3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
4EM2A 1NHAA 1QQIA 3F23A 2XV4S 4I09A 1DUXC 3G1ZA 2A6EF 5GANe 3FZVA 2ZIOA 4PGHA 4OLFA 1B7YA 1S29A 4HAMA 1FPQA 1K7AA 4RGUA 3G73A 5L3GA 1BC8C 3DXJF 1BI1A 5EEHA 4EMSA 4M78B 2CWEA 3ERED 3DFGA 3GFJA 3GZ5A 4S05A 3QSUA 1P6RA 3LA2A 4YCWA 4OMYA 4JLIA 2A69F 4O5VA 1MJ9A 4LLGF 2ADUA 5HDGA 2ZGWA 2MC3A 3VOEA 1RNLA 2EV5A 1USYA 1ODDA 4XU0A 3Q9VA 3L2CA 4ZYGA 2FBIA 3IG2A 1TBXA 4TQDA 1P92A 3JSPA 2OZ6A 3GFIA 5LJ5g 2E5AA 3F6VA 5DCMB 1YW8A 1XN7A 1ZGAA 1LQ1A 2QHUA 2R7DA 3NETA 1R5HA 4Y17A 3P8YA 4OIOF 4BQAA 3QAHA 4LB5A 4BHCA 3RI4A 1ASZA 3NEMA 2QUFA 2VOOA 1FBQA 1ZGJA 4U7DA 1SETA 5GAOp 3RGLA 4XTWA 3F8MA 1I8FA 2VC8A 1J9IA 4YYEA 1IN5A 2EFNA 4YRCA 3HXUA 1D3BB 4MEXF 4RB2C 2J3LA 1LJOA 2PFBA 2F5CA 2HZTA 2ZNJA 1Y0UA 4MTDA 2DZ9A 4C8QC 1U3EM 4CS2A 1FZPB 4P9UA 3FM5A 3Q5FA 2X4HA 4NHJA 2JSCA 3HSBA 4WXDA 1XGMA 4PJOD 3F6OA 4J5YA 1Y96A 3TOBA 2EV6A 3TO7A 3ZQ7A 2EA2A 4Q5SF 3LQQA 3ZMVA 1KOGA 3JB9D 3DP7A 2L54A 4XSZF 3J80K 5GMKi 4WX9A 1H4QA 4H2SA 5GANf 2ALYA 1EIYB 4YRFA 1JJCB 1Q1HA 2XVCA 3HTSB 2K7LA 3V7CA 3CUQA 1ZRFA 3BDDA 1BM9A 4L5JA 3RACA 4WF2A 1RIOH 4M7DG 4XU3A 3NRVA 1B8AA 4PZJA 3BPVA 3K1MA 3R61A 2ZFWA 4BHBA 1WQ2A 2D45A 2XASA 1MGTA 4H2WA 1KU7A 5GAN8 5H6QA 4A6EA 4L87A 1MZBA 2FU4A 2P8TA 4QVCA 1BI3A 2FMLA 1BOAA 2EL9A 3JB9J 1CF7B 4H2XA 3I59B 4G8XA 2BV6A 2HQRA 1USTA 1FYKA 3W6JB 2XUBA 3DKWA 3HFVA 1SFUA 2VT3A 5LJ5h 3V8KA 5CYVA 4CZZA 4BWAA 1Z7NA 5D5WB 5KNNA 2DTOA 4PJOF 4BHPA 1TNSA 1R22A 1K79A 4P72C 5GAMg 4HZFA 1FBUA 1KMMA 1PDNC 4EMHA 1WRJA 1EH6A 5FO5A 2VODA 3N4MA 1FSEA 3KLOA 3BP8A 1B6AA 4M9SA 4RB0A 4ZYHA 5LJ5e 1ATIA 1G3TA 3R6SA 4RB3C 4BW9A 2VT2A 1HTTA 4KR2A 3TO6A 3CO7C 4AWXB 1T98A 3WTSC 2EWNA 2O8XA 3BOQA 1LEBA 4HX7A 5AIPA 4U0WA 2E41A 4TQFA 4M75D 5I21A 3FXUA 1EOVA 4KT5C 5E8GA 2RHSB 2EJGA 2CW0F 2LF7A 2VBYA 1ZG5A 4N0AA 3GXOA 2DQ0A 1EV7A 3MF2A 1IN6A 4HLYA 3INZA 2MD5A 3WTUC 4G85A 2X0LA 2ZINA 5LJ5f 3A7AA 1MGQA 2Q5HA 3RDIA 3WQZA 4TVYA 4M75B 4F7UG 4G9YA 3QO5A 4HVCA 4KN4X 1P4XA 3RIRA 4N9HA 4YRKA 1E17A 4Q47A 3JTGA 1WPYA 5LJ3d 2HGCA 4YRTA 4PJOA 2YPRA 1BJAA 4XLNF 3P8VA 4KIFA 3HFNA 1SRYA 4HT8A 1BI2A 5CVUA 4QLCU 1KQ2A 4G6QA 1STZA 5CVVA 4YRMA 2RHQA 3GO5A 2L4AA 3NELA 5TJJA 5GAN4 3RPUA 4M77E 4P3NA 3GWZA 4XU1A 2P5IA 3HXXA 3Q9SA 2YU3A 3ZN1A 2KJBA 1I6XA 1PYSB 2ODRC 2VBWA 4UVAA 4M9ZA 1R5GA 3FMQA 2VOPA 3BJAA 4YFKF 1XGSA 1XDSA 2DEQA 5ICEA 1ON1A 1B7YB 4Q6GA 1G5IA 5J8FA 2ISZA 4OIRF 4U0YA 4OMZA 3L2ZA 5GAMh 1HSTA 4UV9A 3C1DA 5L3FA 2ELHA 5ILSA 2QBYB 4K87A 3HRTA 1D3BA 2HYFA 1SD5A 4NOYA 4P3OA 1REPC 2VBXA 1L0OC 1LEAA 2PJPA 4U88A 1SMYF 1OYIA 2FXAA 5ICFA 4UPAA 4M7DE 4C92E 2RB6A 2OBPA 2GQQA 1FBSA 2PG4A 4M77F 4A2UA 2R7FA 5FB2A 2RV8A 5LHHA 3BY7A 4M73A 1U1TA 4YROA 5FLXZ 1SD6A 4G7ZF 4UP8A 2RVCA 5GANh 4P74A 3GX4X 1OYWA 1N9WA 1HKQA 2VXFA 1LB2A 11ASA 1USSA 2VC1A 2VXEA 3A5ZA 4L9VA 5DDGA 4YRGA 4FT8A 1ADJA 2I2LA 2ZO4A 2O61A 4RGXA 2FNPA 1MKMA 3JCMJ 3P8TA 4A0XA 1PUEE 1EFWA 2WTEA 4EJVA 3EFSA 5GMKe 4G6DA 2BE5F 5DCFA 4A0ZA 3ZN0A 4UV8A 3RTRA 2DTHA 5FFXA 5LJ3f 1K78A 2A6HF 4UUVA 2ZZFA 1YQAA 1NJ8A 2QTXA 4EMGA 1PP7U 3M8FA 3MFKA 2LDUA 3D5LA 5GMKh 1FWZA 2GAUA 3QO8A 4DNCA 2V79A 1LJ9A 5CLSA 3QPHA 2FSWA 2Q0OA 2DQ3A 1X2HA 4RB1A 2XROA 3WG9A 4P71A 1U1SA 5DD4A 3LWFA 2ZT6A 3JCMe 2H94A 1YLFA 3LSSA 4CH6A 4CHUA 4JRIA 4M72A 2MBFA 3HHHA 2OAZA 2CFXA 2GXBA 5HLGA 4TVWA 4R1HA 1B70A 4EX5A 2AXLA 1KQ0A 5LLQA 3U1DA 3A7UA 5J8CA 3QU6A 2C7IA 4M7DB 4HQMA 4XLPF 4I02A 5F5WA 4AIHA 1T39A 3RUXA 2CJ9A 3I71A 3C3WA 3BJUA 3T1BA 3MCZA 1L3LA 4A53A 5LJ3g 5E20A 2R3SA 4P96A 1B9MA 2L4MA 4RAYA 4Z2YA 4YRNA 2NYXA 1O7LA 3KZZA 5GAMe 3W6KB 4XTXA 2W84A 2AS5F 4AIKA 4HX4A 2YR2A 3TUPA 3DEUA 1I27A 1Z05A 4C8QE 2ESNA 2Z9OA 4EMKA 4HDVA 3SFZA 1J59A 4C92C 1ZH5A 3EYYA 3IWZA 5GANg 5ED4A 3LC0A 3I53A 3VQYA 4UP7A 2DBBA 1X54A 2FA5A 1H4TA 2GA1A 2F2EA 1SD4A 1EVKA 5DCMA 3D0SA 4EM0B 1LOJA 1YFHA 2HDCA 2EJRA 5GAMf 2PMHA 4YIFA 3HXZA 4ZTUB 4RCCA 4M7AD 1ZN2A 1W7PA 4EV0A 5ICCA 2DJZA 1KYZA 2QHVA 1G6NA 1MJBA 5K5OA 2VE8A 4YREA 3VFZA 3BROA 5JR3A 3VEPA 5IT3A 1WWXA 2Z3YA 2L02A 2EFWA 2K4JA 2IA0A 4P73A 3QO3A 2DU9A 4M7DF 2HR3A 1FLIA 2P6SA 4YIIA 1WQWA 3ZPLA 3ICAA 2RHSA 1YB3A 2M1BA 4M7AF 3HFZB 5L3EA 1JGSA 1AWCA 1NJ5A 2P6TA 4M75G 4F7UB 2AKWA 1AOYA 4HV5A 5FFZA 4EJWA 2PEXA 5DYMA 4X9DA 4H2TA 5GAN2 5E1ZB 4KIBA 5DV5A 2E7XA 2D1HA 2LSOA 1R36A 1IL2A 2P4WA 1YG2A 1G5HA 1O3SA 4ETSA 3HXVA 4EJOA 1SAXA 1R1UA 1EVLA 2CGPA 2ALYB 2XTIA 1HW5A 3SB2A 2O0YA 2RGVA 3HY0A 1R00A 3VODA 3IC7A 3HRKA 3ECOA 3KP7A 3CUQB 2W25A 3I58A 2VXZA 1ZREA 2H27A 3WTTC 4L9NA 5JFRA 1NJ1A 3A74A 4CO8A 2F5FA 1QF6A 4P72A 1D8JA 4TWAA 2Q2EA 3I54A 2PBIA 4WK8F 5E18F 2J5OA 4ESFA 5TRDA 4YRSA 2ZKZA 2LKPA 2Y90A 1J75A 3JCMP 3AAFA 3P9CA 1WLEA 4LG0B 4YRQA 5F6FA 3RERA 5L3BA 4MGRA 3ABTA 2A3SA 3FWEA 5LGTA 1VQZA 2LNBA 1T38A 1TQPA 3QU3A 4L5IA 3LA7A 1ZYRF 2KKOA 2DLLA 1WSUA 2MLGA 3J7AO 1J5YA 4U0VA 4RMFA 4M6YA 3GIBA 1YFRA 2DTRA 3HRSA 4Q48A 5HS7A 2XGXA 3HRUA 2A07F 2ODRD 3L1AA 3WU0A 5GANd 2ESHA 3CUQC 2K86A 4BNCA 5A2QK 5ELOA 3I7FA 4XBFA 2ZNZA 3L09A 2YLCA 3ISPA 1T0FA 1TQMA 2FOKA 2L01A 1U6GA 3JW4A 3JAMK 2GA2A 1LNXA 4KQEA 1N9SA 2HKOA 3HSFA 3JB9G 3GVAA 4B8XA 3GFMA 3F22A 3GLXA 2FBKA 3AHUA 2M45A 4GYGA 2XGTA 5JVTA 1T6SA 3FXQA 1RIQA 4TVAA 4PJOG 1QZYA 3HTUA 2JPBA 1BI0A 2NRAC 3TEHB 1IXCA 4P74C 2W85A 3ZMUA 3R07A 5EEGA 3L4GA 4M6XA 4IJAA 2C6YA 2UXXA 1DP7P 2OZUA 5FD6A 3ABUA 1W4MA 1XGNA 3WGHA 5D8LB 5LGNA 3F8BA 1S7OA 4GYIA 3ERRA 1LNWA 3EQLF 4XEMA 4CH3A 2DQRA 2J5PA 2EA4A 4H02A 1B76A 2JPCA 3HIFA 1TQIA 2YSRA 1ZHFA 3RJPA 3JCMf 2CIMA 3T8TA 5HOOA 5C53B 3KP2A 3BJOA 2HEOA 3TDUC 3A7RA 4HWSA 4IF4A 3LFKA 6PAXA 1Z6RA 1OYYA 3GUDA 1HKTA 1GGMA 1V3FA 5DD8A 1LDDA 1U2WA 3QP5A 1W66A 2HOEA 3LSTA 4KR3A 4M9XA 4P3PA 4IHTA 3JCMW 3M9AA 1HC7A 3J80Z 2H09A 1H4SA 4PJOE 4JK1X 4E51A 4YRJA 4M77G 4JBAA 5J6XA 2ACJA 3QPTA 1TTYA 3FB9A 4O6JA 2FYKA 3VU3C 2EB7A 3P9KA 5HDKA 5GANj 2DAOA 3RKXA 1KMNA 3WTWC 2BEOA 4HA8A 4AH6A 2HWVA 1ZLJA 1MDMB 4YDQA 3KE2A 1QE0A 2D1VA 4H2VA 1QO0D 12ASA 1Z7MA 4H0EA 3E97A 3K9TA 2P5LC 1F9NA 2K57A 4G7HF 3L4GB 2YHTA 3RYPA 4EGYA 2DVEA 2AKWB 4N0BA 5FGMA 2VN2A 1XB4A 1IW7F 2Z33A 2L3DA 3RPQA 3OOPA 3BFMA 2P5VA 4M77A 3B02A 4PG3A 2DI3A 4M74A 4FHTA 1KQ9A 4GXOA 2P5KA 5E1XA 2FRHA 4G84A 4YPFA 2COMA 3QO7A 4HLXA 2PMEA 1FC3A 3LSQA 5GAN5 1JXSA 5E8IA 2GZWA 2EK5A 3WE2A 4M77D 2YLBA 3E6CC 4M75A 3H3UA 4XTUA 5GAN6 5ELNA 2VE9A 2KJCA 3ROUA 1C0AA 2VC0A 1F4KA 3LA3A 3FJPA 1YYVA 4LJZF 2PQ8A 4EJUA 3V7SA 2JT1A 3HYIA 3IWFA 4NB5A 4EO4A 3K1PA 3QTCA 5ILUA 3DPLC 5H6RA 2KIMA 4LFUA 2F5DA 3K0LA 3IRQA 3HSRA 2STWA 1G3SA 3WTVC 1KA8A 1D5VA 2RHQB 3PQJA 2RQPA 2QHSA 4PHCA 1I5LA 1YCYA 1FP1D 1SESA 4RGRA 4C92F 2HTSA 2ISYA 2AMCA 2BGCA 1GXPA 4YRRA 4TV7A 3FIFA 2Y48A 2KIFA 1U8RA 3QOPA 3MWMA 4ENMA 1ZRCA 2ZTGA 3KP3A 4H2YA 1X2GA 3JB9H 3O3KA 1P4AA 1YW7A 3L7WA 1G3WA 1O57A 2EFOA 3A5YA 3GW2A 1SFXA 1P2FA 2DFIA 4O3MA 4MTEA 1HKSA 1XSXA 4KFCA 1IN7A 3I5UA 1IRGA 5LJ5d 3T8RA 4HF1A 3HHGA 4M77B 3ECHA 4P73C 2EFQA 4MEYF 5D5XB 4GO1A 3REUA 4I0AA 2W57A 4R79A 1FOKA 3T5XA 2ZJ2A 3M1EA 5C51B 3K1NA 4NQWA 3FM3A 3TGNA 4CS4A 5GMKm 4MNUA 4O2DA 2GXGA 2FEZA 3REOA 3QUIA 3K69A 3U2RA 5ICGA 3MF1A 3VQXA 2ARUA 1GHCA 2IP2A 1Z1DA 4K86A 4EMKC 2E3CA 2XKOA 4A5NA 5D4RA 1QBJA 1WYDA 5LJ3e 2DDZA 4XSXF 2JN0A 5FD5A 3QHSA 2RDPA 3WU1B 5H20A 3HTZA 4IRGA 4HF2A 4ESBA 5GAOr 1XSDA 3EUHA 1G4DA 3I64A 4TVAB 2PN6A 1WNLA 1FYFA 1EH8A 3HFZA 3I0TA 2F5EA 1M8VA 2I4MA 1OPCA 4M7AB 2EV0A 4CDGA 2RA2A 4F7UA 1KU9A 1R58A 1ULYA 4RGSA 1H9TA 3SZTA 2XRNA 1QZZA 1KQ1A 4OIPF 5LRSA 2G9WA 1BIAA 1TW3A 4OP0A 3LAJA 4HQEA 4K88A 1MDMA 4G94A 4M75C 1EH7A 3B73A 3E9IA 2RC4A 4CH4A 3L00A 4CH5A 1FNNA 3COAC 2QZ8A 4LB6B 2UZKA 2ZXJA 2TDXA 3K2ZA 1H9GA 3DPTA 2GWRA 2JRTA 1S3JA 3ZMTA 2IW5A 1F5TA 4YRPA 1TNTA 1UCRA 1UFMA 4CICA 3BZ6A 4HWPA 4WXCA 1IZ1A 1R1TA 5GMKl 1O3QA 1NYRA 2FMYA 3EDPA 4A5MA 5D8KB 3MEYA 4LG0A 3TQNA 2IJLA 5CJ9A 5LRRA 4YRIA 1U5TC 4ZYDA 2YX7A 2CO5A 5ERIA 5K1PA 1DDNA 1J5WA 1L0WA 4KMUX 1KQ8A 4M7AG 1BBYA 5HS9A 5JHUA 3DQVC 3FMRA 3ZMSA 4YFNF 2M30A 3C7JA 4RQEA 1SMTA 4ON0A 5D6FA 4C92G 1B70B 4YP0A 4UNOA 3FHZA 4JUVA 1XMAA 1JRIA 2O3FA 5A2QZ 3V8LA 3PZCA 4Q4ZF 1HSJA 3ZMZA 3OV8A 1YO5C 4PGGA 2YX4A 1O7FA 1LDJA 2NNNA 3DSQA 4KIGA 2HKXA 4KNYA 3R4KA 3J81Z 1KU2A 1BIBA 4AIJA 1RUNA 2Z99A 3PCOA 3SZPA 2E64A 2XKPA 3U9GA 4I01A 1BBWA 2Q7HA 4NCXA 4C8QB 1FT9A 2IY5A 1CGPA 1IXRC 1GXQA 4R8HA 4XTVA 3MAJA 2VONA 3KCCA 4A0YA 5IT9Z 2DPUA 5FLXK 2DU7A 4XTZA 2WC2A 1EIYA 5LGUA 3VB2A 4WI1A 3TEHA 4EM1A 4I0BA 4MHGA 4M78C 5LJ3h 1KGSA 2H6CA 2BBYA 3HSEA 2JTVA 1USYC 2HTJA 3NQOA 3SHFA 4UHTA 1S8NA 1XCBA 2OD5A 4LK1F 2PMFA 3CLOA 5DUIA 5GMKj 4NL3A 4BYYA 1ZLKA 4ZTZB 1ZG1A 1WU7A 3GEZA 4LNSA 3F72A 4E70A 2CQKA 4AVPA 1YS6A 2UXNA 2O6GE 3UGQA 3RF1A 4XQ3A 3IALA 1UHWA 2Y0MA 2M5WA 2IRFG 5KK1A 4HV6A 3JCMc 4OU0A 1UB9A 4K2EA 2E65A 5GAMd 2DTIA 3PQKA 3TDZC 3E5QA 3HOSA 4L9TA 5F1RA 3IKMB 4M7DC 1BC7C 1S6LA 4F7UF 2AMCB 1B4AA 4M78E 2V1XA 4RQFA 2ZNYA 4RCBA 5GAOl 4N9IA 2V1UA 3J81K 2DW4A 2CJAA 1ZRDA 5CVIA 1WQ7A 4MMLA 5ILVA 3KP4A 4HYEA 5LEKA 1ZG3A 4ZH4F 2WV0A 1VTNC 4L0ZB 2XAJA 3F21A 4P75A 3E6MA 5C52B 4N0AC 2DPDA 4GGGA 4KMFA 2RKHA 4C8QA 3LAPA 1E2XA 1U5TA 4PNOA 1Z7UA 2KIUA 4IPAA 4YCVA 4PDKA 4MQVA 3JCMQ 3HRIA 3R0AA 5GAMj 2P7CB 3ELKA 1HW2A 3M4QA 5LBQA 2QHTA 3BDUA 4M7AE 1XCVA 4F7ZA 1IAWA 2ZT8A 1T2KA 5HGQA 1XGOA 3IKVA 2IA2A 2RD1A 1X56A 1W5TA 2HYGD 4ZIBA 4RS8A 5HDNA 1XSVA 3M8EA 3CJNA 4LLNA 4HF0A 4HWRA 1JJCA 3WODF 1LDKB 3M7GA 4PJOB 2OA4A 3E3VA 1TW2A 5AIQA 1LYLA 3QP6A 4ESJA 5DY9A 4C8QG 1QNTA 2Q7GA 4KDPA 3JCMg 2K27A 1JHFA 1J0RA 3RYRA 3H3ZA 1YGBA 3N97A 2XHKA 3JCMV 4ZZDA 3E6BA 4C8QD 2UWMA 5GAN7 1TLHB 5GAOn 2ZR3A 3TO9A 1F1ZA 4A54A 1NJ2A 3CO6C 2QYOA 4HT9A 1W7PB 1I1SA 1KYWA 1IUYA 4XTYA 3W3SA 2ZCWA 1Y96B 4J6WA 3GF2A 1BBUA 4H2XB 2NS0A 4OIQF 4JQFA 4Y15A 3CDHA 1I4K1 5LHIA 2DXTA 4PJOC 3WE3A 3BJ6A 4LK0F 4HX8A 3SWNC 1FYLA 3JSOA 2ZNIA 3QRFF 2W24A 1NYQA 2QQAA 2CYYA 2XIGA 4QWQA 1WKMA 1KU3A 4Y13A 4WWCA 5BQTA 3IKTA 2FE3A 4ENNA 1XMKA 1B34B 3VQVA 3BWGA 1JHHA 2FF4A 4UVBA 3WTZA 5BPIA 4LGWA 2IA1A 2CGHA 2G7UA 2VBZA 1U78A 2ZZGA 5GAN3 1B9NA 4KA4A 3G3ZA 4LD5A 2E10A 3MEXA 2Q7EA 4C92A 2O03A 2ZBKA 1ON2A 2DK8A 2PI0A 1E22A 4J15A 3PFIA 1RUOA 1H0MA 4IRIA 1ADYA 4UXNA 2V9VA 5E1WA 3WGIA 3SWNB 4YCUA 1I5ZA 5D6EA 3KEQA 4ZZLA 5BMZA 5DEQA 3RKYA 2QENA 2V1DA 2IPQX 3WTXC 3V7RA 1SERA 2J3MA 1ONVA 1OR7A 1K78B 3FF5A 4D0PA 2A68F 1IF1A 2NNYA 3F8NA 4M75F 3RESA 3E5UA 2E1NA 1P4WA 2G7HA 1MD0A 3R0JA 4BH9A 1YW9A 2HQNA 3E6DA 1DPUA 3PCOB 2V6CA 2Y75A 4IRHA 3SXYA 3ZP5A 1YIOA 2DK5A 3KP5A 1RI7A 1NNHA 4YRLA 1Z91A 4HWTA 4HOBA 3KFUA 3L9FA 3TKYA 4H2UA 2Q5IA 2QLZA 1K6OA 3E9HA 1C0WA 1ZARA 1YFSA 1YS7A 3DV8A 4M7DD 3GYHX 1FSHA 4CS3A 4P5OA 1R7JA 1WI9A 2WWYA 2DU5A 4OOIA 4V2SA 1EQRA 5CVJA 4LLLA 5L3CA 3JCMX 3VQWA 3BY6A 4CXFA 5K1YA 1FP2A 5D5VB 3KP6A 1Z9CA 3C18A 3IRRA 3FX3A 4OINF 3TEGA 3DF8A 2E1HA 3UGTA 1R23A 3KFWX 1MJAA 2QBYA 4U7BA 3EETA 1GVJA 3IKLA 2RM4A 3JB9F 4WJ3M 2ZCEA 3KETA 2DT5A 3MZYA 1W7PD 2EJFA 2K02A 4C92D 4J6XA 2ARTA 2STTA 2KRFA 1TH7A 3ML6A 4M77C 4M71A 5HS8A 5DUKA 5LHGA 2QQBA 1QGPA 2EFPA 4ZYEA 4EJTA 4KUMA 3M4PA 1FX7A 5K5QA 4XEOA 4C8QF 3UH0A 5LJ5j 3MZHA 4UP9A 4A12A 2P7VB 4TTVA 3KZYA 2FQ3A 5AONA 3I59A 3EFRA 4X9CA 1R1VA 4IXAA 3RKWA 2MH2A 3O6BB 3WTYC 2M87A 1I81A 3F8FA 2HS5A 2NAZA 1OKRA 3F3XA 3PGGA 4M78F 2XAFA 2ZMEA 5E3IA 1B59A 4A6DA 1IN8A 2RN7A 3A32A 1Z6TA 5CAIA 1M5Q1 3JTHA 2DZCA 1E1TA 4MQ9F 1X3UA 2HFHA 3GZ6A 4GCVA 5HLHA 4HW0A 3BW1A 4IHSA 4PCQA 1RZ4A 5BOXA 3HXYA 1O3RA 1N9RA 1DPRA 2FNAA 2A61A 3KEOA 2MH9A 4BXUA 3CMQA 2DQLA 4L18B 2ZT7A 2PMUA 4I2OA 2Q8KA 2P0LA 1G3YA 3HXWA 4WCGA 1UHMA 4KN7X 1SD7A 2QQ9A 2MLKA 4L0YB 4I98B 4QVDA 1IXSB 2Z5UA 4LMYA 1XD7A 3F8CA 1PP8F 4AD9A 3CUOA 2E7WA 3S2WA 3NEUA 3V4GA 3BPXA 2H6BA 3JCMb 3NENA 2DXUA 5LJ3j 1J7KA 1D3YA 3ULQB 4M7AC 1J2XA 4WXHA 5LEJA 5BS6A 3P7NA 4HBLA 2QM3A 4RAZA 4KICA 1HW1A 1HK9A 2LF8A 2MA3A 2ZT5A 4P75C 1QPMA 2BYVE 2ZR2A 1O3TA 1W5SA 2K4BA 4J6YA 4P9FA 1XDUA 5GAOm 2ARSA 3H92A 2CSOA 2XAHA 4EMKB 1YTYA 1LVAA 2ZMEB 3MQ0A 5BPDA 3SWNA 1E24A 4CYDA 4DPGA 1IN4A 4M7AA 1HXDA 5D5UB 4Q15A 4M78G 4ASNA 4BAYA 1CF7A 2B0LA 4EVIA 1JBMA 2I4NA 1ZAOA 2FB7A 3E5XA 2DKGA 4M7DA 4DQ2A 4RDXA 1FYMA 2RNJA 4B09A 1B34A 3TOAA 3CTAA 2CJBA 2ZIMA 5KVRA 5D4SA 3P9IA 3JCMh 2ZXFA 4P55A 3O2PE 4I7HA 2OQGA 1U5TB 3A31A 4ENJA 3QNEA 2IVMA 2PLYA 3SQNA 4C92B 2XAQA 5L3DA 2M8EA 1SFEA 5E17F 1V4RA 2OU2A 1FY7A 3HOTA 3R60A 2IT0A 4F7UE 2XAGA 5GAOq 4EGZA 4WJ4A 3IL2A 2DO7A 4XU2A 3OD1A 4M78A 1X55A 3FMSA 4XRFA 3WGGA 5K5RA 4Y91A 4HWOA 3FXRA 4ENKA 4FX4A 2I4OA 2EJ9A 3KLNA 5F64A 3VBBA 4KYWA 4HDUA 2CG4A 1IRFA 4FX0A 3HY1A 1H641 1A04A 2GIVA 4EQQA 3EYIA 2EAYA 5CVRA 4G7OF 2QWWA 1X01A 3LQRA 4MMKA 1G51A 2JZYA 2D2WA 4YFXF 5K1XA 1I1GA 5HLIA 1B1BA 1BN5A 4M78D 1E1OA 2FBHA 4L9JA 2I4LA 1HBXG 2HNIA 5JI6A 3HFOA 1ASYA 4JRKA 3UFGA 3JCMd 4P71C 2G4CA 2OQRA 5HVQC 3M4GA 3ZMDA 4IVNA 4CGZA 3I4PA 3IHUA 1OMIA 3GFLA 5IT9K 4NL2A 1H4VB 3HRMA 3RL6A 2C8MA 2ZZEA 1NJ6A 2IY5B 2QVOA 4UVCA 3JB9I 3T0YA 2E1CA 2A5YB 3JAMZ 4X5OA 1S7AA 4M75E 1YFTA 3REXA 1JE8A 3HUGA 1HQCA 4YG2F 1D8KA 3V8JA 2ETHA 4S04A 1PYSA
chains in the Genus database with same CATH superfamily
4EM2A 3HL2A 2LQNA 3QJYA 3IQLA 1NHAA 1QQIA 3F23A 1JJ2P 2HXIA 3E2UA 3FK6A 2XV4S 4I09A 1DUXC 3G1ZA 2R7VA 2A6EF 2ZFUA 1JQQA 5GANe 3PIOA 4AYBN 3FZVA 4BXXJ 2ZIOA 2IGNA 3QYHB 4PGHA 4OLFA 1KC8R 3CCUI 1S29A 1B7YA 1M1FA 2WV1A 2VYTA 4HAMA 1FPQA 2NVXJ 1K7AA 4UUSB 2FRYA 5CKBA 2V8IA 4RGUA 3OYAA 3G73A 1D1AA 5L3GA 2XSDC 1BC8C 1EFNA 2JUGA 4E7KA 3DXJF 1BI1A 5CQYA 5KYYB 5EEHA 5GADJ 4EMSA 2LX7A 1BR4A 2PJRA 4M78B 2DJIA 1X43A 2CWEA 9ATCB 3ERED 2M9UA 2MABA 3DFGA 3GFJA 3GZ5A 4S05A 1N25A 3QSUA 4D5CA 4BE0A 1P6RA 3LA2A 3EFOA 2A7YA 2K2VA 3OW2S 4XKVA 4IO9F 4YCWA 2JVVA 4OMYA 1LE8B 2A69F 4DYRA 1WHJA 1SPKA 4JLIA 4AG1C 4PKCC 4E4HA 4N4HA 1WGXA 4O5VA 4F91B 1MJ9A 4OB2B 2XMFA 4LLGF 2ADUA 5HDGA 2ZGWA 2MC3A 2AKLA 3HXLA 1RNLA 3VOEA 2EV5A 3KXTA 3JRCA 1USYA 3M4YA 2RNGA 1ODDA 4XLFA 4HNTA 3Q9VA 1WPKA 4XU0A 5KYUB 3RKQA 2L3QA 2EIFA 3GZNB 3L2CA 4X34A 1CKBA 1WJAA 5IY5H 1UG0A 4ZYGA 2FBIA 3IG2A 1TBXA 4TQDA 1P92A 1T95A 2OZ6A 3JSPA 2KAFA 3GFIA 5LJ5g 3CMAI 2KRNA 2J6KA 3R6NA 1OYXA 2E5AA 3F6VA 2LQKA 5DCMB 1YW8A 2QSFX 2PX9A 1B8IB 1XN7A 2ZB9A 1ZGAA 3SYTA 1LQ1A 2QHUA 2R7DA 3NETA 4BL0B 1R5HA 4Y17A 3P8YA 2K9LA 3BTLA 3QAHA 4D9JA 4BQAA 2X9DA 3KYDB 4LB5A 4OIOF 4BHCA 1RACB 3I5RA 2JUFA 1WFWA 2K79A 3G6ET 2FVUA 2DPPB 3RI4A 2AKKA 1TWCJ 1ASZA 5F27A 2ZMEC 2QGFB 3A01A 1YNZA 3NEMA 4AYBA 5CR2A 2BIVA 1YJNA 2QUFA 2VOOA 1FBQA 2RQRA 1ZGJA 4W97A 4U7DA 3CD6A 2CUEA 1SETA 5GAOp 5J3BA 1YJWT 3CCYA 3RGLA 3EG0A 4XTWA 3LSGA 2NXNB 3HGYA 2DYBA 3F8MA 1I8FA 3JRIA 2VC8A 1J9IA 1WJRA 5FWCA 1RRJA 4YYEA 3K4LA 1IN5A 2EFNA 2A37A 3JSCA 1A5JA 1BCOA 2XKOC 4DOWA 3M0TA 2O4XA 4YRCA 2W0ZA 3X24B 3HXUA 1SANA 1D3BB 2LJ0A 3H5RA 3OWTA 4MEXF 3OYBA 3OW2P 1Q82U 3O8HA 4RB2C 1WJEA 2XRLA 1VQ6T 2J3LA 1LJOA 2PFBA 4P5NA 2CUFA 3DLAA 2F5CA 5JVGF 3JAME 2HZTA 2ZNJA 3EG2A 1Y0UA 4MTDA 2BXYA 4XRMA 2F5TX 2QKLB 4AM3A 4BU2A 2DZ9A 1Q82C 3S6WA 4C8QC 1U3EM 4CS2A 1BYMA 1FZPB 1VQNQ 3DBHB 4P9UA 2XF6A 3FM5A 3LL7A 3Q5FA 2X4HA 5CK9A 4NHJA 2JSCA 5GPAA 3HSBA 4WXDA 1RKTA 1XGMA 1E3OC 4PJOD 1WHUA 4NC8A 2A05A 3F6OA 1N75A 4H02A 4J5YA 3DWLE 3CCJI 1Y96A 3TOBA 4BI4A 4DBFA 3IUOA 2EV6A 1BKBA 3TO7A 3ZQ7A 2HSEB 3I56T 4RM2A 4A3FJ 4L59A 3WXMB 2EA2A 3B6CA 4Q5SF 1VQ5T 5A0GA 3LQQA 3ZMVA 1MNEA 2FQ4A 5GAHJ 5JHFA 1BW5A 1KOGA 2FEIA 3JB9D 3DP7A 3SZGA 2E2IJ 3GTKJ 5GPCA 4Z8AA 2L54A 2O5RA 1MSEC 4XSZF 3TBIA 3ERRA 3J80K 4JJDA 2XB0X 3ME9A 4BBSJ 4WX9A 3UT1A 5GMKi 3TU4K 1H4QA 4IL6C 3TQ7P 3CCRT 2DOEA 4H2SA 2ZSHB 5GANf 2ALYA 2JZ2A 5J3LA 2P84A 1EIYB 4YRFA 1HA8A 1JJCB 4A3IJ 3K2AA 1Q1HA 2XVCA 3H5AA 3M0SA 1V76A 1WHLA 2DK3A 3EG9A 3HTSB 2K7LA 1ZR4A 1Z9QA 3V7CA 1YI2Q 3CUQA 4DZPA 3L2RA 1ZRFA 1TG0A 3BDDA 3OMGA 1BM9A 1G59A 3CC4T 3DCFA 5J1YA 5DTDA 4L5JA 3KZIC 2YS9A 3K70D 2DBMA 1YE9A 2RHZA 3DTEA 4WF2A 3CMEA 3RACA 2RJDA 3MPUB 1RIOH 2QQSA 4M7DG 4XU3A 1H3HA 3JRAA 2CV2A 3NRVA 3QODA 4PZJA 3NARA 2JA8J 3BPVA 3K1MA 4OB3B 3R61A 2ZFWA 4HVVA 4BHBA 1WQ2A 2BW3A 2D45A 2XASA 2QCOA 3IAS2 3OYDA 1VQ7T 1MGTA 3OW2A 5FU6C 4R56A 2O9VA 4H2WA 3QYBA 3OL4A 1SC7A 2VLAA 3DB4A 5KYXA 1KU7A 1UGSB 5GAN8 3CCSQ 5H6QA 3LSHA 4A6EA 2F1LA 2L9RA 5I2SA 4NQWB 4L87A 2HEQA 1MZBA 2KZVA 2FU4A 2P8TA 4QVCA 3VS3A 4F17A 1BI3A 2D0NA 2FMLA 1MUZA 1YJNT 1OCTC 2PMZN 1XPXA 2FD5A 3A02A 1BOAA 4J8OA 2NVTJ 5L8RE 2EL9A 3JB9J 1CF7B 4H2XA 4ELZC 4XKCA 2K4YA 3I59B 5HNHA 2DJNA 4G8XA 4OMQA 2BV6A 1VQ4Q 2HQRA 3CCSI 5J26A 1RR7A 1USTA 5GTIC 3M58A 3SD4A 3MD2A 2BHYA 1FYKA 1TU0B 2HBPA 3H9GA 2XUBA 3DKWA 3W6JB 2A36A 3HFVA 1SFUA 2VT3A 4N4OB 2EGCA 2KROA 2PZ1A 5LJ5h 2DD4A 3K4CA 5CYVA 3V8KA 4CZZA 5GJWB 4BWAA 2DODA 1OV3A 1Z7NA 5D5WB 2KQRA 5CO7A 2DTOA 2JS0A 4PJOF 5KNNA 2ZXIA 4BHPA 1TNSA 4IUQA 1R22A 1WJDA 1K79A 4P72C 5GAMg 4CS4A 2JA7J 1Q86R 4HZFA 4KH1B 2M16A 1FBUA 1KMMA 3PIPA 1PDNC 3GTMJ 4XRSG 2QI2A 4EMHA 4NC7A 4QPOA 1WRJA 2DDAA 4CUGA 1EH6A 1LPLA 1ZA2B 5FO5A 2XDVA 2VODA 4RLFA 3N4MA 1FSEA 4DYQA 3KLOA 2GBQA 4B43A 3BP8A 4MFEA 3ZQGA 2A5WA 1SFKA 1B6AA 4M9SA 4RB0A 4ZYHA 1RAAB 1TTHB 3EHRA 1N6AA 1KONA 4ESRA 5LJ5e 2QYZA 1ATIA 1G3TA 1U9NA 3R6SA 1MMDA 4RB3C 1NJIU 4BW9A 2VT2A 2RHXA 1YJNQ 2OTJA 3TO6A 3CO7C 1FJLA 4AWXB 1UHFA 1HTTA 4KR2A 2KMUA 1T98A 1OPLA 3WTSC 1XTDA 2EWNA 2O8XA 3BOQA 5B3SH 2F69A 1LEBA 2RPNA 4HX7A 3OIOA 5AIPA 5EZGA 2HKQB 2WSCE 4FSXA 4BY6B 2DD5A 1ARKA 1Z0XA 1XTAA 2W4SA 4U0WA 2JRMA 2E41A 3H41A 2GFUA 1SG5A 4TQFA 3W3CA 1W0UA 1NK3P 4OMMA 3S32A 4M75D 5I2MA 5I21A 3FXUA 4HPQA 3M0PA 3RMSA 1EOVA 4KT5C 5E8GA 2LJ1A 1YHQT 2RHSB 2EJGA 1UHCA 2CW0F 2LF7A 1GT0C 2VBYA 3KPHA 5EGOB 3UKGA 1ZG5A 2PQWA 3FXOA 4N0AA 2H1LA 3X28B 2E1MC 2FPFA 3GXOA 2DQ0A 2PTKA 3I4MJ 5HKCA 1EV7A 4CCLA 4BBRJ 2MI6A 3ER0A 3MF2A 1IN6A 4HLYA 3INZA 2MD5A 3WTUC 1M9SA 4IEJA 1PKSA 2X0LA 1FMVA 2SRCA 3EG9B 3HKZN 1IG7A 2VGMA 3Q1JA 3PFYA 4OGCA 1K0SA 2EYQA 1PYVA 5LJ5f 3A7AA 4Y52J 1MGQA 2RQQA 2Q5HA 4PLIA 3GTLJ 1IC8A 3RDIA 4BQOA 3WQZA 1ZUKA 1TT0A 4BY7J 3VS5A 4TVYA 4M75B 4F7UG 4G9YA 4J7IA 3EUAA 3QO5A 5AT1B 4HVCA 4QQ6A 4KN4X 1P4XA 3CMAT 3RIRA 3EUKL 4N9HA 1X3WB 1V5GA 1C0MA 4YRKA 1E17A 4Q47A 1WA7A 3JTGA 3TREA 2BW3B 2LTOA 4CYCB 2IXSA 1WPYA 4CC7A 2AIRB 2ED0A 5LJ3d 2HGCA 3PFSA 2E70A 3VS1A 3DLLA 2YXYA 4YRTA 1GL5A 1TUGB 4PJOA 2E2HJ 1VYVA 2YPRA 1UG1A 4Z89A 4M3BA 1BJAA 3ONQA 4BI8B 1MIJA 1SF9A 1S9HA 4XLNF 1UJ0A 3P8VA 1ACIA 1BCMA 3E19A 4JDSA 4KIFA 3C2GA 3HFNA 1SRYA 3MKDA 4HT8A 1BI2A 5CVUA 4QLCU 3X26B 2DA7A 1YCSB 1M1KU 4G6QA 2CUJA 2CYZB 1STZA 1KQ2A 5CVVA 3EGXB 4IUUA 4CA0A 4YRMA 2LKSA 1YBYA 1SSFA 1K73U 2RHQA 2DFHA 1ZQ1A 3GO5A 1OULA 1OCCH 3VSKA 1GUUA 2L4AA 3ZGKA 2DIGA 4LDYA 3NELA 3I56Q 3K4BA 1VQ5A 1K4SA 5TJJA 1U5SA 5GAN4 3RPUA 4M77E 4GY5A 3TEEA 1NG6A 2ZPHB 1QQJA 4AG2C 4LIVA 4LUDA 4C5EA 3GWZA 4PJ0C 4XU1A 1VQ4T 2P5IA 3HXXA 4P3NA 3Q9SA 2YU3A 1BOBA 1PRLC 3S2HJ 3WVDB 2CP6A 1WXUA 3ZN1A 3CCUT 2KJBA 2M7AA 3IH3A 1XG1A 2BY2A 5EZHA 1I6XA 2LG4A 2DT7B 1U8BA 2X9HA 4IURA 1BA5A 1PYSB 3OSVA 3A8MB 5DLQE 2ODRC 5M5XJ 3CCVI 3H9QA 2VBWA 2PU9B 4UVAA 4M9ZA 1R5GA 3FMQA 3PNWC 2VOPA 1NH3A 2MIOA 3BJAA 2HZDA 2OF7A 4YFKF 2KT1A 1XGSA 2BVLA 1OU8A 5CKEA 3VS4A 1XDSA 2DEQA 5ICEA 1ON1A 2VKNA 1B7YB 1MH3A 4Q6GA 4V2GA 3U1KA 2FZKB 3CCEA 4E47A 1CQTA 5J8FA 2ISZA 4OIRF 1K9MR 1G5IA 4U0YA 4OMZA 2NS6A 3CCRI 3L2ZA 2CQNA 5GAMh 1HSTA 3FKJA 4UV9A 3C1DA 5L3FA 2H3JA 2ELHA 4BKXA 3ASKA 5ILSA 2QBYB 4K87A 3HRTA 4FU6A 4JS5A 2BZYA 1FEXA 3M07A 4RTZA 1D3BA 2ZJRF 1LVKA 2D5VA 3C4SA 1T0HA 2JMCA 1Z3YA 1T33A 2HYFA 3W2VA 1SD5A 2A08A 1QWEA 2HCKA 5M3FJ 4NOYA 4A4EA 1REPC 4P3OA 3FC3A 4U87A 1W5CC 1L0OC 1LEAA 2VBXA 3I3LA 4U88A 4IOCF 2PJPA 1NYGA 4IQJA 1RLPC 2HQAA 1IV8A 1OYIA 1SMYF 1PVEA 2FXAA 2XGEA 4W1UA 5ICFA 4B3AA 4M7DE 4C92E 2RB6A 5E3MA 2OBPA 2XC7A 1TP4A 2GQQA 3DKMA 1FBSA 1EJ9A 3O5ZA 1Y57A 4II2A 1M1GA 2PG4A 1QCFA 4CSWA 4A2UA 2K6DA 3QZ9B 4M77F 1MH4A 1VQMQ 1PJRA 4B44A 2HOAA 2R7FA 2RV8A 5LHHA 5FB2A 4M73A 1R49A 3I4NJ 3BY7A 2CP0A 3OQ5A 2WBMA 3UF4A 2R93J 4IOAF 3EH2A 1VA7A 3OYCA 1U1TA 4YROA 5FLXZ 1SD6A 4X1EA 4G7ZF 1TC3C 3G4SI 3OA6A 3J7ZI 5DM7F 2RVCA 4UP8A 5GANh 4P74A 3GX4X 1OYWA 1X2NA 1HKQA 2CW7A 1VNDA 4M6VA 4PSXA 2VXFA 4KGZB 2X6XA 5FU7B 2OTLT 2QA4I 1LB2A 1K8AR 2E19A 11ASA 1USSA 2VC1A 2VXEA 2LJ3A 3DTKA 4L9VA 5DDGA 4BEHB 1HLVA 1PCXA 4KGXB 3A5ZA 4YRGA 4FT8A 1ADJA 1QRYA 2VPLA 2I2LA 4OVAA 2Z0WA 2ZO4A 3AL0B 2O61A 1V1CA 2EQUA 3D5SC 4RGXA 4KUIA 2FNPA 4JPBW 4LDVA 2OCCH 3NTIA 1MKMA 4CCMA 1TS9A 3M54A 3JCMJ 1KJWA 3P8TA 4A0XA 3H3VK 2CH0A 1PUEE 3CPWA 2NUTA 1EFWA 2WTEA 4LVJA 2E5ZA 1VQ7Q 4EJVA 2LBFA 1WJ5A 3EFSA 5GMKe 3CXCP 4G6DA 2BE7D 2BE5F 5DCFA 4A0ZA 4OMFB 3ZN0A 3CC2A 4UV8A 3RTRA 1I3QJ 2NVUB 2ZJPF 2DTHA 5FFXA 1M90C 1OCZH 2AXTC 5LJ3f 3DBLB 1K78A 2A6HF 1X6OA 2IAIA 4UUVA 1KHIA 3ZBDA 4A4KA 1YITT 4A3KJ 1KQSS 3CC7T 1YQAA 2W7NA 1M4ZA 2E12A 3GP8A 2ZZFA 2XAUA 3U23A 3HOZJ 4J01A 1SVLA 2VJJA 2QTXA 1F43A 1W36D 1PP7U 3FLGA 3OB9A 3M8FA 4EMGA 1D1CA 3MFKA 2LDUA 3D5LA 2JTMA 2LZ6B 3DLMA 3UATA 2DA5A 1ZX6A 3DEEA 5GMKh 1FWZA 3VYTB 2EBIA 2Z16A 3WU2C 2GAUA 4FASD 1OI1A 4Z02A 3A1YA 3QO8A 2X48A 1S1NA 4DNCA 2V79A 4AVZA 2AKWB 1LJ9A 1FMWA 1HYOA 3QPHA 2FSWA 5CLSA 2Q0OA 1OZ2A 4BDYA 2HDDA 2L0KA 5HCKA 5FJ8J 4FCYA 1Z21A 2PUKB 1X2HA 2DQ3A 4RB1A 2XROA 4LVMA 3WG9A 4P71A 1U1SA 5DD4A 4A3LJ 3NPFA 3A03A 3LWFA 3M53A 3T9NA 2ZT6A 4JRQA 5FLXE 5F04A 1V55H 2H94A 3JCMe 2K7AA 3QKJA 3BG7A 1YLFA 4A3MJ 3LSSA 4CH6A 4CHUA 2CDTA 4JRIA 4M72A 3PT9A 1UTIA 2MBFA 3HHHA 2OAZA 4A3CJ 2CFXA 2GXBA 1MW7A 1ZSGA 2HQXA 2FG0A 5HLGA 4TVWA 2EZHA 1JO8A 1M3AA 2YUSA 3D5RC 4R1HA 1N77A 2FHDA 1B70A 1RR8C 2F5VA 4EX5A 5KAFC 2AXLA 1KQ0A 5LLQA 4JJNK 2AO9A 3U1DA 2D8JA 3A7UA 5J8CA 1TWFJ 3QU6A 4C3JJ 2C7IA 4M7DB 5L23A 4HQMA 4XLPF 1K0XA 3EG1A 3RDVA 4I02A 1A6IA 3M0UA 3MKLA 3S3NA 2K2MA 5F5WA 2K9MA 4AIHA 1T39A 1X2MA 3OMCA 3P8HA 3FXJA 3RUXA 4DEXA 3CPWS 2VIXA 3C3WA 3I71A 1YIJA 2CJ9A 3E9GA 1RKWA 3WVEB 3BJUA 2KVQG 3T1BA 5D6WA 3MCZA 1C6VX 1L3LA 3CCRA 2OTLI 1G8XA 5EC7A 4A53A 4XL9A 3OYFA 5LJ3g 2KFDA 3CBMA 5E20A 2E1OA 3CCEI 1E0EA 2R3SA 4P96A 4BXFA 1B9MA 1JGGA 1Y56A 3TMOA 2L4MA 1H8AC 2LVSA 2JUCA 4RAYA 3VYUB 2GQIA 4Z2YA 4BS9A 4MDWA 4YRNA 1QA6A 2NYXA 1O7LA 3KZZA 4ZDLA 1Y07A 2K3XA 3MVPA 2LRDA 3PE0A 5GAMe 3A0BC 3W6KB 2M0MA 1YP5A 2DA1A 4XTXA 1TWGJ 1QVUA 3VYHB 3M3YJ 1X1BA 3C2HA 1QVGS 2XU8A 2W84A 4FM4B 1YRNB 1WI3A 2AS5F 2KBTA 2P0WA 2WAQA 4BEHA 4UUTA 4AIKA 4HX4A 1U3OA 4QKUA 4BI3A 3J81E 1ZGWA 2YR2A 2DMQA 3SFIA 2ROTA 2WAEA 3CCLA 1RETA 4RLQA 3TUPA 1VIFA 3DEUA 4XR6A 2X4XA 2RAEA 1I27A 5CKDA 2K85A 2LMDA 1Z05A 2XB5A 3ZXSA 3H0GJ 3DTIA 4C2MJ 2ESNA 3K7AJ 4D5FA 1W0TA 2Z9OA 2D9TA 5KYUA 3G6EA 4EMKA 4HDVA 1JTXA 3SFZA 2CQXA 5E3NA 1J59A 4I6ZA 1ZELA 1ZH5A 2JN6A 3EYYA 3IWZA 4YEJA 5ED4A 1K9AA 3REAB 4C92C 5GANg 1NG7A 1NJIC 3CD6T 5B5EC 1YJWA 3LC0A 3BCAA 3I53A 2B63J 3VQYA 4UP7A 2DBBA 4ZTFA 2FA5A 1X54A 5F1JA 3UA6A 4ZDPA 5H2FC 1NPPA 2GA1A 4IZZA 1H4TA 2F2EA 1QP2A 1ETXA 1SD4A 5DCMA 1B8IA 1EVKA 3D0SA 4EM0B 1LOJA 2Y0SA 3DKYA 3MMYB 2RI2A 1YFHA 5IN1A 2HDCA 4C0FA 5FROA 3ZEHA 2RF0A 1ZKGA 2EJRA 5GAMf 2PMHA 3TW6A 4YIFA 5F0HA 2MMPA 3G7ZA 4RCCA 4BUGA 5CQXA 3HXZA 4G85A 2L3RA 4M7AD 1ZN2A 2R7XA 1KIKA 3H8ZA 4Y92A 1T08B 1W7PA 4EV0A 5ICCA 2DJZA 1KYZA 2QHVA 1G6NA 1MJBA 8AT1B 1D0YA 1GBRA 5K5OA 2VE8A 2CP7A 1M1EB 3X25B 4YREA 3VFZA 3BROA 5JR3A 1HF0A 5C4JJ 3VEPA 3I35A 3F9KA 3HM5A 5IT3A 1WWXA 2AHQA 3ZR8X 2EZLA 2Z3YA 1WYXA 2DRKA 2QGGA 5IHIA 1QVGA 2MD0A 2L02A 2EFWA 2K4JA 2IA0A 1LFPA 3G71I 4P73A 3QO3A 3MN2A 2LKXA 2DU9A 4A93J 2DFFA 4M7DF 2HR3A 4A3DJ 2BOLA 1FLIA 2P6SA 4YIIA 1VQLI 4HCBA 1WQWA 3ZPLA 1VQKA 3PMIA 3ICAA 4ME7A 2RHSA 3PNVA 2K3PA 1YB3A 2M1BA 3CP2A 4M7AF 2AHJB 3HFZB 1EF4A 2DMPA 4LDWA 5L3EA 1JGSA 1AWCA 2IS6A 1NJ5A 1VUBA 2P6TA 4XN0A 4M75G 4F7UB 2AKWA 1AOYA 2R7WA 3G4SQ 4HV5A 3DPUA 5FFZA 1X6GA 4EJWA 2PEXA 5DYMA 2OAWA 4X9DA 4J9GA 2VQLA 5GAN2 4H2TA 5E1ZB 4KIBA 5DV5A 1YI2I 2E7XA 1ENHA 1ZLMA 2D1HA 2LSOA 1R36A 2VB6A 3IAM2 2XDPA 2LCSA 3CDIA 2GOMA 4ANJA 1QVFS 2P4WA 4G12A 1YG2A 1G5HA 1O3SA 2VQHA 3OOUA 4ETSA 4EJOA 1SAXA 3HXVA 2DMUA 4OWRB 1NLPC 1GVDA 3FK7A 1R1UA 1EVLA 2CGPA 2KRMA 3L2VA 4R0KA 2ALYB 3U21A 2XTIA 1HW5A 3SB2A 2O0YA 3CLQA 2FUG2 2RGVA 1G2HA 3HY0A 1TWBA 2YRCA 2IGOA 1R00A 2KPMA 2X6YA 3VODA 1UUEA 3IC7A 3HRKA 2CFOA 3ECOA 3CUQB 3KP7A 2W25A 3JR9A 3I58A 2VXZA 3RZDJ 2GCXA 2GQVA 1HC8A 3LH0A 3ABKH 1ZREA 2V9PA 3WTTC 4L9NA 2H27A 2QEXI 4GDFA 1OQKA 1PM3A 2HQHA 3CCJA 5JFRA 5KH6A 3QPLA 3CMAA 1NJ1A 3A74A 4CO8A 2F5FA 1QF6A 1OR7C 3FDRA 2YU9J 4P72A 3ERMA 1IHVA 3FISA 1Y7XA 1D8JA 3IP4B 3SEZA 2A28A 2Q2EA 3I54A 1QHHD 1YIJQ 4TWAA 3QPSA 2PBIA 4A3GJ 4AUXA 1JTYA 2E71A 4C3IJ 4CCJA 2CH4W 2MAMA 1JUMA 4WK8F 2WAFA 5E18F 2PJRB 2J5OA 5KCMA 3KIOA 4ESFA 2M4KA 4DGWB 2IS2A 1AD5A 1W1FA 3F70A 3G4ST 3CCUA 5TRDA 4YRSA 4NDLA 2ZKZA 2LKPA 2Y90A 1J75A 3JCMP 3AAFA 1UGQB 3HG9A 3P9CA 5IP7J 4LG0B 2QG9B 5F6FA 4BACA 2DVJA 3RERA 1WLEA 5L3BA 4MGRA 4YRLA 3ABTA 2EPDA 1MBHA 2H8RA 2A3SA 1T3SA 3FWEA 5LGTA 1VQZA 2LNBA 1T38A 3MO8A 1VQ8T 1TQPA 3QU3A 4L5IA 4DBRA 1I07A 2LCCA 3LA7A 1ZYRF 2KKOA 4NS5A 1Q7YU 2LMJA 1Y71A 2J06A 2DLLA 1YX5A 5B1BH 1LCKA 4LXCA 1GV2A 2MLGA 1WSUA 3J7AO 2L8DA 4RMNA 3HL8A 3CCQT 1VQPA 1J5YA 4U0VA 3MHXA 4RMFA 3CMMA 4M6YA 3GIBA 3PNYA 1YFRA 2DTRA 3DU5A 3HRSA 4Q48A 2XGXA 5HS7A 2KRHA 4M3EA 3HRUA 4ZTJA 2A07F 2NUPA 2YT6A 1YHQQ 2ODRD 5CKTA 3W2AA 3GBQA 3L1AA 4ZJZA 3WU0A 5GANd 1N78A 4NUBA 4CZCA 3QDRB 1W2BA 2ESHA 3CUQC 3EGDA 2K86A 2J6FA 4BNCA 2VPRA 2KYBA 5E3OA 5A2QK 3C0CA 1MNDA 2JVHA 1U06A 2FOWA 5C3EJ 3DBRB 3VDXA 1NJ8A 3I7FA 4A4HA 2Y31A 3A2KA 1JU5C 5ELOA 4XBFA 3LGLA 2ZNZA 3L09A 3A8HB 2YLCA 4FIBA 3HJEA 3ISPA 1Z77A 4IHVA 1ETYA 1T0FA 1TQMA 2L01A 2FOKA 1U6GA 3JW4A 3JAMK 2GA2A 3S2DJ 1AWJA 2KE9A 3ZL7C 4HVUA 1LNXA 2KXCA 3JRBA 4KQEA 1E7OA 1X6BA 1N9SA 2CV0A 2QDLA 4PLLA 5GJVB 2HKOA 1D09B 1FMKA 3HSFA 2V26A 2DFUA 2ZZDA 3GVAA 4B8XA 5KYYA 3GFMA 3JB9G 4XOPA 2OV7A 1XOVA 2LTPA 4PSWA 1T0FC 3GLXA 5J47A 3OMYA 3F22A 1DJ7B 2P4TA 3TSZA 4S0HB 2FBKA 2JT4A 3L1PA 2LY1A 3AHUA 2NOJB 3CCQQ 1UELB 3CPFA 2M45A 4GYGA 5DLOA 3A98A 2XGTA 5JVTA 1T6SA 3FXQA 5IHNA 1EKEA 5J4VA 4PJOG 1RIQA 1QZYA 3HTUA 1UAAA 1ERDA 3UWNA 2JPBA 2X35A 2ZPGB 3A5ZB 3MP6A 1BI0A 4LDXA 2NRAC 1N8RU 2P0KA 4C0DB 3BTCA 1K9MC 1IZ6A 2CW8A 2W1OA 2R7TA 4LNPA 3TEHB 1ZR2A 3OSGA 1IXCA 4P74C 4IUPA 2W85A 4PK4A 3ZMUA 4LVKA 1WI7A 1VQPI 5EEGA 2E60A 3L4GA 4M6XA 2QA4A 3R07A 1LKXA 1OCOH 3HKZA 3DEWA 3CCMT 2HXOA 1VQ7A 1Q81U 2DOAA 4IJAA 2R5AA 3G4SA 2C6YA 2JXBA 2UXXA 3BR1A 1DP7P 2UUZA 1X1DA 2OZUA 5FD6A 4IUTA 3CC7Q 1ABOA 3ABUA 1W4MA 1J09A 4DZJA 5EJCA 3META 1XGNA 1IREB 1V29B 4J9FA 3CXCS 2JJ9A 5CKHA 4Y4RA 3WGHA 3M57A 3J80E 2MYSA 4J9BA 5D8LB 5LGNA 2V1QA 3F8BA 1S7OA 2RK2A 4RUGA 4GYIA 2AK5A 2V1NA 4LD6A 1LNWA 1D0XA 3EQLF 3SEQA 1XJWB 3CP8A 2XK0A 2DQRA 4DA4A 4XEMA 4CH3A 2DA6A 1VQOQ 3BR5A 2X3WD 1IGNA 2F2VA 3I56I 2J5PA 2EQJA 3M55A 2HD0A 2EA4A 2CJJA 3FBIB 2ID6A 4IUVA 5IAYA 2JPCA 3LWIA 3CCVT 3J7YJ 3SFMA 3HIFA 2HZYA 1TQIA 5EDNA 1M90U 2YUNA 2YSRA 1ZHFA 3RJPA 3JCMf 1B76A 2RHIA 2CIMA 2E5NA 3T8TA 2L9VA 2DA9A 2MPXC 4E2FB 2LK2A 4PFOA 5HOOA 2W82A 3TSWA 4MZPA 1KFZA 5C53B 3KP2A 2A8EA 1Y6IA 1XMXA 1OPKA 2JJ7A 2KISA 2QSHX 4AFQC 3BJOA 2M34A 2HEOA 4MZTA 4B4CA 2LCLA 3TDUC 3LSMA 1OFCX 3A7RA 3A0HC 4HWSA 4IF4A 4BQQA 3LFKA 6PAXA 4J9DA 4Y7NJ 1VQ6I 1Z6RA 1OYYA 3GUDA 4V2FA 1HKTA 1GGMA 1V3FA 5LFAA 3S1MJ 5DD8A 4ZN3A 2PMFA 1LDDA 1U2WA 2Y69H 1A36A 3QP5A 4RAFA 2NUPB 2MK5A 4F52A 3H0IA 3CCET 2V1RA 2R5MA 3PVQA 1W66A 2HOEA 4RTVA 4UPAA 3LSTA 1KZHA 2E6NA 4KR3A 3CCLI 2L2PA 4M9XA 4P3PA 1QKXA 4IHTA 3CCVA 3JCMW 4JYKA 3VV0A 3M9AA 2KY9A 1HC7A 4JRPA 3J80Z 2H09A 3RNJA 4YIRX 1H4SA 1M2OA 1VOMA 4JK1X 1F1BB 4PJOE 5TISC 1ZQ3P 1R9TJ 1JJ8C 4YRJA 4E51A 4M77G 4JBAA 5J6XA 2ACJA 1MNMC 3VJPA 3CMEQ 2RN8A 1PWTA 3QPTA 1TTYA 4JP0A 4FTHA 3ABLH 3MCAB 3FB9A 1ETOA 2XPWA 3NGPA 4O6JA 5E79C 5IYDJ 2FYKA 4XOTA 2ECZA 3H0HA 2EB7A 3P9KA 3VSLA 3W2WA 3VU3C 1S72A 1VQNA 3CCEQ 2LNHB 4FYWB 5HDKA 5GANj 2EIJH 5FW9A 2DAOA 3RKXA 2KMTA 1APLC 1KMNA 4HA8A 2BEOA 3WTWC 1MV0B 4AH6A 4A63B 2J6OA 1WCMJ 2HWVA 1ZLJA 4J9EA 3JRFA 1MDMB 1NM7A 1QW1A 3HKSA 1VQ9Q 2KSSA 4KITB 1WGSA 4YDQA 3H35A 3KE2A 2H1KA 1O9SA 3MKWB 2K5FA 2DDBA 1GBQA 4ZNXA 2ECBA 1QE0A 1PUFA 2D1VA 3OS2A 1UFFA 4RAGA 4H2VA 1Q86U 1QO0D 1TUCA 4CI0C 5GAGJ 2R7OA 3AG4H 4BJ5C 5KHDA 2KDZA 4IHXA 2JMWA 5HLTA 3I9QA 12ASA 4H0EA 2VV5A 1Z7MA 4L6V5 3E97A 3K9TA 3JRGA 2LY2A 4L5EA 1QKWA 4B47A 3RQ4A 2DN0A 4GRIA 2P5LC 3VWBA 3C12A 1F9NA 3QQAA 3MKZA 2XG8D 2K57A 4G7HF 3L4GB 2AQEA 2YHTA 3RYPA 4EGYA 2DVEA 3HPWA 2OJED 4N0BA 1ZBJA 2G3RA 5FGMA 1GCQC 2VN2A 4B1RA 1XB4A 1IW7F 4Y3OA 2Z33A 4FT2A 1FXXA 1I50J 2R5YB 5FKLA 2L3DA 2W48A 3OOPA 3RPQA 2P5VA 3Q0UA 5F0CA 3B02A 1VQ7I 1AZGB 3BFMA 4PG3A 3PUFA 2LD5A 2E3HA 2DI3A 2NS7A 4M74A 2O7OA 3F0CA 3GNGA 3ZQQA 2PNIA 5IXBA 4FHTA 5EGOA 2WADA 1QVPA 1KQ9A 4GXOA 3TP0A 2P5KA 5E1XA 2FRHA 3DKXA 1B8AA 1Y1VJ 5HNFA 3AKZA 3J7AY 2COMA 2HQEA 2QEXT 2F6CA 3A8LB 3CCRQ 2BHZA 4A3BJ 2L0AA 3QO7A 4HLXA 1A35A 5FRMA 2PMEA 4A3EJ 1FC3A 1W4SA 4II1A 3M59A 3QG1A 1JXSA 5GAN5 3LSQA 4QW2A 3I55I 2EYZA 5A0LA 5D6XA 4PJMA 4HSTA 1GFCA 4DBQA 5E8IA 3NFCA 2BY3A 2GZWA 2EK5A 3K4KA 3WE2A 2NS8A 2NUTB 1K83J 4M77D 3H5NA 2HVQA 3LSIA 3E9FA 2YLBA 3ASNH 3E6CC 3EAEA 3H3UA 4M75A 4XTUA 5GAN6 1ORKA 2D8HA 5ELNA 2X1DA 2VE9A 2KJCA 2I5UA 2RK1A 3OS5A 4IHWA 3ROUA 1VQ4A 1IL2A 1C0AA 1SSHA 2VC0A 1F4KA 3LA3A 3S14J 3FJPA 4HCZA 1YYVA 3PM1A 4LJZF 3GOXA 2M3AA 3VUZA 1VQKQ 2PQ8A 3I55A 4EJUA 3V7SA 2JT1A 2K5IA 3HYIA 2HDWA 3IWFA 3Q3SA 4NB5A 2VUBA 4EO4A 3K1PA 2CP3A 3QTCA 5ILUA 3DPLC 3LMMA 3H9JA 5H6RA 2EIKH 2KIMA 2LVMA 4LFUA 2F5DA 2LH9A 2QGUA 4DYCA 3K0LA 3IRQA 2IS1A 1RADB 3HSRA 2STWA 1G3SA 3K4MA 4RBOA 2KEAA 4J19A 3WTVC 3HDDA 2A3LA 2JS2A 5KCOA 1KA8A 1D5VA 3CJQB 4FL6A 2EQKA 2RHQB 3PQJA 3QWLA 2VJIA 1R6RA 3QYEA 2RQPA 2ZXWH 1SHFA 2QHSA 1NK2P 4PHCA 1I5LA 2ZC2A 2M51A 2R7QA 3S1NJ 3LLRA 1POGA 1NG2A 1FP1D 4H4KC 1YCYA 2HDAA 2M0OA 1SESA 4RGRA 4XLCA 2ESWA 4C92F 1Q7YC 5CPRB 2HTSA 2ISYA 3LSRA 1Y1WJ 1BR1A 1BW6A 1IJWC 2AMCA 3E7LA 4P1WA 2BGCA 1VQMI 3WHBA 1GXPA 1VQMA 4YRRA 4TV7A 3FIFA 3M0RA 2YRDA 5IYBJ 5B1AH 1B7TA 2Y48A 2ECCA 3EGDB 2KIFA 3M8JA 1U8RA 1RPWA 2R7RA 3QOPA 3G71Q 3MWMA 4ENMA 1ZRCA 4B9WA 3KP3A 1R4MB 4BY6C 2ZTGA 3VS2A 2DYSH 4JOMA 2YSQA 4MZMA 3VS7A 3JB9H 1X2GA 4H2YA 3O3KA 1P4AA 1YW7A 3L7WA 2F2WA 1G3WA 4IQ4A 1O57A 2EFOA 3CCJQ 3A5YA 3G1LA 3HC7A 1SFXA 3GW2A 4E7HA 3LYIA 2QK0A 3C95A 1TT5B 3VS6A 1P2FA 2E5QA 3TCJA 3UR3C 2DFIA 1IHWA 1UECA 5IOZA 2O31A 4O3MA 4MTEA 1HKSA 1XSXA 5DS9A 1XNIA 3TVTA 1JKQC 1VQ8A 2FX0A 4KFCA 3M5AA 2Y0SN 1IN7A 1S72I 3I5UA 1I0CA 2K3YA 1K1ZA 1I39A 1RAGB 3FRNA 2ZPIB 1IRGA 2CUBA 5LJ5d 1RAFB 4BE1A 1DP3A 1TWHJ 1YX3A 3T8RA 2XPUA 3HHGA 4HF1A 3ECHA 3P8DA 4M77B 3VRYA 4C5HA 3G1JA 2ELKA 2CREA 4P73C 2EFQA 3PMTA 4M3GA 4NC6A 4MEYF 5D5XB 2X4WA 4HNVA 2R92J 4GO1A 3S8PA 3REUA 4CCKA 3Q0VA 2B86A 1AEYA 4I0AA 1MBEA 3S93A 3H0DA 2OTJI 3CBPA 3ZQIA 3H9NA 2ZSIB 2OTJT 4LUEA 2W57A 4R79A 1FOKA 2ID3A 2HBWA 2Q5IA 3RQIA 1Y0NA 1VQPQ 3T5XA 2FPEA 4AFUC 2ZJ2A 4Y28E 2LDMA 1Q81C 3M1EA 2FJ1A 2EQRA 3SDGA 3S3MA 2VUMJ 2DAQA 2DXBA 3S16J 2Y4YA 3HOYJ 5C51B 1U0JA 3CCMA 2QQ8A 1XX5A 2CUDA 2XIDA 3CMET 3CC7I 1RC9A 3K1NA 3PSFA 3FM3A 4NQWA 1NLOC 3TGNA 1YITI 3DLLF 1QP3A 1UGVA 2DYIA 2YWWA 4MNUA 3C94A 5GMKm 2CSQA 2KNBB 1WJFA 5EYRA 2Y9YA 3KX2A 2O8KA 2RJCA 4O2DA 3HPHA 3JCUC 2XI9A 2I0NA 1D5YA 5FKNA 3G1MA 2GXGA 3GNFB 2NOGA 4DOZA 1CKAA 2FEZA 3REOA 3QUIA 4ZGEB 3CMAQ 3K69A 3U2RA 5ICGA 2Y4XA 3MF1A 3VQXA 3CC4Q 2ARUA 1HD3A 4KULA 2XD0A 1GHCA 3M4OJ 1M27C 2IP2A 4C3HJ 4KRTA 3I56A 1JKRC 5TGTA 1Z1DA 1HSQA 1KG1A 4EMKC 3MQZA 2E3CA 4K86A 2C0OA 2CH4A 4BY1J 4PJJA 2XKOA 3REBB 4RDUA 1WZ2A 4A5NA 2COYA 1HCRA 2DBKA 5D4RA 1QBJA 1E3PA 4N4IA 1HDDC 1WYDA 1TOVA 1F36A 5LJ3e 2DDZA 1P7JA 4HEA2 2QXFA 4F14A 2E1MB 2PMZA 4XSXF 2JN0A 4N4GA 5FD5A 3QHSA 4BD3A 1KHCA 2RDPA 3WU1B 5H20A 3HTZA 2V4JC 1XC5A 4HCKA 1VQ9T 4IRGA 2M7BA 2HNHA 2JQ7A 2JW4A 4AMCA 4QTRA 1WIEA 1WH5A 1KD1R 3E1SA 4HF2A 4ESBA 5GAOr 1XSDA 2MOXA 4H2UA 4RTTA 3EUHA 2LRQA 1IV6A 1G4DA 2E4HA 3I64A 3QWYA 4D6WA 2ZXHA 4TVAB 3CF2A 3OYKA 2PN6A 2OTLQ 1WNLA 2NYSA 2DERA 3J7AF 4LD9K 2NLUA 1FYFA 1EH8A 3HFZA 3I0TA 2F5EA 4RTWA 1M8VA 3NWSA 2I4MA 1OPCA 2LX9A 2R7UA 2KK4A 2EV0A 4IX7A 3BR2A 3S1QJ 4CDGA 4M7AB 2RA2A 1NEBA 4F7UA 1KU9A 1YJWQ 3NAUA 2Y30A 1R58A 2LP0A 1ULYA 3K6GA 2C0IA 4RGSA 2GFAA 1HDPA 2YUQA 2XDBA 2VASA 4QPQA 1H9TA 3SZTA 4J9CA 2LREA 2TCTA 2XICA 4YRVA 2XRNA 2BKDN 4G84A 1TWAJ 1QZZA 5C4XJ 1KQ1A 1GV5A 3OIPA 4AU7A 1ITYA 2JTFA 4OIPF 1UJYA 2QASA 3CC7A 2OI3A 3ZCOA 3OYYA 4FE4A 5LRSA 2G9WA 3G71T 1BIAA 3CCLQ 4ZC3A 1QZEA 1DQUA 1TW3A 4X0GA 3OBWA 4OP0A 1Y8RB 1X58A 3LAJA 4HQEA 4K88A 1K8AC 3HOUJ 1UG2A 1MDMA 1BJZA 3OYMA 3IH4A 1Y8QB 5I22A 1EA3A 3S17J 4G94A 4M75C 1BL0A 4BJ6C 3CC4I 1EH7A 1W36C 2DL7A 4M4ZA 2E34A 3B73A 3E9IA 2RC4A 4F92B 2Y9ZA 4CH4A 1SVOA 3L00A 4C30A 2Z2SB 4CH5A 2RJFA 1FNNA 2LY9A 1I1JA 2EYYA 1V5FA 2L9NA 4MLOA 1AWXA 1OCPA 1X1AA 2OCEA 2QEXQ 2DETA 3COAC 1GDTA 3BG5A 2QZ8A 1O75A 1JKOC 1YITQ 5IXFA 4LB6B 1IXDA 2OC6A 1X69A 2M2EA 1WVRA 2ZXJA 2UZKA 2TDXA 4M3DA 4ZYAA 1KSWA 3K2ZA 5KE2A 1H9GA 3DPTA 2GWRA 2JRTA 1S3JA 3ZMTA 3CQZJ 1MMSA 3UNGC 2IW5A 1F5TA 4YRPA 2VQGA 2GF7A 1TNTA 1UCRA 1UFMA 4CICA 4GLKA 1A0NB 3BZ6A 4HWPA 4WXCA 3M1CA 3OYJA 3CCUQ 3BT9A 1AU7A 2FL7A 2CU7A 3MKYB 1IZ1A 1R1TA 2CQ7A 4XKWA 3JRZA 4C0GA 1P9QC 1O3QA 5GMKl 1NYRA 2FMYA 3EDPA 2R7ZJ 1GCQA 1WXBA 1JT0A 2E3IA 2KI7A 4A5MA 5D8KB 3SHWA 2EQMA 4LG0A 2GGRA 3MEYA 1KD1U 3TQNA 2JM9A 2B8AA 2IJLA 1MHNA 1V5EA 2F2XA 2L7ZA 2OUMA 2RQWA 2DE0X 2SEMA 5CJ9A 5LRRA 4YRIA 1U5TC 4ZYDA 2QKMB 2YX7A 2CO5A 2KDOA 2RI5A 5ERIA 2CV1A 5K1PA 1DDNA 1J5WA 1L0WA 4KMUX 4XLHA 1KQ8A 4M7AG 1BBYA 5HS9A 1B3QA 2N8GA 1RUWA 2PVOB 5JHUA 4YRQA 2GIZA 5FKOA 3DQVC 3FMRA 3ZMSA 4YFNF 2M30A 3C7JA 3QWXX 2EH3A 4RQEA 1SMTA 4ON0A 1KK7A 3MJXA 5D6FA 4C92G 1B70B 2EILH 4YP0A 2VGNA 5KYNA 4UNOA 3FHZA 2IIMA 4JUVA 3MZ8A 4HG2A 1XMAA 2DA3A 3MEVA 4Q5WA 2MF2A 3X20B 1JRIA 1YJWI 2O3FA 5A2QZ 3V8LA 5I11A 3PZCA 4Q4ZF 1HSJA 3ZMZA 3OV8A 4AC0A 4IIOA 1YO5C 4PGGA 2YX4A 1O7FA 1LDJA 2CUZA 2LOOA 2NNNA 3IV5A 3CC4A 3DSQA 2B7EA 4BUPA 1S7EA 3PO3J 3PUBA 4KIGA 5JLXA 2HKXA 1DGRM 4KNYA 3R4KA 3D7SB 1JUSA 1PNJA 3J81Z 1KU2A 1BIBA 1ZUYA 4AIJA 2HKNA 2NUZA 3M9QA 3G6EQ 1NBEB 2HVSA 1VQ4I 4UC4A 2Z99A 5FLMJ 1RUNA 3SZPA 3PCOA 2E64A 2XKPA 2WSEE 2M4GA 4I01A 3U9GA 3NMZC 1BBWA 2Q7HA 4NCXA 4C8QB 1FT9A 2FPDA 2IY5A 3BQYA 1ZK8A 3AG1H 3AFHA 5CCAA 2HQ5A 1CGPA 1IXRC 1GXQA 4R8HA 2R5YA 3MAJA 2JM8A 4XTVA 3UPUA 2VONA 1Q1VA 2NWMA 3KCCA 2Q1ZB 4A0YA 5KE3A 2VVKA 5IT9Z 4LVIA 2HPIA 2K9SA 3TW7A 2NVQJ 3EG3A 4HCCA 2DPUA 3FKIJ 5KAIC 5FLXK 2DU7A 4XTZA 2WC2A 3HOXJ 5GTHC 1EIYA 5LGUA 4EIKA 3BLYA 4RTYA 3VB2A 4BGDA 1VFCA 4IIMA 4WI1A 1IDYA 5J1UA 4X6AJ 4X1VA 3TEHA 6AT1B 3OR2C 4EM1A 2KDSA 2KR3A 3HOWJ 4I0BA 1WX6A 2YDLA 4MHGA 1M1KC 1GXIE 1VQLQ 4M78C 5LJ3h 4FYYB 2A0FB 5KNLA 1KGSA 1FYNA 2DLPA 1HJDA 2M1HA 4D8KA 2H6CA 1MBFA 2BBYA 3HSEA 2EW3A 2QTVA 2JTVA 1TUDA 4TVRA 1USYC 2HTJA 2KRSA 3NQOA 2IS4A 1U9OA 3K10A 3SHFA 1DU0A 4UHTA 1S8NA 1MBGA 1XCBA 2OD5A 4LK1F 4CH7A 4JX5A 3CF5F 4V19K 1XS9A 1ZSZA 3CLOA 5DUIA 3EHQA 8ATCB 5GMKj 4NL3A 4BYYA 1ZLKA 1D1BA 3L2UA 1PKTA 3CMYA 4HT4A 4ZTZB 1M90R 3LH5A 2EIMH 1ZG1A 1WU7A 4ZDOA 2KGTA 3MEWA 3GEZA 4LNSA 3F72A 2C0TA 4E70A 4II3A 2CQKA 4AVPA 1YS6A 2UXNA 2EBPA 3KYCB 1SEMA 4UB8C 1RI0A 4LE9A 1P7IA 2O6GE 2AQFA 1JKPC 4OB0B 2O88A 1VQ6Q 2ENMA 4XQ3A 3IALA 3RF1A 3UGQA 1UHWA 2Y0MA 2M5WA 3WG7H 5IT9E 1JJ2A 3EGUA 2IRFG 5KK1A 2JA6J 2AZSA 1AOJA 3LOCA 2CZ1B 4HV6A 2XGDA 3JCMc 2QA4T 4OU0A 4XN3A 3JRDA 1UB9A 4K2EA 1UZCA 2E65A 1K76A 5GAMd 2H3EB 1YITA 2DTIA 3PQKA 3TDZC 4AIDA 2JOYA 3A4CA 3E5QA 2QDYB 4E7SA 1VQLT 4JLGA 3HOSA 4L9TA 5F1RA 3BG9A 4M7DC 3ZOBA 3IKMB 4C2UA 1BC7C 1JT6A 1S6LA 1QCNA 2GXAA 1Z9ZA 3CQTA 1S72T 4PJLA 4XMYA 1I6HJ 2PVGB 4F7UF 4CC4B 4KT6A 2AMCB 1UGPB 1B4AA 4F16A 4M78E 1QPIA 2V1XA 1VYTA 2RQUA 5CQEA 3CCVQ 5E3LA 2VI6A 4RQFA 2K5CA 1VZ0A 2ZNYA 4RCBA 5B66C 3VUBA 1T8IA 5GAOl 4N9IA 2V1UA 1E6HA 1IRZA 2WA0A 3J81K 4EPCA 2LR8A 2DW4A 3SDBA 2M02A 2V8JA 5HK3A 2CJAA 1NYFA 1ZRDA 2P4RA 5CVIA 4AFZC 1MBJA 1WQ7A 4MMLA 1G5VA 2I8DA 5ILVA 5KYWB 3KP4A 4JX6A 4HYEA 5LEKA 1UDLA 1ZG3A 4ZH4F 4F55A 2AZVA 2WV0A 4F93B 2IG0A 1VTNC 1AKHB 4L0ZB 2CT4A 7AT1B 1S72Q 2XAJA 3FXLA 4PUSA 1MSFC 1OQYA 2GTJA 3F21A 2YUPA 2WB1A 4P75A 3E6MA 5C52B 2KL4A 4N0AC 2QA4Q 2DPDA 4GGGA 1QLYA 1R71A 4KMFA 2RKHA 4C8QA 2IEKA 3LAPA 1YJ9Q 1VQ9A 2DEUA 1E2XA 1U5TA 4PNOA 1Z7UA 4BB7A 2MGQA 2KIUA 4IPAA 4YCVA 2DTZA 4PDKA 4KJZA 4JJCA 1VQPT 2ZPEB 1OX8A 1R5ID 4MQVA 3JCMQ 3HRIA 4ATOA 1SVMA 2VJ5A 2DXIA 4M77A 1EIFA 4QT7A 2IBDA 3R0AA 5GAMj 1O4XA 2P7CB 2CZ6B 2LT1A 2RNAA 2RO0A 4QVDA 1YJNI 3A1PA 2FRWA 3ELKA 4JS4A 3FEOA 2DMTA 4PFPA 1X1PA 2Y2ZA 1HW2A 1OEBA 3OS0A 3M4QA 5LBQA 2QHTA 3BDUA 3GTPJ 2BXZA 4FE7A 4M3FA 4Z88A 4M7AE 1XCVA 3JV3A 2ZINA 4F7ZA 1IAWA 1YN8A 2RMOA 3CEYA 2ZT8A 1T2KA 3AG2H 3BCBA 5HGQA 1XGOA 2DFEA 2BVMA 3IKVA 2IA2A 2RD1A 1VQ9I 4D1QA 2EQIA 1VQNT 1J3TA 1X56A 1W5TA 4QQDA 2HYGD 5C6SA 3HP9A 4ZIBA 2HU9A 1RESA 4RS8A 5HDNA 1S5LC 1XSVA 3M8EA 4XORA 2DL8A 3CJNA 3L2WA 2CT3A 4LLNA 1MMNA 4HF0A 1FOXA 1UB4A 4HWRA 1JJCA 4LVLA 3WODF 1LDKB 2ZAEA 3M7GA 4XQFA 2OA4A 5C0MA 3I55T 4PJOB 3E3VA 1TW2A 2W10A 5FU6B 5AIQA 1LYLA 3QP6A 1N8RR 2JA5J 3A01B 4ESJA 5DY9A 3RR6A 4C8QG 2MC4A 1QNTA 3CXCA 2Q7GA 3EH1A 1PD1A 3W6VA 4KDPA 3JCMg 2LQ8A 2K27A 1JHFA 3OIQA 2DO3A 2DL5A 1J0RA 3RYRA 4RTUA 1MMAA 2VKEA 4A4FA 4C0DC 2WAQN 3H3ZA 1Q81R 1BB9A 1YGBA 3N97A 2KRCA 2XHKA 2LFBA 2O4XB 1LFBA 4EEFG 3E6BA 4ZZDA 1YJ9I 2UWMA 1TLHB 2OJ2A 3JCMV 2O2OA 4C8QD 5GAN7 5GAOn 2ZR3A 3TO9A 1F1ZA 5GAEJ 4A54A 4EATA 1VQ5I 3HOVJ 2R7SA 1NJ2A 1YI2T 5FLVA 3CO6C 2BUDA 3GLLA 2L89A 3PVLA 2E36A 2EGAA 2QYOA 1JB0E 4HT9A 4BJTA 1WHKA 1M3BA 2ROLA 1KQSP 1W7PB 4LITA 1I1SA 4R55A 3V42A 1QWFA 1KYWA 2H8WA 3QYFA 3LWHA 1YIJI 2BZ8A 1IUYA 4KT0E 2EKOA 3N5BB 2QF7A 4XTYA 3W3SA 4FYXB 4JZ4A 4OMPA 1RI9A 2ZCWA 4OGEA 1Y96B 4J6WA 2KQWA 3GF2A 2JMAA 3HEFA 1BBUA 4H2XB 1AWOA 3CCLT 2NS0A 4OIQF 4XK4A 1EZZB 3CPWP 1N27A 4JQFA 1UE9A 4Y15A 2R58A 1ZBXA 1JXMA 1VIEA 4RG2A 3CDHA 1I4K1 3JRHA 5LHIA 4HVWA 4CC2A 3NWTA 2DXTA 2GTOA 1VQKT 4PJOC 5M5YJ 3WE3A 3LNQA 5D6YA 1WDXA 3CCSA 1VQOA 2DJQA 2V7FA 2K9QA 3BJ6A 3HUGB 2KP6A 4LK0F 2K3FA 4HX8A 1X2KA 1FYLA 3SWNC 2X1EA 4FYVB 5EEAA 1R0CB 4WCIA 1IDZA 5AYFA 3JSOA 3VKIA 2LQWA 4FW2A 2ZNIA 2A6TA 3QRFF 2W24A 4YPFA 3E0JB 2GLOA 2BZTA 3CCQA 1NYQA 3BC8A 2J05A 2ME0A 2QQAA 2CYYA 2XIGA 4QWQA 1WKMA 1KU3A 4Y13A 4WWCA 5BQTA 2K9NA 2FE3A 3IKTA 1XMKA 3G1OA 3RPUD 4ENNA 1Y39A 4E7LA 3OYNA 1B34B 4E6RA 4MDXA 3S15J 3VQVA 3BWGA 1JHHA 3MP1A 2FF4A 5HODA 4UVBA 3WTZA 1MV3A 2DXCA 4TVAA 5BPIA 4LGWA 2IA1A 2CGHA 2G7UA 2VBZA 1VQNI 1KC8U 2IGMA 1U78A 2ZZGA 4RM3A 2MW8A 3VYSB 3KFVA 5GAN3 3CMEI 3CD6Q 1B9NA 2E35A 1N5ZA 2DM1A 3FJ5A 4KA4A 5KYXB 3G3ZA 4XNFA 4FSSA 3HBLA 4LD5A 2HPMA 2E10A 3MEAA 3MEXA 3P5JA 4E7ZA 4CCNA 1Y0MA 2DF6A 4C92A 2Q7EA 2MG4A 3MEUA 2O03A 4F04B 4AFSC 3VPRA 3SEMA 2ZBKA 1WFXA 1RLQC 3FIWA 1ON2A 4GLMA 2F4OB 3IH2A 2DK8A 2HL5C 5FRNA 2PI0A 4OB1B 4IHYA 1E22A 2XSJC 1QVGP 4J15A 3PFIA 1RUOA 2UV1A 2KHMA 5CIUA 1H0MA 3X2QH 4IRIA 3OBYA 2OTJQ 2CS3A 2V9VA 4UXNA 1ADYA 4NBQA 2EVRA 5E1WA 5C44J 3WGIA 1VQ6A 3SWNB 4YCUA 1I5ZA 5D6EA 4LN2A 2MCNA 1M1KR 2X6OA 2DA4A 2XPVA 5F0FA 3KEQA 2VKHA 4ZZLA 5BMZA 2V6EA 3AL0C 1FTZA 2KYMA 5DEQA 5IP6A 4XICA 1JUPA 3ZQCA 3RKYA 3UDCA 4CRIA 2X6WA 2QENA 2V1DA 3PSIA 3TL4X 2IPQX 4KH0B 3Q0WA 3WTXC 1K73R 4MO7A 2KLOA 2DILA 3V7RA 1SERA 2J3MA 1ONVA 1OR7A 3DB3A 1N9WA 1K78B 2CKKA 1NE8A 3GTOJ 4RA2A 1OOTA 3FF5A 4D0PA 4CYCA 1SAUA 1QVFP 2A68F 4XIDA 2NNYA 1IF1A 4C2TA 2RQTA 2WSFE 1IUFA 3F8NA 4M75F 1X2QA 2DA2A 3RESA 3E5UA 2E1NA 1ZSZC 4B3XA 4FT4A 2ABLA 1GRIA 1P4WA 2G7HA 4HSRA 1AA7A 1MD0A 2HYJA 3ABMH 3R0JA 2K40A 2YUOA 5FU7C 3VRZA 3FHNA 4XRSA 4BH9A 5FKMA 1YW9A 2HQNA 2X85A 2VL8A 3E6DA 2ED1A 5M3MJ 3OSFA 3OYIA 1PC0A 1DPUA 2CP2A 2QAZA 1VQMT 3PCOB 5HK0A 2V6CA 2Y75A 4ZGDB 4IRHA 3SXYA 3BR0A 1FTTA 3OL3A 3A8GB 4GFBA 3ZP5A 1QMCA 1YIOA 1OU9A 2L3SA 1MBKA 4LOCA 2F4IA 2CZ7B 1VQ8Q 2DK5A 3KP5A 1RI7A 2DL4A 1NNHA 3PIOF 1Z91A 1PUFB 4DEYA 4HWTA 3QXEB 3ASOH 4JZ3A 2RHYA 4L5GA 5F08A 4HOBA 3ZQHA 4FW1A 2R4GA 3KFUA 5FKKA 2L7KA 3L9FA 2VJ4A 3TKYA 2HMAA 5J1RA 2ZPFB 3QZ5B 2QLZA 1K6OA 4J00A 1Q82R 1GCPA 2D0QB 3LSPA 3E9HA 4E7IA 4XLEA 1PRMC 1C0WA 1ZARA 2LLKA 2BZXA 2JTEA 1YFSA 3DV8A 1YS7A 4M7DD 3GYHX 3ZFJA 1QHGA 1FSHA 4CS3A 1QVTA 4P5OA 1R7JA 1WI9A 2WWYA 2Z1DA 5BNGA 2RREA 4UY8I 4OOIA 1G2BA 3GBGA 1ABQA 4FETA 2AT1B 4V2SA 2DU5A 2R5ZA 2MSYA 4QSHA 1EQRA 5CVJA 4LLLA 5L3CA 3QDFA 3JCMX 3OR1C 3VQWA 3BY6A 3QYGB 4CXFA 5K1YA 1UGRB 1FP2A 2X4YA 1NEGA 3BTIA 5J40A 2OPTA 5D5VB 1ACMB 1LFUP 3VYGA 3KP6A 1Z9CA 1WZOA 3QJ6A 3G6EI 2EINH 3C18A 2DMOA 1JEGA 1R4NB 2NVYJ 3FX3A 3C2BA 3IRRA 4OINF 3TEGA 1M2VA 2VXDA 3AG3H 3DF8A 1ZSZB 2E1HA 3I55Q 1H88C 4J9IA 3LX7A 5IPAA 1R23A 3KFWX