3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
2FMYA 4PJOA 2F2EA 4LNSA 3BZ6A 5ICGA 4JQFA 1Z7UA 5C52B 2MBFA 4C8QC 3PCOB 2HTSA 1O57A 1B9NA 4M7DE 2QHSA 3QO5A 2D45A 3P9CA 3HSRA 2C6YA 3NELA 4E70A 4HLYA 3MZHA 5J6XA 2IY5A 4G6QA 5HLHA 4YPFA 1LYLA 1HKSA 3P9IA 4M78G 2J5OA 4PGHA 4YRSA 1K79A 2ESNA 3HYIA 4YRGA 4M78E 3GX4X 1NJ2A 4OIRF 4UP8A 3DSQA 3CJNA 3J7AO 4CYDA 2AS5F 4IRIA 2CJ9A 4H02A 3MFKA 4EJTA 1XSVA 1JJCA 4M71A 2XAQA 1I6XA 3REOA 4ASNA 1NJ8A 4O2DA 1RNLA 3CTAA 2ZT8A 1WI9A 1PP7U 4P9UA 3F8CA 1YQAA 5GANh 2PEXA 2DQ0A 1LDJA 2V9VA 3ICAA 4KIFA 4BHBA 3LAJA 1P6RA 4OOIA 2DQRA 5JR3A 4HDUA 3F8MA 3RESA 3QAHA 1F1ZA 5K5QA 1EIYA 4YRKA 2QHTA 4HYEA 3L00A 1PDNC 4YRIA 5A2QK 2M30A 2PG4A 5JI6A 1K78A 4M77B 1I27A 2DU9A 2IT0A 2R3SA 3BP8A 4M75C 3UH0A 2HFHA 2WC2A 1KYWA 4M7AD 3OOPA 4NCXA 1ZRCA 5GMKe 3TO7A 4HF0A 3O2PE 3COAC 4IXAA 2BE5F 5DUKA 5FD5A 2VOPA 5HLIA 2ZNZA 1WQ2A 3RPUA 4IHTA 1LEAA 4UVAA 4WK8F 2RB6A 4M77G 3M8EA 1TTYA 1N9RA 3A31A 1FYFA 1U6GA 11ASA 1TQMA 4UHTA 1UHWA 3VQXA 5LHHA 4C8QD 4EJWA 2AXLA 2V1UA 3A7UA 5GMKl 2VXZA 1UCRA 4KNYA 1O3SA 3M1EA 2PMUA 1B1BA 2EFNA 1H9GA 1WKMA 5IT9Z 5LJ5j 4L0YB 4MMLA 2Q2EA 1I8FA 4PJOC 1EV7A 2HKXA 2IY5B 3PGGA 1XGNA 1IXSB 1B70B 1XD7A 2V1DA 2GAUA 4IJAA 5D5WB 3L1AA 3LA2A 1R58A 3VOEA 1BIBA 2AKWA 3L2CA 3KZYA 4AVPA 1IW7F 1BM9A 2BGCA 2ISZA 2EJ9A 4PJOB 3DPLC 3BDUA 2XAHA 2P8TA 4KN7X 4WX9A 4PGGA 3BY7A 5HOOA 1TNSA 4H2YA 5GMKh 2DBBA 1V4RA 5H20A 1J2XA 4ESFA 1YO5C 3NEMA 1N9SA 5ILSA 2XUBA 1LDDA 3JW4A 2W57A 2GXGA 1U5TB 3JCMQ 3MQ0A 2O61A 4UV8A 3LQRA 3RL6A 1ZREA 4P71A 4K86A 1T2KA 2HKOA 2Q0OA 2Y90A 5DD4A 4XU3A 3DEUA 2GIVA 4M9SA 3FXRA 3GFJA 3V7RA 2G7UA 3HIFA 1PP8F 3Q9VA 5CAIA 4YRCA 4U0VA 3DXJF 4WXDA 4Y17A 4XQ3A 4M77D 3JCMV 3REUA 1BJAA 1NYRA 4CS4A 4MHGA 4C8QB 3B02A 1LJOA 1S6LA 3W6JB 1J9IA 3F8FA 3QP5A 5LHIA 1OR7A 2CIMA 3V7CA 2IJLA 1AOYA 5LJ5d 2XIGA 2ZZFA 3JB9D 3E6BA 5LLQA 1E17A 4M6YA 5D5XB 4A2UA 1D8KA 4RGSA 5LBQA 4HX7A 3I4PA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 3GEZA 4K87A 3INZA 4MEXF 5BPDA 3F3XA 1UB9A 1SMYF 4YIFA 4HV5A 4S04A 2ZBKA 5E18F 3HSEA 4P74C 4BYYA 1D5VA 1ADJA 4KT5C 3L4GB 4MNUA 5BOXA 4M7DF 1ATIA 4RGRA 4R79A 2HEOA 5GAMh 4A0YA 2EL9A 1H0MA 2HYFA 1P4AA 5LJ3d 1QE0A 1JRIA 1WNLA 4XTXA 3RJPA 4TWAA 4Q47A 1SFEA 4Y15A 1U1TA 3WGGA 3HRKA 5LJ3h 5ICFA 1WPYA 1HK9A 3NENA 2QQAA 1J7KA 4IVNA 4PG3A 3HFOA 1FBUA 3KLOA 3PZCA 4G7HF 1Z6RA 1UHMA 5GANf 2DZ9A 2Q7EA 2QUFA 1WQ7A 1TW2A 4D0PA 3EFSA 4RCBA 3A7RA 4C92F 3I0TA 1SAXA 2A3SA 4A6EA 1QGPA 4A54A 4NHJA 4CH5A 3HOTA 2KJCA 2ZNJA 3GYHX 4PJOF 3C7JA 1ODDA 3MZYA 1ULYA 1ZN2A 4HWTA 2ZZEA 1USTA 1FSHA 2E1CA 3RGLA 1REPC 4HA8A 1NJ5A 1MZBA 4EMGA 1KQ9A 1B6AA 2VODA 3QO7A 2OA4A 3U1DA 1MJAA 4M9ZA 2VXEA 2DW4A 2QLZA 4DPGA 2DI3A 3ML6A 1XDSA 4FX4A 5L3GA 4Q15A 3NEUA 2FEZA 1L3LA 3HTZA 2Y75A 2K7LA 1CGPA 2HOEA 3IG2A 5LGNA 2QBYB 1O3RA 4M75F 2YSRA 4YFXF 5AONA 1JGSA 4C92D 4BW9A 1YFRA 2I4NA 3I58A 4EQQA 5J8CA 1P4WA 5HVQC 5GMKi 4KMFA 5I21A 4O6JA 4WF2A 1Y96B 2Q5IA 1Z6TA 3IWFA 4EM2A 2W84A 4H2XB 2V1XA 2ZJ2A 2C7IA 4WWCA 1P92A 3JSOA 1G5IA 3CUOA 2E7XA 3JB9I 4IHSA 4I7HA 1W5SA 1F9NA 3HSFA 2D2WA 1ZAOA 5K1YA 5JVTA 3UFGA 3HY0A 2E1NA 2P5VA 4P71C 2NNNA 1YFSA 1D3YA 3LWFA 3EETA 4LG0A 2LF8A 1W66A 5KK1A 2P7CB 4DNCA 2STWA 2FXAA 2Q5HA 1U2WA 1TH7A 1GHCA 2MC3A 3SXYA 2FA5A 1TW3A 2QENA 2MLKA 4M73A 3KCCA 3M9AA 4OIOF 1S7AA 2RC4A 3E6DA 2ZKZA 2G4CA 2E64A 1HKTA 2C8MA 5E20A 2DDZA 1U78A 1EOVA 1FY7A 2EB7A 2JN0A 3E5QA 3NETA 3RYRA 1HTTA 2IP2A 2YLBA 3L2ZA 4EX5A 1SMTA 5GAMe 4LK1F 3RTRA 1Y0UA 4ZH4F 1R1UA 2PMHA 5AIPA 4J15A 4JK1X 3LC0A 2P6TA 5LRRA 1YGBA 4ETSA 3SWNC 4PNOA 2HNIA 3HFZA 1TNTA 5DUIA 4EGYA 2DXUA 3JCMc 4L18B 1QPMA 1RIOH 1ZG3A 1E2XA 4CGZA 4M7DD 3TDZC 4KN4X 4E51A 4FT8A 4OP0A 4EMHA 4UPAA 1ZYRF 5D5UB 4RDXA 4PZJA 2CFXA 5L3EA 12ASA 1U5TA 3AAFA 3JCMX 1EH6A 4K2EA 3TGNA 2QBYA 2I4LA 4CZZA 1R1TA 3QOPA 2L01A 1XGSA 4GYIA 2EJFA 1YW7A 5LJ3j 3J81K 4EV0A 3JSPA 2HS5A 2XAJA 1T6SA 4PJOG 4M78C 2IA1A 2A6EF 4B8XA 4QWQA 4LB6B 1RUNA 4XEOA 3IKTA 3TEGA 3SQNA 2PN6A 2O0YA 4TVAA 4BWAA 5D8LB 3IALA 4P75A 4EMKB 3W3SA 2EV5A 4MTEA 4HF1A 1KGSA 1J59A 4G7OF 2RA2A 5CVIA 2HWVA 1PYSA 4G8XA 3TO6A 1KU9A 3JCMh 1YCYA 2DU7A 1HW5A 2TDXA 4M74A 3A7AA 2AMCB 4XLPF 3MCZA 3VEPA 4UNOA 5HS7A 3BJOA 4KQEA 4H2TA 3FX3A 3R4KA 1RUOA 2G7HA 4R1HA 2MH9A 1LJ9A 4M75G 5GAMd 2DT5A 4ZIBA 3IKMB 5LJ3g 1LOJA 4LK0F 3HRIA 5FGMA 4C92E 1ZARA 2LNBA 2F5FA 2AMCA 1Z05A 3T5XA 4KYWA 3E9IA 3F22A 1XN7A 5KVRA 4M78A 1XB4A 3A5YA 2ZCEA 4HW0A 3KFUA 2VT3A 2PFBA 5FLXK 4UVBA 2XRNA 1SD4A 1KYZA 4HF2A 1X54A 2ODRC 4GGGA 2FB7A 4P9FA 1D8JA 3L4GA 2EFOA 3V4GA 1JE8A 3EYIA 4XEMA 3K2ZA 3KETA 1OMIA 3HXVA 1YFHA 3I64A 5HDGA 3LAPA 4YRQA 1SD7A 4ZZLA 3WTYC 2VT2A 1BI0A 2FF4A 3L09A 1KQ1A 4C92G 3K0LA 2MA3A 4XTZA 2PBIA 2FBIA 5D8KB 2FE3A 4PJOD 2RKHA 4EVIA 4P55A 2ZT7A 1X2HA 1FBSA 4NQWA 3ZMVA 4C8QA 2E7WA 5LHGA 4M75E 3LFKA 2VC8A 3E9HA 1EH7A 2RQPA 3SZPA 4F7UG 4F7UA 4WXHA 4BXUA 2PJPA 2VBYA 1U1SA 2XVCA 3BW1A 3J80K 3EFRA 2ZT5A 1HQCA 2QTXA 3DPTA 2F5EA 3KP5A 1IXCA 1DDNA 2RM4A 4QVDA 1STZA 2ODRD 2RHQA 1MGQA 3NRVA 2ZT6A 2P6SA 2FRHA 3RYPA 3G73A 1C0AA 2CO5A 2UWMA 2A61A 4M77C 4AH6A 2KJBA 1YW8A 2HTJA 1EH8A 4EJOA 5L3FA 4RB0A 4CDGA 5GANj 3RKXA 3SWNA 4M75D 4YFKF 3ZN0A 4J6WA 2H27A 1IZ1A 3RERA 3GLXA 1IXRC 4X5OA 4I01A 1ASZA 3MF1A 1W5TA 3WU0A 2DK8A 3F6OA 2ALYA 1USYC 3PQKA 3GF2A 1HKQA 4A5NA 3GFIA 4P3PA 5HDNA 1GXPA 4N0BA 4FX0A 3ZQ7A 2J3MA 4M7DC 4CICA 5HLGA 3N4MA 2CGPA 2LDUA 1BI1A 1ADYA 1J5YA 4XU0A 1EQRA 2ZMEB 3J80Z 5K1XA 1JXSA 3FWEA 1X56A 2CW0F 5LJ3e 2KIFA 3EQLF 3QO3A 4WJ4A 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 3HXZA 4M77E 1X01A 5GAOp 3DQVC 2K4BA 4EMKA 1XMAA 2M87A 3K1PA 3T0YA 2Q7GA 1M5Q1 2MD5A 2DKGA 5DCMB 5FO5A 2L54A 4P74A 5E8IA 1G3WA 2CSOA 4XRFA 4Q4ZF 3GWZA 2EK5A 1WWXA 5ILUA 2FOKA 2LKPA 1WLEA 2ARSA 3ECHA 3QU3A 1FX7A 2MH2A 3TDUC 3ULQB 4XTUA 2EAYA 4DQ2A 2P5IA 1LNXA 2JPCA 4YRPA 2RNJA 3MEXA 2DTHA 4H2SA 3CMQA 4LMYA 5GAOn 2EV0A 4PDKA 2VBXA 4M7AF 5L3DA 1ZRDA 3HXXA 2OD5A 4U0WA 3QUIA 3HTSB 4AWXB 3CLOA 4ESJA 3IRRA 4OIQF 2YHTA 5ICEA 3O3KA 1Z9CA 3HRSA 4H0EA 4KIGA 3R07A 1XGOA 2A6HF 1R23A 5C51B 3TKYA 1R1VA 5LJ5e 1G3YA 2FBKA 2I4MA 2NRAC 4Y91A 1B7YB 2P0LA 4Z2YA 4ZZDA 1D3BB 3GO5A 3T8TA 5FB2A 3R0JA 1O7LA 3DFGA 2D1HA 2OU2A 2RGVA 1ONVA 3F8NA 3H3UA 5DEQA 2ZMEA 4YRRA 1ZRFA 5LJ5f 3KP7A 4HLXA 5CVRA 4ESBA 3DV8A 3M7GA 4B09A 4I98B 3WE3A 3HFZB 1SFXA 5FFXA 2ALYB 2EFPA 4YRLA 1HSJA 5D5VB 2A69F 2H6BA 2CYYA 5K5OA 2E3CA 4J5YA 3J81Z 2P5KA 2ZXJA 3EUHA 5HDKA 2B0LA 4IRGA 4P72A 2ZIMA 3LSQA 4XTYA 2Z5UA 4EGZA 4M75A 3GFMA 4M7AA 3KP3A 5CVJA 2DPDA 1IN8A 1R36A 1MKMA 2L3DA 3QO8A 2W85A 3JCMJ 4EMKC 2NNYA 1RI7A 1B34A 2Z9OA 2VC1A 4HWRA 1V3FA 4HX8A 3PFIA 2KRFA 1T39A 1GXQA 3G3ZA 2ESHA 3DP7A 4RGUA 2BV6A 2DAOA 5EEHA 4IRHA 4YG2F 1KMMA 4EM0B 4RCCA 4G7ZF 4M9XA 1SRYA 1SFUA 1ON2A 2L4MA 4LG0B 1EVKA 4L5JA 2QQBA 5GAN2 2IW5A 2DTOA 1YIOA 5E17F 2YPRA 3G1ZA 3GZ5A 2DK5A 4ON0A 3UGTA 2CQKA 1HC7A 4Q48A 1B7YA 1X3UA 4P5OA 2YX4A 3P7NA 3VB2A 2XAGA 5E1WA 4Y13A 4U88A 2RD1A 2RDPA 4OMYA 4IPAA 5GANg 4P72C 1WRJA 5E3IA 4C8QE 4RAZA 6PAXA 4ENNA 4M7AC 4RB3C 1WSUA 3E3VA 5GAMg 1BBWA 2ZTGA 2K86A 1FP2A 4EJVA 3HXYA 3WU1B 1R5GA 3HHGA 4M78B 4YROA 3F72A 1OYWA 4H2WA 3VU3C 4I09A 5GMKm 4G84A 1I4K1 4BHPA 4X9DA 2BYVE 3ZMTA 2DU5A 4MQ9F 3GUDA 2IA2A 4JBAA 4M7AG 3CDHA 2XGXA 1FZPB 1FNNA 2FSWA 1G6NA 1RZ4A 3V8KA 1XCBA 4L9NA 5ED4A 3M4QA 2ISYA 1U5TC 1T0FA 4HQEA 4CXFA 3K9TA 2DZCA 5CLSA 1IN4A 3FF5A 3I71A 3F6VA 2JZYA 2FQ3A 4GYGA 3VQVA 3K1NA 1NNHA 1JHHA 3HXWA 3FHZA 4H2XA 5LEJA 5FFZA 3A5ZA 2H09A 1Y96A 4RAYA 3RI4A 4N9HA 3IKLA 2EWNA 5HS8A 5EEGA 4G9YA 2ZGWA 3FB9A 4ZYEA 1S29A 3SZTA 2PLYA 1IF1A 1W4MA 3JCMd 3I59A 5FLXZ 3VQWA 3FXQA 2M8EA 3SFZA 2DQ3A 1KQ8A 1SD5A 1R7JA 3A32A 3JTGA 4P96A 3WTUC 3R61A 5ELOA 1R22A 4ENMA 1FT9A 4ZTZB 1K6OA 1B8AA 1FPQA 5DV5A 4J6YA 1W7PB 2CWEA 1H4VB 3JB9F 4M78D 2X0LA 2XHKA 3KP2A 1RIQA 2KKOA 4KR3A 4C92A 4OLFA 1MGTA 4TVYA 3VBBA 3MEYA 2VBZA 4N0AA 4MQVA 4YFNF 1JBMA 4MGRA 2UXXA 3GXOA 1TLHB 1NJ6A 4L87A 3LSTA 5GAMj 5F6FA 3BROA 2UZKA 4XU1A 2J5PA 1FYMA 2OZ6A 4U0YA 5GAN6 4YRMA 4RQEA 3HRUA 3HY1A 3SHFA 4JLIA 5E1ZB 3QP6A 1Z91A 1QO0D 4A0XA 3E6MA 3BJ6A 4FHTA 3E97A 1QBJA 2STTA 1G3SA 3JCMg 4EMSA 2PI0A 1SETA 3IL2A 3KLNA 3OD1A 2GA2A 1CF7A 3DF8A 3QTCA 4M75B 5BS6A 3ZMSA 1IUYA 4XLNF 2DVEA 3M4GA 1GGMA 3ZMUA 2ZCWA 2F5DA 2VONA 1DP7P 4HT9A 3KE2A 5JFRA 1HBXG 1P2FA 4P3OA 3SWNB 2A07F 5K1PA 3BJAA 4KUMA 2NS0A 3QSUA 4A6DA 5GAN7 3I53A 5LRSA 3QPHA 3EDPA 3I7FA 5F64A 2OQRA 3I5UA 2DO7A 1YTYA 2Z3YA 5TRDA 2NAZA 2DXTA 5D6FA 4RQFA 3ABTA 2KIUA 5C53B 2HGCA 2OAZA 4A53A 3DKWA 1S3JA 4O3MA 3L7WA 4ZYDA 2DPUA 2K27A 3FIFA 4F7UB 4GCVA 4KMUX 3BDDA 2ARTA 1R5HA 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 2JPBA 4O5VA 2XAFA 2QHUA 2PMEA 4CH4A 4GXOA 5ERIA 3MF2A 3GW2A 5BQTA 3KFWX 2E65A 1QNTA 3M8FA 4G6DA 2ZIOA 2E41A 5GAN5 4MTDA 2RHQB 3H3ZA 3FZVA 5H6RA 4AIKA 3P8YA 2M5WA 4CHUA 1YS7A 4JRKA 3P9KA 1QZYA 4NL2A 1HXDA 1USYA 4XTWA 1Z7MA 2YR2A 4YCVA 5ELNA 3E5UA 1ZH5A 4OINF 2O8XA 4TQDA 1C0WA 4S05A 1BC8C 3R60A 2ZNIA 4YCWA 1BI2A 5LGUA 2EJRA 3Q9SA 5LJ3f 4HX4A 4CO8A 2GA1A 2JRTA 5GAN8 3JB9J 2K02A 3IRQA 3GIBA 4ENJA 4P3NA 4L5IA 2Y48A 2QHVA 1YB3A 5D4SA 4M77A 3HFNA 4R8HA 4NL3A 2HQNA 1KU2A 1S7OA 1KOGA 1IAWA 2O6GE 1FP1D 4YIIA 1J75A 3AHUA 3T1BA 3K69A 4L9TA 4OU0A 4HOBA 1USSA 1PYSB 3P8VA 1ZLKA 3IKVA 3R0AA 2JTVA 5JHUA 1JHFA 3JB9G 4I0AA 1OPCA 2RHSB 3RUXA 1YYVA 4Q6GA 4K88A 2W24A 5CVVA 5HS9A 3PCOA 1JJCB 4KA4A 2ZR2A 4CH6A 4YRFA 1DPRA 4H2VA 2DFIA 3F21A 2NYXA 2YX7A 3F8BA 5D4RA 1E1OA 2P5LC 1ZLJA 1B76A 3FM3A 5A2QZ 3BFMA 3V8LA 3C1DA 1KU3A 5GMKj 2PMFA 2RV8A 1ZHFA 1H4QA 3WG9A 3WODF 1HW1A 1QQIA 2BBYA 4P73C 5LJ5g 1BBUA 4P73A 4TVAB 4EO4A 4L9JA 4F7UF 2X4HA 4RB1A 4XSZF 1O3QA 3D5LA 1G5HA 3WTSC 4CS2A 4HQMA 5CJ9A 3P8TA 2ZR3A 3FXUA 4YRNA 5KNNA 1I5ZA 1UFMA 2QWWA 1XCVA 5GAOl 3CUQB 4YCUA 5DD8A 1W7PD 4RGXA 5J8FA 3ROUA 1W7PA 4TVWA 2L02A 4KDPA 2DJZA 5GANe 1MJBA 3C3WA 4Q5SF 1SERA 1B59A 5LJ5h 4J6XA 2HR3A 3TQNA 2QZ8A 4BH9A 4N0AC 2ZFWA 4CS3A 3ZP5A 5GAOr 2FBHA 2J3LA 3QU6A 4HBLA 3I59B 1KMNA 1KQ2A 2O03A 1K7AA 4M7AE 4LLNA 3NQOA 4KR2A 3MWMA 4C92B 4G85A 1X55A 1EFWA 1B34B 1FBQA 3HFVA 2EFQA 3M4PA 3LSSA 1XSDA 4MMKA 2FMLA 3CO7C 4P75C 4TV7A 3TUPA 5DYMA 2LSOA 2XKOA 5ICCA 1FWZA 4YRTA 3A74A 3GFLA 1TQPA 4UP7A 1ASYA 1MDMB 2ELHA 2ZINA 4A5MA 3CO6C 5DY9A 4YDQA 1E1TA 2OBPA 2Z33A 1FYLA 5GAN4 1FOKA 4WCGA 3Q5FA 2VE9A 5D6EA 3WTXC 2V79A 3E5XA 3HRTA 4RS8A 2ZXFA 3BY6A 1KU7A 2ZO4A 4WJ3M 3RDIA 3OV8A 4M7DG 4M7DA 3SB2A 1P4XA 1KA8A 3WGIA 2E10A 2XTIA 1Z1DA 1L0WA 2EFWA 4C8QF 4XTVA 1WQWA 3WGHA 2H6CA 3L9FA 3JCMW 2F5CA 2IVMA 3S2WA 4XSXF 3TO9A 3T8RA 2D1VA 3ZMZA 4JRIA 2CGHA 3KP6A 1H641 3VQYA 1LQ1A 1Z7NA 4BHCA 1MDMA 2WV0A 1VQZA 4WXCA 5H6QA 4I2OA 3WE2A 1QF6A 4QLCU 3EYYA 1MJ9A 3E6CC 4NOYA 4RMFA 3V8JA 5AIQA 4LLLA 3LA3A 5E8GA 4GO1A 1X2GA 2K4JA 1IN6A 3ERED 5GAOm 2G9WA 3ELKA 1I81A 2GXBA 2LF7A 3HOSA 2ARUA 5K5RA 3K1MA 2M45A 3JTHA 3O6BB 1U8RA 2A5YB 4XBFA 4A0ZA 2UXNA 2HZTA 1F5TA 1J5WA 5L3BA 2Z99A 4HWSA 4KICA 3HHHA 4N9IA 1J0RA 3TOBA 5LEKA 1SD6A 5F5WA 3RACA 4EM1A 3TEHA 4YYEA 5DCMA 5GANd 1FYKA 2DQLA 4PHCA 2QVOA 5TJJA 2ZNYA 3WTWC 1IRFA 1BC7C 2DTIA 4M7AB 2A68F 2RN7A 3BPXA 3ABUA 3ZN1A 2DLLA 2Y0MA 2EA2A 1ON1A 2OZUA 2JSCA 1Q1HA 2GWRA 1IN5A 3WTTC 2I4OA 2YU3A 1YG2A 4M72A 3LA7A 1H9TA 3V7SA 2M1BA 3U2RA 4BNCA 4BAYA 2E5AA 3H92A 2FYKA 4F7UE 2QQ9A 1T98A 4TQFA 1HSTA 2WWYA 1WYDA 2VE8A 1A04A 3IHUA 4HV6A 3WTZA 3GZ6A 2COMA 4TTVA 2CJAA 1CF7B 3JAMZ 5CYVA 1OKRA 4JUVA 1BIAA 3FMQA 1FSEA 2FU4A 2P4WA 4UUVA 2XGTA 4EJUA 2P7VB 2CG4A 4LGWA 1E24A 3FJPA 4RB2C 1O7FA 1B70A 3RIRA 1N9WA 3F23A 3W6KB 1E22A 2VN2A 2JT1A 2EA4A 2CJBA 1XSXA 3JCMe 3BPVA 3BOQA 1FC3A 1FLIA 3WQZA 2HDCA 3FM5A 4ZYHA 1QZZA 1XMKA 2WTEA 5E1XA 4HDVA 3C18A 2BEOA 3ERRA 4M77F 1BI3A 2QM3A 5FD6A 5CVUA 1ZG1A 2HQRA 1H4TA 5GAN3 3JAMK 1LB2A 1IRGA 1I1GA 3IWZA 1D3BA 3ZMDA 2XV4S 4U7DA 4YP0A 3JCMf 3FMRA 3TEHB 3ISPA 1G51A 3FMSA 1S8NA 3RF1A 4L9VA 1EVLA 4BQAA 3QNEA 4C8QG 1IN7A 1M8VA 1U3EM 3HRMA 3JCMP 4LD5A 3HSBA 2H94A 2XROA 4LB5A 4YREA 1NHAA 1B9MA 3JB9H 2L4AA 3RPQA 1HW2A 2AKWB 5BMZA 4I02A 5F1RA 5IT3A 1EIYB 3HTUA 5L3CA 3JCMb 1ZGJA 4UP9A 2VOOA 4YRJA 3HUGA 4HAMA 1YLFA 5DCFA 3I54A 1OYYA 1I5LA 4A12A 1MD0A 3QRFF 4CH3A 2ACJA 3VFZA 2IPQX 4XU2A 3HXUA 3U9GA 1DPUA 3WTVC 4PJOE 1WU7A 4AIJA 1YW9A 4OIPF 4LLGF 4V2SA 4ENKA 4C92C 1YFTA 1NYQA 2RHSA 4ZTUB 2R7FA 2IRFG 2VC0A 3CUQC 3PQJA 2V6CA 3REXA 3QPTA 4LJZF 1F4KA 1TBXA 3QHSA 2GQQA 4HZFA 2OQGA 1ZG5A 2FNPA 2ZZGA 1NJ1A 4ZYGA 4M78F 2W25A 4H2UA 3IC7A 1XDUA 1DUXC 3GVAA 2DEQA 4OMZA 2Q8KA 3TOAA 3KP4A 2R7DA 4AIHA 4WI1A 1KQ0A 2PQ8A 2XASA 2EJGA 1B4AA 1G4DA 3D0SA 1SESA 4IF4A 3RKWA 4HVCA 5BPIA 1LEBA 2VXFA 1LDKB 3BJUA 4F7ZA 5LGTA 1BN5A 1O3TA 4AD9A 3KZZA 1GVJA 1IL2A 2EV6A 4HT8A 3RKYA 5HGQA 3UGQA 1K78B 3B73A 1I1SA 2XKPA 5ILVA 1PUEE 2VBWA 3ZPLA 1L0OC 3BWGA 1H4SA 3CUQA 2IA0A 2I2LA 1XGMA 2Q7HA 1BBYA 1R00A 4UV9A 4KFCA 4HWPA 5IT9K 3ECOA 3LQQA 1T38A 4M7DB 4NB5A 5GAMf 2ETHA 2HYGD 3R6SA 4QVCA 4I0BA 2MLGA 4X9CA 4UXNA 3KEQA 4HWOA 1OYIA 5DDGA 2E1HA 2GZWA 1BOAA 3VODA 4LFUA 2FNAA 2QYOA 1VTNC 2YLCA 2KIMA 2K57A 4MEYF 4PCQA 1LNWA 5GAOq 4KIBA 4UVCA
chains in the Genus database with same CATH superfamily
4IL6C 4J9FA 2FMYA 1SHFA 2LX9A 1UE9A 4PJOA 3CCYA 1QVGA 2F2EA 4LNSA 2IXSA 3BZ6A 4A4FA 5DM7R 2GXAA 2HNHA 5ICGA 4JQFA 1Z9QA 2XICA 4ESRA 3C2BA 1Z7UA 4FQGA 4BEHA 5C52B 2MBFA 1GL5A 4C8QC 4G12A 3E7LA 3PCOB 1YJWA 3HG9A 2HTSA 4A3MJ 4I76A 1O57A 3PNVA 1B9NA 4M7DE 3CXCA 3KYCB 1K9MU 4HCBA 2XRLA 2QHSA 3TCJA 1T0FC 3QO5A 2D45A 1IUFA 3HSRA 3P9CA 1YIJI 2C6YA 1PVEA 1T0HA 1LVKA 1B8IB 3NELA 3K4KA 4E70A 1R5ID 3HBLA 4HLYA 3MZHA 4PJ0C 1OOTA 2EGEA 4KH1B 5J6XA 2IY5A 4G6QA 5HLHA 4YPFA 3I9V2 1Q82R 4AU7A 1LYLA 3A5YA 1K0XA 1ABOA 1HKSA 2RHZA 2KRMA 1YITI 3CEYA 2Y9ZA 3L1PA 2L0KA 1Z3YA 3BT9A 3P9IA 4PSWA 5K7ZA 1JGGA 2YU9J 4Y7NJ 4V2GA 4M78G 2J5OA 4EATA 2RI5A 4PGHA 4MZTA 4YRSA 1K79A 1X6BA 2ESNA 3QYBA 3HYIA 3OW2P 3CC2Q 4YRGA 4M78E 3S3OA 2R7TA 1BYMA 3GX4X 1VQ5I 1NJ2A 1V55H 1OZ2A 3WVDB 4OIRF 4RTZA 3JRBA 4XL9A 1NYGA 4UP8A 3GMEA 2QDLA 1E3OC 3DSQA 3CJNA 3D5RC 1QPIA 3J7AO 2DFUA 2KROA 2X35A 4N4GA 4CYDA 3BG7A 4J00A 4AFSC 1JT0A 2AS5F 4IRIA 1QWEA 2QKLB 2CJ9A 3MFKA 4EJTA 2DFFA 4H02A 1XSVA 1WZOA 3G1OA 4ZC3A 4M71A 3QKJA 5KYWB 1JJCA 2XAQA 1I6XA 2GBYA 1PRMC 3REOA 4ASNA 4MFDA 1NJ8A 5F08A 4BY7J 1RNLA 3CTAA 1PKSA 1VQ9T 2ZT8A 1WI9A 1AZGB 2QQSA 4O2DA 4FU6A 5KCHA 4II1A 4B3XA 3EG1A 1PP7U 3CD6A 1AZEA 1USYA 4P9UA 2A8EA 3VYUB 4AG2C 2ZPGB 1WH7A 2JMAA 2LMDA 1DJ7B 2AK5A 3EG9B 3F8CA 3I55A 1YQAA 3ZEHA 5GANh 2PEXA 4MZPA 2DQ0A 1LDJA 2V9VA 3H0FA 2DXCA 2W00A 3BTJA 4KIFA 4BHBA 1VI0A 1P6RA 2BW3B 4C9YA 3LAJA 4OOIA 2DQRA 5JR3A 2E19A 2BHZA 3CF5F 4HDUA 4A3IJ 4JP0A 3F8MA 1VQLA 3FBIB 3RESA 3QAHA 1F1ZA 4M3FA 5K5QA 2NUZA 1WXUA 1EIYA 4KH0B 1VQ6T 2DDBA 4YRKA 1E3PA 4A69C 1BA5A 2QHTA 3ME9A 3IQLA 1K6YA 4HYEA 3L00A 1KJWA 4IHWA 1PDNC 4YRIA 4OB0B 5A2QK 2M30A 2RQVA 2PG4A 5JI6A 1K78A 3W3CA 2PJRB 1SG5A 2MABA 1R49A 2BZ8A 2K2VA 1VQ4T 1I27A 3BC8A 2DU9A 1K61A 2V6EA 5F0FA 2MIOA 3LW5E 4F16A 2IT0A 1VQ7T 2R3SA 3BP8A 4M75C 5AYFA 3UT1A 1T33A 2COBA 2HFHA 1TWHJ 1VQOI 2LRDA 1KYWA 2WC2A 2FOWA 3OOPA 2ZJQF 1KHCA 2JW4A 4M7AD 4NCXA 3A8HB 3ZR8X 1ZRCA 5GMKe 3TO7A 4HF0A 3O2PE 1B72B 1MBJA 3COAC 4IXAA 1E3HA 2BE5F 5DUKA 3IAS2 5FD5A 5HLIA 3OYNA 2VOPA 5C44J 2ZNZA 1WQ2A 4OAZA 2R7XA 1JU5C 2MOXA 3RPUA 3QYEA 3HGGA 4IHTA 1LEAA 2Y69H 2R7VA 4UVAA 4WK8F 1X2QA 2RB6A 4JLIA 3SDGA 4M77G 3HKSA 3M8EA 5IYBJ 1TTYA 1N9RA 5B5EC 2P84A 3CCST 3A31A 1FYFA 3I55T 2R5ZB 1U6GA 1JUPA 3OYMA 11ASA 1TQMA 2KLOA 3AG1H 4UHTA 2NVXJ 1T3LA 2FPFA 1UHWA 3EUAA 3VQXA 5LHHA 4LE9A 2O9VA 4C8QD 4N4HA 1T08B 1ZBXA 3S1MJ 4EJWA 1RAFB 2AXLA 1U3OA 1IHVA 2V1UA 3A7UA 4MIMA 5GMKl 2VXZA 5KYUB 3QQAA 1UCRA 1QU3A 1X3ZB 4KNYA 3AG2H 4F3QA 3M1EA 2PMUA 1O3SA 4CCKA 1B1BA 2EFNA 2K5CA 1BW5A 1H9GA 2GTJA 2LCCA 2KFDA 2P4RA 2YRCA 1WKMA 5IT9Z 1IJWC 1RAHB 1ZA2B 2D0QB 2M02A 1WJEA 3PNTA 3A5ZB 3PVQA 5LJ5j 2WB1A 4L0YB 4MMLA 2Q2EA 3ZQQA 1I8FA 4Q5WA 1MH3A 4NBQA 1NJIR 4PJOC 1EV7A 2HKXA 1H8KA 3PGGA 1G2HA 2IY5B 2EIJH 1XGNA 2IAIA 2RJCA 1IXSB 1I3QJ 3GTJJ 1B70B 1XD7A 2V1DA 1VQNT 3QOEA 2EILH 1TZLA 2GAUA 3I5RA 4IJAA 2BUDA 3K7AJ 5D5WB 3L1AA 2QEXQ 3CCVQ 3ONQA 3LA2A 1R58A 3VOEA 1BIBA 3KX2A 2AKWA 3L2CA 2WY7Q 3KZYA 4AVPA 1M1KU 3GBQA 1IW7F 2KL4A 3QDFA 1BM9A 9ANTA 2BGCA 2DA4A 1RR7A 2VWFA 2ISZA 2EJ9A 3M0RA 1VQNA 4PJOB 3G6EQ 3DPLC 3NTIA 2ICWG 1YRNB 2Y4YA 3BDUA 1UGPB 4FE7A 2EQMA 2XAHA 2P8TA 4KN7X 4WX9A 4HNVA 1LE8A 1LCKA 4JX5A 4PGGA 2CFOA 2Q1ZB 2XF5A 3RZOJ 2EYXA 3BY7A 5HOOA 3FDRA 3K4NA 1TNSA 4H2YA 5GMKh 2DBBA 2RQRA 4C0ZA 1V4RA 2LREA 5H20A 3CC7I 3R6NA 3HJEA 4JRQA 1J2XA 2TCTA 1UJ8A 4ESFA 2VL8A 1W1FA 5I22A 1YO5C 3C2HA 4XR6A 3NEMA 2KIQA 1N9SA 3H0DA 4I99C 4QPOA 4IQJA 1X1DA 3FRNA 3HC7A 5ILSA 1GFDA 3H6ZA 2XUBA 4BY1J 1LDDA 3NTKA 4QKUA 3JW4A 2ECZA 2W57A 3EUKL 2GXGA 1U5TB 2NS7A 4V2FA 3MQ0A 3JCMQ 3MKYB 1RAEB 4LNPA 1KQSS 3M07A 4RBOA 2O61A 2DD4A 4FTHA 4FT4A 3VKIA 4UV8A 3LQRA 4PFZA 1X6OA 3RL6A 1ZREA 4P71A 3PIPA 5GJWB 4KISA 2QEXA 2ZXHA 4K86A 1T2KA 1DQUA 2HKOA 2Q0OA 1VQOT 2Y90A 5DD4A 4JDSA 1SANA 1SEMA 3DEUA 4XU3A 4C3HJ 3CCQI 1RPWA 2GCXA 2D6FA 2CP2A 2GIVA 1JEGA 4M9SA 4PUSA 3FXRA 3GFJA 3V7RA 4OF1A 8ATCB 1H92A 2G7UA 3HIFA 2JVGA 1PP8F 1EF4A 4C5HA 1GUUA 2V9PA 3S2HJ 2QYZA 5DLOA 1BR4A 3Q9VA 5CAIA 2ZAEA 4YRCA 3KIOA 3DXJF 4U0VA 4WXDA 4Y17A 3MKZA 4F93B 1IREB 4M77D 1AOJA 4XQ3A 3JCMV 2L9VA 1VQ6I 3L2QA 5KYXA 3REUA 1PSFA 2HD0A 1BJAA 1D0XA 1NYRA 3TEDA 4CS4A 4MHGA 2K3XA 4C8QB 3ZOBA 3OIQA 3BQYA 2XK0A 3B02A 2ZPHB 2NUTB 1YIJT 2MYSA 1LJOA 1S6LA 1O75A 3W6JB 2E70A 1VQMQ 1J9IA 1FEXA 3F8FA 3QP5A 4B43A 5LHIA 1JJ6C 1OR7A 2XDVA 2O01E 4GY5A 2RREA 3V7CA 5LFAA 2CIMA 3NWSA 2IJLA 1AOYA 2PX9A 5LJ5d 1KOGA 2XIGA 2ZZFA 3JB9D 2YUOA 3E6BA 4RA2A 3TP3A 5LLQA 4QW2A 2XDBA 3CCUT 1E17A 4M6YA 3M9QA 5D5XB 2K9QA 1D8KA 4A2UA 4D7NA 4RGSA 2R7SA 5LBQA 2F5KA 4C5EA 4HX7A 3I4PA 4RM3A 4B1RA 1OCTC 1QMCA 3MAJA 4L0ZB 1TQIA 2DTRA 3KEOA 1G3TA 5B3SH 1SSFA 3GEZA 1Q82C 1K8AC 1QVGP 4K87A 1X3WB 3M8JA 2TRTA 3F9KA 3D5SC 4MEXF 2K85A 3INZA 5BPDA 2HVRA 4HCKA 1OQYA 3F3XA 4ZNXA 1UB9A 1IGNA 1SMYF 1JKOC 4YIFA 3ZCOA 2V8JA 4KULA 4HV5A 4S04A 4BE0A 4OWRB 2ZBKA 5E18F 3HSEA 1OI1A 4EIKA 4P74C 1SVMA 4BYYA 3WHBA 6AT1B 1D5VA 1ADJA 4KT5C 4ZDLA 2XC7A 4EPCA 3L4GB 3BTLA 1Y1VJ 1N77A 4MNUA 5BOXA 4M7DF 1AHDP 3OBYA 1ATIA 1XQHA 2FEIA 4RGRA 3N05A 4R79A 1MBKA 2HEOA 2HOSA 5GAMh 4A0YA 2AIRB 1RAGB 2OI3A 1MBEA 3VV0A 4LDXA 2EL9A 2LRQA 1H0MA 3K4MA 2HYFA 1P4AA 2VKDA 5LJ3d 1JRIA 4JZ4A 1WNLA 3H9NA 2DT6A 3RJPA 1QP2A 3LGLA 4XTXA 1XTAA 4Q47A 1SFEA 4Y15A 2M9UA 4CRIA 1JQQA 1X1BA 1QW1A 1WGSA 1AKHA 2DRKA 1U1TA 4LXCA 4YTLA 3UA6A 2QA4T 3WGGA 5H2FC 5LJ3h 3PTAA 3HRKA 2JSPA 5ICFA 1WPYA 3LGFA 5IAYA 1HK9A 5FU7B 4F92B 3G4SQ 2QQAA 1SFKA 3NENA 1J7KA 1D1AA 2BVMA 4IVNA 4PG3A 3HFOA 1FBUA 3CMAT 2BY3A 1Y8QB 3KLOA 2HKNA 5E3OA 4G7HF 3PZCA 1WFWA 1RUWA 1Z6RA 3OYIA 4E7IA 2BE7D 1UHMA 2R7QA 3THKA 5GANf 4HRIA 2DEUA 3FJ5A 2KSSA 1W36D 2DZ9A 1WGXA 3LX7A 2Q7EA 2QUFA 3CCJT 3LWIA 1WQ7A 1U5SA 2KP6A 1TW2A 2L7MP 1V5FA 4D0PA 5GAEJ 3VSLA 3EFSA 2LY9A 4RCBA 5FLXE 3A7RA 4PJJA 2L7KA 3I0TA 4C0GA 1SAXA 2A3SA 1HD3A 2XGEA 1QGPA 4A6EA 2EGAA 3C2GA 1Z21A 4BBRJ 1C0MA 2L3SA 3ER0A 4A54A 3AL0C 4NHJA 1TSFA 2ENMA 4CH5A 4CYCA 1POGA 3IV5A 4B9XA 3HOTA 2KJCA 3S1RJ 4ZGJB 2ZNJA 2ECCA 3X2QH 1W70A 4Z6YA 1FMKA 5EJCA 1MH4A 2HXOA 3GYHX 1JO8A 4PJOF 3ULRB 1V54H 4K11A 3C7JA 1ODDA 3MZYA 3M0TA 2HZDA 1ULYA 1ZN2A 2KPMA 1N27A 4HWTA 5EYRA 2ZZEA 1USTA 1FSHA 2E1CA 1W2BP 3RGLA 3CDLA 3A0HC 5CPRB 1REPC 4HA8A 1NJ5A 2VJ4A 1MZBA 1MNEA 1KQ9A 1B6AA 3TMOA 1X6GA 4EMGA 5L23A 3CCRQ 4HNUA 2VODA 3QO7A 1N6AA 1WHJA 2OA4A 3U1DA 2JM9A 4H4KC 2J7IA 4AIDA 2JVVA 4JZ3A 1AKHB 1MJAA 4M9ZA 4BUPA 5J4VA 3G4SA 3MVPA 2VXEA 1U0JA 2EW3A 4DA4A 4J83A 2OTLQ 2DW4A 2QLZA 1VQKI 2ROTA 3PNWC 1VQ7Q 4DPGA 2DI3A 4A3GJ 3ML6A 1XDSA 3LMMA 2RQUA 4AUXA 4FX4A 5L3GA 4Y28E 3NEUA 2XIDA 2FEZA 4Q15A 2RH2A 3RNJA 5KH6A 1L3LA 5EZGA 1YWOA 3HTZA 1X69A 1BKBA 2Y75A 1ZX6A 1YJ9Q 2K7LA 5A0LA 4LVKA 1CGPA 1X58A 4HCCA 2CZ7B 2HOEA 3I55I 3IG2A 5LGNA 2QBYB 2DK3A 1N8RR 1O3RA 1UJ0A 4J7FA 1Z77A 1MBFA 1FOXA 2ED1A 4M75F 3A98A 3HOWJ 3CCJA 1VQNQ 3RZDJ 1J3TA 2YSRA 4YFXF 1QKWA 5AONA 1KONA 1LPQA 5LL6S 3NFCA 1WJ5A 1JGSA 4C92D 1OCZH 1UG1A 4LDUA 5M5YJ 4BW9A 3ZQFA 1YFRA 3UATA 3CC4A 2I4NA 3I58A 4E7LA 4D9JA 5IOYA 2OX7A 5DTDA 4EQQA 3CJTB 5J8CA 1E0EA 1P4WA 1V5GA 1Z0XA 5HVQC 5GMKi 4D5FA 2OV7A 4KMFA 4O6JA 5I21A 4WF2A 1Y96B 2P4TA 2Q5IA 1Z6TA 3IWFA 2B9SA 5FU6B 5FRMA 2ZPIB 4EM2A 2CT4A 2W84A 1Q82U 3BR2A 3FIWA 2V1XA 3PT9A 4IOAF 2ZJ2A 4H2XB 1SRLA 1BOBA 3G6EI 4AYBN 4HG2A 2GLOA 2C7IA 1RAIB 4WWCA 5HKCA 4KRTA 1P92A 3JSOA 2OTLI 3CUOA 1UB4A 1G5IA 3Q3SA 2E7XA 5KCMA 3GP8A 3JB9I 3M0SA 3LSMA 2BXZA 1A36A 4IHSA 4I7HA 1W5SA 3P5JA 1F9NA 2IS4A 2LC2A 3HOUJ 2O2OA 1YOVB 3HSFA 2D2WA 1ZAOA 3G71T 1QVPA 5K1YA 4BJ6C 2KDSA 5JVTA 2X4XA 2C06A 3UFGA 1NH3A 2E1NA 2P5VA 3CCLQ 3CCQT 3HY0A 4P71C 3VS5A 3DTIA 2UV1A 2EINH 5FLMJ 2NNNA 1YFSA 1D3YA 5M5WJ 1JTYA 1YI2I 3HOZJ 4B9WA 4C92F 3I56Q 3OSGA 3LWFA 2HL5C 1WJSA 2A05A 3EETA 2LF8A 4LG0A 1QVGS 1VQ4Q 1W66A 2C0OA 2VB6A 5KK1A 2FL7A 2BY0A 3LSJA 4DNCA 5IP9J 3DBRB 2FXAA 3IH4A 2P7CB 3SYTA 2STWA 4X6AJ 2R93J 2Q5HA 1EKEA 3E9GA 4Z88A 3S16J 1U2WA 1TH7A 1GHCA 2MC3A 2VJIA 3RSNA 3SXYA 1VQMT 2FA5A 4V19K 1D1CA 2HQHA 4V2SA 2HKQB 1TW3A 2QENA 4FE4A 2MLKA 4M3DA 4M73A 3GNFB 2WSCE 1OFCX 3KCCA 1S72A 1H8AC 3M9AA 1YX5A 4OIOF 1N25A 1S7AA 3HB9A 4OAYA 2RC4A 3E6DA 2ZKZA 2BE9B 2LX7A 2L9SA 1GV5A 1MBGA 2Y31A 1IG7A 2E64A 2G4CA 2FRWA 2RQQA 2KMTA 1HKTA 2GOXB 2Y0SN 5FJ8J 1HF0A 2JTMA 4NS5A 5E20A 3G71A 2L2OA 2C8MA 1OQKA 2DDZA 2ID3A 5K7FA 3FKIJ 4B6MA 3PVLA 1U78A 5GANg 2M34A 4FYYB 1EOVA 1FY7A 2EB7A 4QIWN 3JRCA 1Q81R 3MMYB 2JN0A 3E5QA 2ZCFB 1G5VA 2HL3A 3NETA 1P7IA 3RYRA 1VA7A 2LVMA 4RKUE 1HTTA 2IP2A 1KFZA 2YLBA 3L2ZA 4EX5A 1SMTA 1D5YA 5GAMe 1BR1A 4LK1F 3RTRA 1Q86R 1KHIA 3H8ZA 1Y0UA 1NBEB 3M3YJ 4ZH4F 1R1UA 3J7AF 2PMHA 1T8IA 1P7JA 4BXXJ 5AIPA 2D8JA 2FG0A 2RJFA 4JK1X 2DN0A 2E2HJ 1VQ7A 4J15A 3LC0A 2QGUA 4KGVB 2P6TA 5HLTA 5LRRA 4OMPA 2RJDA 5KYXB 4ETSA 3SWNC 2GOMA 1YGBA 3VS6A 2VJ5A 2M9HA 5TISC 3S2DJ 1WJFA 4PNOA 1BCMA 2DILA 2HNIA 4XONA 2Y4XA 1TNTA 5DUIA 2GIZA 4EGYA 4RLFA 2DXUA 2GTOA 1QCOA 2QK0A 3JCMc 1OX9A 4PL6A 4L18B 1QPMA 3BQZA 3QYFA 1K73R 3ICAA 4ANJA 1RIOH 3CC2I 1ZG3A 2DCEA 2DL3A 1U9OA 3Q0WA 1JXOA 1OPLA 3CBOA 1E2XA 2IGKA 4CGZA 4M7DD 1VFCA 2RMOA 2D0NA 3TDZC 4LIVA 3BLYA 2KDOA 2RQTA 3I4MJ 5DLQE 4BACA 4KN4X 1TOVA 5KYYA 3CCUQ 4E51A 4FT8A 2OC6A 1BU1A 4OP0A 4EMHA 3TW6A 4UUSB 2P81A 2QEXI 2NUPB 4UPAA 1K9MC 2L3RA 1ZYRF 2E1OA 5D5UB 4QT7A 5EEAA 3CCMA 2WBMA 2DNUA 4RDXA 4PZJA 4PLIA 1OV3A 3R6OA 1S72T 2CFXA 5L3EA 5A2QE 4II3A 1U5TA 3CESA 1PG5B 2DPPB 12ASA 3AAFA 3TSWA 3M55A 1TP4A 2LMJA 3JCMX 2V26A 3ABLH 1X19A 4UB8C 1M1FA 3WXMB 2RQWA 1ZA1B 1SKUB 3CC4T 2R5YA 1UGRB 3M4YA 1EH6A 4K2EA 1HSQA 1YJNA 3TGNA 2QBYA 5FWBA 1YITA 2I4LA 4CZZA 1R1TA 1RLQC 2X1DA 3QOPA 2L01A 1XGSA 4GYIA 2I10A 3K70D 3HKZA 1YW7A 1DP3A 2EJFA 2DD5A 2VV5A 4GBQA 5LJ3j 4A3KJ 3J81K 4LIUA 3P8TA 4JLGA 1MBHA 3META 3EG0A 4EV0A 3JSPA 1M2VA 3FC3A 2HS5A 4YRVA 2FRYA 4D6WA 2XAJA 3IH2A 4E6KG 2W0ZA 2R0QC 4IIMA 1H3ZA 1QHHD 1T6SA 2YUSA 3HEFA 1FOWA 2R5AA 4PJOG 3GNGA 4Z89A 1NTCA 2HYJA 4M78C 2IA1A 2A6EF 4B8XA 1M90U 1GBQA 5FKMA 4BE2A 1O9SA 4QWQA 2RK1A 2V8IA 1ZR4A 3UA7A 4D8KA 4LB6B 1RUNA 4BQNA 2YWWA 3VS3A 4XEOA 3IKTA 3TEGA 3SQNA 2PN6A 2O0YA 3MKLA 2KRHA 3DEWA 1LPLA 5D8LB 2ATCB 2OTJT 3IALA 4TVAA 4BWAA 4P75A 2A5WA 4EMKB 3W3SA 2EV5A 4MTEA 4HF1A 3QIIA 2HI3A 1KGSA 3SJMA 1J59A 3SEQA 4B44A 1RABB 4G7OF 3A4CA 1CKBA 3NHNA 3VBBA 2RA2A 5CVIA 2LT4A 2HWVA 1PYSA 3OR2C 3JRIA 2MFZA 3X24B 4G8XA 3TO6A 1QZEA 2CMPA 1KU9A 4TWAA 2K6DA 3MEVA 4BKXA 1YCYA 1HW5A 1I50J 2TDXA 2E71A 1BW6A 4M74A 1VQLI 3CMEQ 3CCLA 1DU0A 2IVWA 2DMUA 3QXEB 4XLPF 2AMCB 3MCZA 3VEPA 1RC9A 4UNOA 2MI6A 4M77B 3M59A 5HS7A 2LCSA 3DKYA 3BJOA 3IAM2 2XHCA 2CW7A 3RKQA 4H2TA 3FX3A 2NLUA 3R4KA 1I39A 1EIFA 4RTVA 1RUOA 2G7HA 2ZC2A 4R1HA 1S1NA 2MH9A 1LJ9A 1UJYA 3REAB 4M75G 2IS6A 5GAMd 2QSGX 2DT5A 4ZIBA 2LQ8A 1YJ9T 5EZHA 2F4IA 3CQZJ 4OMNA 5GP9A 3IKMB 2NYSA 2C0TA 1WJBA 3FDYA 3L2RA 4W1UA 5LJ3g 1LOJA 4LK0F 4OMFB 1VUBA 4R55A 1N8RC 2F4OB 4J7IA 3J7ZI 1M2VB 3HRIA 2DJNA 5FGMA 4XQFA 1G83A 4C92E 1ZARA 1YJWQ 4Y33A 4J9IA 3CMET 2LNBA 2F5FA 3NTHA 1KIKA 3S8PA 2AMCA 1Z05A 2LR8A 3T5XA 2JNGA 4KYWA 2E35A 3IH3A 1TWCJ 1H89C 3F22A 3E9IA 1XN7A 5KVRA 1WI7A 2M0MA 2FJ1A 2W1OA 2EYYA 3I5SA 1R9TJ 4M78A 1XB4A 3KFVA 3VJPA 4HW0A 5LD2C 1RI9A 1VQMA 2ZCEA 3DB3A 4J9DA 3OB9A 2VT3A 3DPUA 5EF6A 3G1JA 2ELJA 2PFBA 5TGTA 3GTMJ 5FLXK 4UVBA 2GQIA 2FZKB 2XRNA 1SD4A 1KYZA 3EGXB 3VDXA 3CPFA 4HF2A 1X54A 2DE0X 4GGGA 4BY6B 2ODRC 2FB7A 4P9FA 1D8JA 3L4GA 1AWWA 4XRSA 5FLVA 2EFOA 3V4GA 4J01A 2M4KA 2JT4A 2F5VA 1JE8A 4UUSA 3EYIA 4BI8B 4XEMA 3K2ZA 3KETA 1OMIA 4TVRA 3HXVA 2KXDA 1YFHA 3I64A 1KZHA 5HDGA 2CUBA 2KGTA 3LAPA 4YRQA 1Q81U 1SD7A 2JUFA 1BBZA 4ZZLA 3WTYC 2XPVA 2IPOB 1J09A 2XDDA 2VT2A 1BI0A 2X85A 3F70A 3OSVA 3H5NA 1TU0B 2FF4A 2COZA 2G6FX 2L5QA 2R7ZJ 3L09A 1HDDC 4AG1C 4LVLA 1KQ1A 2LK2A 1W4SA 4C92G 1UGSB 3EG2A 3H9GA 4BB7A 3CD6I 3K0LA 5B66C 3FXJA 2MA3A 4RG8A 5GAHJ 4XTZA 2PBIA 2FBIA 5F04A 2EZLA 5D8KB 2FE3A 2HQAA 3TEEA 1K83J 4PJOD 2RKHA 4Y4RA 4P55A 4EVIA 2ZT7A 1X2HA 1FBSA 4NQWA 2XF7A 4XMYA 3ZMVA 1YX3A 4C8QA 2E7WA 2D9TA 5LHGA 1GVDA 3Q0VA 4IURA 3ASNH 4M75E 5F1JA 3LFKA 5EG0B 4ZJZA 2VC8A 1YNZA 3A8LB 3E9HA 1EH7A 2RQPA 1NJIC 3SZPA 4F7UG 1FYNA 4F7UA 2LG4A 4WXHA 4BXUA 5IPAA 2PJPA 4A3EJ 2VBYA 1U1SA 2ZPBB 2XVCA 3AG4H 3BW1A 4FYWB 2EZHA 3J80K 4IEJA 3EFRA 5ECAA 2ZT5A 1HQCA 3PNYA 4KQEA 2QTXA 1WHHA 3DPTA 2DL7A 3JRAA 2F5EA 1PM3A 3KP5A 2X1EA 1IXCA 1DDNA 1RLPC 2L8DA 2LT1A 2RM4A 4QVDA 1STZA 3CCQQ 2ODRD 2RHQA 1MGQA 3DTKA 3NRVA 3WG7H 2BZTA 1FTTA 2P6SA 2FRHA 3RYPA 3G73A 2AKLA 2ZT6A 2CO5A 2UWMA 2A61A 4M77C 4AH6A 1C0AA 2KJBA 2R57A 1YW8A 2HTJA 3OYLA 1IZ6A 2JA8J 4BUGA 1EH8A 1QVUA 2CUZA 4EJOA 5L3FA 5EGOB 1A31A 1ETWA 4RB0A 4CDGA 3ZL7C 3M53A 3I56T 5GANj 2RHQB 4P72C 4FW2A 5IP6A 3RKXA 4X1VA 2KZVA 2RHIA 4NC8A 2EQRA 5F0CA 4GDFA 3S1QJ 1GT0C 1X27A 4M75D 3A01B 4OMLA 3SWNA 2CP0A 4YFKF 3ZN0A 1WX6A 3GOXA 4LVIA 4J6WA 2H27A 3CCQA 3AFHA 1IZ1A 2X6XA 1YI2Q 2HSEB 1VQLT 5CR2A 4IQ4A 2DA9A 2CQXA 3RERA 2YRVA 5IH2A 8AT1B 1X2NA 3GLXA 1TWFJ 1IXRC 4X5OA 2JTFA 4I01A 3MZ8A 3CCLI 1ASZA 3MF1A 4N4NB 2DYRH 1SRMA 1DU6A 4RMNA 2PQWA 2DXBA 1W5TA 3BCBA 3WU0A 2DK8A 2BKDN 3F6OA 3L2UA 1K73C 3A02A 3D7SB 2CUEA 2ALYA 1USYC 1ZR2A 4NUBA 3EHQA 3PQKA 3GF2A 1HKQA 4J9BA 4A5NA 4F55A 3GFIA 4JJBA 5HDNA 4P3PA 1VYUA 1JUMA 1V5EA 4XAXB 1VQ8T 4A3LJ 1HCRA 1YIJQ 1GXPA 4N0BA 4FX0A 2FO0A 4J19A 3ZQ7A 2J3MA 1D0YA 2DL5A 4M7DC 4CYCB 3H9QA 4QQ6A 4CICA 2DBMA 1FIPA 5HLGA 3N4MA 2LDUA 1BI1A 3OYHA 1J5YA 2CGPA 3GTLJ 3MO8A 4XU0A 2ZMEB 3J80Z 1ADYA 1EQRA 1JXSA 5K1XA 3FWEA 3KYLA 1X56A 3M56A 4M3GA 1AWXA 2CW0F 3BG9A 1OCCH 1K8AU 2CUDA 3OL3A 4OGCA 5LJ3e 2KIFA 3EQLF 1FJLA 1EJ9A 3QO3A 4WJ4A 4HPQA 4M6XA 4G94A 1AWCA 3N97A 2O3FA 1YS6A 2AHQA 2FZCB 4OB1B 4M77E 3HXZA 1X01A 1MNMC 4XK4A 2RI2A 1OYXA 5GAOp 2E12A 3DQVC 2K4BA 3PO3J 4EMKA 4IOCF 1XMAA 2ESWA 2VPRA 2M87A 3K1PA 3T0YA 2IGNA 4E4HA 3KXTA 2Q7GA 1M5Q1 2VQCA 2BY1A 2MD5A 2DKGA 4QQDA 5DCMB 5FO5A 2L0AA 1JJ2S 3CPWP 3FBNB 2L54A 3GTKJ 3DTEA 2CH0A 1Y07A 5E8IA 3E2UA 4P74A 4XLEA 1YWPA 1G3WA 2QF7A 2CSOA 4XRFA 4BY6C 1S7EA 2Z1DA 2RN8A 3UKGA 2L7ZA 2NVYJ 2VQGA 4Q4ZF 1ZSZA 3GWZA 3UDCA 2BHYA 2EK5A 4X1EA 2BZXA 1WWXA 5ILUA 4DGWB 3ZBDA 3I55Q 7AT1B 2QXFA 2FOKA 2LKPA 3BR0A 1AHJB 2O88A 4IUVA 2QA4A 1WLEA 2COYA 2FPDA 2ARSA 2HQXA 1E7OA 2O5RA 3ECHA 3QU3A 3S15J 1FX7A 1TT5B 4XICA 2MH2A 3TDUC 3ULQB 3S14J 4XTUA 3VRYA 2EAYA 4C5GA 2VGMA 2KZGA 3CCEI 1Q95G 1HDPA 4DQ2A 5HODA 1LNXA 2P5IA 2JPCA 4YRPA 2RNJA 1NEBA 3MEXA 2ZMEC 2LJ0A 2DTHA 4H2SA 3CMQA 4LMYA 5GAOn 1GDTA 4CZCA 1XC5A 3I35A 4DBFA 2EV0A 4PDKA 2VBXA 4E47A 4M7AF 3Q0UA 5L3DA 1ZRDA 2OD5A 1MMSA 3HXXA 4U0WA 3QUIA 3HTSB 1QP3A 3MHXA 4AWXB 5J1YA 1UHFA 3CLOA 5IN1A 3BG5A 2YS9A 3CLQA 4ESJA 3IRRA 4OIQF 4A3DJ 2YHTA 1Y56A 5ICEA 1N9WA 1X1CA 3PIPF 5IHNA 3O3KA 4YIRX 1OISA 5IXBA 1Z9CA 3HRSA 4H0EA 4KIGA 1PUFB 2JJ9A 2HQ5A 2MK5A 5C3EJ 3PL8A 2FUG2 4BJTA 3R07A 4A4HA 1SHGA 3K10A 2CZ0B 3LYIA 1XGOA 2A6HF 1R23A 5C51B 3TKYA 1R1VA 3MCAB 2VKVA 3SEMA 3PM1A 4XOTA 2VASA 2B86A 2I5UA 2UUZA 3CP2A 5LJ5e 1G3YA 3KPHA 2FBKA 1ZUUA 1UZCA 4YEJA 2V7FA 5K7HA 2NRAC 4A93J 2I4MA 5E79C 1NLPC 2DX1A 4Y91A 3PFYA 1BB9A 2W7NA 1ZQ1A 1A6QA 2HBWA 2JA7J 4G6TB 1DGWY 5CKEA 1B7YB 4Z2YA 1AWOA 2P0LA 4ZZDA 1D3BB 2E6NA 1S9HA 2HMAA 3GO5A 1M2OA 3T8TA 4DYRA 2IGMA 5FB2A 4KBMB 5KYWA 1NPRA 3R0JA 2IIMA 1O7LA 3C94A 3DFGA 2D1HA 4F04B 5C4JJ 2OU2A 4B4CA 3DLAA 5HK0A 2RGVA 3OYCA 3RCOA 2DL8A 1ONVA 4KT6A 1VIEA 4EEFG 3CP8A 3F8NA 3H3UA 1QLYA 3G1LA 3UNGC 2HCKA 2JN6A 3TQ7P 5DEQA 1QHGA 3URGA 3LSKA 1X1AA 3OMYA 5FKKA 2ZMEA 4YRRA 4RQEA 1ZRFA 2XU8A 3OBWA 3FK7A 3NPFA 5LJ5f 4A4KA 1I1JA 3KP7A 4HLXA 3LH5A 1YITQ 1IC8A 2LP5A 4J8OA 5CVRA 2F48A 4ESBA 3DV8A 3OMCA 2HVQA 2LD5A 1BCOA 3BTCA 2CV1A 3M7GA 4B09A 2MWOA 2Y2ZA 3CF2A 1ZUKA 4I98B 3WE3A 2Y30A 2G0EA 1G8XA 1WJQA 2EPDA 2J6KA 3HFZB 2O9SA 3C4SA 1SFXA 5FFXA 4WTOB 1L0WA 1UEBA 2EFIA 2E4HA 2ALYB 3CQTA 2EFPA 2DYSH 4YRLA 2VKEA 2IS1A 2EQKA 1W6XA 3GTOJ 2H3JA 2OAWA 3EFOA 2Z16A 1HSJA 4BE1A 1PKTA 2E3HA 5D5VB 4EDUA 2A69F 2H6BA 2CYYA 5K5OA 2KAFA 2X1CA 1VQ9A 2E3CA 2R92J 4J5YA 4XN0A 4CC2A 2P5KA 2ZXJA 3EUHA 3J81Z 3BZCA 2B0LA 5HDKA 3QPLA 3RDVA 4IRGA 3HOYJ 2BXYA 4P72A 3JR9A 3DU5A 1A35A 2ZIMA 4XTYA 3LSQA 2Z5UA 4EGZA 4M75A 2AZSA 3GFMA 4M7AA 4JJDA 2HEQA 2H8HA 1ZBJA 3KP3A 4C30A 1TUCA 2NUTA 5CVJA 1IN8A 1R36A 2DPDA 1MKMA 2L3DA 3QO8A 1VZ0A 2W85A 4AFQC 1UMQA 3JCMJ 2QQ8A 4EMKC 2ZXWH 2NNYA 1NJIU 1RI7A 5F27A 1V1CA 1B34A 4CC7A 2Z9OA 2EQUA 2VC1A 4HWRA 1V3FA 4HX8A 3PFIA 3ZQIA 2GNCA 2RJEA 2VIXA 5GMKj 1OULA 2KRFA 1T39A 1GXQA 4E7KA 3G3ZA 1ZUYA 1K8AR 2ESHA 4A3CJ 2Y9YA 3DP7A 2BV6A 3JCUC 4RGUA 2DAOA 3O8GA 5IYDJ 1ETOA 5EEHA 3JAME 4IRHA 5E3MA 4YG2F 2DAQA 4E7ZA 4EM0B 3CC2T 1KMMA 2MMPA 1JI8A 4RCCA 4G7ZF 4M9XA 2K3BA 4MDWA 1SRYA 2KHMA 1SFUA 3EAEA 3DLLA 4JX4A 4HVWA 1KQSA 4N4OB 1MNDA 1ON2A 2L4MA 4LG0B 4L5JA 1B3QA 1ZLMA 5KE3A 1EVKA 2QQBA 5GAN2 2IW5A 1UGVA 1Y0MA 2E5ZA 2LBFA 2DTOA 4F17A 1EZZB 4OGEA 1YIOA 4DYCA 3M58A 5E17F 1R8OB 2R5ZA 2CREA 4FL6A 2YPRA 4NQWB 2MWPA 3FKJA 3G1ZA 5D6XA 4Y3OA 5CKHA 2JS0A 4J9EA 3GZ5A 2GFUA 3LWHA 2DK5A 3OIPA 4ON0A 1WXTA 2CQKA 4MZMA 4FCYA 1HC7A 4Q48A 4AVZA 1XJWB 1Q86U 4CC3A 4HNTA 1M3BA 1JKQC 3CCSI 1B7YA 1X3UA 2P0PA 1Y0NA 2WAQN 3H9JA 4D5CA 2E5KA 4M4ZA 1F43A 2E5AA 4P5OA 2YX4A 2XF6A 2QAZA 3P7NA 1R4NB 3VB2A 2ZSHB 2XAGA 5E1WA 4Y13A 4U88A 3MP6A 5D6WA 2RD1A 2RDPA 3DBLB 4OMYA 4IPAA 2CP6A 2LBFB 1WRJA 2CUJA 4XOPA 3C95A 5FWCA 3VS7A 2IBDA 4C8QE 5E3IA 3SEZA 3OYDA 1IGQA 3EGDB 2DOAA 3OA6A 4JS4A 1JT6A 5L8RE 3KFUA 2XPUA 4RAZA 6PAXA 3CCRI 4ENNA 3CBPA 4M7AC 4RB3C 1WSUA 2F2VA 1E6HA 2GQVA 3UGTA 4LVJA 2WADA 3E3VA 5GAMg 3OYEA 1BBWA 1LFUP 2F2WA 2ZTGA 2K86A 4E7JA 1FP2A 5D7UA 3G6EA 4EJVA 1K9AA 3OQ5A 3JRGA 4AFZC 3HXYA 1UGQB 1MIJA 2FX0A 2NVQJ 1WCMJ 3A1YA 3F0CA 3U1KA 2VI6A 3WU2C 3WU1B 4D1QA 4ZTFA 4CCLA 4CCMA 3KBGA 5CQXA 2VQLA 1ERDA 1R5GA 3JREA 3HHGA 2EKHA 2KDZA 1YHQA 3WVEB 4M78B 4YROA 2D8HA 5FKOA 3F72A 3DWLE 1OYWA 3CC2A 4H2WA 3VU3C 4ITVA 4I09A 1FTZA 5FKLA 2X9DA 5GMKm 3CCUA 1HYOA 2VXDA 4G84A 3PIOF 2JK3A 4BHPA 1I4K1 2A3LA 2LNVA 4X9DA 2BYVE 3ZMTA 1WXBA 3JCMh 2DU5A 4MQ9F 5HK3A 4L6V5 3GUDA 2XDPA 2IA2A 4JBAA 4M7AG 1RL2A 1PJRA 3CDHA 2A36A 1HLVA 1CQTA 1PCXA 4ZGDB 2XGXA 1FZPB 2GBQA 1FNNA 1VQ8Q 3X25B 2RHXA 5D6YA 1S72Q 2FSWA 2K5LA 1G6NA 1RZ4A 3V8KA 1XCBA 1I3AA 3LFUA 4L9NA 5ED4A 2SEMA 2B8AA 3HTRA 3M4QA 2ISYA 3AT1B 1U5TC 1PC0A 3M1CA 1T0FA 4HSTA 1X43A 3OW2A 2JA2A 4HQEA 2AKKA 4CXFA 4C3JJ 2PMZN 2X3XD 5GJVB 1JJ8C 3K9TA 2DZCA 2K3YA 3VS2A 1ZKGA 5CLSA 1IN4A 4F52A 3OY9A 3FF5A 2KYBA 3CCJI 3E19A 1VQ5T 3I71A 1GV2A 3F6VA 4NNJA 2JZYA 2FQ3A 2NOJB 4GYGA 4BDYA 4C2UA 3VQVA 1AA7A 3K1NA 3VSKA 5IHKA 1NNHA 1JHHA 3HXWA 3FHZA 1LFBA 4H2XA 2DTZA 2LY2A 3H0HA 4Z8AA 5LEJA 5FFZA 3FHNA 3A5ZA 2H09A 1Y96A 3G1MA 1RI0A 1A5JA 4B48A 2LQWA 2LVSA 4RAYA 5JVGF 3DB4A 4LVMA 3HPWA 2IGOA 3RI4A 2E3IA 4N9HA 2RK2A 3IKLA 2EWNA 5HS8A 2OJ2A 4HSRA 1BR2A 1K1ZA 2OJED 1G2BA 1UHCA 2I8DA 3K6GA 1F1BB 3HOXJ 5EEGA 4G9YA 1JKPC 1RAAB 3V42A 2X4WA 2ZGWA 1KSWA 3FB9A 4FT2A 3M0PA 4ZYEA 1S29A 3SZTA 3MEWA 5CKFA 2PLYA 1OCOH 4I6ZA 1IF1A 2VGNA 1W4MA 2XAUA 3JCMd 3I59A 5FLXZ 3QWLA 3VQWA 3FXQA 2NS6A 1W2BA 2CJJA 5AT1B 4JOMA 3S32A 3C12A 3O8VA 3S93A 1VQ7I 2V9KA 1WDXA 4XLFA 2CP7A 2M8EA 3SFZA 1VQ5A 2DQ3A 1KQ8A 1MW7A 1SD5A 1R7JA 3A32A 2L7FP 3JSCA 3JTGA 3RQ4A 4RM2A 1E24A 4P96A 3WTUC 3X28B 3BR3A 3R61A 2QSHX 4DZJA 4QQGA 5ELOA 2ZXIA 2F5TX 5CO7A 1R22A 3UPUA 3PFSA 1X1PA 2CQ7A 1TS9A 4ENMA 4ZGEB 2M4GA 1FT9A 3FISA 1K6OA 1B8AA 4CCNA 3ZRGA 1FPQA 1R77A 4ZTZB 1VQPA 3OSFA 4FSXA 3A01A 5DV5A 4J6YA 4II2A 3H3VK 5J1UA 1W7PB 2CWEA 2DXIA 3M0QA 3JB9F 1H4VB 3VRZA 4M78D 2X0LA 4X34A 2XHKA 3KP2A 3CXCP 2KKOA 1B70A 1RIQA 4KR3A 2VUMJ 2PVOB 4OMMA 3I3LA 4C92A 2XSJC 1YJ9A 4OVAA 5KYYB 5JLXA 3G4ST 1GBRA 1MGTA 1Q7YR 1AD5A 4QSHA 3FLGA 1VQLQ 2VBZA 4FSSA 2E60A 3MEYA 3KZIC 3S3MA 2OTJA 3A03A 4N0AA 3HKZN 4MQVA 4YFNF 1JBMA 4MGRA 1P9QC 2PTKA 4OB3B 2HU9A 2UXXA 3M57A 3GXOA 3S17J 2LFBA 3VUZA 2FVUA 1TLHB 2WY8Q 1D09B 3U23A 4DOWA 1KC8R 1NJ6A 1GFCA 1TC3C 4L87A 1T95A 1WVRA 3LSTA 2V1QA 5CQYA 5GAMj 3BR6A 3BROA 4XKBA 5F6FA 4XKWA 2UZKA 2YDLA 4XU1A 5DM6F 2J5PA 3CCRA 2F4MB 2NXNB 1FYMA 2J06A 3DKXA 4CI0C 2OZ6A 4U0YA 5GAN6 1F36A 1VQOA 4ATOA 3HRUA 1W0UA 3HY1A 4YRMA 3QWXX 3SHFA 2NVTJ 3M0UA 1PWTA 5E1ZB 3OS1A 1VQMI 1MHNA 5M3FJ 1V76A 3QP6A 2MW8A 2XPWA 1Z91A 2F6CA 1QO0D 2VLAA 4A0XA 1VQ8I 1K0SA 4QPQA 2L3PA 3BCAA 2EYWA 3E6MA 3BJ6A 4FHTA 4VUBA 3E97A 3VYHB 5CQGA 3SDBA 1QBJA 2STTA 3ESWB 1G3SA 4RTWA 3JCMg 3PIOA 2QASA 4EMSA 2PI0A 3A8MB 1SETA 3IL2A 2HPMA 4DJAA 5HNHA 3KLNA 3M4OJ 2X6WA 3OD1A 1YHQQ 2CRGA 3AL0B 1IXDA 2GA2A 3CCUI 1CF7A 3CDIA 5FRNA 3DF8A 1IHWA 3HM5A 2KI7A 3QTCA 3TBIA 1QRYA 3GZNB 2GF7A 4M75B 5BS6A 3ZMSA 1IUYA 4XLNF 2DVEA 3M4GA 1GGMA 3ZMUA 2ZCWA 2F5DA 3X26B 2VONA 1DP7P 4M6VA 2OTLA 1MUZA 2M0YA 2LLKA 4BQOA 3KE2A 2VYTA 4HT9A 5JFRA 4ABZA 1P2FA 1HBXG 4AYBA 1B8IA 2AT1B 5IYCJ 2QTVA 4RTXA 3LSIA 3SWNB 4D8DA 2A07F 2ZZDA 4P3OA 5K1PA 3OS0A 4NC7A 1XG1A 2DODA 1NE8A 3BJAA 4KUMA 2K5IA 2NS0A 4UUTA 4DOVA 3LSGA 1YP5A 3QSUA 5EGOA 4A6DA 5GAN7 3EGXA 3PE0A 2JM8A 3I53A 3ZQHA 4DBQA 5LRSA 3QPHA 2O8KA 3EDPA 3I7FA 5F64A 1SC7A 1TUGB 4ORZA 2OQRA 1U8BA 1VYVA 2X4YA 2DFHA 3TSZA 1YJNI 2CP3A 2E5QA 3I5UA 1W5CC 5C4XJ 2DO7A 2A6TA 4PFPA 1YTYA 2Z3YA 5TRDA 2NAZA 2DXTA 5D6FA 2KRNA 4RQFA 1M1KR 1EFNA 3ABTA 5IXFA 2KIUA 4OB2B 4C5IA 5C53B 2HGCA 2OAZA 2YXYA 4A53A 4JS5A 2M7BA 1ETKA 2L9NA 3DKWA 1S3JA 4ZYDA 3L7WA 4O3MA 1UTIA 4XRSG 2DPUA 4JPBW 2K27A 3FIFA 1VQ9I 4F7UB 4GCVA 1BJZA 2HZYA 4KMUX 3BDDA 2R58A 4RAFA 2XMFA 1GCPA 1OLTA 4FYVB 1YRNA 2ARTA 1R5HA 2GM4A 2ADUA 4U7BA 1LVAA 1ZGAA 2RVCA 1FXXA 2A28A 2JPBA 4O5VA 2XAFA 4LDYA 4RG2A 4A63B 2DA3A 4UY8I 1OX8A 1PHTA 2C0IA 3BE3A 2QHUA 2RI3A 2PMEA 3QWYA 2DA5A 4CH4A 5GPCA 4AMCA 4GXOA 5ERIA 2AO9A 3CMMA 1RACB 3MF2A 3GW2A 5BQTA 3KFWX 5BNGA 2HOAA 3CCVI 1ITYA 1B72A 2W10A 3VPRA 2E65A 1M3CA 3CMAA 2K3FA 3VWBA 1QNTA 3M8FA 3JV3A 4G6DA 4JJCA 2ZIOA 2O4XA 4DIQA 3ERMA 2E41A 4IUUA 5GAN5 4MTDA 1B7TA 2H3EB 5C0MA 3H3ZA 3CCET 3FZVA 5H6RA 1D1BA 4AIKA 3IUOA 1NYFA 4BDZA 2XGCA 1QKXA 1X2KA 3IP4B 4MO7A 2H8RA 2M51A 1N8RU 3P8YA 3W2AA 3HFZA 2M5WA 1YE9A 1YS7A 4CHUA 4JRKA 4JRPA 3P9KA 4W97A 1QZYA 4NL2A 1YJWI 4CA0A 2K9GA 1MMDA 1HXDA 3K4CA 2LJ3A 3QBYA 2BZYA 4XTWA 2YR2A 3A8GB 2RHYA 4IUPA 1Z7MA 1WHUA 4YCVA 5ELNA 2A0FB 3E5UA 1ZH5A 4OINF 2KMUA 2O8XA 2PNIA 4HVUA 1VQNI 4TQDA 1AWJA 2ABLA 1C0WA 3K4LA 4S05A 1I07A 2GFAA 2XD0A 2LKSA 1VQ4I 2W48A 4A3FJ 1BC8C 3RMQA 2DETA 3RPUD 3JRHA 2DLPA 1WH5A 3R60A 2ZNIA 1EX4A 2O4XB 3QZ9B 4YCWA 1BI2A 2EJRA 5LGUA 3Q9SA 5LJ3f 4HX4A 3HPGA 1APLC 4CO8A 2GA1A 2JRTA 2K7AA 3CCSQ 1Z7LA 3I56I 5GAN8 3LSHA 3EGUA 3HP9A 2E1MB 3CCMT 3JB9J 2K02A 3IRQA 3GIBA 3PUBA 5JLWA 3E1SA 2VQHA 2M3AA 4ENJA 2M16A 4L5IA 2X3WD 4P3NA 2Y48A 1MMNA 2XTIA 2LQKA 3RR6A 1GRIA 2QHVA 1UHSA 1YB3A 5D4SA 2PJRA 3HFNA 4M77A 1QVFS 2DA6A 4CCJA 5GADJ 5I2MA 4ZTJA 4R8HA 5EG2A 3LNQA 1SVLA 4ZN1A 1KD1R 2LTOA 2NUPA 1OU8A 2YUPA 4NL3A 3CD6Q 4HT4A 3JRFA 1JXMA 4C3IJ 2HQNA 1KU2A 1S7OA 4BI3A 5I11A 1IAWA 2O6GE 1VQPQ 1KC8U 2O9LA 2YRDA 1FP1D 4YIIA 3PUFA 1MMAA 2Y0SA 1J75A 3RBBB 3AHUA 3T1BA 3I4NJ 2N8GA 2EPFA 3K69A 3NAUA 4HOBA 4L9TA 4OU0A 1USSA 3EH1A 3M54A 3N5BB 1VQ8A 3OL4A 2HBPA 1ZLKA 4KUDK 4LD9K 1PYSB 3P8VA 1YI2A 2CUFA 1M3AA 3IKVA 5GPAA 2QKMB 2JTVA 3R0AA 2B7EA 5JHUA 2KT8A 1JHFA 3QPSA 1JJ2A 4R56A 3CC7T 3RQIA 1Z9ZA 3JB9G 4I0AA 1SSHA 3FXLA 1OPCA 2A37A 2J6FA 4LN2A 2HOTA 3H0IA 1YYVA 3RUXA 3H35A 2RHSB 4K88A 2AQFA 2W24A 5CVVA 5HS9A 2OTJI 1KC8C 1JJCB 3PCOA 4IUTA 4KA4A 2BTTA 2ZR2A 2KQRA 2X9HA 1M8MA 2E2IJ 4CH6A 4YRFA 1DPRA 2LY1A 3ABMH 4H2VA 2WA0A 2DFIA 3GLLA 3F21A 3QYGB 2ZPFB 2NYXA 2E6ZA 2YX7A 3F8BA 5D4RA 1E1OA 2P5LC 5J47A 2YUNA 1ZLJA 4DYQA 3QJYA 2LKXA 1D0ZA 1IV8A 4C0DB 3CCLT 4GFBA 2DIGA 1SEUA 3TP0A 1B76A 3FM3A 2ED0A 5C6SA 2PMFA 5A2QZ 1YBYA 3H5RA 3BFMA 2RNAA 3V8LA 3C1DA 5DS9A 3J7AY 1KU3A 2OPTA 4LITA 1N75A 3GTPJ 1Y57A 2CZ1B 1M9SA 2AZVA 2DMOA 2RV8A 1TWBA 4CSWA 3ASKA 1UUEA 1ZSGA 1ZHFA 2R5YB 4CC4B 1H4QA 3WG9A 3WODF 1HW1A 1ACIA 4LDVA 1QQIA 2BBYA 2WV1A 2HQEA 1X4PA 1BL0A 1YN8A 4IUQA 5LJ5g 4P73C 2PUKB 1BBUA 1ARKA 4P73A 4TVAB 4EO4A 2MAMA 1MV3A 2O31A 2O7OA 1ZHIA 2KE9A 2CSIA 3OMGA 4BI4A 4L9JA 1ABQA 2X4HA 1PD0A 4F7UF 5E3LA 2FQ4A 3MP8A 2JUCA 5CKTA 1LUJB 1B07A 3HL8A 3BR1A 4XLAA 1MV0B 2DIQA 4RB1A 4LD6A 3SFIA 2E5NA 4XSZF 1O3QA 3D5LA 1G5HA 1OEBA 3WTSC 4CS2A 4HQMA 3RMSA 5CJ9A 2K9LA 3UR3C 4BL0B 9ATCB 2WSEE 1Q1VA 2JTEA 3FXUA 3MPUB 2ZR3A 3TREA 4YRNA 1I5ZA 1UFMA 5KNNA 2K40A 2QWWA 5EC7A 5FROA 1XCVA 3MD2A 2RPNA 2PVGB 3FXMA 3W6VA 1RRJA 5GAOl 3ASOH 2JRMA 3CUQB 3C0CA 3J81E 1JJ2P 4YCUA 2G3RA 1G59A 5DD8A 1PD1A 2X6YA 1W7PD 4RGXA 5J8FA 4IX7A 3ROUA 1PRLC 3GPLA 1W7PA 4TVWA 2DA2A 2L02A 2QGGA 5IHIA 3H0GJ 3LSPA 1IB8A 2CV0A 3HL2A 4KDPA 2IS2A 3QYHB 2DJZA 3QODA 3FJPA 3PO2J 1WLPB 5GANe 1MJBA 2KQWA 1HJDA 3C3WA 4CUGA 4Q5SF 1Q81C 4YELA 1SERA 1VQ6Q 1B59A 5LJ5h 3H36A 4J6XA 3HOVJ 3CJQB 1VQOQ 2ID6A 2HR3A 1VQKQ 1BK2A 4PJLA 2KRSA 2L3QA 3LLRA 3TQNA 4FYXB 2QZ8A 4BH9A 4N0AC 3QG1A 5A0GA 2ZJPF 4HXJA 2HXIA 2HDAA 2ZFWA 3CCSA 3A8OB 4L5GA 1YIJA 4CS3A 3ZP5A 4C0DC 2K4YA 3ZXSA 2JQ7A 5KAFC 5GAOr 2FBHA 2CU7A 1GXIE 3QU6A 4HBLA 3I59B 1W0TA 2J3LA 1KMNA 5IT9E 3K4JA 1KQ2A 3X20B 4PK4A 2O03A 3TL4X 2X4JA 1OCRH 1M90C 1K7AA 2LQNA 4M7AE 2OTJQ 4LLNA 2DU7A 4PSXA 3NQOA 1FMWA 4M3BA 3MWMA 3PMIA 3QDRB 3UF4A 4KR2A 4C92B 3QJ6A 2R7WA 2RAEA 1ETYA 1FOYA 1B34B 1X55A 1FBQA 4G85A 1EFWA 2FD5A 2EFQA 3MN2A 1GCQA 3Q1JA 3HFVA 3LSSA 3M4PA 2KT0A 2LP0A 2KYMA 3E9FA 1R0CB 2P0QA 2PZ1A 2K79A 1XSDA 1FIAA 2CS7A 4MMKA 3PMTA 2FMLA 3VS1A 1WPKA 3CO7C 4P75C 4TV7A 1K9MR 3TUPA 2K9MA 2X6OA 2LSOA 2XKOA 5DYMA 5ICCA 1X75C 2EIMH 1FWZA 2EKOA 2LDMA 4IHXA 2R4GA 2WAEA 3P8DA 4YRTA 3H1CA 3JRDA 2E2JJ 3A74A 2WB1N 3GFLA 1TQPA 4FM4B 4UP7A 1IDYA 4AT1B 3DU6A 2ELHA 5GTIC 3OYFA 1TWAJ 1MDMB 2ZINA 4A5MA 3CO6C 5IOZA 3B6AA 5J40A 2JA6J 2MF2A 5DY9A 4YDQA 4CH7A 3PSFA 3OYAA 3A2KA 3UWNA 2K5FA 1WZ2A 1VQ5Q 1AEYA 3S1NJ 1E1TA 2OBPA 4ZYAA 2Z33A 1FYLA 5GAN4 1KD1U 2JUGA 1FOKA 4WCGA 3Q5FA 4KT0E 4XNFA 2VE9A 5D6EA 3WTXC 3NARA 2QA4Q 4JJNK 2P0WA 1RR8C 4R0KA 2KISA 2V79A 3E5XA 3HRTA 4RS8A 1Y1WJ 4D7MA 1VQ4A 2ZXFA 2CKKA 3BY6A 3MJXA 1XPXA 1RADB 5J26A 1KU7A 2ZO4A 4QTRA 5HY6A 3OSSC 4WJ3M 3RDIA 2FZGB 1WJCA 2DOFA 4E7HA 3OV8A 4M7DG 2DFEA 4M7DA 1SVOA 2CQQA 3A0BC 1P4XA 1KA8A 2P0KA 3SB2A 3CC7A 3MQZA 2F69A 2JMWA 3WGIA 1IO6A 2E10A 2V1RA 2R5MA 1LFPA 1Z1DA 4F91B 2CS3A 2EFWA 2BIVA 3OOUA 4BGDA 1O4XA 1JB0E 4XTVA 4C8QF 4NC6A 4RLQA 5J1RA 4Y92A 1WQWA 3GCMA 3WGHA 2H6CA 3L9FA 2MD0A 4P5NA 3JCMW 1YHQT 2F5CA 2IVMA 4ZDPA 2K9NA 1CKAA 3P8HA 3S2WA 4FW1A 5J3BA 4XSXF 2EQJA 1Y6IA 3TO9A 3T8RA 1NM7A 3JRZA 3G7ZA 2ECBA 3O8HA 2D1VA 1K4SA 3ZMZA 4A3JJ 4JRIA 4N4IA 1TL8A 2CGHA 3KP6A 4FASD 5KE2A 1H641 1K4US 3VQYA 4FETA 1LQ1A 4XKVA 2X48A 1Z7NA 2L89A 3CPWA 4BHCA 1MDMA 2WV0A 1SFOJ 4WXCA 5H6QA 1VQZA 2M2EA 1RESA 4S0HB 4I2OA 1R6RA 3WE2A 1PSEA 1VIFA 3EGDA 2MC4A 4PFOA 3BDLA 5J39A 1QF6A 2DMNA 3HDDA 2RF0A 4QLCU 3EYYA 3K4BA 1MJ9A 3E6CC 4NOYA 4RMFA 1NEGA 5CCAA 3V8JA 3CCMQ 3T9NA 2NVUB 4DW6A 5AIQA 4LLLA 3CCJQ 2LOOA 2JA5J 3LA3A 1UELB 5E8GA 1Z67A 4GO1A 2CH4W 1X2GA 3MKDA 4JX6A 1C6VX 2ZPEB 2K4JA 1IN6A 1TT0A 3ERED 2KY9A 4KUIA 4RTYA 5HCKA 5GAOm 2CSQA 2G9WA 3ELKA 4LG3A 1I81A 2LJ1A 2GXBA 1KG1A 1NLOC 1KD1C 4JYKA 2HVSA 2X51A 2EVRA 3FEOA 4HCZA 2LF7A 3TU4K 3HOSA 2ARUA 2DMTA 1PNJA 3LH0A 4RDUA 2PVDB 2D5VA 4XORA 1IO2A 3K1MA 5K5RA 2M45A 2MGQA 3HUGB 3ZQLA 3BTIA 1NK2P 2I0NA 3JTHA 3O6BB 1U8RA 4U87A 3K70C 1WJRA 3NMZC 1IGUA 2JJ7A 2A5YB 3A7AA 2H1KA 4XBFA 5EDNA 2DJQA 2AHJB 4A0ZA 1UFFA 2QI2A 2UXNA 1CSKA 3VUBA 2ZSIB 3SFMA 2PU9B