL0B 4IZZA 2FZGB 4J83A 4C5GA 3CCJQ 1JUPA 1YX5A 1PSEA 2PMZN 2ZPFB 3JW4A 1X2KA 2NUZA 3LGLA 3F6VA 1PSFA 4LD6A 5CO7A 2JQ7A 2K27A 3A8GB 1LYLA 5EEHA 1RZ4A 4J6WA 2KJCA 1BBWA 4F3QA 3A32A 4JOMA 1DQUA 2XAUA 4L18B 3UDCA 2IAIA 2X9DA 3W6JB 1B07A 2DBBA 2ROLA 2PN6A 2IG0A 2W4SA 4G6QA 3OSVA 1J0RA 1FT9A 1JTXA 3OYHA 3MO8A 1KD1U 1MIJA 1OCRH 4L0YB 2MW8A 2M5WA 3TBIA 4QTRA 3PM1A 1D1BA 1GVJA 5D6XA 3KP4A 2ZT7A 4P75A 2MABA 2LH9A 1REPC 2XKOC 5JVGF 2YWWA 2QGGA 5A2QZ 2BYVE 4R55A 3FMSA 4LE9A 3I56I 1U5TB 1QLYA 4QQ6A 2R5YB 1SVOA 3QOPA 1LE8A 2DRKA 2PQWA 3GO5A 1NEGA 5F0CA 1HD3A 3E2UA 4PKCC 2LC2A 2H3EB 1AD5A 3BR5A 2H8WA 4CA0A 2ZBKA 3QODA 3KZYA 1S29A 3W2WA 1RNLA 4CRIA 3TKYA 5CQEA 4RLFA 3CCET 5TGTA 2HSPA 3CO7C 2RJDA 2G6FX 3G71Q 1BBUA 4F14A 4JRPA 2XGDA 3G1JA 3SZTA 5FLMJ 1ETXA 2XSDC 1VQ8I 2RH2A 1YIJQ 5A0GA 1MNEA 3CJTB 1G59A 1YRNA 2RQVA 4M78F 3I0TA 3LSQA 4M7DD 2AS5F 4P74C 4PHCA 3Q0VA 4C3HJ 3GBQA 3BR6A 3I64A 2FE3A 1V29B 1TSFA 2D0QB 3H0FA 5GPAA 2XMFA 3OMGA 3QYEA 4J9DA 3UA6A 5K1PA 5FKKA 1WJAA 3HHTB 4A3MJ 3G71T 1UAAA 4QW2A 3M8EA 3U2RA 4Q48A 3PTAA 3VS2A 4ZTUB 1Q86C 1XCVA 2L9RA 4ELZC 1I5ZA 3QYGB 1B9NA 4I2OA 2LRQA 3LLRA 4YROA 1LDJA 4DOWA 1NM7A 4E47A 2W7NA 2JMWA 3OSGA 2EYQA 4BW9A 4PNOA 4LNSA 2ROTA 1ZGAA 1ZGWA 1QZZA 4RLQA 2QQRA 1XSDA 3P5JA 4EATA 4ABZA 5EGOB 3CCSI 2ID6A 4KA4A 1WQ7A 2RI2A 2XICA 3AT1B 4CI0C 1W2BA 4H2SA 1O4XA 2EW3A 1W4MA 1BI3A 2GXBA 1PNJA 1XNIA 2V79A 5ERIA 1V1CA 4DEXA 3MEXA 4A3IJ 1YX3A 2LQKA 1SMTA 1V54H 4KMUX 3RUXA 3CC4I 4BE2A 5GAN5 4DZPA 1FTTA 1IDZA 2LVMA 3TDUC 1FOWA 2A68F 3EG0A 5LJ3e 2CJBA 3BR3A 4UVCA 3R0JA 4UUSB 2FXAA 1UHSA 1X3WB 1E3HA 2M4GA 3GTPJ 3CC7I 2PZ1A 3J81Z 5KYXB 4H2VA 4KICA 4IHYA 1YWPA 3RYPA 4A6EA 5BS6A 2KI7A 4E51A 3KFUA 4A54A 4HG2A 4WJ4A 2ABLA 4CC4B 3DWLE 2K4BA 9ATCB 3KXTA 1YJWA 3CCRI 2JS0A 3S2DJ 3OW2A 5K7ZA 4FYXB 1UEBA 2XROA 4RTXA 1M90C 4GFBA 3DEUA 5FROA 3HBLA 3LC0A 2Q7EA 4KITB 2A7YA 2Z1DA 1S1NA 4PJOE 2TDXA 3K1MA 3LAJA 1IHVA 2GGRA 4ENJA 4K2EA 4D7NA 1WPKA 2Q8KA 4HF1A 2PMFA 1E1TA 2CMPA 3VSKA 2BBYA 5FWCA 4F7UB 5GAN7 1DUXC 1Q81C 3QTCA 3REXA 1WFXA 4N9IA 1E3OC 2E12A 3N5BB 2ALYB 3G1ZA 5KYNA 1OEBA 1BOAA 2ETHA 2DOFA 4AU7A 1PKTA 5HLHA 1H3HA 2WY7Q 2ZINA 4HWTA 4Y91A 3I53A 2JSPA 1E3PA 1V5FA 1ZTRA 1ORKA 2JK3A 2MBFA 2O8KA 2DMTA 1XOVA 3JRHA 7AT1B 3A2KA 2MI6A 5GANh 3HYIA 2HZDA 2WACA 5FFXA 3WTVC 3H35A 2DXBA 3JSPA 1K78B 5D5XB 4DNCA 1JRIA 4AFZC 2LRDA 4PSXA 2BXZA 1WQWA 2VV5A 2GFAA 4E6RA 4PDKA 2RM4A 3NEMA 3OYKA 2QASA 2L7FP 4AYBN 3NTHA 2XDDA 2QYOA 3D5RC 1J7KA 2F48A 2VPRA 4LMYA 2Y90A 3MF2A 2TCTA 2ZKZA 4BQOA 2FZKB 4XU0A 2ZO4A 1TQMA 4FSXA 2HL5C 5LHGA 3A01A 2NXNB 3H6ZA 2HOAA 3G4SA 2VXEA 1X3UA 3CDLA 1UG2A 1N8RC 5D5UB 2BKDN 1XCBA 5F64A 2E2JJ 2GAUA 2YS9A 3FM3A 1KC8U 2YX4A 4BACA 1WNLA 1W7PA 2HL3A 4QVCA 3VEPA 3OYEA 3TOAA 1G3SA 3KFWX 1R00A 3H9GA 3T9NA 2EILH 5A2QK 2FPFA 5LEJA 4BD3A 2M2EA 3RCOA 5D6FA 1MBEA 1B3QA 3CPWP 2HYFA 3FF5A 3H92A 2R3SA 2DL7A 2FF4A 2OA4A 3A5ZB 1X1DA 2XC7A 2VT3A 4OMPA 3PIPA 1Q7YU 2Z33A 1RLPC 2LZ6B 4YCUA 2RQPA 1SF9A 5IY5H 2H8RA 1YP5A 3ERMA 2KHMA 1G3YA 3DCFA 1MMGA 2COWA 4ZYGA 1VQZA 3I71A 1FLIA 1UHMA 4CO8A 4AWXB 4K87A 2DODA 3ML6A 3FM5A 5C4JJ 1PDNC 1O9SA 1SFOJ 3MKZA 3D0SA 5IXBA 1UGRB 4XLEA 1MZBA 2SEMA 5HODA 4J7IA 1XGNA 4ZYEA 4A4KA 5F27A 3KX2A 1TUDA 2ISZA 4M6YA 2P5LC 3RSNA 2HQNA 1WI3A 5FO5A 3A0BC 2LF8A 4B48A 1DPUA 1ZSZA 2K3XA 3OS0A 3BDLA 5E3LA 3M57A 4RMFA 3VQXA 2E36A 5GMKj 2EZHA 2Y0MA 5J8CA 1JUMA 4LLNA 1MGQA 4RS8A 3W6VA 2JWTA 1UGQB 2D45A 1BJAA 2RREA 2IIMA 3IKTA 5IHIA 1TZLA 3SEMA 4EVIA 2GBQA 4IRHA 1NYFA 4LUDA 4XBFA 3CCLT 4RB3C 1Z77A 2A07F 1I0CA 4KMFA 4TQFA 3CMAA 4M3DA 4UB8C 1WI7A 4BQAA 2D1XA 1B7YB 3S3MA 5EG2A 3EDPA 2E71A 4UUSA 2XPUA 1VQNA 3UWNA 4BQQA 1Y57A 4M9SA 4A3EJ 4NS5A 3ZMTA 1SPKA 4OU0A 2RMOA 2HQ5A 1PRLC 2KQWA 1R77A 1AWCA 4IHVA 3OQ5A 4JLIA 2NS6A 3PO2J 4DOZA 4IL6C 1WXTA 1QVUA 3ONQA 3RI4A 5FLXE 2GQIA 2HEQA 4M7DA 2F2XA 4XU1A 2D9TA 1F43A 5IHNA 1YJNT 3NGPA 2EWNA 4LIVA 4MEXF 1UHFA 2P0QA 3I58A 3ZQQA 1XTAA 1I1GA 1NPRA 4NQWA 3HKZN 4C8QD 1XDSA 2CO5A 3AFHA 3TO7A 1WU7A 3M1EA 2QA4I 3BZCA 12ASA 4OIPF 4CZCA 1ZBJA 3PT9A 1AEYA 3VQVA 3CCQT 5D5WB 3QAHA 1BL0A 2M16A 2E7XA 3QPHA 3DQVC 4CCMA 2L3QA 2E3IA 2QAZA 3HL8A 4F93B 3C2BA 1EVLA 3I5RA 2I4LA 3AAFA 1NJ8A 4A3JJ 1SAXA 2QCOA 2GA2A 2DNUA 2X51A 1VQ8A 1WLEA 4RAGA 1X2MA 3UNGC 1FC3A 3GVAA 5AONA 1K79A 3WGGA 1H3ZA 1K0SA 1RAHB 3ER0A 4ENKA 4ZYDA 2WSFE 2KAFA 3FC3A 3IUOA 4XNFA 3WU0A 2EFPA 5FD6A 2QSGX 4OMMA 4IIOA 1VQPT 3P8TA 5IOYA 1AA7A 3IH2A 4YIFA 2E5NA 1UGPB 1R58A 1UUEA 3EYIA 2IW5A 4CYDA 1NJIC 4MEYF 1M3AA 4H2WA 1FMVA 2FRYA 3A03A 1AWXA 2KYBA 1ETWA 3KFVA 3HOXJ 4DPGA 4Q5WA 2COBA 4LB6B 1VQMA 4ZTZB 2ZNZA 3UGTA 4PJJA 2MC4A 1X19A 4MO7A 4AIHA 3HGGA 2K5FA 3GIBA 1OULA 2K7LA 2DYIA 2RQTA 5LFAA 5ICFA 3JCMc 3I56T 3ISPA 1OMIA 4E7KA 1JB0E 2RHYA 1ZRDA 4LD5A 1NG2A 2W24A 2LX7A 4MZTA 1X2QA 4KT0E 3BW1A 4B8XA 3D5SC 2XPWA 2K4YA 1HW5A 1MW7A 2DFIA 1MDMB 3HPWA 3QWLA 2IT0A 1R23A 3M1CA 1BC8C 1ZUYA 4C92C 4D7MA 1IGUA 4OB1B 1KC8C 1S6LA 1WJEA 1IZ1A 2E19A 2FD5A 4JYKA 4MZPA 1G5IA 3MP8A 2O9LA 4VUBA 2K5CA 2FQ3A 3E5XA 1WSUA 2Y69H 2CU7A 3B6AA 3SD4A 4BAYA 1JXSA 2DPPB 2UZKA 3D7SB 2WV1A 4L5GA 3OBYA 2KL4A 3LFUA 1OR7C 4EJTA 1LEBA 2X6WA 1RPWA 1YFNA 1QVGP 3A7RA 2VPLA 4TVRA 2L7KA 8ATCB 1VQ5T 4XEMA 5GAMj 2B9SA 4AYBA 4ENNA 4BHCA 4I0AA 4UP9A 2ZJ2A 5FRMA 2V9KA 2AK5A 1SSHA 3K2AA 4CCOA 3FISA 3PL8A 1EFNA 2ED1A 1Y07A 3CLOA 1SEUA 2VC0A 2HDDA 1U9OA 4RAFA 2M0MA 3ZGKA 5LHIA 2K5LA 3ZQIA 4IF4A 4J9GA 3I56A 1ZGJA 2BTTA 3SFMA 1WYDA 5KNNA 2JUFA 2BW3B 2DO3A 3CCEI 1ZG3A 4XTVA 3OL4A 5E79C 1H92A 2HSEB 1DP7P 2HYJA 1IREB 2FMLA 4XIDA 1VQ5Q 2ZT5A 1KMMA 2GWRA 4A4HA 3FXLA 2O88A 4EO4A 1Y1WJ 3BDUA 5CVVA 3RESA 3HPHA 4OMLA 4BUPA 4L87A 3A74A 2JA2A 2CP3A 3SHWA 2MGQA 1KQ8A 3LSTA 5LJ5h 3OMYA 1E2XA 1UELB 2VLAA 5CVUA 2LCSA 4MMLA 1ZYRF 3HJEA 2JW4A 5A2QE 3M59A 2PLYA 5LD2C 3OA6A 3GWZA 2VIXA 2FG0A 2XHCA 1G51A 2CS3A 5L3GA 4HDUA 1YHQQ 3F72A 2E1CA 1RACB 4F7UE 1BR4A 1JKOC 4Y13A 1IXDA 4R79A 1HLVA 1D3YA 3CDHA 2L3PA 2NUTA 1YJNI 4C5IA 4YRRA 4CDGA 1P7JA 2MYSA 5IYDJ 2QG9B 4XTUA 3G7ZA 3VJPA 4YCWA 3JRGA 1OR7A 4HA8A 1NE8A 3JCMJ 2HNIA 3EAEA 2IGKA 5CVJA 3RZDJ 1FOKA 4E7LA 2NUTB 5GAMh 3CCJA 2DL3A 5CVIA 3SQNA 3DTIA 1QVGS 1JJ2S 1ERDA 3JAMZ 1SFUA 3PQKA 4BBRJ 1YRNB 1PD1A 5HK0A 1E6HA 2GCXA 4HCCA 4M7AG 3FXKA 5GADJ 3TUPA 1IXSB 2JZYA 1H4SA 4B09A 1N9WA 3CCSQ 4BU2A 1X54A 1QHHD 3CC7T 4M71A 1GDTA 2KYMA 1S72A 2D2WA 3K69A 1TNSA 2P84A 1ZA2B 5E20A 4RDUA 4AH6A 3OW2P 4M78G 5C53B 4ANJA 2DKGA 1IN6A 3A7AA 3MKYB 2KXDA 3CC4Q 3BP8A 2YRCA 3CC2T 2RHQA 2CZ0B 3BCBA 2CW0F 1ACIA 1K61A 1WJSA 3ZEHA 1ZR4A 4B9WA 1VQ9A 3QU6A 1HW1A 1JJ6C 3PSFA 1NJ5A 3CC7Q 3H1CA 3KP6A 2AQEA 3LA7A 2NOJB 4FX0A 5HDKA 4RGSA 1WDXA 1K4TA 1FBUA 1WHUA 1B70B 3HRUA 2LMDA 2ZMEC 3TGNA 3FIFA 3LSPA 4BI4A 1SRLA 3QQAA 2KLOA 3EUHC 1TL8A 1UFFA 1M1GA 3BJAA 3H5RA 3ZFJA 1HSTA 1U9NA 4UVBA 1TC3C 4KFCA 2CFXA 3GLLA 5IT9K 2VVKA 5J47A 3M0UA 1RR7A 3TOBA 1HKTA 4IUPA 4XU3A 3VS4A 2AMCA 1Z9QA 2HR3A 3BTLA 2WSCE 3TW7A 3M8JA 4P3OA 2LJ0A 4KDPA 3O8GA 1N5ZA 3NFCA 2OTJT 1ZSZB 3A31A 2K9SA 5EF6A 3AL0B 1W0TA 2GTOA 2I2LA 1USYA 2E1MB 3WTXC 3CMAQ 5HGQA 3BG6A 2FL7A 1SRYA 1H9TA 5KE3A 2RJEA 3M07A 4ORZA 3LW5E 1ATIA 5E1XA 5E18F 3I4NJ 3JCMP 4DJAA 3TEEA 4MIMA 1KU2A 5C3EJ 5LJ5g 3CC2A 1HKQA 4ATOA 1UDLA 2OX7A 1VI0A 2DETA 2JVHA 3QBYA 4E7ZA 2LBFB 5GJWB 1X2NA 1YQAA 2W85A 1WHKA 4U7DA 2JPBA 1SD5A 5DM7F 1JJ2P 5A0LA 4A0ZA 1YLFA 2OCEA 2WAFA 3VQWA 3TDZC 4CH7A 5HS7A 2DEQA 2UUZA 1VQLA 2MF2A 2KDOA 5CVRA 3ABTA 3K4KA 3REOA 2OTLA 2K79A 4PZJA 3QHSA 2X6XA 4PFPA 2NVUB 4PLLA 4M9ZA 2PVGB 4EM1A 5C6SA 2ZPBB 4RG2A 2VONA 2Y31A 1TWGJ 4HLXA 4JZ4A 1LOJA 5IAYA 1POGA 5CYVA 3HGYA 2XTIA 3MQZA 2MLKA 1DDNA 1NEBA 2MOXA 1U0JA 3LQQA 2CP5A 1YJ9I 1I8FA 4BY6B 1U78A 1DGRM 1TLHB 4G7ZF 3FXMA 4KGZB 2G4CA 2C0OA 3R0AA 3AHUA 2KNBB 2UWMA 3R61A 4F7UF 2ZXFA 2BEOA 1J9IA 2HKXA 1U06A 1MH4A 2ARTA 1S72Q 4HNTA 2M45A 5EJCA 1SD7A 3G6EA 1EQRA 2JN6A 4GLMA 3MMYB 2RNAA 1LB2A 4A12A 4XONA 5F6FA 2DL4A 4J6XA 2DU9A 5CPRB 4XLNF 1YTYA 1VQNT 2A8EA 2JM8A 2CP7A 1A6QA 3GW2A 5B1BH 3HFOA 2K3FA 2QEXT 2DMUA 2DN0A 1SHGA 4P96A 2EV5A 4NQWB 3JRAA 3LH5A 1Q82R 1ZG5A 1Y1VJ 3HEFA 4IO9F 5J4YA 2CZ1B 2J06A 1KD1C 4IUVA 4UVAA 5DCFA 1VQKT 4J19A 5DY9A 1W2BS 1T0JA 2XVCA 4I09A 1IZ6A 5J1UA 4XRFA 2CDTA 1MNDA 4QPOA 2QA4A 3CCVT 1E17A 3HXVA 2K2VA 2DMNA 4OOIA 3ZMVA 2X85A 1X6OA 3S1MJ 1QKXA 5GAOq 2L02A 5LJ5j 4TV7A 4F55A 2QEXQ 2RHXA 3J7ZI 2DM1A 1M1FA 4C5HA 4E7HA 4R56A 3UGQA 4YRGA 4BHPA 2JTVA 2L2OA 2JA5J 2JM9A 4YRFA 2DXCA 5KVRA 4XKBA 3QZ5B 4C5EA 1TH7A 4PFZA 3FHZA 2JA6J 3GUDA 4I76A 3CMEQ 2AZVA 4G7HF 4BY1J 1KQ1A 2JT4A 2HPIA 4D6WA 3M4QA 4M77A 1T08B 1QRYA 4YEJA 1FWZA 3F23A 1WYXA 3I55Q 4Q47A 1VQ9I 2PVDB 2F5CA 3FJ5A 3RYRA 3GFIA 1YHQA 2EGEA 2RGVA 5E8IA 1ZHIA 3CUQB 2J5PA 5J4VA 4EQQA 1DJ7B 2LJ3A 4IURA 1Y0UA 2H3JA 2O9VA 4ZNXA 2VT2A 2M8GX 1R22A 3HRMA 3QPSA 2OJ2A 4LIUA 1M1KC 2PVOB 1Y71A 1CKBA 2LP5A 4XU2A 3BR0A 2QHVA 3G2BA 5BPDA 3FRNA 5CK9A 2EYYA 2QA4T 2ZCFB 1VNDA 3OIQA 1VQLI 2ECCA 2P5VA 3S16J 3JRDA 2BIVA 2Q5IA 2E1OA 3WTUC 1OV3A 1J5WA 2ZNJA 5GAMf 4H02A 4F52A 2XIDA 1FOXA 5GP9A 4X34A 1ASYA 1M2VB 2CZ7B 4EMKC 3OWTA 3DF8A 1PP7U 3KBGA 4X9DA 1H4QA 3SDBA 2EFIA 2CJAA 4LLLA 5E3OA 5BPIA 1SC7A 1FYKA 1Q1HA 4HV6A 3EPZA 3PUBA 1VYTA 2D0NA 3TP3A 1VQ7Q 1QKWA 1IL2A 2KRCA 4BXUA 4ZDOA 2ACJA 4BKXA 1G2HA 2HKQB 4YRIA 2O4XB 5ICCA 1U3OA 3A4CA 2RQRA 4ESFA 1F36A 2DDBA 1LUJB 3I54A 2ZCEA 2P6SA 1OCCH 1Q1VA 3CUQA 5DDGA 2E35A 1GV2A 2CV1A 2A61A 2A37A 1MJBA 3A01B 2V1XA 3CCQI 4M3BA 2V4JC 4FTHA 3RL6A 4K86A 2VUMJ 3MFKA 1K8AC 5CJ9A 4CS4A 2E5KA 3GBGA 3ZCOA 1TWHJ 2C6YA 3QP5A 3PCOB 3K4NA 3C2GA 2EZLA 1RAAB 1J75A 1T39A 1Z6RA 3FXUA 1TG0A 3RKYA 1VQ4Q 1MBGA 2CSQA 5HLIA 3BT9A 1LDDA 1LVKA 5KE2A 1Q82C 3VDXA 2OTLQ 4B1RA 4AG1C 2L7MP 3H3ZA 2L8DA 4M3EA 2NUPB 1FYMA 4G8XA 3C2HA 4OVAA 4ZN1A 2VQCA 3F8NA 2M1BA 2NOGA 3L7WA 4CCNA 2F2EA 3K4MA 4KIFA 2F4IA 2RDPA 1N6AA 3L2ZA 3CXCA 3CCUA 2ATCB 4M78A 1W66A 2ZR2A 4HSTA 2QLZA 2HI3A 2FYKA 4LB5A 3BR1A 3UH0A 4JK1X 2K3PA 2DA9A 4C92E 2VUBA 1S7OA 3U9GA 1SFXA 3S6WA 5A0DA 2FA5A 5EEAA 1K1ZA 1I5LA 2QYZA 1Y56A 1L0OC 1JO8A 1KK7A 1RAIB 2J6OA 3A98A 4PJOG 5GAOl 1IRFA 3IWZA 4PJOD 3PO3J 2OTLT 1Y96A 1TNTA 3WGHA 1Z3XA 2ICWG 2VI6A 3MCZA 1T38A 1PC0A 3MPUB 3QWXX 3CCVI 1R9TJ 2BVLA 1X1AA 1GCPA 4M7DG 2NS0A 3E0JB 1R4NB 4G7OF 3O2PE 5H2FC 2EQRA 1HDPA 4HYEA 2MH2A 2W00A 4C3IJ 1SESA 5IYCJ 5LHHA 2KFDA 4A0YA 1DGWY 4KUMA 2FX0A 5GAN8 1I5OB 4IUTA 1Q95G 4HWPA 2DT7B 5LRSA 2BY1A 4EEFG 4YRLA 4DYRA 2DJQA 1R49A 1T0HA 3CCUT 2KSSA 2ZAEA 1IV8A 2B0LA 2KRFA 1T98A 2L5QA 4N4NB 4D0PA 3CC7A 4F16A 4L6V5 1AWOA 2HOTA 1NJ6A 2IGOA 3PVLA 4OLFA 4YYEA 3S14J 3KP3A 4HQEA 2HTJA 3JRIA 4CGZA 1HKSA 4M77D 3F8BA 5C51B 1Z9CA 3PQJA 4XN0A 3S1RJ 2CJJA 3HY1A 3ABLH 5HDGA 4Z6YA 3CCRA 3QP6A 3KEOA 3WHCA 3X2QH 2RO0A 3QO8A 2AKLA 3JCMb 3AKZA 3REBB 2QENA 2HXIA 2XIGA 1WXBA 4DOVA 1TWCJ 3QPTA 4AIKA 1W5TA 2KBTA 3JCUC 4HWRA 2NYSA 3GZ5A 4C2TA 2PTKA 3E9HA 3P9IA 4EM2A 4GGGA 4BXFA 4HT9A 4UNOA 5L3DA 4QLCU 3HP9A 4IOAF 2ZIOA 4GBQA 2X1CA 3WE2A 2CIMA 5HDNA 3X25B 4P71C 3G1LA 3HXLA 3BC8A 4PFOA 1Y96B 3WE3A 4WI1A 3I55I 3ASKA 1X58A 1FXXA 2BE9B 5M3MJ 4GY5A 2L54A 1QF6A 3PMIA 3QU3A 1MV0B 3C4SA 1Q82U 2DTRA 5FLXZ 1EV7A 5LRRA 4BWAA 2OUMA 1FYLA 1HA8A 1V3FA 4PJOC 3WU1B 1UJ8A 5EDNA 1EF4A 2I4NA 4UB6C 2VKVA 1T2KA 3I4MJ 3WVDB 3EG9B 3K10A 3A1YA 1K8AU 4UPAA 2YSRA 4BGDA 2PMUA 2AIRB 1HTTA 3IAM2 1OU9A 1TQIA 1XGMA 4P75C 4OMZA 5L3FA 1U5TA 2RNGA 2DD4A 2CUBA 2E34A 1XS9A 1YGBA 4RB0A 3A8LB 5FJ8J 5AIQA 4HVVA 3HSBA 4HF2A 4RG8A 4DQ2A 4HF0A 3N4MA 1VOMA 2OV7A 4WCIA 2JJ7A 1YJ9A 1M8VA 1PJRA 3RZOJ 1F5TA 2OTJI 3HKZA 3MJXA 2DTOA 5LL6S 3P8VA 4O2DA 3RACA 1S7EA 5LJ5f 2IS2A 1BC7C 4QSHA 2EFNA 3PIPF 2OQRA 4CHUA 3K9TA 4O5VA 3L2RA 1WH7A 2DFEA 2F5KA 3JREA 2H8HA 1TU0B 3CUQC 1PM3A 2DPDA 3CMET 1WZOA 3RKWA 1YFTA 1NG7A 2DJNA 4RM2A 2ZTGA 2DXTA 3KCCA 1C6VX 1UECA 1KC8R 4ZGJB 1IRGA 2VBWA 2WV0A 1UE9A 2LJ1A 1D09B 2KGTA 4JDSA 4H2UA 4J9IA 4XN3A 4DBFA 1FYFA 2JA8J 1SMYF 2HFHA 2O7OA 3QJ6A 3ESWB 2EBIA 3NTKA 1YI2T 1OZ2A 3PNVA 2DRMA 2A36A 4UP8A 3B02A 1RI9A 2LP0A 4C8QE 3L9FA 1R71A 2AKWA 1D0YA 2KT1A 4CCKA 3X24B 2YRVA 1VTNC 4L5EA 2NS8A 3JTHA 2M7AA 1B7TA 3E5UA 1H8KA 1MJAA 4QIWN 4EJOA 1HC7A 4YRMA 3M4GA 5JLWA 1MGTA 4HAMA 4LGWA 3EFSA 2P5KA 3V7CA 4XTYA 2I8DA 4OGCA 5CAIA 5DM7R 3G73A 2RK1A 1JUSA 2PQ8A 4JJNK 5L3CA 1ON2A 1Y8RB 5BQTA 4BE1A 1SSFA 3LA2A 3I5SA 2JJ9A 2QTVA 3O5ZA 2DDAA 2VC1A 3BPVA 4AVPA 4TVAB 2X0LA 1FP1D 2XKOA 4XTXA 4OINF 4ZZDA 1ZARA 2G7UA 1R7JA 3U1KA 3FXRA 1QU3A 3F0CA 2XAHA 5M5YJ 4QVZA 3CMEA 4M7DB 3REUA 1QVTA 1H0MA 1I1JA 1R5ID 1VQKA 3EYYA 2CT4A 3OD1A 3MAJA 2DYBA 4N0BA 3V8LA 3GFLA 3FEOA 3IG2A 5KHDA 1C1AA 3C18A 3GEZA 4FASD 3EGUA 2A5YB 1IC8A 1ZLMA 3CDIA 2FRHA 2BW3A 3ASOH 4IRGA 4KIGA 3H36A 2A3LA 3E9FA 4CC2A 2D8HA 2FZCB 3SHFA 2QWWA 4DYQA 2VBZA 2G7HA 3EHRA 3CCEA 5KYWB 3BG9A 3DKXA 3N05A 4XLAA 4I02A 1WJQA 2K6DA 3PJRA 5KAIC 4OF1A 2DU5A 3O3KA 2RV8A 1BIAA 3JR9A 4FYVB 5J8FA 3BQZA 1QZEA 2L2PA 2FUG2 3OS1A 2EJ9A 5IOZA 3QYFA 1ETVA 2K85A 1S8NA 5D8LB 2NAZA 2B8AA 2HQXA 3QKJA 2ZZEA 4OB0B 1NNHA 1GCQC 5I21A 1R1UA 2LBFA 4ESJA 5LLQA 8AT1B 2F5FA 2QKLB 3ERRA 4P71A 1BOBA 1MMAA 2QQ9A 1H89C 6AT1B 4PGHA 3PFIA 3EQLF 3KPHA 4RAZA 1ON1A 2LDUA 2DFUA 3QZ9B 3ZMUA 4DBHA 4MLOA 4ZGEB 3G1OA 4Y28E 3JAME 4KIBA 2QVOA 2YUOA 1TW3A 3FXQA 2D1HA 3SYTA 5GMKi 3LWHA 1BN5A 3V8KA 5L3BA 1VQ5I 4FT4A 2E10A 4PUSA 3QOEA 2CV2A 1QW1A 2EVRA 1B34B 1YBYA 3P9KA 2P0PA 3A5YA 4YRJA 3VYUB 4M7AE 4RDXA 2HKNA 5GAOm 3VRZA 2GZWA 4JJBA 4XAXB 1K73R 3A5ZA 1DPRA 4DYCA 1U5TC 3PUFA 1XSVA 3S15J 4UY8I 1FOYA 4G85A 3T1BA 2GQVA 1T6SA 3JRZA 4S04A 4M7AA 1H9GA 1VZ0A 2UXXA 2X48A 1VQPI 2RN8A 3CQTA 4J9FA 4HBLA 4A93J 1GFDA 2M7BA 1YHQI 5ICEA 1LEAA 2ESNA 2Y30A