3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
4IHTA 3U2RA 4KDPA 5D5VB 4CO8A 3TEGA 1WQ2A 2EV5A 1LOJA 2PN6A 4C92F 4YIFA 2F5CA 3L09A 5LBQA 5BMZA 2YHTA 4DPGA 3F23A 2Z5UA 2X0LA 3IWZA 1O3QA 4AWXB 3CO7C 4M75C 5GAMe 3V4GA 5FD6A 2Y90A 4A5MA 1WKMA 3E6BA 1USYC 1S6LA 1NJ2A 4ASNA 3R60A 3L7WA 2ZMEB 3GFLA 4F7UB 2L54A 3CJNA 2AS5F 4HX7A 3RKWA 2E3CA 1J5YA 2NS0A 2ZFWA 4S05A 5FFXA 1MJBA 4OMYA 4KMUX 4XLPF 5GAN2 4LLLA 3HXUA 4H2WA 3OOPA 3JCMh 3M7GA 1I5ZA 1FYMA 2CW0F 4C92G 4HV6A 4P3PA 1XCVA 5FD5A 3ZN1A 1T0FA 2EFPA 2XKOA 3MCZA 1UFMA 5KNNA 4L9JA 3ERRA 4N9IA 2P5LC 2O8XA 1ZLJA 3H3UA 4UXNA 1J9IA 1NJ5A 4TWAA 1ULYA 1MDMA 1XN7A 5LJ5e 4H0EA 4LLNA 4X9CA 4IVNA 4EMKB 5JHUA 2CSOA 2L02A 4TTVA 5TRDA 1E22A 3KFWX 2WV0A 1U78A 4ON0A 4RQFA 1S29A 4A6EA 2J5PA 5FFZA 2M30A 2RN7A 3RTRA 3A7AA 4M7AB 4XTXA 4OLFA 3F21A 4WK8F 2GQQA 2EV6A 4I0AA 3KETA 4EMGA 3QO8A 5D5XB 4CGZA 5TJJA 3LA7A 1I6XA 3JCMf 5ICCA 2VE8A 5D4SA 2IY5B 4G6QA 4CICA 3HOSA 2HNIA 5GMKe 3QUIA 4H2VA 4P73C 1U5TC 2UXNA 3CUQC 4HX4A 1YB3A 3DXJF 4M78G 2QHSA 2V1UA 1BBWA 5J8CA 1Z1DA 1FYKA 1JGSA 2O6GE 2A6EF 5L3FA 2IW5A 2QTXA 3VOEA 3T8TA 4L87A 2XTIA 5GMKm 4Q15A 2PEXA 3IKVA 2ZT8A 2E41A 3NEMA 3TOBA 4PJOE 2CFXA 2LSOA 1JHFA 4YCVA 4EJTA 3ZQ7A 2MD5A 3QU6A 4Q47A 1Z6TA 1I4K1 3QNEA 5LGTA 2RHSA 4WI1A 2BV6A 2VODA 4NOYA 1C0WA 4YRMA 2E5AA 3F22A 1IZ1A 11ASA 4KR3A 2DU7A 2RHQB 5GAOr 1QO0D 2ELHA 4PHCA 4OU0A 2VXFA 4NL2A 4B8XA 3K69A 3AAFA 4CXFA 2QM3A 2RD1A 3JCMd 3KLNA 3ECOA 1X01A 4BHPA 3DQVC 3HXWA 5FO5A 4GXOA 1P92A 4MTEA 5L3BA 1R22A 1EH8A 4M77F 4O6JA 4M7DF 2DK8A 3KP6A 4HX8A 5HLIA 1KU3A 1U1SA 4CS4A 3Q9SA 2ACJA 1LEBA 2G9WA 4IHSA 1FSHA 2O0YA 3E5QA 4A0ZA 3WTTC 3HXVA 1XMKA 4XLNF 1STZA 2RKHA 3ISPA 3L1AA 2FF4A 1LEAA 1DDNA 3UGTA 1SMTA 3FX3A 4P75A 4CH3A 3R07A 4M77E 2FE3A 4WXHA 1TTYA 5LHGA 1BI1A 4CS2A 2XGTA 1IF1A 3ML6A 4YRPA 3DKWA 1MGTA 3K1NA 4C92A 2CJ9A 2RA2A 1IAWA 1QPMA 3WU0A 2ZCWA 3TGNA 4WJ3M 2LKPA 4ZTUB 4M7DG 5LEJA 2AMCB 3WTVC 1TH7A 3HTSB 4LFUA 4MMKA 3LQRA 4E51A 2C7IA 3FXQA 4IXAA 3EETA 4J6YA 3HRKA 2QQAA 1WWXA 2JZYA 2RNJA 4J6XA 2Q5HA 4RDXA 2G7UA 3PZCA 5GAN8 3HFNA 4LG0A 2QQBA 3NETA 5K1YA 3KP5A 2IP2A 3DF8A 2LF8A 1MDMB 4K86A 1P2FA 3IWFA 4GYGA 2XAQA 3R0AA 4M9XA 2QHVA 4IRIA 1WI9A 1WYDA 3CMQA 5GMKi 1V4RA 1OYYA 4L9NA 5F5WA 4C8QC 1ZH5A 4FT8A 5ILUA 4AVPA 3BY6A 2R7FA 1USTA 3M8EA 1SMYF 1H9TA 3LSQA 4YP0A 3LAJA 3F6OA 3E97A 4YG2F 1GVJA 2VE9A 2F2EA 4XQ3A 5GANh 4IRGA 5ERIA 3QOPA 2DZCA 4CYDA 3I59A 1ZG3A 3K0LA 4LGWA 1QE0A 3PCOB 3ERED 2KIUA 2ZNJA 4EJWA 4P74A 4MQ9F 3JAMK 3WTSC 5DD8A 4L0YB 1ZN2A 4M75F 1B9NA 4WXCA 4ZIBA 2JN0A 1BIAA 4L5JA 1BN5A 1D5VA 4TVWA 1SD7A 4P71A 4ENKA 1AOYA 4M77D 4O5VA 4M7DD 1HC7A 2ZNZA 3SQNA 3HHHA 4TV7A 4A0YA 1IUYA 2YLBA 1IXCA 2E1NA 3JCMV 2O3FA 3HSEA 3BY7A 1QF6A 3RPUA 3VFZA 1WPYA 3HRMA 4P55A 2QENA 4M75E 3RJPA 5GANf 4BXUA 2K7LA 4RAZA 3K1PA 4UVAA 1KQ9A 2DEQA 1U3EM 3HXXA 5E1ZB 2ZIOA 4PJOC 3GYHX 3ELKA 4TQDA 1D3BA 1F4KA 1DP7P 5LJ3h 2QYOA 2ZZEA 3BOQA 4MGRA 2RDPA 2YR2A 4EGYA 3WTWC 5ICFA 1BI2A 4EQQA 2PI0A 3J81Z 4YRKA 1EH7A 3JB9F 3IKMB 2IA2A 3DSQA 4HDVA 3KFUA 1SD5A 4HQMA 3SB2A 1Z7NA 3KCCA 4U7BA 5KVRA 5DEQA 4BHBA 4OIQF 3RGLA 4EJOA 1W7PA 4GGGA 1RI7A 5HGQA 2FOKA 3WGIA 1YTYA 3JCMW 4M7DA 2ALYA 1M8VA 2DPDA 1EVKA 3ABTA 2VOOA 4MEYF 4KIBA 1X3UA 3O6BB 2DTOA 1MJAA 3ULQB 4CH4A 4C92B 2EFWA 4ZYGA 3C1DA 1T39A 2HR3A 3QU3A 3L00A 5L3GA 2QBYA 5LJ3f 5DY9A 2PMUA 2GA1A 1G4DA 4OIRF 3BP8A 4CZZA 4ENJA 1KQ8A 5GANd 2DTIA 2I4OA 5GAOn 4RGUA 3JB9G 5BQTA 1PP7U 2I4LA 2EFQA 2RC4A 3BJ6A 2K27A 2MH9A 3K2ZA 3BFMA 4YRJA 2W57A 2K86A 5L3DA 5A2QZ 2KIFA 1C0AA 2I2LA 1BBYA 1I81A 2GWRA 2ZXFA 2IVMA 4A6DA 1H641 5LJ3j 12ASA 4ZZLA 1BI0A 5JR3A 4HV5A 2LF7A 1G5IA 3JCMe 1LYLA 4TVAA 1F9NA 3MF1A 4M75D 1E1TA 1H4SA 1TW2A 1KQ2A 4ZYHA 1FBUA 2A6HF 3DFGA 1XSXA 4WWCA 3IKLA 5GAN5 1XGNA 1EV7A 2DT5A 3I4PA 5AIPA 3JCMb 4M78B 2BYVE 1W5SA 5IT9K 2HFHA 2PBIA 4CHUA 4N0BA 1LVAA 5LHHA 1H0MA 4JRKA 4EMKC 3JSOA 3HSBA 3I59B 1HW5A 5LJ3d 1O7FA 1SESA 1IN5A 1QGPA 2EV0A 2H09A 4WJ4A 4M7AC 3GW2A 4X5OA 3G3ZA 2D2WA 2H6CA 3IHUA 1B8AA 2FBIA 2HTJA 2HGCA 3MAJA 4PNOA 5LRSA 4V2SA 2ZINA 2MBFA 2FB7A 3A32A 4UPAA 3RACA 2QUFA 2Q8KA 3LWFA 3ZP5A 1HXDA 2Q5IA 3SFZA 1GXQA 1X55A 3RYRA 2VXZA 3FZVA 2ZXJA 4P9UA 4X9DA 2HYGD 3JB9D 4HWRA 1ONVA 3E5UA 3F8MA 4WF2A 3HIFA 2UWMA 4RCBA 1YLFA 4G85A 2EJGA 2F5DA 2VC8A 4P72C 2AKWA 2VBXA 2Q7HA 5D5WB 2PMFA 2IRFG 1MKMA 2DZ9A 3BPVA 4K88A 4Q5SF 1USYA 3SHFA 1ZRDA 2RB6A 1G3SA 2PQ8A 2XV4S 4UP7A 3F8NA 2XIGA 2WWYA 3KP2A 4A2UA 2ZT5A 4RGXA 2K4JA 1RUNA 4ZTZB 4BQAA 4LNSA 2JTVA 1Y96A 3WTUC 4KIGA 4IJAA 2VONA 4M73A 3RPQA 3BDUA 1SD4A 1JJCA 4N9HA 1YFTA 1CF7B 4OINF 1XSDA 1JE8A 5CVVA 2OBPA 5D4RA 4Z2YA 3BW1A 1BM9A 2RQPA 4C8QF 3HY1A 5CAIA 4EVIA 2DI3A 1HBXG 1I1SA 1W7PB 2OZUA 3TEHB 2EJFA 3U9GA 3KZYA 3EDPA 2ALYB 4D0PA 1T6SA 3E9HA 3GEZA 2DPUA 5GAN6 5FB2A 1YO5C 1E17A 4C8QE 1FWZA 1ZGAA 5E17F 1K79A 1FP2A 2EK5A 1EVLA 1B34A 2QBYB 2P6TA 2FMYA 3VQYA 4G9YA 1OR7A 2FBHA 3M4PA 3V8JA 2HKOA 1R36A 4XSZF 2KJBA 3VEPA 1XD7A 4OP0A 4KR2A 2QZ8A 3GWZA 4M9ZA 4UNOA 3CUQA 3L9FA 2STTA 4YRCA 4G84A 1EFWA 1TQPA 3E9IA 1WQWA 3VB2A 3D5LA 2HYFA 2ARUA 4YRRA 2P8TA 3TUPA 2WC2A 2ARSA 4YRQA 2C6YA 4XEMA 4CDGA 3QAHA 2MLGA 3J80K 3R0JA 1D8JA 2IT0A 3P8TA 2PFBA 1UB9A 4TVAB 3DPLC 3E6MA 3MZYA 5JVTA 2GXGA 3I54A 1LJOA 4RB2C 3IL2A 5BS6A 4PJOF 3KP3A 5D6FA 4YFNF 1HW2A 3F8CA 2ESHA 3WE2A 2IA1A 2EJRA 4M78E 2FRHA 3HFOA 2B0LA 1KU7A 2NNYA 1FX7A 1YW9A 4QVCA 3F8FA 3N97A 2H27A 4HBLA 5ELOA 4P96A 3FB9A 3QO7A 1P4AA 5K5QA 2P0LA 3ZMDA 5CLSA 2HQRA 4HT8A 3RERA 4YRNA 1FP1D 3UGQA 4YRLA 5F1RA 1KMMA 5BOXA 4XTYA 2GAUA 4RGSA 5CVIA 3P9IA 4KFCA 2DK5A 3IALA 4MQVA 4EM2A 1W5TA 2YU3A 3U1DA 3EFRA 3F72A 3WTZA 1FOKA 1FT9A 5GANe 2J3MA 1VQZA 2KJCA 3H3ZA 5DDGA 1U6GA 1EIYA 2BE5F 4JQFA 2ETHA 1QNTA 4I09A 2CJAA 4L5IA 2DXUA 1ZYRF 2YSRA 2Q7GA 4UUVA 2QHTA 2JSCA 4C8QD 4RGRA 1REPC 1IN6A 2DVEA 2AKWB 2XVCA 1PYSA 5GAMh 2FNPA 3RI4A 2ZT7A 2JT1A 3NELA 3PQKA 2P6SA 3DP7A 3GIBA 3GFMA 3L4GA 2P4WA 1EOVA 2DKGA 2PJPA 3QSUA 2MC3A 2ZNIA 1B9MA 2DW4A 1A04A 6PAXA 1J59A 4YRIA 4EM0B 2P7VB 4F7UF 4U0VA 3VU3C 1L0OC 3FM3A 3GVAA 1Y96B 2E1CA 1NYRA 1O7LA 1TQMA 2I4NA 5HDNA 4HT9A 4A12A 4HDUA 5JFRA 1JJCB 3LSSA 1DUXC 2R7DA 4LB5A 1L3LA 2Y75A 3FM5A 3HRSA 2XAFA 2Q0OA 4F7UE 4YRSA 3V8LA 4A0XA 4M77G 2UZKA 5LJ3e 3FF5A 1YFHA 3JTGA 3C18A 2K02A 5GAMf 2Q2EA 1WU7A 4MMLA 1Z7MA 3DEUA 2VN2A 1ADYA 4L9TA 2RGVA 4R1HA 2EWNA 3VQVA 1R58A 4ESFA 1IW7F 2V79A 1I5LA 2MLKA 4RQEA 1P4WA 4HWPA 2V9VA 4R8HA 1B34B 4E70A 4PJOD 3RYPA 3C7JA 2DU9A 1JRIA 1G3WA 1JBMA 4LMYA 4HA8A 4J6WA 4XEOA 3I71A 5GAMj 1NJ8A 4HOBA 3DV8A 1M5Q1 3QPTA 1YW8A 2EFOA 5HDGA 3GX4X 3QTCA 3CTAA 3JCMQ 1K7AA 4YCWA 3C3WA 2DTRA 4C92C 4M7AE 2DTHA 4RB1A 5GAOm 4XTVA 1ODDA 4L18B 3RKXA 2OA4A 2ZKZA 1KYWA 3FMRA 3SWNA 1Z7UA 2EAYA 3BROA 3ZMUA 3WTXC 5GAMg 1OPCA 1BIBA 4XTZA 3WODF 2OZ6A 4YREA 5GAMd 3P7NA 5GMKl 5GAN4 2JRTA 1SERA 4WX9A 4N0AA 3WQZA 3QRFF 2NRAC 1R5HA 4WCGA 2IPQX 5LJ5j 4U0WA 3LAPA 4PCQA 2OU2A 3LQQA 3O2PE 2IA0A 4UP9A 3HRTA 3JB9J 3P8YA 1X2HA 2GXBA 3W6KB 2YX4A 5HOOA 5HVQC 3TQNA 4L0ZB 3T0YA 2XKPA 5CJ9A 4M74A 1SAXA 3AHUA 2DO7A 2DU5A 1FNNA 5ED4A 3FXRA 3QO3A 2RHSB 2A3SA 1QZZA 2F5EA 4RAYA 2ODRD 4M78C 2CO5A 3M4QA 3JCMJ 1R5GA 3QO5A 4KT5C 3A31A 5LJ5g 4OMZA 5GMKj 3WTYC 3W3SA 1EIYB 5CYVA 4EMSA 2I4MA 4ZZDA 4KICA 2AXLA 2ZZFA 3MZHA 4M75G 4HWTA 3OV8A 3REUA 2E7WA 5HLHA 3UFGA 3BDDA 4P74C 2VOPA 2CGPA 3JCMP 3KZZA 1LJ9A 3WE3A 4O3MA 1B1BA 1KU2A 4I2OA 3L4GB 4U0YA 4YROA 1S7AA 1R1TA 2H94A 1XGSA 3NEUA 3KE2A 5EEHA 1ZAOA 2E64A 3R4KA 4CH5A 4DQ2A 5LRRA 1ASYA 5A2QK 5AONA 3IG2A 1N9RA 3JAMZ 2ARTA 5GAN3 4KA4A 4Q4ZF 2DLLA 2FXAA 4XU0A 1O3SA 1JXSA 1OYWA 1XGOA 1Q1HA 4M77A 3P9CA 2P5IA 4FX4A 4P5OA 5DD4A 5J6XA 1LNWA 4ETSA 3EQLF 4YPFA 1RUOA 4BAYA 2ZMEA 1LNXA 1ASZA 3JSPA 4MNUA 4UHTA 5HDKA 1OMIA 2DQRA 2HZTA 2W84A 3S2WA 1XSVA 2V1XA 5D5UB 2L3DA 2W24A 3QHSA 2DXTA 4M6YA 3TO6A 1G51A 4KIFA 4B09A 3F8BA 1AWCA 3GFIA 1HSTA 3REXA 3HHGA 3O3KA 2EA2A 2ZCEA 2Z3YA 2V6CA 4FHTA 4BHCA 4JRIA 4CS3A 3GZ6A 4LG0B 4G7HF 2QHUA 1S3JA 4BW9A 2V1DA 3QPHA 4Y15A 4KYWA 2M1BA 4UP8A 3FHZA 4AIKA 4R79A 1NJ6A 3A74A 2XHKA 3MWMA 2BEOA 4OOIA 4G94A 3PGGA 4YCUA 1TNTA 3CDHA 4G7OF 1U8RA 3ZN0A 1MD0A 4A54A 1SD6A 4AH6A 4XTUA 1DPRA 1KMNA 1U1TA 2CJBA 1G3TA 1FSEA 2MH2A 3F3XA 3SWNB 4KN4X 1T2KA 4A5NA 1LDJA 1ZRFA 4HYEA 1XDUA 3W6JB 5K1PA 4EJVA 1GHCA 4RB0A 1ZRCA 4QVDA 5E18F 1R00A 2OQGA 4P72A 2EFNA 1IN7A 1E1OA 3REOA 2DQ0A 2J3LA 1WRJA 3I53A 5K1XA 2KRFA 4P3NA 3ICAA 1GXPA 2ZO4A 2L4MA 3TKYA 1H9GA 2FQ3A 4H2TA 5CVJA 4LB6B 3NRVA 1H4VB 3JCMc 3Q5FA 1K6OA 4I02A 5ICEA 4MTDA 1YG2A 4RCCA 1IN8A 5ILVA 3SZTA 3P8VA 1BC7C 4NHJA 4PGHA 4QWQA 3VQWA 2JPCA 4M75A 1X54A 4O2DA 2RHQA 2Z99A 4XU2A 3JCMX 3G1ZA 1U2WA 3RL6A 3HXYA 3RKYA 5H6QA 3FIFA 1ATIA 1KGSA 1BOAA 2C8MA 3HOTA 1FBQA 5DCFA 2L01A 1I8FA 4BNCA 2ZIMA 1R7JA 1D3BB 3WGHA 5IT9Z 3IC7A 4EX5A 4TVYA 1G3YA 1K78A 4ESBA 5DUKA 4KNYA 1B70A 2CWEA 3UH0A 2L4AA 1SFXA 5F64A 2OD5A 5E8IA 3I0TA 5DCMA 3BPXA 2D45A 2CYYA 5L3CA 1FZPB 4BYYA 1N9WA 2XROA 3FXUA 1P4XA 2GIVA 1FY7A 3E3VA 2Z9OA 2FBKA 3A7RA 1SRYA 2J5OA 1TBXA 3F6VA 4YDQA 2XASA 3D0SA 3G73A 4M71A 2ZNYA 2CQKA 3I64A 5FLXZ 1HKTA 1H4QA 1P6RA 2Y0MA 4M77B 5ILSA 4M7DB 2A69F 3BJOA 2E1HA 4L9VA 3ZMTA 5E8GA 1X2GA 2M87A 4Q48A 4YRGA 5EEGA 2RM4A 4U88A 3IRRA 4C92E 1ZREA 3FJPA 2VBYA 1YFSA 4XTWA 2AMCA 3EFSA 1B7YA 3B02A 5I21A 2Y48A 2HTSA 3WG9A 4C8QG 3MQ0A 2VC1A 2ESNA 2FU4A 4Y17A 4P73A 3QP6A 3MEXA 1U5TA 2O61A 4A53A 4KQEA 2UXXA 1YS7A 1SETA 4LK1F 5C51B 1QQIA 4H2XA 2DDZA 1IXRC 2PLYA 1ZG5A 3BJAA 1UHMA 5K5RA 1OYIA 4H02A 4M78F 2JPBA 4HW0A 4Y13A 4YFXF 2NAZA 4M9SA 2DFIA 3L2ZA 4HZFA 1RNLA 2VC0A 3JB9H 5LHIA 1VTNC 2CGHA 2QQ9A 2MA3A 2ZR3A 1ON1A 3ABUA 5LLQA 4LLGF 5E1WA 5DUIA 3PQJA 2STWA 1MGQA 3KEQA 1Z91A 3SZPA 4HF0A 4KMFA 1KA8A 1YIOA 1BI3A 1TLHB 5IT3A 4ENNA 5D6EA 4Y91A 3PCOA 4HF1A 1D3YA 3COAC 2KKOA 4IPAA 1ZHFA 2XAHA 4G8XA 2M45A 2X4HA 5C53B 2A5YB 2GZWA 1W66A 4MHGA 4PJOG 2ISZA 3ECHA 4GCVA 4GYIA 1HW1A 3HFVA 2CIMA 1T98A 5DV5A 1TQIA 1PUEE 1CGPA 2XUBA 2ZJ2A 3BZ6A 5GAOq 2FMLA 1FYLA 3M8FA 3J80Z 3LA3A 4BH9A 4JK1X 2HWVA 4H2SA 1XB4A 3FMQA 2PMEA 4UV9A 3RDIA 4C92D 2GA2A 4M75B 2WTEA 4HWSA 2F5FA 3GZ5A 1MZBA 1QBJA 3IKTA 3JCMg 1OKRA 1WSUA 4G6DA 5D8KB 1B6AA 2XAGA 2EB7A 1BC8C 5F6FA 2G7HA 1IRGA 2NNNA 5E1XA 4Q6GA 1B4AA 1H4TA 4HWOA 4AIJA 1HSJA 1KYZA 1K78B 1TNSA 1B70B 5HS9A 3N4MA 4H2UA 2QLZA 4GO1A 2HDCA 4YIIA 5DCMB 1WLEA 2HKXA 3QP5A 4FX0A 3J7AO 4LJZF 5C52B 4IF4A 3INZA 3ZMVA 1YYVA 4XU3A 2IJLA 2VBZA 4I7HA 1S8NA 2EJ9A 1HTTA 2FEZA 3V7SA 5LJ5h 5ICGA 3WU1B 1HK9A 2XRNA 3GO5A 5HLGA 4NQWA 3R6SA 4M7DE 3KP4A 4M78D 1ZGJA 4PZJA 3JB9I 4EGZA 4J15A 3FWEA 5AIQA 4F7UG 4XBFA 2ZT6A 3GXOA 4C8QA 4PGGA 3KEOA 4HVCA 3M1EA 3ZMSA 4M7AF 3HSFA 4YFKF 2O03A 1B7YB 2P5VA 1KQ0A 3E6DA 1HQCA 4P75C 3I7FA 3T8RA 2HS5A 2ISYA 1U5TB 5GMKh 4XSXF 3CUQB 4P3OA 4EO4A 1Z9CA 4XRFA 4UV8A 3E6CC 4EMHA 4H2XB 4ZH4F 3HTUA 1XCBA 3R61A 3EYIA 5LJ5f 4QLCU 1IRFA 2ZGWA 1T38A 4ESJA 3LFKA 3VQXA 4M72A 4M7AG 1WNLA 1WQ7A 3HRUA 3M9AA 1YFRA 4CH6A 1E24A 4UVBA 2M5WA 4M6XA 5BPDA 2ZTGA 5H20A 4XU1A 2Q7EA 2XGXA 3HTZA 2FYKA 2W85A 4M78A 2ADUA 5CVRA 4F7ZA 5FGMA 2OQRA 4HQEA 3WGGA 1FLIA 3A7UA 2H6BA 1E2XA 1R23A 3LA2A 1GGMA 4U7DA 4PJOA 3J81K 5E3IA 3LC0A 3K1MA 1R1VA 4G7ZF 2K4BA 2G4CA 1IXSB 1O57A 1PDNC 1NJ1A 1D8KA 3VBBA 2HQNA 2PMHA 4ENMA 4JLIA 1Y0UA 2P5KA 1W7PD 2A61A 3TDUC 3SWNC 1FYFA 1NYQA 4KUMA 2HOEA 2D1VA 2COMA 1J75A 1J0RA 3HFZA 1Z05A 3ZMZA 5LJ5d 1O3RA 5ELNA 4N0AC 2ZZGA 2BGCA 1XMAA 2YX7A 1EQRA 4YRTA 5L3EA 1I1GA 4LK0F 5H6RA 1PYSB 1TW3A 3GFJA 3DPTA 2LNBA 3BJUA 4NL3A 4YRFA 3HXZA 4I01A 2RV8A 1B76A 4P71C 1USSA 4UVCA 1F1ZA 5BPIA 3K9TA 5LGNA 2D1HA 1YS6A 2P7CB 3ZPLA 1YGBA 2M8EA 1LQ1A 2VXEA 3A5YA 4M7AD 3TDZC 2QWWA 4ZYEA 2E10A 2EL9A 4ZYDA 1CF7A 1KQ1A 3HY0A 2DQ3A 5GANj 3IRQA 3TO9A 5DYMA 2YPRA 4JUVA 3V7RA 3JTHA 1B59A 1R1UA 1LB2A 1Z6RA 3RIRA 4F7UA 4HLYA 3KLOA 2VT2A 3T5XA 4J5YA 3T1BA 2ZR2A 3TEHA 4PG3A 5J8FA 1J7KA 1LDKB 3B73A 3SXYA 1J2XA 1SFUA 1NHAA 4AD9A 1L0WA 1UCRA 2FSWA 1RIQA 2Z33A 4MEXF 1G6NA 2LDUA 2RVCA 3V7CA 3M4GA 2VBWA 2K57A 3GLXA 3BWGA 4C8QB 5GAN7 5GANg 2ZBKA 1PP8F 3HYIA 4H2YA 4OIPF 3PFIA 3EYYA 2CG4A 1SFEA 3EUHA 5GAOp 4EV0A 1KU9A 1F5TA 4HLXA 3CUOA 3GF2A 2HEOA 4EMKA 1FPQA 5D8LB 4M77C 3VODA 5GAOl 4M7DC 5KK1A 3NQOA 3RUXA 4S04A 1XGMA 2DQLA 2OAZA 4P9FA 3LSTA 1FBSA 3KP7A 1ADJA 1KOGA 1XDSA 4NB5A 4M7AA 2ODRC 1JHHA 3L2CA 4K2EA 2R3SA 3ROUA 4WXDA 1YCYA 3Q9VA 4AIHA 4KN7X 2BBYA 2E7XA 2KIMA 2VT3A 1ON2A 5K5OA 2E65A 1MJ9A 1QZYA 2DAOA 2A68F 2IY5A 5LGUA 3E5XA 3MEYA 4LD5A 3MFKA 1ZLKA 2XAJA 1BBUA 4I0BA 4HF2A 2DBBA 2PG4A 2FNAA 1S7OA 3HSRA 1RIOH 3RF1A 5HS7A 1ZARA 4PDKA 3V8KA 2DJZA 3A5ZA 1LDDA 3OD1A 2QVOA 4DNCA 1FC3A 4RMFA 5LJ3g 5E20A 1X56A 3I58A 1J5WA 5LEKA 4JBAA 2YLCA 3RESA 4PJOB 4IRHA 1G5HA 4BWAA 1W4MA 1YW7A 3FMSA 3HUGA 5JI6A 4OIOF 3H92A 5CVUA 5FLXK 1NNHA 2FA5A 4TQFA 2TDXA 1IL2A 1YQAA 1IN4A 3I5UA 1N9SA 3CLOA 4I98B 1V3FA 3JW4A 2NYXA 2A07F 3TOAA 3NENA 1BJAA 2W25A 3MF2A 1ZG1A 4RB3C 5HS8A 3HFZB 1UHWA 1I27A 4HAMA 4K87A 4NCXA 3P9KA 1HKSA 1DPUA 1RZ4A 3TO7A 2EA4A 1O3TA 1EH6A 3CO6C 4YYEA 3HRIA 4EJUA 4RS8A 4EM1A 3GUDA 1HKQA
chains in the Genus database with same CATH superfamily
3K4KA 2JNGA 3META 4IHTA 1FOYA 1WQ2A 1AHDP 4YIFA 3FXMA 3L09A 2J6KA 2X0LA 1O3QA 3VS1A 1SVMA 3CO7C 2DD5A 2DD4A 3V4GA 1OCPA 3E6BA 4XMYA 1S6LA 2O9VA 2LLKA 1NJ2A 1AD5A 3D1NI 4FSSA 2DAQA 3REAB 2L54A 2AS5F 4HX7A 2E3CA 2WY8Q 4S05A 1WHUA 4KMUX 1ETKA 4HT4A 3FBNB 1IO6A 1I5ZA 1S7EA 2CW0F 3CC4T 2D8JA 2HXOA 4P3PA 1Y8RB 1T0JA 2K5IA 4DBHA 3R6NA 3ZN1A 2EFPA 4ZTJA 2ZB9A 5KNNA 4L9JA 3ERRA 4FW2A 3IUOA 4DJAA 3OMGA 2ECZA 4UXNA 3UKGA 5LJ5e 4KUDK 2CT3A 4LLNA 4X9CA 4IVNA 2PUKB 3EG0A 2CSOA 4TTVA 1E22A 4RQFA 1S29A 4AM3A 4E7JA 2EQIA 1V76A 2D9TA 3M1CA 4XTXA 4LDVA 2A8EA 2JUCA 1SSHA 4EMGA 2COBA 3L2QA 4M6VA 5TJJA 5FLVA 2JTFA 3JCMf 2VE8A 4CICA 4P73C 2K5CA 4ANJA 3LFUA 4M78G 2QHSA 4F92B 5J8CA 3QPLA 4PJMA 3VDXA 2IW5A 4A3MJ 3CCQQ 1U5SA 4L87A 1B8IB 1V54H 4Q15A 3IKVA 5KYUA 3NEMA 3TOBA 3GBGA 3CCET 2O7OA 4EJTA 4OVAA 3ZQ7A 1BR4A 1I5OB 2DL8A 2MD5A 2CQXA 2RHSA 4WI1A 2QQ8A 1AVZC 4C5GA 2QEXI 3OYHA 4YRMA 2RHQB 4A3FJ 5GAOr 2E34A 1MNEA 4PHCA 3K69A 2QM3A 1MV3A 5KYNA 1LFPA 3KLNA 2RHYA 1X01A 3KEYA 4BHPA 5F0CA 5FO5A 2ROLA 1FTTA 1AZGB 2PU9B 4C30A 1VQPQ 3ABMH 2BZXA 5E3NA 1MMGA 3VYHB 3ESWB 3SEZA 2D0QB 3E7LA 1JT0A 1KU3A 1Q82C 5C0MA 2OTJA 4N4OB 2DYSH 2O0YA 4A0ZA 3HXVA 3ISPA 3L1AA 1OEBA 3UGTA 1ENHA 4P75A 3JRFA 3CCSA 4HVVA 4M77E 2L5QA 3CPWA 3HHTB 2B86A 4X1VA 3ML6A 3FKIJ 5HCKA 1MGTA 3K1NA 4DYQA 1IAWA 1AWJA 3WU0A 2ZCWA 3M4YA 5LEJA 2XMFA 3J81E 3HTSB 4KGXB 3FXOA 4J6YA 1WWXA 4QT7A 1YCSB 2H1LA 5GAN8 2DXCA 1Q86R 2QQBA 1KD1U 4JP0A 4M9XA 1V55H 1K6YA 2RI3A 3EAEA 1OYYA 1BYMA 4LN2A 4C8QC 4AVPA 3C4SA 3FDRA 1UG1A 2LZ6B 1GVJA 3QOPA 2DLPA 1YIJI 1JO8A 1G2BA 4LXCA 3CJRB 1ZG3A 3K0LA 4BJ6C 3ERED 1EF4A 2KIUA 4EJWA 4P74A 3JAMK 4BQQA 1X75C 2EYWA 5CK9A 4L5JA 1D5VA 1FEXA 2BVLA 4TVWA 4ENKA 4M77D 1M30A 2R5MA 1IUYA 4FT4A 2O3FA 3ZQGA 2XSDC 3HSEA 3BY7A 4HSTA 3RPUA 3K70C 2GTOA 3W2VA 3S93A 4DOZA 3ZXSA 5GANf 1KQ9A 2NS7A 2ENMA 1UFFA 1WXTA 3GYHX 1DP7P 1XNIA 4OMMA 2K3PA 3WG7H 2ZZEA 2G6FX 2HKNA 4DOVA 4LVMA 5EYRA 1OCZH 3WTWC 5LFAA 2W0ZA 1EH7A 3IKMB 3OSFA 4HDVA 1GUUA 4IX7A 3VUBA 4QIWN 3CCUQ 2VKNA 3L2VA 3RGLA 1W7PA 1V5GA 3H41A 1S72A 1RI7A 3WGIA 3CESA 2HOSA 1KSWA 4J9IA 2DPDA 2HPIA 5C4JJ 4MEYF 1AKHB 4CH4A 4L59A 4C92B 4ZYGA 1X1CA 1T39A 4R55A 2HR3A 3K2AA 3BG6A 2RNAA 2GA1A 3BP8A 4ENJA 4MIMA 2I4OA 2VGNA 3JB9G 5BQTA 2EFQA 1A0NB 1K9AA 1VQKA 2K86A 1KC8R 1TUCA 1YX3A 3C2HA 1BBYA 1I81A 1N5ZA 2HCKA 4A6DA 5LJ3j 2K2MA 1KG1A 1BI0A 5JR3A 2CS7A 4HV5A 3ZQHA 2JUGA 1NEGA 1LYLA 2HZDA 3ZEHA 4ZYHA 1FBUA 3S8PA 2K5FA 3IKLA 3TVTA 5AIPA 2J6FA 3KXTA 2HFHA 1WJQA 2G3RA 2FRYA 5GAGJ 3DLAA 3CC4Q 1LVAA 4EMKC 2D8HA 4JRPA 3JSOA 5I11A 3VKIA 1YJNI 1JKOC 1M2VB 3G3ZA 2D2WA 1B8AA 2FBIA 1Q81C 2VL8A 2Q5IA 2E1MB 3VYUB 1TUGB 2EH3A 1D0YA 4X9DA 2HYGD 3E5UA 2UWMA 4B1RA 2JWTA 3KYCB 2F5DA 2DETA 3VJPA 4QQGA 2VBXA 2PMFA 2RJEA 2JZ2A 1MKMA 1RAHB 3BPVA 4K88A 3SHFA 4QW2A 2ME0A 1G3SA 3CPWS 4G6TB 5KE2A 3F8NA 2XIGA 2I0NA 2R7WA 1Y96A 4IJAA 3RPQA 1QCOA 4BBRJ 1JJCA 1CF7B 2M2EA 1WJ5A 2DYBA 4BUGA 3JREA 2OBPA 3CJQB 4Z2YA 3BW1A 4C8QF 1UE9A 2NVUB 2DXBA 5F0FA 4MZPA 3QWLA 2EJFA 3EDPA 4P1WA 1T6SA 3A0BC 3GEZA 3OB9A 2WBMA 2YUNA 2J06A 1ZGAA 5KYWB 1Z3YA 3PNVA 4J7FA 3VQYA 1OR7A 3M57A 5KH6A 3VEPA 1XD7A 2J7IA 2QZ8A 1VIEA 4FYWB 4M9ZA 4UNOA 3CUQA 3L9FA 2QYZA 4G84A 1WQWA 2HYFA 2ARUA 2P8TA 3FLGA 5HNHA 2WC2A 1N8RR 2K3YA 3L42A 3PE0A 1PYVA 2DILA 2L7FP 3TL4X 2MLGA 3BG7A 3J80K 4J7IA 4Y52J 2IT0A 3P8TA 1Z21A 1UB9A 4TVAB 1VQ4I 2V9KA 3I54A 4YFNF 3CC7A 2COWA 2ESHA 2LNVA 1S5LC 4L5GA 3GLLA 2HQAA 2IA1A 4YEJA 4M3DA 2CRGA 4QVCA 5KYYB 2H27A 4P96A 5TISC 3QO7A 2LC2A 4C9YA 2NUPB 2P0LA 1ZGWA 4ME7A 1GCPA 3E9GA 3M58A 3UGQA 5F1RA 2ZXHA 5B66C 1ETQA 2DK5A 3I9V2 4BUPA 2CP0A 2JA6J 2YU3A 3U1DA 3WTZA 4FT2A 3S1NJ 1VQZA 2M1HA 2BE5F 3LSMA 2H1KA 2YSRA 2MI6A 4UUVA 1HOMA 1KIKA 2XVCA 1YI2A 5GAMh 3RI4A 1I1JA 4RKUE 3NELA 4EATA 1OULA 1NEBA 2P4RA 4C3JJ 1EOVA 1UJYA 4XRSG 2DKGA 3IH4A 1KK7A 4F7UF 4BEHB 4U0VA 2DE0X 3OR1C 1GDTA 3LW5E 2XGCA 3EPZA 1O7LA 4XKCA 2K7AA 3EFOA 5JFRA 3LSSA 2MSYA 1L3LA 3FEOA 2R93J 5LJ3e 2K02A 2LQNA 2Q2EA 1WU7A 2CREA 2VN2A 4F91B 1K9MU 4R1HA 2EWNA 1R58A 4ESFA 2V79A 2NS6A 1HDPA 3TBIA 2XU8A 1B34B 2LH9A 4PJOD 4JX4A 3C7JA 4QQ6A 3CF2A 1JRIA 2KR3A 3O5ZA 1G3WA 1A31A 4VUBA 1UB4A 2YU9J 1M5Q1 1IB8A 4F16A 2AKKA 2JOYA 4M7AE 2JS0A 1ETYA 2DA5A 2ZKZA 3FMRA 2ED0A 3FBIB 4FCYA 3WTXC 3CBOA 4KBMB 4LVJA 3P7NA 1WHGA 2DMUA 2XK0A 4WX9A 3WQZA 1ETWA 3MKLA 1WPKA 1R5HA 1VOMA 3FK7A 1PHTA 2KAFA 3DKYA 4U0WA 2OU2A 1EA3A 3HRTA 3I56I 5KYUB 1U0JA 4L0ZB 2R7ZJ 5CJ9A 4M74A 3AHUA 2V26A 2VV5A 3SD4A 2ZFUA 3PSFA 2RHSB 1OCTC 2A3SA 2F5EA 1VQ9I 5E3MA 4PFOA 3QYEA 3QO5A 1M4ZA 2JM8A 2M0OA 4OMZA 2IVWA 5GMKj 2QSHX 2F48A 1AWWA 2IBDA 3MKZA 3MZHA 4HWTA 3OV8A 3REUA 2E7WA 3CCEA 4P74C 1MHNA 2CGPA 4JJDA 3FC3A 2MABA 1S7AA 2H94A 1VQLA 1XGSA 1ETXA 3G4SA 3NEUA 3KE2A 2E2IJ 1UG0A 4DQ2A 2QCOA 3FXJA 2ARTA 4Q4ZF 2KPMA 3A8OB 2FXAA 3OYIA 5CQYA 1XGOA 3P9CA 4FX4A 2R7TA 5J47A 1LPLA 1H8KA 5IT9E 3EQLF 2YUQA 1RUOA 1GBRA 3VYTB 1GCQA 5DS9A 2ZMEA 4ELYC 1LNXA 1ASZA 4MNUA 4UHTA 1OLTA 5HDKA 3MO8A 2DQRA 2HZTA 1K61A 4KT0E 1XSVA 3QJYA 5D5UB 2KXDA 3DB4A 3KPHA 4FYYB 4PL6A 4M6YA 1G51A 1JUPA 3F8BA 1E6HA 3GFIA 5FLXE 1KHCA 2WSEE 4IUUA 2ZCEA 4RDUA 2Z3YA 1R71A 4CS3A 4AVZA 3GZ6A 2QHUA 4BW9A 3CDLA 2PTKA 2M1BA 1LE8A 4AYBA 4XOPA 4R79A 1U8RA 1NYFA 3QIIA 1MMDA 2JXBA 2XRLA 1SD6A 2W4SA 1C0MA 4XTUA 1Y56A 1U1TA 2D1XA 2CJBA 3ABLH 2E5ZA 3SWNB 4ZGEB 1NK3P 1VQMI 2RMOA 4D8DA 3SDGA 2YSQA 3EGDA 5K7HA 3RKQA 2PZ1A 1LDJA 1ZRFA 1RAFB 5GP9A 4QVDA 4CI0C 4QKUA 4N4NB 5A0DA 3VS2A 4P72A 1IN7A 3S14J 1E1OA 1WJRA 1TWAJ 4ZNXA 1GXPA 2HNHA 5CVJA 4LB6B 5HK0A 1VQ6T 3NRVA 1H4VB 3JRBA 1YG2A 5L8RE 3Q1JA 2A08A 2O88A 3P8VA 5FU7B 1YITT 2E5KA 2QEXA 4QWQA 3VQWA 4C0FA 4M75A 2JTEA 2Z99A 3SDZA 3HXYA 4GRIA 5H6QA 4PJJA 3EGXA 1BOAA 3LSRA 3HOTA 1BJZA 1FBQA 4XM3A 2ZIMA 3WGHA 5D6WA 5DUKA 5F64A 2BXZA 3I0TA 5DCMA 3RDVA 4JZ4A 2E70A 2CYYA 2KZVA 1QWFA 3E3VA 2Z9OA 1SRYA 2J5OA 3F6VA 2XASA 2Y4YA 1S1NA 4M71A 1OPLA 3Q0UA 4M77B 1DGWY 2DDAA 5ILSA 2FZCB 3RMSA 4L9VA 2LQ8A 3M54A 1X2GA 2G0EA 1M90U 2M87A 2RM4A 3EGUA 5IP6A 2ZPHB 5ECAA 4IHYA 2DRKA 4IURA 2FQ4A 3TW6A 3H36A 3H35A 4C8QG 3MQ0A 4Y17A 1WJBA 2IS2A 4A53A 2H3EB 2HDAA 4C3IJ 1IV6A 1SETA 4PSWA 2C06A 5K5RA 4J9EA 2JPBA 1OQYA 2DFIA 1WHLA 5CKBA 5E3LA 4HZFA 5LHIA 1IUFA 1VTNC 3PM1A 2MA3A 3MEWA 2TCTA 3W3CA 2XC7A 3ABUA 1Q86U 1X2KA 3CCYA 3I55T 2L3RA 3CF5F 2LREA 1YIJA 1KA8A 1YOVB 1PWTA 4HF1A 4ABZA 3NARA 3CXCA 4CCJA 4QPOA 2XAHA 2M45A 5C53B 2A5YB 1KD1C 1RETA 2ISZA 1Y6IA 4GYIA 1T98A 1I3QJ 1PUEE 4HVUA 2XUBA 1FYLA 4XL9A 2LY2A 3PIPA 1NLPC 3FMQA 2EYXA 2GA2A 3GTLJ 3QWXX 4FIBA 3DU6A 4ESRA 3JCMg 5F6FA 2HKQB 2NNNA 4Q6GA 1H4TA 4HWOA 3LSJA 1K78B 1KYZA 3FHNA 3HP9A 1B70B 2XGDA 1NLOC 3N4MA 4GO1A 3AL0C 3ERMA 1WLEA 2EZHA 3VYSB 3VV0A 2MCNA 2FHDA 4IF4A 3ZMVA 3CD6Q 2IG0A 2I5UA 4XU3A 3RCOA 2M0YA 2VBZA 2Q1ZB 2KP6A 3V7SA 5ICGA 3WU1B 4NQWA 2WAQA 3R6SA 4M78D 1ZGJA 2WAEA 5KNLA 4F7UG 2M3AA 2ZJPF 2KBTA 1IRZA 1EIFA 4XONA 3HC7A 1I3AA 4IOCF 2XHCA 2COYA 2RPNA 3BZCA 2VJ4A 1N6AA 1HQCA 2ISYA 1U5TB 5GMKh 3CUQB 2KRHA 2QAZA 3G71T 2ZZDA 2COZA 3ASKA 1OOTA 2BTTA 4C2UA 2RHXA 5LJ5f 3X20B 2Y0SN 4HEA2 4XLFA 4BQNA 2DOFA 1SFOJ 2OF7A 1YHQA 4RG2A 3HRUA 1KC8U 2M5WA 5BPDA 4E7IA 4IHWA 4XU1A 3LYIA 1MV0B 2FYKA 4M78A 4PFPA 2H8RA 3K4MA 1IJWC 2XDVA 4BI8B 1WX6A 2Y69H 1FLIA 4CCMA 3LA2A 4U7DA 2EKHA 1U9OA 3J81K 3LC0A 1QVTA 2YUPA 1R1VA 1Y07A 3QZ5B 1POGA 4G7ZF 2G4CA 4HXJA 1NJ1A 2JA5J 3M56A 3VBBA 2PMHA 2K2VA 2A61A 1FYFA 1HDDC 1J3TA 3ZMZA 2JA2A 1X4OA 3MZ8A 4HKEA 2ZZGA 1XMAA 1GFDA 5F27A 5H6RA 4M3FA 2ZPIB 1FIAA 3DPTA 3M0RA 1QZEA 4P71C 5LGNA 2D1HA 2P7CB 1JKPC 5JLWA 2M8EA 3S15J 2VXEA 3A5YA 2DFUA 2QWWA 3EFOB 4BBSJ 1MUZA 1VQ6Q 1OQKA 2DQ3A 5GANj 2YPRA 4HNVA 1PD1A 2CW8A 1HF0A 4FE7A 2FD5A 1TG0A 1J2XA 1SFUA 1NHAA 1L0WA 2FSWA 2LDUA 3HOXJ 1UDLA 3M4GA 3I5SA 5GANg 3CJTB 4OIPF 2K9QA 1QPIA 1QVFA 4Z02A 4EV0A 4BGDA 1ZKGA 1F5TA 3QXEB 2E1OA 1UG2A 5D8LB 3VODA 4M7DC 1W0UA 1W4SA 2DQLA 3CCMI 4P9FA 3I5RA 1KOGA 1GCQC 2ZMEC 1Y0MA 4WXDA 4PUSA 1YCYA 1VQOT 4AIHA 2KIMA 1D1CA 1IDYA 1ON2A 5K5OA 1XTAA 3N05A 5F04A 2AQFA 2R7QA 2DAOA 2IY5A 2OJ2A 3MEYA 3ULRB 3FDYA 2LVSA 5DM6F 2XB0X 2DBBA 2PG4A 2FNAA 3HSRA 1RIOH 1ZARA 4PDKA 3AFHA 4B47A 3OD1A 1QKWA 2P0WA 1HYOA 2DVJA 1J5WA 4BY6B 2YLCA 4PJOB 3KYLA 4AFZC 2PVOB 4A3EJ 1ZUUA 1JJ2A 1G5HA 1MH4A 2A3LA 3FMSA 1TP4A 2HVRA 1ZSZB 4HCBA 2JA8J 2FG0A 2JMAA 3CLOA 1V3FA 3Q0WA 2A07F 3NENA 1BJAA 1ZG1A 5HS8A 3OYGA 2LVMA 1X1PA 4A4FA 4UUTA 3CMAI 2KLOA 1O3TA 3BTLA 2E36A 3HRIA 4EJUA 3I55Q 3U2RA 4KDPA 5D5VB 2LT4A 1R9TJ 4OF1A 2RJFA 2PN6A 4C92F 4UY8I 1PVEA 3RR6A 5BMZA 2YHTA 3F23A 2PQWA 2HOAA 4CUGA 1P7JA 1UGRB 2I10A 2M7BA 4M75C 3M0UA 5GAMe 2K40A 3A8HB 2EBPA 4J9DA 1WKMA 1TSFA 1USYC 4A4KA 3R60A 3L7WA 2ZMEB 2E6NA 1J5YA 2ZFWA 1K73C 3HXUA 3EH1A 4GLMA 4Z8AA 1X6GA 3OOPA 3JCMh 1FYMA 1VQNA 2E3HA 4NDLA 1WJSA 1K0XA 3CDIA 3MP1A 5GTIC 1H3ZA 2P5LC 2O8XA 5CQXA 1J9IA 1NJ5A 1LE8B 1YJWI 5JHUA 2L02A 1E3OC 1Y0NA 3BTCA 2ID6A 2J5PA 4HG2A 2M30A 4A63B 1RACB 3A7AA 4M7AB 2F69A 4B3AA 2DYIA 1NYGA 2DFEA 2EV6A 3KETA 2NUTA 1NPPA 1PSEA 5D4SA 4FASD 4G6QA 2EQKA 2A6TA 1K9MC 3HOSA 1TT0A 5L23A 3QUIA 3ER0A 4HX4A 1KONA 1ITYA 2F4IA 2MG4A 2V1UA 4A4HA 1RAGB 2JSPA 2E2JJ 4BQOA 2EKOA 1QKXA 5B1BH 3VOEA 1WHMA 5J40A 4F04B 3I4NJ 2P0PA 5GMKm 3IAM2 5GADJ 2LSOA 3G71Q 3CC2I 4FW1A 2X1EA 2XPUA 2KI7A 4Q47A 2F4MB 1VQ9A 4KITB 2AHJB 3LH0A 4XIDA 4NOYA 2SEMA 2RH2A 3F22A 1JU5C 4E6KG 1V5EA 5CKFA 4OU0A 2VXFA 2XF6A 4B8XA 3EGXB 3AAFA 1K8AR 4JPBW 5IAYA 4BY1J 1WFWA 2C0OA 3ECOA 2K9GA 3DQVC 1DJ7B 4GXOA 5KYXB 1R22A 4O6JA 1YITA 4M7DF 2DK8A 5EGOB 3UPUA 2CJJA 2MYSA 3Q9SA 4FTHA 2G9WA 1FSHA 4Y3OA 1XMKA 4LG3A 2RKHA 5EEAA 1QVFS 1ZQ1A 2L0AA 2GIZA 1TTYA 3FIWA 4CS2A 5A0GA 2R0QC 3DKWA 2RA2A 2YUOA 1B72A 4OMFB 2KIQA 4ZTUB 1VQ4T 4CC7A 3WTVC 3AT1B 2QG9B 4LFUA 4E51A 2C7IA 4A3BJ 3EETA 1HC8A 2R5AA 4RBOA 1LFUP 2RNJA 4J6XA 2FJ1A 3HFNA 1X19A 3SEMA 3KP5A 1MDMB 3DU5A 2XAQA 3OYMA 1WI9A 3CLQA 1V4RA 2MOXA 1VQ8I 1ZH5A 1AWOA 3O8HA 1JJ2S 3HGYA 2ZPEB 2QF7A 1USTA 2LD5A 2V9PA 3LSQA 3E19A 1VQMA 4MFDA 3E97A 4YG2F 1RAAB 5GANh 4IRGA 2QXFA 3I59A 5EF6A 2CKKA 1X2QA 4ZN1A 4LGWA 5J26A 2FX0A 1YE9A 1BW6A 2ZNJA 5J3BA 1Y1WJ 2VPRA 2A5WA 1ZN2A 2VKHA 4M75F 3FXLA 1PD0A 1BN5A 3JRHA 4DYCA 2E4HA 1HC7A 1VA7A 2ZNZA 2LY9A 4AG2C 1MBKA 2A05A 1VQOQ 3LOCA 2YLBA 2E1NA 1QF6A 2KRNA 2OAWA 3S17J 2M16A 4MDXA 4BXUA 2K7LA 1R6RA 4UVAA 2DEQA 2F5VA 5CQEA 6AT1B 2O8KA 2JUFA 1WHKA 3CMET 3HTRA 2RNGA 2QYOA 3O8VA 3BOQA 4GDFA 2X1CA 2YR2A 2KDZA 2IA2A 3BR6A 3SB2A 3KCCA 1Y39A 4OIQF 4XLHA 1WLPB 2QGFB 3JCMW 4NQWB 2DMPA 1M8VA 3ABTA 1JT6A 1X3UA 3QU3A 4RTXA 5L3GA 2MPXC 2QBYA 5LJ3f 2PMUA 4UB6C 3S3NA 5GAOn 2OI3A 3GTGJ 1CKAA 3ZOBA 1OI1A 3EG9A 4AU7A 1YWOA 3CCJI 2CS3A 2LMDA 2MK5A 4MO7A 4OB1B 3S2DJ 4ZZLA 4Y28E 2LF7A 2OAUA 3OQ5A 1Z67A 1F9NA 1Q82R 2A6HF 3DFGA 1X2NA 1M90C 3M9QA 4YTLA 1EV7A 4UC4A 2DT5A 1NG6A 3I4PA 4M78B 2RK1A 5IT9K 2N8GA 1YBYA 4BJTA 3QPSA 4JRKA 1JUMA 1MSFC 2IXSA 2MAMA 2VB6A 3DEEA 3Q3SA 2H09A 3GW2A 3IH2A 3PIPF 1Y7XA 3VWBA 2HGCA 3MAJA 2X9HA 1YJNQ 3CCRI 2QUFA 2Q8KA 3LWFA 3ZP5A 3CPWP 2FOWA 1GXQA 3RYRA 1MNDA 1R77A 4V19K 3F8MA 2VGMA 3HIFA 4BB7A 3J7YJ 2DCEA 2EJGA 2AKWA 2ELKA 5D5WB 2B8AA 4AG1C 2DZ9A 2DPPB 2VASA 2WAFA 1ZRDA 1SC7A 1SKUB 4UP7A 1GL5A 1WJCA 2LMJA 2WWYA 1ORKA 2R7RA 3KP2A 4A2UA 2ZT5A 1RUNA 2GBYA 1SD4A 1RI0A 4N9HA 3M0QA 4BDYA 5CVVA 5D4RA 4E7SA 3OSGA 5CAIA 1GXIE 3OOUA 1HBXG 1I1SA 2OZUA 4C2TA 4A4EA 4IUVA 3RQ4A 3LGFA 2ALYB 3DB3A 1ZX6A 4QVZA 4C8QE 1FWZA 1Y8QB 2QA4T 4RG8A 2XDBA 1K79A 1EVLA 1TOVA 4ITVA 2KMUA 1R36A 4XSZF 2KJBA 5FROA 2OTLT 3EG1A 4OP0A 1DQUA 3GWZA 1VQKI 3UNGC 4BDZA 4YRCA 3PFYA 1EFWA 1TQPA 3E9IA 4Z89A 3VB2A 3DCFA 3OBYA 5HY6A 1WI7A 2C6YA 1EZZB 3DPLC 3E6MA 3MZYA 5JVTA 2GXGA 2SRCA 4M4ZA 2X4JA 3IL2A 2CV2A 2LRQA 3CCQI 3KZIC 1HW2A 3F8CA 1VQ4Q 2EQRA 2TRTA 4HVWA 3HFOA 1KU7A 4HBLA 2CQQA 2OUMA 3FB9A 5CLSA 3HXLA 2E5QA 3RERA 4OMQA 2IGNA 2EVRA 5CVIA 2V1QA 4EM2A 4A69C 5IHIA 3GP8A 1FOKA 5DDGA 2R7XA 2IS6A 2LC4A 2EILH 2BY1A 4I09A 4JZ3A 1XX5A 3LWHA 4C8QD 4RGRA 3OYJA 1REPC 2DVEA 1M3BA 1PYSA 2JT1A 1G2HA 5TGTA 3PNTA 3GIBA 2P4WA 2DMNA 2PJPA 3DKMA 4PSXA 4JS4A 1PKTA 2ZNIA 4LE9A 1GLNA 1J59A 2VUBA 2HL5C 3VU3C 1L0OC 3FM3A 2L7KA 1IREB 2RQQA 2DMQA 1VFCA 4OAZA 3HOUJ 1NK2P 3HRSA 2Q0OA 2XF5A 4F7UE 2JMCA 5IXFA 3F70A 1C1AA 1Q81R 2RF0A 3K70D 4BD3A 3HEFA 2KDSA 3OL4A 3PUBA 3OW2A 1P4WA 2X4XA 2V9VA 3LNQA 3OYYA 4E70A 3K4LA 3RYPA 4BKXA 1M27C 4Y7NJ 1DGRM 2JS2A 4J83A 4LMYA 2MWOA 4J6WA 4XEOA 2BIVA 1TWGJ 1YW8A 2EFOA 2LBFB 2MF2A 4C0DB 2ZAEA 1K7AA 4YCWA 1N25A 2DTRA 3TSWA 4A4GA 2DTHA 4RB1A 1ODDA 4L18B 3RKXA 2NUTB 5GPCA 1VQ7T 3WXMB 1Z7UA 3BROA 1K4US 2DX1A 1OPCA 1BIBA 4XTZA 5GAMd 4UB8C 1IV8A 2JRTA 5FU6B 2DIQA 2HI3A 5M3MJ 1D1AA 2NRAC 3H0GJ 5LJ5j 3D5RC 3LQQA 3O2PE 2IA0A 4RM3A 1VQPT 4EIKA 1UTIA 1XPXA 3JB9J 1JJ6C 1X2HA 2YX4A 5HOOA 1TTHB 2XKPA 3G6EA 3ZQFA 3I56Q 3JCUC 2AXTC 3NWSA 4J9HA 1FNNA 5CPRB 4XKBA 3BR0A 2CO5A 4RTTA 5LJ5g 1FMKA 3VUZA 3WTYC 1EIYB 2P4TA 1TUDA 4RA2A 3CMAA 2GFUA 4M75G 1BU1A 4JJBA 1QU3A 3UFGA 1X2MA 5IOYA 1YI2I 3JCMP 1LJ9A 1I39A 3WE3A 3CCUI 4I2OA 3L4GB 4U0YA 1R1TA 2K9SA 2E64A 3SDBA 3R4KA 3JAMZ 1Q1HA 2OC6A 1Z0XA 5I2MA 1XC5A 1NJIC 1FOXA 5DD4A 4ETSA 3BE3A 3CCLT 3JSPA 2BHYA 3E0JB 2W84A 2XPVA 4QPQA 4RTWA 1QVGP 2L3DA 4KIFA 4B09A 3REXA 1OYXA 1UHFA 2DRMA 2DXIA 3VS3A 3KYDB 2V6CA 2CP2A 1YJ9T 1S3JA 4XKWA 4B3XA 1E7OA 3QPHA 1YJWA 3BZKA 2VQLA 4UP8A 3FHZA 4AIKA 2XHKA 5DLOA 1E3PA 2GBQA 4OOIA 2BEOA 3PGGA 4YCUA 3CDHA 4G7OF 2BOLA 1PUFA 2CV0A 3CC4I 1MD0A 2HVSA 1DPRA 3E1SA 5CKDA 4W1UA 1G3TA 1PKSA 1FSEA 4EJVA 1OPKA 1GHCA 4RB0A 4Y33A 2NS8A 1HA8A 4XK4A 2OTLQ 4ZTFA 3S3MA 5J39A 3REOA 2J3LA 1WRJA 1RL2A 2L9VA 2KRFA 2FPFA 4P3NA 3E9FA 2L4MA 2OCEA 2FQ3A 4IUPA 3CC2A 3JCMc 1WA7A 2QASA 1YRNB 3CBMA 5ICEA 4RCCA 3SZTA 4NHJA 4NC8A 2DL5A 4GBQA 4J9CA 5EG0B 1A5JA 1GV5A 1W5CC 2DOAA 2B63J 4XU2A 1U2WA 3RL6A 3RKYA 1ATIA 1OV3A 2C8MA 5DCFA 1R7JA 3K4JA 3WVDB 3CCEI 5CQGA 1G3YA 2EIMH 4ESBA 2FZGB 5GJVB 3UH0A 2L4AA 1SFXA 2D45A 5L3CA 4BYYA 1ZA2B 1VQLI 1G83A 1N9WA 2XROA 3G4SI 1P4XA 1K8AU 1IGQA 2FBKA 1A36A 4C0GA 3OW2S 4YDQA 2DJIA 1O4XA 3D0SA 3G73A 3I64A 2VWFA 1H4QA 2CMPA 2Y0MA 2CSQA 3BJOA 1X6OA 3QZ9B 2YRVA 2M4KA 3CMEA 2HDDA 3DWLE 3QKJA 1R8OB 3M0SA 4Q48A 4YRGA 4U88A 4BU2A 4RAFA 2WB1N 5KCOA 1K76A 2VBYA 4XTWA 2AMCA 3B02A 4RMNA 2PVGB 3HJEA 3C94A 1EFNA 3QP6A 2BE9B 3MEVA 4KQEA 1X3WB 4II3A 1JQQA 5C51B 1QQIA 1IXRC 2L3PA 1ZG5A 3BJAA 1OYIA 4H02A 1MMAA 4JJCA 1TT5B 3PIOF 3BCBA 5FKNA 3TW7A 2F4OB 2HPMA 1VQ8A 1VQ5T 2M0MA 1ON1A 3WU2C 3X2QH 4LVIA 2ZJQF 4LLGF 3OIOA 3B6AA 3PQJA 3S2HJ 2D6FA 3DBHB 4C5IA 2RQRA 1YIOA 1TLHB 5IT3A 4ENNA 5D6EA 4Y91A 1D3YA 2DA1A 4LDWA 3PSIA 3E2UA 3EHRA 4GCVA 4F14A 1R49A 2LYCA 1TQIA 2K9MA 2ZCFB 1CGPA 5GAOq 1T3LA 4AFSC 3M8FA 1XQHA 3J80Z 4A3IJ 2JA7J 4BH9A 3QODA 4UV9A 3Q0VA 1VQ7Q 2WTEA 1F36A 2ZPFB 2B7EA 4RTUA 1QLYA 1WSUA 3CCVT 3RZOJ 4AIJA 1HSJA 5FKMA 3FXKA 1C6VX 1OU8A 1OX8A 2RHZA 4MZTA 2QQSA 3J7AO 2JRMA 1KFZA 2JK3A 3INZA 4D7NA 1OCRH 2FEZA 1WZOA 5LJ5h 1EKEA 3KP4A 1YX5A 2AO9A 4EGZA 3OWTA 5AIQA 4XBFA 3GXOA 2XSJC 3KEOA 4HVCA 2J6OA 3ZMSA 3WHBA 4M7AF 4YFKF 2O03A 1B7YB 2P5VA 3E6DA 5KAIC 3I7FA 2HS5A 5E3OA 4II2A 4XSXF 3CCJA 3AKZA 3PNYA 4EO4A 1Z9CA 3OSSC 2LX7A 5EZHA 1X1BA 4H2XB 2O9LA 3HTUA 5J1YA 2NXNB 3R61A 1KHIA 4CYCB 2QA4A 3A1YA 4ESJA 3RPUD 1K0SA 4RM2A 1WQ7A 3M9AA 3CCLQ 2Y30A 1E24A 1JEGA 2BZYA 2CUFA 1QA6A 2CH4W 5H20A 1GT0C 2XGXA 1Q7YU 1CSKA 2ADUA 2LTOA 3WGGA 1WH7A 1WCMJ 2I8DA 1GGMA 1Q82U 3MVPA 3K1MA 1YJ9Q 5CR2A 2R7UA 1V1CA 1IXSB 1O57A 1PDNC 1D8KA 4CRIA 3CCRA 2HQNA 3FKJA 2GTJA 3OMYA 3GNFB 3FJ5A 1Y0UA 1W7PD 1NYQA 4KUMA 2LJ0A 3JRDA 1J0RA 1DU6A 3HFZA 1BOBA 3IV5A 2B9SA 1IDZA 1O3RA 4XLEA 5J1UA 4YELA 4YRTA 5L3EA 1M9SA 4FISA 5M3FJ 1PYSB 1TW3A 3GFJA 1VNDA 5I22A 3LSHA 5IY5H 4NL3A 4YRFA 4I01A 4CCNA 5KAFC 1F1ZA 1ZUKA 5BPIA 2ZXWH 2JJ7A 5IP7J 1YS6A 3KUFA 3ZPLA 1KZHA 1LQ1A 5FW9A 2E10A 1QVUA 3HY0A 3TO9A 1LB2A 1Z6RA 4HLYA 3DTIA 2GQIA 5J8FA 1KD1R 1J7KA 1LDKB 2F1LA 1Y1VJ 4CSWA 2ZJRF 4MEXF 1G6NA 5CKHA 4B9XA 4M3GA 1OCOH 2VBWA 2K57A 3GLXA 4C8QB 5GAN7 4KH1B 2ZBKA 3HYIA 1MH3A 4H2YA 4XR6A 3U1KA 1UMQA 2QI2A 3C0CA 3CXCP 1SFEA 2PMZN 2WB1A 3EUHA 5GAOp 3UATA 1LUJB 4AT1B 2KDOA 2YUSA 2HEOA 3H5RA 1FPQA 1GFCA 5KK1A 1X3ZB 3UA6A 4S04A 3MMYB 1XDSA 4NB5A 3L2CA 4K2EA 4EDUA 2XICA 3Q9VA 3A2KA 3CCMQ 5FWCA 4GFBA 2QTVA 2A68F 5LGUA 3E5XA 1YHQI 5IH2A 3CCQA 1W36C 2XAJA 2W10A 2CUDA 2DJZA 1LDDA 1FC3A 2A28A 5LJ3g 1X56A 3I58A 4CC2A 5LEKA 4JBAA 3RESA 2DT6A 4BI3A 4JYKA 3UA7A 1Y57A 2EIFA 4BWAA 1W4MA 2D5VA 1YW7A 1D0ZA 4PLLA 3H92A 1IG7A 1NNHA 2HQ5A 2OTJT 4TQFA 3DPUA 1YQAA 1IN4A 3I5UA 5M5YJ 4A3CJ 3JW4A 3TOAA 2EIKH 4CC3A 1VQ5Q 2XDDA 2DFHA 2YWWA 4K87A 1ETVA 2P0KA 3CCST 1DPUA 1VQPA 3TO7A 2EA4A 4JRQA 1MBEA 3FK6A 2Y4XA 4BS9A 5FRNA 4YYEA 3R6OA 1TXQA 3TEDA 3GUDA 2QGGA 4X34A 5EC7A 1B07A 4CO8A 5IYCJ 3TEGA 2F5KA 4FE4A 2GFAA 3MKWB 3LWIA 4CH7A 3M0TA 3LLRA 3IWZA 2ZC2A 1K4TA 2H8WA 4AWXB 1WZ2A 3B6CA 4Y4RA 4A5MA 1BCMA 4ASNA 2CQ7A 2HQEA 3GFLA 4F7UB 4A3JJ 3DBLB 2KRCA 2NS0A 4IKFA 3GTOJ 1MJBA 5HLTA 4OMYA 4XLPF 5GAN2 4LLLA 2VKEA 3M7GA 3G1JA 4HV6A 1PJRA 3HB9A 2DK3A 3CCVQ 4N4IA 3MCZA 3QDFA 4N9IA 3H3UA 3AG4H 1Q81U 4EMKB 4XK8E 5TRDA 3KFWX 4XLAA 4ON0A 4KRTA 4A6EA 5FFZA 2K3BA 3RTRA 1TWBA 1OZ3A 2KSSA 4OLFA 3LL7A 3F21A 2DT7B 2GQQA 4I0AA 2CYZB 3QO8A 1AWXA 2CP6A 5D5XB 4KGVB 4D7MA 4CGZA 4LDUA 2LFBA 2LP0A 3LA7A 1I6XA 5ICCA 4D5FA 1PCXA 2KT0A 2F2VA 2LCCA 2DL7A 2GGRA 1YB3A 3A0HC 3S32A 1M1KU 1BBWA 1Z1DA 1LVKA 2O6GE 2A6EF 5L3FA 3A5ZB 3HG9A 2QTXA 1QVGA 3T8TA 2LCLA 2AZSA 3NTIA 2PEXA 3U23A 4C2MJ 2ZT8A 4PJLA 1SPKA 4PJOE 2CFXA 3LSKA 4YCVA 2R4GA 1MMSA 4IHXA 1Z6TA 1I4K1 3QNEA 5LGTA 2LQWA 4X6AJ 1HJDA 3LH5A 2CUEA 2VODA 1C0WA 11ASA 3ZFJA 1GRIA 1QO0D 2JQ7A 2RD1A 1S72T 3J7ZI 4FL6A 3JCMd 2LRDA 1QVFP 3EUKL 2ATCB 3W2WA 2NOJB 2BY2A 4MDWA 1P92A 2KZGA 3F0CA 3CCUA 4JX6A 4HX8A 2CU7A 5HLIA 1U1SA 4CS4A 1PC0A 2DOEA 1ERDA 2AKLA 1LEBA 3OMCA 4E7ZA 3WTTC 4XLNF 3MEUA 1LEAA 1SMTA 4F17A 5GAEJ 4ELZC 4IUQA 4WXHA 5LHGA 1AOJA 1BI1A 2XGTA 1AKHA 4YRPA 2R5YA 4C92A 2R5ZA 3UDCA 2CZ0B 2AMCB 3BR1A 2DERA 2VQHA 1VQNI 3HRKA 1SVLA 2JZYA 1RUWA 4B44A 1JJ2P 2CT4A 3LSPA 3J7AY 5F0HA 2VJIA 3UR3C 4LG0A 3NETA 5D6XA 3DF8A 4K86A 5CKTA 3R0AA 1MBGA 4RTYA 2QHVA 2ECBA 3CMQA 2ZPBB 1QVPA 5GMKi 3VS0A 3AG1H 4L9NA 5M9OA 2X3WD 5F5WA 4FT8A 5ILUA 1WJFA 3CC4A 3BY6A 1VUBA 2DNUA 1SMYF 1H9TA 4YP0A 3LAJA 3F6OA 4IHVA 3BDLA 2RJDA 2HXIA 3VRYA 2EINH 4XQ3A 4LUDA 5ERIA 2DZCA 2L3QA 3P5JA 1TWFJ 1UECA 1UHSA 1QP2A 1JUSA 3A98A 4MQ9F 1K73R 4U87A 3WTSC 2PJRA 1B9NA 2GM4A 4ZIBA 2JN0A 4P71A 1AOYA 3GCMA 4O5VA 2EYYA 2DJQA 4M7DD 3AG3H 3SQNA 3CD6T 2KXCA 3JCMV 4KULA 3OA6A 3VFZA 3HRMA 4XQFA 4M75E 3RJPA 2W1OA 1N77A 2WADA 1U3EM 3HXXA 2ZIOA 3H9NA 3MN2A 4TQDA 2E35A 1F4KA 4XRMA 1T0HA 5LJ3h 1VQ6I 4MGRA 1CQTA 2RDPA 2YRCA 1K1ZA 4EGYA 4HPQA 1BI2A 1YITI 1K9MR 1XTDA 2PI0A 1WFXA 3J81Z 3VYGA 4YRKA 3QQAA 3JB9F 3KFUA 3VYRB 1Z7NA 5KVRA 5DEQA 4BHBA 2OTJQ 2H3JA 1WXUA 3M59A 3REBB 2A7YA 2KRMA 1A6IA 4M7DA 1H89C 1YWPA 2CUJA 3OYNA 1EVKA 2EZKA 2BVMA 3ULQB 4LITA 3CCSQ 2EFWA 3ZCOA 3L00A 4CZZA 5GANd 2DTIA 4DZPA 2XF7A 4RGUA 2RC4A 3BJ6A 3CC7T 5K7FA 2R57A 2K27A 2MH9A 2QSFX 3BFMA 4HSRA 2W57A 2FO0A 2DBMA 2WV1A 4RAGA 2I2LA 3H0FA 3PTAA 2GWRA 2ZXFA 2VXDA 3CCJQ 1H641 5JLXA 1QVGS 2C0TA 5HNFA 4TVAA 2L8DA 1QW1A 5IOZA 4M75D 1E1TA 1H4SA 1TW2A 3DLLA 3ZQQA 1XSXA 2BYVE 1W5SA 3EUHC 1RRJA 3I35A 1I50J 2NUPA 1WJDA 1SESA 1BR1A 5DM7F 1IN5A 2H6CA 3IHUA 5LRSA 4V2SA 2FB7A 3A32A 4NC6A 3RACA 2XGEA 1HXDA 3PO3J 1Z77A 2VXZA 1FMWA 2ZXJA 1ONVA 1ZELA 2X4WA 4Z88A 4G85A 4F55A 2Q7HA 4RUGA 3OYKA 5FJ8J 1XJWB 1USYA 4CCLA 3IAS2 2X4YA 2XV4S 1EJ9A 2HDWA 3MQZA 2VIXA 3PFSA 4BEHA 4ZTZB 4BQAA 3WTUC 4KIGA 1MBHA 2LR8A 2VONA 3BDUA 2CZ7B 1D09B 4E7LA 1YFTA 4OINF 2ED1A 1JE8A 1BM9A 2E19A 4XAXB 3HY1A 3S1MJ 4EVIA 1QWEA 2DI3A 3JRGA 1W7PB 2NVQJ 2EQJA 3E9HA 2DPUA 4EEFG 5FB2A 1YO5C 4XN0A 1S72Q 3J7AF 1E17A 2CW7A 1FP2A 2EK5A 1B34A 2P6TA 3M4PA 3V8JA 1ZK8A 2BY0A 3PUFA 3NTKA 1QHHD 4KR2A 3BG3A 5C4XJ 4RLQA 1XG1A 2LNHB 3D5LA 3EH2A 4YRRA 2NOGA 2ARSA 4YRQA 2QGUA 1VQKQ 3QAHA 3O8GA 3BC8A 3A1PA 3R0JA 1D8JA 3PL8A 2PFBA 2K9LA 4V2FA 5BS6A 4CA0A 1I0CA 3KP3A 2NUZA 5FWBA 4B9WA 1QHGA 1UJ8A 2EJRA 4M78E 1SG5A 2FRHA 2NNYA 1WYXA 1FX7A 4B6MA 3G71I 3VS5A 5ELOA 1P4AA 4E7HA 2HQRA 4HT8A 4YRNA 3LGLA 5BOXA 1WI3A 3K10A 4PFZA 5D6YA 4MQVA 3C2GA 3PVQA 1VQLT 1W5TA 3G4ST 4BE2A 5FLMJ 1D0XA 1FT9A 4BY7J 2J3MA 1U6GA 4JQFA 4OMLA 2ETHA 2DXUA 2E5NA 2JSCA 2EYZA 1WJAA 4I6ZA 1IN6A 4DA4A 1Q7YC 3JRAA 2Z2SB 2AIRB 2LK2A 2ZT7A 1SANA 1KJWA 3PQKA 3DP7A 3GFMA 1G5VA 9ATCB 1M90R 3QSUA 2MC3A 1B9MA 4YRIA 2P7VB 3KIOA 3GVAA 1Y96B 2MW8A 4RLFA 1LCKA 2I4NA 5HDNA 4HT9A 4HDUA 5KCHA 2Z16A 1JJCB 1SSFA 2OV7A 4C5EA 1DUXC 2R7DA 2HVQA 1MSEC 4LUEA 1X58A 1PRMC 2VLAA 3FM5A 4YRSA 4DOWA 1SEMA 4A0XA 2UZKA 3FF5A 1RLPC 3JTGA 3DKXA 4MMLA 3H9GA 4OMNA 2RGVA 2E2HJ 4ZJZA 3OYCA 2PNIA 1NE8A 4RQEA 4HWPA 3HL8A 4R8HA 2HYJA 3RMQA 1JBMA 1MIJA 1I07A 5GAMj 2ABLA 1NJ8A 1FTZA 4HOBA 4LIUA 3DV8A 5J4YA 5HDGA 3QTCA 3JCMQ 4DEXA 3C3WA 4D5CA 2BKDN 4C92C 2M02A 2K9NA 5GAOm 2JJ9A 2OA4A 1KYWA 3SWNA 2QKLB 5GAMg 3VPRA 2V7FA 2QEXT 5GMKl 2DJNA 2W00A 5GAN4 2AK5A 4WCGA 1N27A 3TQ7P 3LMMA 3CC7Q 2GXAA 2JVGA 2A36A 3P8YA 3SFMA 1VQOI 4KUIA 1ABQA 4KT6A 3TQNA 1RABB 2C0IA 4II1A 2ODRD 5HODA 3AL0B 4A3DJ 2ESWA 1UEBA 3M4QA 3JCMJ 1R5GA 4KT5C 2F5TX 3W3SA 4EMSA 2I4MA 4IOAF 3PT9A 2AXLA 4DIQA 2M7AA 5HLHA 3TEEA 4LVLA 3BDDA 2KRSA 3S6WA 3TP0A 2VOPA 3KZZA 1UGPB 3H0DA 1B1BA 3PMTA 1JB0E 4YROA 1ZAOA 2KK4A 1YI2Q 2E1MC 3HOWJ 4CH5A 5LRRA 1IXDA 5AONA 3IG2A 1N9RA 5GAN3 3C95A 2DTZA 4BJ5C 2FVUA 1O3SA 2CDTA 4LDXA 2H8HA 4M77A 2P5IA 1XMXA 1M1FA 5CIUA 1LNWA 4FYVB 4YPFA 1X43A 2R5YB 2R5ZB 1OMIA 2VJ5A 1VIFA 3D5SC 2Q2EB 2V1XA 4IQ4A 2W24A 4NNJA 3TO6A 1AWCA 1Z3XA 3HHGA 1ZR2A 3O3KA 3MHXA 1MBFA 2EA2A 1X27A 1SVOA 4FHTA 3CP2A 4BHCA 4LG0B 1UZCA 1YIJT 4Y15A 3A4CA 3CEYA 2GOXB 5IPAA 1A6QA 1NJ6A 3A74A 2LT1A 4G94A 3I9QA 5LD2C 4OWRB 3ZN0A 2X6WA 3CXCS 4OMOA 2KYMA 4AH6A 1RI9A 3FISA 3QYBA 3A02A 2MH2A 3M3YJ 4OB0B 4KN4X 2R7SA 4PJNA 1PSFA 5K1PA 1N8RU 2L2OA 1R00A 2OQGA 2EFNA 4IQJA 3QWYA 4ATOA 3I53A 5K1XA 3ICAA 2ZO4A 2PJRB 1H9GA 2EYQA 4H2TA 1IHWA 2XB5A 2KNBB 3Q5FA 2CH4A 4I02A 3G6EI 4MTDA 2LOOA 4N4HA 1IN8A 3H5AA 2JVHA 4PGHA 1UHCA 2RI5A 2CZ6B 2CP3A 2EGCA 4O2DA 2EGAA 3JCMX 1AEYA 4OGEA 3FIFA 1KGSA 1BBZA 2FEIA 2A37A 3OW2P 2M9HA 2L01A 2KQWA 3HGGA 3MKYB 1I8FA 2RQTA 1M1KC 5IT9Z 1K78A 1B70A 4A3GJ 3CD6A 2OD5A 1TWCJ 3BPXA 3VSLA 3CCEQ 1ZHIA 5GJWB 1ARKA 2IPOB 4IZZA 5GTHC 1HD3A 3A7RA 4PK4A 3HZJA 2L0KA 2IEKA 1VQLQ 2O5RA 5FLXZ 3G4SQ 2LTPA 2WSCE 3H3VK 4YIRX 2E71A 4M7DB 2WY7Q 2E1HA 3ZMTA 1Q1VA 2QSGX 5E8GA 2V8KA 3SZGA 1V29B 4XN3A 1YHQT 5BNGA 3FJPA 1YFSA 3H0HA 5I21A 4AYBN 2Y48A 3SEQA 3WG9A 2FU4A 1U5TA 4DW6A 2O61A 2Y9YA 2A0FB 3F9KA 2UXXA 4NC7A 3DLMA 4V2GA 3BR3A 2DDZA 4HW0A 4Y13A 1YJNT 2NAZA 1RNLA 2VC0A 8AT1B 2CGHA 1SAUA 2QQ9A 2KMTA 2ME6A 1QMCA 3QYHB 1Y71A 5LLQA 3QG1A 2RHUA 5EZGA 5DUIA 3C12A 2Y0SA 4BACA 1ZBXA 2STWA 3QBYA 1MGQA 3KEQA 1NJIR 1Z91A 3EGDB 1AHJB 3PMIA 1X1DA 2AZVA 3PCOA 2LJ3A 3COAC 4G8XA 2X4HA 1YN8A 2GZWA 4A3LJ 1W66A 4MHGA 3UT1A 1RADB 1HW1A 2CIMA 2OJED 3OYLA 2XAUA 4K11A 2V1NA 3BZ6A 2ZJ2A 1T56A 4J9BA 3SYTA 2EFIA 4JK1X 2X85A 2HWVA 1K73U 1JI8A 2KVQG 4M75B 3P8BB 4HWSA 3GZ5A 1OKRA 2QEXQ 5D8KB 1B6AA 2XAGA 1BC8C 1JXMA 3OYDA 2G7HA 1IRGA 5E1XA 2MIOA 1B4AA 1MNMC 1VQ6A 3L2UA 2DBKA 5HS9A 4H2UA 2QLZA 2HDCA 4YIIA 5DCMB 1BA5A 3ME9A 2M34A 2HKXA 3QP5A 4LJZF 1YYVA 3NPFA 2IJLA 4FSXA 2EJ9A 5DLQE 4OB3B 1HK9A 5HLGA 1WHHA 3CMEI 2F2WA 3M53A 1SF9A 4PZJA 3JB9I 3FWEA 2ZT6A 2GOMA 3GTKJ 4PGGA 1WDXA 1Q95G 4CZCA 1FMVA 3M1EA 2ZPGB 1M3AA 2ELJA 3HSFA 4L5EA 1KQ0A 4P75C 2L9RA 3QYGB 3UF4A 4XRFA 2RQUA 1FJLA 4UV8A 3DLLF 3A8GB 4EMHA 1RLQC 5H2FC 3EYIA 3NHNA 4FU6A 2EGEA 2P81A 1OX9A 3OL3A 3LFKA 3WHCA 4M72A 4YRVA 1YFRA 4I76A 4UVBA 2P0QA 4EPCA 2KT8A 2Q7EA 3HTZA 3L1PA 3PIOA 4F7ZA 3HM5A 4JOMA 4J19A 5A2QE 2GQVA 3A7UA 2JW4A 2H6BA 1R23A 2W48A 4PJOA 4BXFA 5E3IA 3WVEB 1FOWA 1WH5A 1YIJQ 1ZSZA 2BHZA 3BT9A 1W0TA 4ENMA 1OZ2A 4S0HB 3CQTA 2P5KA 3SWNC 1RAEB 2D1VA 2COMA 1GVDA 1Z05A 5LJ5d 3I55A 5ELNA 4HNTA 1EQRA 2YX7A 1R5ID 4LK0F 3SHWA 2K4YA 1QCNA 3BR5A 2YXYA 3RSNA 3I4MJ 2X48A 1OJLA 3BJUA 1S9HA 1B76A 1USSA 4UVCA 5FU7C 1VQNT 4M7AD 3TDZC 2WAQN 4ZYEA 2M4GA 4PKCC 2BE7D 2EL9A 4ZYDA 1KQ1A 3IRQA 3EHQA 3M07A 3JTHA 1B59A 1TS9A 3I3LA 2RQVA 3RIRA 4LNPA 2HQHA 2VT2A 3T5XA 2ICWG 4J5YA 3BTJA 3T1BA 2ZR2A 2QDYB 3TEHA 4PG3A 3SXYA 1K83J 3B73A 4B4CA 4AD9A 1UCRA 1BK2A 3BWGA 1TZLA 2CUZA 2KY9A 1ZUYA 3TU4K 4XLCA 3EYYA 2CG4A 3H8ZA 4GY5A 2LX9A 3CUOA 1JTXA 2ZSHB 1NG7A 2MWPA 2F6CA 4M77C 2ZSIB 3NQOA 3RUXA 1XGMA 5C44J 3LSTA 5JHFA 3KP7A 3PJRA 1R4NB 3PVLA 2KROA 4M7AA 2ODRC 3I56T 5KCMA 4KN7X 4JS5A 2VT3A 2QA4I 2E65A 1QZYA 2PUOB 1N78A 1OCCH 3BTIA 2X51A 1ZLKA 2OTLI 1VQ9T 1LPQA 1BBUA 1O9SA 4I0BA 1QP3A 3ASNH 1S7OA 3RF1A 4L6V5 1YHQQ 3V8KA 4HCZA 8ATCB 3G71A 2IAIA 3HKSA 4IRHA 3LX7A 1W1WE 3HUGA 5D7UA 2VVKA 2BZ8A 5F08A 5CVUA 3X28B 5FLXK 2FA5A 4Z6YA 2TDXA 1IL2A 1NBEB 2NYXA 1IZ6A 1UHWA 2LG4A 2XDPA 1I27A 4HAMA 5FKKA 3P9KA 1HKSA 1ACIA 1Q86C 1H88C 3NGPA 2CH0A 2EBIA 1T08B 3CO6C 4R56A 4EM1A 5KYXA 1HKQA 1M3CA 5EGOA 5C6SA 4E7KA 2EV5A 3S3OA 1LOJA 3VSKA 3S16J 3LSIA 1M1GA 2DEUA 1MMNA 2F5CA 5LBQA 1X4PA 4DPGA 2Z5UA 1ABOA 5FD6A 2RREA 2Y90A 1MW7A 1JTYA 4Y92A 1V5FA 1T95A 4C3HJ 3CJNA 5DTDA 3RKWA 2R92J 4IIMA 5FFXA 1RKWA 2M51A 2L3SA 2X6OA 4H2WA 5CO7A 1PM3A 4C92G 2M8GX 3OYBA 1PRLC 4C0ZA 1XCVA 5FD5A 1T0FA 2XKOA 3GTQJ 1UFMA 1VQMT 5KHDA 1ZLJA 1U9NA 2EQMA 4TWAA 2E3IA 1ULYA 1MDMA 1XN7A 4H0EA 4RTZA 2WV0A 1U78A 2KGTA 2CV1A 2RN7A 3THKA 1WIEA 1KQSP 1GV2A 2CP5A 4WK8F 2DF6A 2X1DA 2EPDA 1OR7C 3GPLA 3A01A 2IY5B 3L2RA 3ABKH 2HNIA 1F1BB 5IP9J 5GMKe 4H2VA 1U5TC 2UXNA 4D8KA 3CUQC 2MFZA 4H4KC 3DXJF 4TVRA 2XPWA 3W2AA 1FYKA 1JGSA 2FZKB 2JMWA 2O31A 2XTIA 1P9QC 3X24B 2E41A 1VQOA 3OYFA 1JHFA 1VQ7I 2CUBA 3QU6A 5IHKA 3OS5A 2BV6A 3RQIA 2HSEB 2E5AA 1IZ1A 4KR3A 2DU7A 2ELHA 4LVKA 4NL2A 1KC8C 4CXFA 3VRZA 2DYRH 4MLOA 1VQPI 2V6EA 5AYFA 2CSIA 2O9SA 3ZQLA 3HXWA 4DGWB 2LJ1A 4MTEA 5L3BA 1EH8A 4M77F 5CCAA 3KP6A 2VUMJ 4ZDOA 3H1CA 2ACJA 4IHSA 3E5QA 1E6GA 1STZA 2FF4A 5IXBA 1IRXA 4UUSA 1DDNA 3FX3A 3CP8A 4G12A 4CH3A 3R07A 2FE3A 2V8IA 3FRNA 1IF1A 2CP7A 3HKZN 2CJ9A 1QPMA 3TGNA 4WJ3M 2LKPA 4M7DG 1Z9ZA 2XG8D 3HL2A 1TH7A 3HOYJ 4MMKA 5J4VA 3LQRA 2HL3A 3FXQA 4IXAA 2QQAA 4PLIA 4JJNK 1JXOA 5EDNA 2WSFE 4AUXA 2Q5HA 4RDXA 2G7UA 2GLOA 3PZCA 4BL0B 1P7IA 2ECCA 2JVVA 2KISA 3QYFA 1VQNQ 5K1YA 2IP2A 2LF8A 4AFUC 3H5NA 3CCLI 3P8DA 1P2FA 2DN0A 3IWFA 4GYGA 2HD0A 1MBJA 1ZA1B 4IRIA 1WYDA 2LCSA 2EPFA 4I99C 2R7FA 3CMMA 2HSPA 1M8MA 4XORA 2DL4A 3GF5A 3M8EA 2FL7A 1CKBA 1OISA 1X6BA 1W2BP 2VE9A 2F2EA 1YJ9I 4CYDA 2FPDA 2J05A 1YJNA 1QE0A 2RAEA 2VQGA 3MKDA 3PCOB 1NM7A 4DYRA 5DD8A 2JM9A 4L0YB 5HK3A 3N5BB 3CMYA 4WXCA 1JKQC 1BIAA 3ONQA 1SD7A 3A8LB 1DP3A 5M5WJ 2KE9A 2LP5A 3HHHA 4TV7A 4A0YA 3BG9A 2DDBA 5A0LA 1VYVA 1IXCA 2HBPA 3GBQA 1WPYA 4P55A 2QENA 1RR8C 4KISA 4IO9F 1AT1B 1M2OA 4CCOA 4RAZA 3K1PA 1VQ9Q 1K4SA 4BY6C 5E1ZB 3PNWC 4PJOC 1N8RC 3ELKA 1D3BA 1W36D 4BE0A 1ZTRA 3RZDJ 1ZSZC 2V4JC 5ICFA 1HSQA 2FPEA 3S1QJ 4EQQA 3ZL7C 3DSQA 4RTVA 1SD5A 4HQMA 4U7BA 1VYTA 4M3EA 1YITQ 1WXBA 4EJOA 4HCKA 4GGGA 4X0GA 3C2BA 5HGQA 2FOKA 1B3QA 1YTYA 2ALYA 3NMZC 2VOOA 4KIBA 1ZR4A 3O6BB 2DTOA 1MJAA 3ZRGA 3C1DA 5DY9A 1B72B 1G4DA 4OIRF 1KQ8A 4AIDA 2HMAA 4OGCA 1PP7U 2I4LA 2O01E 2PX9A 3P8HA 3K2ZA 3UWNA 3ZR8X 4E6RA 4YRJA 5L3DA 3G2BA 4R0KA 5A2QZ 2KIFA 1C0AA 4E2FB 1JKRC 3QDRB 3DTEA 1UGSB 1DU0A 2IVMA 5M5XJ 1FXXA 3A8MB 12ASA 2HAXA 1G5IA 4ORZA 3JCMe 7AT1B 1VQ4A 3MF1A 3HPHA 1KQ2A 5DM7R