3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
2XRNA 4LLGF 4ENJA 2ZGWA 5CVUA 5GMKi 4I09A 1Y96A 4PGGA 1SMYF 1HSJA 5GANe 2ZT7A 1WPYA 4UNOA 1UCRA 2EWNA 2EV5A 5DUKA 4MMKA 4YRNA 1E22A 5GAMj 3I64A 4EM2A 2MA3A 5E18F 3GLXA 1TW3A 4HF1A 3WU1B 4RGSA 4IRGA 1BIAA 2C8MA 4B8XA 3VFZA 2ZIMA 3TDZC 4G7OF 1EH7A 3FMSA 1PP8F 2ZT5A 4RS8A 5J6XA 5ICGA 5FD5A 2JRTA 1EVLA 5E8GA 2ZXFA 4LLLA 2A61A 2H94A 3L09A 4XBFA 2FA5A 3BDUA 1R23A 1G3TA 3E6MA 1B70A 1W4MA 3I0TA 4U88A 2HEOA 2ESNA 1ZLJA 4Q5SF 4HT8A 5LJ5h 2XVCA 2LNBA 5K5QA 3CO6C 4G7ZF 3O6BB 2O6GE 3I71A 1USSA 1K79A 4EV0A 3J81Z 4CZZA 4YRTA 5L3EA 3HHHA 4F7UA 3TO6A 3RESA 1Y96B 2QQ9A 2P5VA 3JCMP 3BWGA 5K1YA 1RI7A 4TQDA 3NELA 1J59A 2MBFA 1I8FA 1LNWA 4R8HA 4B09A 2Y0MA 2OQRA 4C92F 3ZMTA 5GMKl 1MGTA 2NRAC 3RUXA 3A5YA 1Q1HA 4A0YA 2DK5A 2V6CA 2VXZA 3ISPA 4EVIA 3ICAA 1HKSA 4PG3A 4GXOA 3KCCA 5LJ3g 1H641 3VQXA 3JCMd 3PQKA 5HLIA 4YFKF 1G6NA 1YW8A 2XGTA 2ZXJA 4UXNA 4KMUX 3IL2A 5LJ3f 1XGNA 1ZRCA 1FLIA 5H6RA 1Z05A 1H0MA 2ZNYA 5EEGA 3BPXA 3HFOA 5TRDA 4P73C 4UUVA 1I5LA 4A53A 2ZR2A 4BHCA 3BPVA 1LNXA 1WRJA 4KN7X 4KYWA 3TEGA 4C92E 2IJLA 2OZUA 4AIHA 5BQTA 4M9XA 2PJPA 5ED4A 3HFZA 2JT1A 2R7FA 5GAMd 2VXFA 4M75C 4F7UB 1ZN2A 4A0ZA 1J5WA 3HSEA 4P3OA 4TTVA 4EJWA 5IT3A 2QHUA 4NCXA 2RN7A 3VB2A 4TQFA 3REXA 3J81K 3NRVA 1K7AA 4P73A 5K1XA 1QGPA 2EK5A 5ILUA 4L5JA 4YFNF 5BS6A 3JCMW 2DQ0A 2I4MA 2ALYA 2ZT6A 3ERED 2VC8A 4CH6A 3WTZA 5JI6A 2YLBA 1IUYA 2A07F 1R5GA 3BJAA 2NYXA 3TEHA 1X56A 5JR3A 3N4MA 5DY9A 2ESHA 5LHGA 1P92A 2GXBA 2Z3YA 5GANg 4PDKA 5D8LB 2IRFG 4M75A 3MQ0A 1XGSA 3MWMA 1M8VA 3QO5A 3DPLC 2RGVA 3GFLA 1X2HA 3HXWA 1R36A 3HRSA 5GANf 1T2KA 4HA8A 1J75A 3QOPA 2H6CA 3Q9SA 2QBYA 4RGUA 5AIPA 4AIKA 3E5UA 5E1XA 4BXUA 3DFGA 4BW9A 5ICFA 2JN0A 4XU3A 1JE8A 4J6WA 2L3DA 4S05A 4PJOG 2L02A 3LAPA 4YROA 4CH5A 4X9DA 3H92A 1L0OC 4HOBA 4M71A 3A7RA 4OIRF 4A6DA 4J6XA 2K4JA 3E6BA 5BPIA 1SETA 4N9IA 2ARSA 3HSRA 1ZG3A 1O3TA 2DT5A 3JB9J 2W85A 1JJCB 3TEHB 1FSHA 1GVJA 2XIGA 3LAJA 4YG2F 1WI9A 3SQNA 1BBWA 3JW4A 3A74A 3INZA 2OZ6A 3T0YA 4XRFA 5D5UB 5GAOm 4YRIA 2JTVA 4CH4A 1OKRA 3NENA 4XU0A 3HYIA 3BROA 1B7YB 3OOPA 3SHFA 1USYC 3TOBA 4IVNA 2ARTA 2YX7A 3H3UA 1ON1A 4C8QE 4K87A 4OOIA 5DV5A 4M7DD 2ZFWA 5HOOA 5LGTA 2HDCA 4KMFA 4M77E 2ACJA 1G4DA 2HTJA 2ZBKA 3IKLA 5GAOn 2VN2A 5LEKA 3R4KA 3WTWC 1NNHA 4ZYGA 2HYGD 1KMNA 4O3MA 2A68F 5GAN7 3F6OA 3HFVA 1LDJA 3KLOA 2FMYA 1M5Q1 4HWSA 4RB1A 1USYA 2X4HA 4ZZLA 2YX4A 3PFIA 3RI4A 2FF4A 2XAGA 4AH6A 1FP2A 5LJ5d 4EM1A 4PJOD 1ZGJA 4PGHA 4F7ZA 3BDDA 3RDIA 2P8TA 1KYWA 3D5LA 4M78G 2DVEA 1ZLKA 2L54A 4WJ4A 4OIQF 4M77C 1SD6A 4ON0A 4PCQA 1I1GA 5GAN5 1MJAA 1RNLA 5BMZA 4OMZA 2BBYA 3LWFA 2WC2A 4GCVA 3W3SA 4YIIA 2AXLA 3M8EA 3R60A 4CICA 4RQFA 1OR7A 4L0ZB 3WQZA 3CMQA 3F8MA 4M72A 1BC7C 4YP0A 1B4AA 3RTRA 2IY5A 2ZZFA 2RVCA 4X5OA 1IN7A 1RUNA 5D4RA 3HY1A 2DQLA 1Z6RA 2IPQX 2HOEA 1T38A 1F5TA 4M77A 4YRSA 2HS5A 2G9WA 1EOVA 1RUOA 3MEXA 4OINF 2DU9A 1YW7A 4TV7A 1BJAA 1JHHA 3RGLA 3P9IA 1IN4A 4HBLA 2M5WA 1KU3A 2BV6A 4LJZF 2R3SA 4HLYA 4NOYA 3JCMh 4RB3C 4YCWA 1WYDA 4DQ2A 2DK8A 4BHPA 4OMYA 1WLEA 3K1PA 3HSFA 3C1DA 2CSOA 5GAN4 2WV0A 1EIYA 5HLHA 1FY7A 2K57A 1W7PD 2EFPA 4RGRA 4YRJA 2Z9OA 1EVKA 3VQYA 3V8LA 3MEYA 1B34A 2GAUA 4ZH4F 1TQMA 1KA8A 2BYVE 4NB5A 4BNCA 4BAYA 4M78D 5K5OA 1K78A 3IKTA 2DLLA 3CDHA 4C8QB 5GAMh 5CVIA 1ZAOA 3GX4X 2ZCWA 1ZGAA 3RYRA 2QWWA 4HWRA 3LSTA 2D1VA 4Y91A 4EGYA 4HWTA 2CJ9A 1MGQA 4M77B 4M7AF 4N0AC 1UFMA 4ENMA 2Q7EA 3BJ6A 3ROUA 4PZJA 1J7KA 1G5IA 4TWAA 1EQRA 2DPDA 3B02A 2EV6A 1CGPA 2HFHA 4HW0A 3QO3A 2JPBA 4EX5A 4XTVA 5DDGA 1QZZA 2EJFA 3LQQA 5LGNA 3K9TA 1OYYA 1YB3A 1SFUA 1SESA 3ZN0A 2H6BA 5LJ3h 1HW5A 3JCMV 3IWFA 3L4GA 4U0VA 2ZR3A 4ENKA 3SZTA 5F1RA 3CJNA 3U1DA 3V7CA 3JB9F 4CXFA 3UFGA 1DDNA 1MJBA 1STZA 1P4WA 4M7AG 4N0AA 1B34B 4H2VA 3IRRA 4O5VA 3FMRA 2HKOA 4LFUA 5D4SA 1K78B 1U1TA 3RERA 1XSDA 2W24A 2IA0A 3E97A 3ELKA 3RKWA 3BY7A 1XGOA 3L7WA 4ETSA 4EJTA 2FQ3A 2DTRA 1T0FA 1GHCA 3QP5A 4P5OA 4KICA 4L9JA 1NYQA 4RAYA 5JVTA 1PP7U 2XAHA 3DKWA 2XHKA 3JB9G 1BBUA 1UHWA 4WXCA 3P8TA 3PCOA 5L3BA 3VBBA 4UVAA 4RB2C 2E1NA 3MCZA 2ODRC 5E1ZB 1E24A 1B9MA 4M74A 3R0AA 2P7CB 3TOAA 2PMEA 1I81A 3KP2A 5HDKA 2FXAA 3V7RA 2EFNA 3IHUA 4Q48A 1JGSA 1IXSB 3EQLF 1I27A 2RNJA 1X2GA 5JFRA 4NL3A 1G3YA 1LVAA 4BH9A 3SB2A 4LB5A 3QHSA 4FX4A 1IRFA 3RF1A 2CJBA 4TVAB 3KP6A 4F7UG 4XLNF 3WTSC 1F9NA 4IJAA 3ML6A 4FX0A 1YG2A 4KT5C 5C52B 3A7AA 3EFRA 2NS0A 3G73A 4P9UA 2PFBA 2I2LA 2VONA 1B6AA 4ESJA 2A69F 2K7LA 2C7IA 1B8AA 4P75C 4YRRA 3JCMJ 4M7AD 4XEMA 3QAHA 1YIOA 5D6FA 3JSPA 2VOOA 5E17F 3E5QA 2FB7A 1FYMA 1OPCA 3PCOB 2WWYA 4UHTA 2DI3A 2YHTA 5D5XB 1TBXA 2PMHA 3BY6A 2ISYA 1FSEA 4YFXF 2COMA 2FYKA 4ZYDA 3I4PA 3GW2A 2CGHA 5LJ3j 4PHCA 2XTIA 1AWCA 3JSOA 2K86A 3MF2A 2M87A 4OU0A 1HBXG 1PYSA 2Q7GA 4HV6A 1BOAA 1D3YA 3JB9D 4G9YA 4DNCA 3JCMc 2K4BA 1XGMA 4P75A 1WQ7A 2GWRA 4QLCU 3ZMSA 2LKPA 5LRRA 4LLNA 3I53A 1VTNC 4JUVA 1B1BA 2Y48A 4P9FA 4M75F 3GUDA 2J3LA 4YRGA 3KP5A 3ZP5A 2JPCA 3FX3A 4U0YA 5GMKe 5LJ5e 1QNTA 2E65A 2ZNZA 2DW4A 5D5VB 3G3ZA 3QO8A 1TW2A 4Y13A 1TNTA 5KVRA 3ERRA 4AVPA 5CVVA 2NAZA 2E1HA 3CUOA 2YR2A 1KU2A 4HF2A 2FRHA 4I01A 4XEOA 1H4VB 4M75G 3HRUA 4ZYEA 1BI3A 3WTXC 3ZN1A 3ZPLA 4KDPA 1J0RA 2CJAA 3C18A 4UVCA 3BJUA 4K88A 1E1OA 3R0JA 2OU2A 2RA2A 1FYLA 3QRFF 5C51B 1QF6A 4YDQA 3P9KA 1PYSB 5JHUA 5GANj 2LSOA 4U7BA 4M7DF 4TVWA 3A5ZA 4K86A 4KIFA 1B59A 4U7DA 3E6CC 2ARUA 3T5XA 1MDMB 1HXDA 2F2EA 4HT9A 1ZREA 1LYLA 4UP7A 3U2RA 1F1ZA 2FBHA 1S29A 2R7DA 2XUBA 2MLGA 4TVYA 1T6SA 2P6TA 3GEZA 3PZCA 1HW1A 1BBYA 1YYVA 4KFCA 3ZMDA 1XDUA 4JQFA 2RB6A 3CTAA 1XSVA 1FBSA 3L2ZA 1FYKA 4C92C 5LHHA 1JJCA 5GAOl 2GXGA 4PJOF 1WKMA 4RCCA 4CHUA 5LJ3d 4M7DG 1IZ1A 1H9GA 4A12A 1TTYA 2ZMEB 3F8NA 2AKWB 2JSCA 3FF5A 5FLXZ 1O3RA 5K1PA 3A31A 2E7WA 2UZKA 1SRYA 1B7YA 3LSQA 5FD6A 1Z9CA 3M1EA 4EM0B 1ZHFA 3M7GA 3MZYA 4YRFA 3JTGA 3M4QA 3TGNA 1WQ2A 5ELOA 5KNNA 4YRPA 1ZG5A 5ICEA 3HFNA 2RHQA 4HZFA 1LJOA 1S7AA 2I4OA 4HWPA 3FIFA 2Q8KA 1P4XA 3HY0A 3KFUA 1J9IA 4C92A 1C0AA 2Z33A 3LA3A 4YRKA 3HRTA 4Y17A 4KA4A 2XKOA 4M75D 1PDNC 2HGCA 1V3FA 2GQQA 2YLCA 1ODDA 1NJ2A 1RIOH 2QENA 3GIBA 3KZYA 2O61A 1IN6A 2CQKA 5FFXA 5HDGA 1F4KA 2QQBA 1ZG1A 4P71C 1EH6A 3WE2A 5CVJA 2XROA 2AMCA 2IA2A 2PN6A 2K02A 4QWQA 4UVBA 2EFWA 2QHVA 3I5UA 3QO7A 2HTSA 4P3NA 2XV4S 3ECHA 2Q2EA 5EEHA 1WQWA 1SFEA 1LDKB 3TDUC 3FXUA 5GANd 1QPMA 2QZ8A 5D5WB 4H2XB 2EA4A 2BGCA 4JRKA 1QQIA 2FMLA 5CLSA 1NJ5A 2W57A 5LBQA 2VE9A 2RHQB 3QNEA 5FLXK 2RV8A 1XD7A 4M9SA 1XCBA 4WF2A 3KP7A 4M78F 4C92B 2VBXA 4P71A 1XN7A 5E3IA 4AWXB 2VBYA 3BJOA 2Y90A 2ZCEA 5HLGA 4EMHA 4N0BA 5BPDA 4EMKC 4EO4A 4EJVA 4G8XA 4NL2A 2IP2A 2DO7A 4Q15A 3RPQA 4IHSA 4G94A 4KN4X 2QUFA 3J80Z 1TNSA 1QBJA 4QVDA 3UH0A 4M77G 2UXNA 2EV0A 2AMCB 3F3XA 2A5YB 2BEOA 5CAIA 3CO7C 3GFIA 1ADJA 4C8QC 4M78E 2J5OA 3KLNA 2UXXA 1XSXA 4A5NA 2CG4A 3GVAA 4UP9A 3UGQA 5HDNA 4EMSA 4GYGA 2ZJ2A 1R58A 3FHZA 3QUIA 2VOPA 2HYFA 4XTZA 2DXTA 4CDGA 1I4K1 2XAFA 4WXDA 4KR2A 2EB7A 5DYMA 2EJGA 2HNIA 3VEPA 4LK0F 1FZPB 5CYVA 4P74C 5GAOr 5AIQA 3E5XA 1JHFA 3ZMZA 3AHUA 3IC7A 3WTUC 2DDZA 4LMYA 2QYOA 3QPHA 4C8QA 3RPUA 2Y75A 2K27A 2P4WA 1YFRA 2W84A 1BC8C 1Z7UA 3ECOA 5F6FA 1U8RA 1QO0D 3F23A 3HXYA 5ICCA 3REUA 3T8TA 4EGZA 4NQWA 5AONA 3E9IA 1U78A 3KP4A 3N97A 4H0EA 4K2EA 1USTA 1YFHA 3RKYA 3IALA 1BI1A 3DP7A 4P74A 2Z99A 4LG0A 3I7FA 3MZHA 5DCFA 2DZCA 4XTWA 3J80K 2OQGA 1NHAA 5D6EA 2KJCA 2IVMA 3F6VA 4KIBA 4EMKB 3U9GA 4G7HF 5C53B 1KQ1A 4HDUA 3Q5FA 3M4GA 2CFXA 3P9CA 4XU1A 1IAWA 4CS2A 3T8RA 3AAFA 3RKXA 4A2UA 4M77D 4Q4ZF 2MC3A 3EFSA 1HQCA 2MH9A 2X0LA 3RIRA 1ZYRF 1U6GA 3JCMe 4G6DA 1XB4A 4H2YA 1KMMA 3C3WA 4EJOA 1R5HA 1SD7A 3RJPA 2VBWA 2P5LC 4P3PA 4S04A 1X3UA 3ZMUA 2VODA 2D1HA 3W6JB 4L9VA 5ELNA 3DSQA 1HKQA 3QU6A 1KQ2A 2E7XA 4I2OA 4MNUA 4L0YB 2DZ9A 2V1UA 2ZNIA 1VQZA 2L01A 4X9CA 1I1SA 4CS4A 3QU3A 1YO5C 3P8YA 1BN5A 2ELHA 4U0WA 5HGQA 2HZTA 5DEQA 1MJ9A 4LG0B 1W7PB 2P5IA 1OYWA 3C7JA 1N9WA 5GAMe 5H6QA 1E17A 3IKVA 5CJ9A 4HX7A 4V2SA 1Z7MA 5L3CA 2DTIA 5J8CA 1R1UA 4HWOA 3REOA 3BZ6A 3FJPA 4E70A 3HSBA 3IWZA 4HQEA 3EETA 1N9SA 3M9AA 1U5TC 4OIOF 2EJ9A 4GYIA 4M7AE 2NNNA 2F5CA 3ZMVA 3F8BA 1IL2A 2DJZA 2HKXA 4P55A 4XLPF 5GAN6 1YCYA 4KUMA 4YRMA 5HS8A 2FBIA 2KIMA 4MQ9F 1A04A 2ZKZA 4TVAA 1R1TA 4L5IA 3HIFA 3DQVC 4LB6B 1FT9A 1HSTA 1YW9A 2HR3A 4CO8A 2HQRA 5GAN3 4MHGA 3VU3C 3VQVA 2M45A 3TKYA 5E8IA 2E41A 3LA2A 1WSUA 2OD5A 4WX9A 4P96A 2M8EA 1HKTA 3QPTA 1U5TA 2FNPA 3SFZA 3VOEA 4F7UF 1D5VA 4EQQA 4KQEA 2PG4A 4GO1A 2UWMA 2CGPA 4YCUA 4M7AC 4BYYA 4RQEA 3VODA 1EH8A 1KGSA 4NHJA 3DF8A 2B0LA 3WTVC 2ZT8A 2MD5A 3NEMA 5DD8A 1H4SA 3R61A 3LQRA 2M30A 2DBBA 2STWA 1S6LA 1NJ1A 5A2QZ 1P6RA 5GANh 5DCMB 2E10A 3F72A 2Q7HA 2FEZA 2MH2A 2Z5UA 2L4MA 3SWNB 2ZZGA 3PQJA 1HC7A 1MKMA 3FM5A 4RGXA 4F7UE 1DPUA 1T98A 3QP6A 3I59A 4HX8A 4J6YA 1QE0A 5LLQA 1G3SA 1DPRA 4O6JA 2VT3A 1XMKA 3L9FA 1HK9A 1JXSA 2CYYA 4R1HA 4MGRA 1YQAA 3ULQB 5DD4A 4UV8A 2Q5HA 3HTSB 3CLOA 4Q6GA 3L00A 3JTHA 1U5TB 2FNAA 2LF7A 2DFIA 1S7OA 4M6XA 4XSXF 4ZTUB 3JCMg 1QZYA 4A54A 3K69A 3GO5A 2RC4A 4Y15A 4P72C 1SMTA 2DU5A 1LOJA 3JCMf 2Q5IA 5FFZA 3B73A 2E1CA 4MEYF 2V9VA 1K6OA 3BFMA 4ZZDA 1XMAA 4G6QA 1W66A 1Z1DA 2QQAA 2ODRD 4H2UA 4PNOA 1ADYA 1B76A 1JRIA 1KYZA 4BHBA 5GMKh 3K1NA 5K5RA 4L18B 5CVRA 1MDMA 3WG9A 5LRSA 1J2XA 1GXPA 3I59B 2PMUA 1KU7A 3EYYA 5GAMg 3D0SA 4M7AB 3K2ZA 4I7HA 3HTUA 1T39A 2A6EF 2KJBA 5A2QK 1IN5A 1BIBA 5FO5A 4P72A 5GAMf 2PI0A 2XAQA 2H09A 4CH3A 4ZIBA 4ESBA 2DPUA 4XTYA 1IF1A 4I02A 5KK1A 5D8KB 1YFSA 2MLKA 1UB9A 3M4PA 1DUXC 4LK1F 3ZQ7A 5HVQC 3K0LA 1ASYA 3COAC 2NNYA 4WI1A 3F22A 1ASZA 1O7LA 1EFWA 5J8FA 4HQMA 2ZMEA 2AKWA 5ILVA 3R07A 4L87A 4HDVA 4M75E 1H4TA 4I98B 3F21A 2KIUA 2PEXA 5LHIA 4H02A 5F5WA 3OD1A 2KKOA 2RHSA 4UPAA 4OIPF 3JB9I 2BE5F 1D3BA 1YS6A 1B70B 4AD9A 3KZZA 3NQOA 3HXUA 2D2WA 3K1MA 1YGBA 4C92G 1C0WA 2CIMA 3FB9A 3WGGA 3WTTC 2DQRA 5E20A 2EFOA 1SFXA 1KQ9A 2VC1A 4EMGA 1G3WA 2E5AA 3IKMB 4HYEA 4M73A 1R1VA 3DEUA 2EAYA 1O3QA 2RD1A 1KOGA 1N9RA 1FPQA 3FZVA 1RIQA 3A7UA 2DTOA 2E3CA 1HW2A 1PUEE 1P2FA 3I58A 4M7DE 3QSUA 3JCMQ 3MAJA 1FC3A 4RMFA 2P7VB 2ADUA 2LDUA 5ILSA 5GMKm 3HRIA 1XDSA 1B9NA 3CUQC 5GAN8 4BQAA 3FMQA 2IT0A 3H3ZA 1ONVA 4IHTA 1LEBA 4UP8A 1J5YA 4BWAA 3ABUA 4HAMA 4H2XA 2C6YA 4AIJA 1Z91A 2CWEA 2RHSB 4HLXA 4J15A 3A32A 4YCVA 2DEQA 4YRCA 4IPAA 3JB9H 5HS9A 1ZRFA 1D3BB 5LEJA 1GGMA 2J5PA 2FOKA 2G7UA 2OBPA 5GMKj 5LJ5j 4PJOE 4XU2A 2YPRA 2DU7A 12ASA 4H2SA 1WNLA 4HX4A 3GFMA 1I5ZA 1ZH5A 4M7DC 3FWEA 2RDPA 3HRKA 4UV9A 1KU9A 4LD5A 3HFZB 2WTEA 3CUQA 4IRIA 1YLFA 2V79A 2ZO4A 1DP7P 3HOTA 1X54A 1REPC 3V8KA 3W6KB 1FWZA 1IW7F 2O3FA 3SXYA 1H9TA 1FBUA 4JRIA 2F5EA 2XGXA 4J5YA 3P7NA 3L2CA 3GWZA 1U2WA 2GZWA 1TQIA 3J7AO 2I4NA 4C92D 1BM9A 2ALYB 1G5HA 3SZPA 2OAZA 5LJ5g 4PJOC 4C8QF 4G85A 4IXAA 4O2DA 2DXUA 2HQNA 4M7DA 1UHMA 1CF7A 5LJ5f 3NEUA 4M6YA 4KNYA 4M77F 1TQPA 4M75B 1IXCA 1SAXA 2FBKA 1XCVA 4XTXA 1MD0A 4HV5A 3FXQA 2DKGA 3HXVA 3GFJA 3BW1A 2HWVA 4WWCA 3MFKA 2QBYB 4ENNA 3OV8A 2RM4A 2XAJA 2ZTGA 4YREA 3CUQB 4PJOA 4MMLA 3JCMX 4C8QG 4FHTA 1R00A 4H2TA 6PAXA 2EJRA 2ZIOA 2O8XA 3RACA 1D8KA 2O03A 3EUHA 2GA2A 3LFKA 5I21A 3E6DA 3VQWA 3HTZA 1ON2A 3F8CA 1L0WA 3V7SA 2QM3A 3TO7A 2EA2A 4A6EA 4RDXA 2PQ8A 5HS7A 2QLZA 4I0AA 3FXRA 1Z7NA 3E3VA 2M1BA 5IT9Z 1Z6TA 4M7DB 1CF7B 4RCBA 4EMKA 4FT8A 2RKHA 11ASA 4G84A 1BI0A 2ZNJA 4L9TA 5H20A 2VBZA 1IXRC 4GGGA 1X01A 3LSSA 2FU4A 1S3JA 4L9NA 1X55A 5ERIA 4IRHA 4Q47A 1U3EM 4HF0A 5FGMA 3RL6A 2P6SA 2XASA 5DUIA 1SD5A 4E51A 4ZYHA 2QHSA 2VXEA 1HTTA 2GA1A 2PLYA 1FOKA 2DQ3A 1R7JA 1FNNA 2YSRA 4XTUA 1W5SA 4A5MA 4M78C 1ULYA 5F64A 2VT2A 1G51A 4IF4A 5E1WA 4PJOB 3Q9VA 1LJ9A 1FX7A 4YIFA 3EDPA 3KEOA 4MQVA 4EJUA 3KP3A 3KFWX 2O0YA 1YTYA 3WE3A 4HVCA 1FP1D 2A6HF 1ZRDA 3F8FA 2W25A 1D8JA 1W7PA 4WXHA 1R22A 2JZYA 2V1XA 1YS7A 1FBQA 3FM3A 1LEAA 1FYFA 2VC0A 3M8FA 1KQ0A 4XQ3A 4CYDA 3DPTA 4C8QD 4A0XA 3P8VA 3EYIA 4M78A 2P0LA 1V4RA 4QVCA 5FB2A 3IRQA 3HOSA 3T1BA 3O2PE 1O7FA 2FSWA 2CW0F 3TO9A 2IW5A 3JAMZ 3E9HA 3HXXA 5IT9K 1YFTA 4YRQA 3O3KA 2V1DA 5GAOp 4D0PA 2QHTA 1TH7A 3GYHX 1U1SA 2DAOA 4MEXF 2FE3A 2G4CA 1O3SA 1EV7A 3R6SA 4KIGA 3DV8A 1S8NA 1WWXA 3V4GA 4H2WA 3IG2A 3KE2A 3WODF 1OMIA 3DXJF 1KQ8A 1L3LA 4MTEA 3SWNC 1NJ8A 2IY5B 4JLIA 3GZ5A 4N9HA 3MF1A 5BOXA 4RAZA 4WCGA 3L1AA 5GAN2 3I54A 1NJ6A 1H4QA 4YPFA 4ASNA 3HXZA 4JBAA 2YU3A 3BOQA 2EL9A 1LB2A 1OYIA 4DPGA 5L3GA 1ZARA 2ETHA 4M78B 3GF2A 3BP8A 1SERA 3NETA 3WU0A 5DCMA 1BI2A 4JK1X 4ESFA 4R79A 3GZ6A 3SWNA 4CGZA 2F5DA 2STTA 2I4LA 3HUGA 2ZINA 4WJ3M 2KRFA 4XSZF 2TDXA 1E1TA 1IRGA 3JCMb 1EIYB 2P5KA 1RZ4A 5LJ3e 2A3SA 2J3MA 1I6XA 3S2WA 3JAMK 2KIFA 4RB0A 2E64A 4KR3A 2QVOA 4ZTZB 2ISZA 1W5TA 2PBIA 2OA4A 2L4AA 3GXOA 2F5FA 3HHGA 2LF8A 2QTXA 2G7HA 4OP0A 2EFQA 5LGUA 2AS5F 3TQNA 2GIVA 1E2XA 2VE8A 3G1ZA 1LDDA 5TJJA 2CO5A 3ABTA 4YYEA 1ATIA 2IA1A 3WGHA 3KETA 3LC0A 2PMFA 1WU7A 4M9ZA 5GAOq 3PGGA 1JBMA 3V8JA 4CS3A 2XKPA 1Y0UA 4OLFA 1SD4A 3WTYC 1NYRA 1LQ1A 1TLHB 2H27A 3QTCA 3TUPA 1P4AA 4MTDA 1GXQA 4I0BA 4LGWA 4Z2YA 4WK8F 3UGTA 1IN8A 3HRMA 4LNSA 5L3FA 3L4GB 2Q0OA 1O57A 3RYPA 1AOYA 2DTHA 3LA7A 2D45A 4M7AA 3WGIA 5L3DA 2ZZEA 1MZBA 2RQPA 4YRLA 3KEQA
chains in the Genus database with same CATH superfamily
2XRNA 5HK3A 2CJJA 1BCOA 3OSGA 1N6AA 3OYCA 1Y96A 4PGGA 1SMYF 5FJ8J 2ZT7A 1WPYA 4UNOA 2HNHA 1IZ6A 1E22A 2MA3A 1TW3A 2CUZA 4RGSA 1W2BP 2A6TA 2K3PA 1T56A 3GBGA 1YJ9I 1VIEA 4ELYC 1TZLA 2ZT5A 3HEFA 2HXOA 5J6XA 2JRTA 1EVLA 3FK6A 2HDDA 2FA5A 3BDUA 1R23A 3EFOB 3EG3A 2OJED 2KIQA 2E1OA 1ZLJA 4HT8A 1K6YA 4KJZA 3O6BB 3I71A 1V54H 4CZZA 2E12A 4YRTA 3TO6A 1KC8C 2P5VA 1I07A 1VQ5T 1J59A 1LNWA 5CQEA 2LTOA 4B09A 2Y0MA 5GMKl 1MGTA 1WGXA 1Q1HA 1YJWT 1Q1VA 2VUBA 4YFKF 5EJCA 4BEHB 2XGTA 4P1WA 2R92J 1ZRCA 1KQSP 4ANJA 1V1CA 1Z05A 1H0MA 1WDXA 3MKLA 1NJIR 4CA0A 2EYXA 1N77A 2ZR2A 3BPVA 2GF7A 4CCLA 4D6WA 5BNGA 4KYWA 2NOGA 4C92E 2PX9A 6AT1B 1W1FA 4KBMB 3SFIA 2PJPA 5ED4A 3R6NA 4IOAF 1ZN2A 3S2HJ 2X85A 3MKDA 3THKA 4A0ZA 3CCVT 2DYIA 1J5WA 4TTVA 2E1MB 3EGXA 2GBYA 1OU8A 3CBMA 3J81K 4II3A 4P73A 1JU5C 3CCET 5J1YA 2EVRA 4CH6A 2JM8A 2YLBA 1IV6A 1OPLA 4BJ5C 1IUYA 1K1ZA 1UAAA 2K4YA 5LHGA 2ED1A 4XQFA 3JRCA 4M75A 2XSJC 4BBSJ 3A4CA 3CCUQ 2WSEE 4HA8A 5EC7A 3QOPA 2H6CA 1K61A 2JRMA 2QBYA 5CQXA 1R77A 2X1CA 5F0HA 1TTHB 2L02A 4Z6YA 4RTVA 3LX7A 2LCCA 1L0OC 3A7RA 5IYDJ 3OBWA 3S3OA 2K4JA 2CP0A 2NUTB 4XK4A 2CUEA 5CKTA 1ZG3A 3DBLB 3ERMA 1VQMT 1XOVA 1JJCB 3LAJA 3NTKA 4YG2F 2JNGA 1WI9A 3AL0B 3CQZJ 3SQNA 1BBWA 3DPUA 2LH9A 3CMAA 3NENA 1F36A 1VQMQ 3BROA 1B7YB 4FT2A 2JMAA 2CYZB 3GBQA 1T8IA 1USYC 3TOBA 2KMUA 1OZ3A 1ON1A 2F2XA 4C8QE 4K87A 3I5SA 2A36A 2RHIA 3CC2Q 5DV5A 2ZFWA 4DOVA 2QDYB 2ACJA 1G4DA 2HTJA 2X48A 3EHRA 2VN2A 4E4HA 3WTWC 1XNIA 1NNHA 4ZYGA 2HYGD 4OVAA 1LDJA 2JWTA 2R4GA 4HWSA 3PT9A 2YX4A 3RI4A 1ETYA 2LBFB 5CPRB 2D6FA 1I39A 4PGHA 3D5LA 4NDLA 3PIOF 4RM2A 4OIQF 1OX8A 1SD6A 4ON0A 4PCQA 3OYIA 4XNFA 5GAN5 3CF2A 4OMZA 1VNDA 4GCVA 4B4CA 3R60A 4BUPA 3WQZA 2DJNA 4M72A 1BC7C 4A4FA 2ZPBB 2LRQA 4YP0A 3VS5A 1A31A 4X5OA 1IN7A 1YI2T 5D4RA 3HY1A 3K4MA 1GBRA 4A3IJ 1VQ4A 2IPQX 4YRSA 2HS5A 2BUDA 1VQKT 3MEXA 1QZEA 3OS5A 2DU9A 1G8XA 4F52A 1BJAA 3P9IA 4MFDA 4HBLA 8ATCB 1KU3A 4NOYA 3JCMh 3A03A 3CCYA 2COYA 1S1NA 2IGKA 1VQ8T 1X2QA 2P81A 3X26B 3K1PA 1BB9A 2E35A 2OJ2A 2CSOA 3CMMA 2KP6A 1FY7A 2K57A 1W7PD 4YRJA 1EVKA 3ONQA 4HCZA 2RI2A 5J40A 3PSFA 1KA8A 2BYVE 2E3IA 1BKBA 4YEJA 3BG9A 3GX4X 2PU9B 2D1VA 4EGYA 2CJ9A 1MGQA 4M7AF 4OMFB 4N0AC 4R55A 4PZJA 3RMSA 1J7KA 2KSSA 1X19A 3I4NJ 3X24B 2LP5A 2ZXIA 1BYMA 1CGPA 4LITA 2HFHA 1VQ4I 2EYYA 4ITVA 3PSIA 2HZYA 1MMSA 5ECAA 3K9TA 1SFUA 1VQ7I 1T0FC 2XB0X 1HW5A 2QI2A 5FKOA 3SZTA 2R7RA 1ZBJA 2CH0A 5HKCA 1ZA1B 4O5VA 4LFUA 3PIPF 1WFXA 1K78B 1U1TA 2XK0A 3I56T 4XIDA 4ETSA 2ZXWH 2ECZA 2LCLA 2FQ3A 1TWFJ 4P5OA 4KICA 4DEYA 1PP7U 2HXIA 4LIVA 4RBOA 4B6MA 2A08A 4RMNA 4WXCA 3P8TA 1Y1VJ 1UELB 2GXAA 4UC4A 2E6ZA 3FK7A 2QF7A 1WJSA 2VI6A 4XORA 2ODRC 3ZBDA 4M74A 2P7CB 4F14A 2PMEA 1I81A 3V7RA 4ZDPA 3IHUA 4Q48A 1X6BA 3EQLF 1I27A 1S72Q 1JT6A 4BH9A 3SB2A 5KE3A 3OSVA 3RF1A 5FKLA 3KP6A 5CKEA 4F7UG 3WTSC 1UECA 3A7AA 1M2OA 1ZQ3P 4E7KA 4P9UA 1ETXA 4PL6A 1B6AA 2A69F 1D1AA 1NLPC 3RQIA 2K7LA 1B3QA 2L3PA 3QAHA 1YIOA 1ZUKA 4I99C 3JSPA 4C0GA 1NYGA 3OYBA 2L7FP 1VQNI 2YHTA 3BQZA 5D5XB 2P4RA 2ZB9A 1HJDA 2LC2A 1NPRA 1VZ0A 4IQJA 1QKXA 2K86A 1RACB 5EG0B 1HBXG 2RREA 3JRHA 3JB9D 4G9YA 3JCMc 2JA5J 3ZMSA 4ZC3A 3MKZA 2V7FA 1G83A 3ZP5A 3FX3A 4U0YA 4FE4A 5GPCA 2ZNZA 5D5VB 4C2UA 3QO8A 5KVRA 1JI8A 2EYQA 4E6KG 2KQWA 2J6OA 3G6ET 2FOWA 4J9FA 5AYFA 4BXFA 3C2GA 2GFUA 3KXTA 3RZOJ 4ZYEA 5FKMA 1J0RA 2CJAA 3C18A 4A3BJ 4C9YA 2G6FX 3G6EQ 1ACIA 3QRFF 5C51B 4XR6A 2CFOA 4MLOA 4M7DF 5KNLA 3BR0A 4K86A 1B59A 1WA7A 3E6CC 3T5XA 1K9AA 3U2RA 4E7HA 1M2VA 3VYRB 2FBHA 4TVYA 2R7DA 2MLGA 2M4KA 1T6SA 2P6TA 1GLNA 3CJTB 1QCNA 5IHIA 2VQLA 2H8WA 4JX4A 2K40A 2RB6A 3CTAA 1FBSA 1W6XA 4XOTA 4PJOF 4CYCA 1WKMA 4RCCA 3BCAA 4JS4A 3CMEA 3DWLE 5LJ3d 2XKOC 4A12A 3F8NA 2JSCA 3CCQA 2PUKB 2DODA 3GTPJ 3OSSC 5K7FA 1FIAA 3M7GA 2MPXC 1NK3P 3JTGA 3M4QA 1XPXA 5KNNA 1M3AA 4FYVB 1LJOA 4RTYA 1G59A 1QCOA 3H35A 3A5ZB 1RL2A 3QQAA 4FW2A 4IOCF 4C92A 3HRTA 1K76A 3PE0A 2QCOA 1M90R 4Y17A 3TMOA 4LDXA 1V3FA 2YLCA 1MBEA 1YOVB 1WFWA 1NJ2A 2V26A 4FL6A 5HDGA 2IGMA 2CS7A 4MIMA 2PN6A 1RRJA 4MZMA 3Q0VA 3C94A 3I9V2 2BZXA 4BACA 5IP7J 3QO7A 4P3NA 2XV4S 1WQWA 1Q7YU 2YUQA 3TDUC 5GANd 3CMEI 4RM3A 2QZ8A 3A02A 2BY0A 2EA4A 1MHNA 2L2OA 3I9QA 5JLXA 4CRIA 4LE9A 2LTPA 1ETWA 3EG2A 5FLXK 2RV8A 2FX0A 3KP7A 5E3IA 4AWXB 2VBYA 2IAIA 2JUGA 1GT0C 1YJ9T 5BPDA 3PVQA 4EO4A 2KT1A 2DA6A 5EZGA 2L0AA 2IP2A 3CXCA 2DO7A 4LVLA 3HDDA 4Q15A 4G94A 1M4ZA 3J80Z 1YJ9Q 1TNSA 1QBJA 1QKWA 4QVDA 4M77G 4YIRX 2LRDA 4J7FA 3CO7C 4F55A 1ADJA 3FC3A 4A5NA 2Q2EB 4BQNA 2Y4YA 1LUJB 3UGQA 5HDNA 4LD6A 1R58A 2MGQA 3CJQB 4D5CA 4HEA2 3CCMA 2QKLB 4CDGA 3H5RA 1I4K1 2XAFA 2E3HA 2K9GA 2EJGA 3OIQA 4JP0A 1NM7A 2BXYA 1YITA 3BCBA 3E5XA 3H9GA 3B6CA 1JHFA 1TUCA 4R56A 3WTUC 4C8QA 5LFAA 2Y75A 2K27A 2MWOA 2HMAA 1BC8C 2A8EA 2JTMA 3M53A 3FISA 4N4NB 3RNJA 5D7UA 3SHWA 2QDLA 3ZQGA 2AO9A 3TSWA 2EZIA 3BR6A 3KPHA 1DJ7B 5DCFA 2DZCA 4XTWA 3W2VA 5IHKA 3QDFA 3DTIA 4PFZA 3M3YJ 2IVMA 4OMNA 2Y69H 2KI7A 1KQ1A 4HDUA 4FYWB 1K4SA 4C5EA 1UUEA 2QASA 3AAFA 2OAUA 2X0LA 3CCMI 4BKXA 3OBYA 1GUUA 4G6DA 3JRBA 4QSHA 1PRLC 4J7IA 5GP9A 4IUVA 1YITI 2DMNA 2R93J 3BR2A 2COZA 3TW7A 1HYOA 4L9VA 2WBMA 3DSQA 4JJNK 2GTOA 4L0YB 2DZ9A 2YUPA 5KH6A 1U0JA 2CW8A 4NS5A 2L01A 1XMXA 2KYBA 5HGQA 3IUOA 5DEQA 3JREA 1K4US 1MJ9A 5GAMe 3IKVA 5CJ9A 2DTIA 5FLXE 5CR2A 4JJDA 3FJPA 2DL8A 2CSQA 1N9SA 3M9AA 1U5TC 2R7QA 3QIIA 2F5CA 2OTLI 3F8BA 2DRKA 2HKXA 4P55A 1YCYA 4YRMA 2FBIA 1YJNT 2ZKZA 3BLYA 2HQRA 4YTLA 1VI0A 5J4YA 5GAN3 4MHGA 2NS6A 2M45A 3MQZA 3LWHA 2MIOA 2M8EA 1A36A 1D5VA 2PG4A 2UWMA 2LT4A 4M7AC 3TCJA 4L6V5 3VODA 1EH8A 5E3LA 1PKSA 4IUUA 2FG0A 1X58A 2MD5A 2K5FA 1H4SA 2QA4A 1P9QC 3ZQLA 2STWA 5A2QZ 2RAEA 1P6RA 2MI6A 3IV5A 1R6RA 1RADB 1M9SA 2DA3A 3AG1H 3PQJA 4X1EA 3FM5A 4F7UE 3QP6A 2E36A 1QE0A 5LLQA 2K9QA 3L9FA 3M56A 4B9XA 4Y7NJ 2E19A 1X75C 2BE7D 2FZGB 3OMCA 3JTHA 1U5TB 2FNAA 2LF7A 2JTFA 4XSXF 4UB8C 4A54A 3LLRA 1SMTA 3J7AF 3B73A 2RQWA 1JUPA 3CMAQ 3BFMA 1XMAA 1W66A 1Y0NA 1Z1DA 2ECBA 2ODRD 2LVMA 4H2UA 4PNOA 2ZMEC 2CT4A 1KYZA 5K5RA 3PJRA 3WG9A 1GXPA 1VQPI 3I59B 4BQOA 5A0GA 4M7AB 1T39A 2LX9A 2KJBA 1FTZA 2LQWA 2XAQA 1YFNA 4CH3A 4XTYA 2DPUA 4QQDA 1IF1A 2JVHA 5D8KB 1YFSA 1IGUA 3CC7T 2CU7A 4LK1F 3VJPA 5J1RA 1ASYA 3F22A 4D7MA 2BIVA 2LFBA 5ILVA 5I2SA 5GAGJ 2KIUA 2PEXA 4CCNA 2L9NA 4N4OB 2O88A 3CEYA 2HCKA 5F5WA 3OD1A 2KKOA 2RHSA 3GNGA 4UPAA 3JB9I 4XAXB 4AT1B 1YHQI 2YRDA 3K1MA 1R9TJ 3ASKA 5J3BA 5E20A 2KDSA 1SFXA 5HNFA 2VC1A 4A3FJ 2E5AA 4HYEA 4RAFA 1R1VA 2EAYA 1O3QA 1D0YA 2NS7A 1N9RA 1H3HA 1RIQA 1VQ7T 1Q82R 2E3CA 1R4NB 4A93J 1VQ4Q 4LDWA 3H3VK 3H41A 1FC3A 2AZSA 1WZ2A 4GLMA 2LDUA 3HRIA 3CUQC 2IT0A 4UP8A 3OL4A 4H2XA 2LMDA 2B9SA 1OZ2A 2PTKA 4YCVA 3JB9H 5FWCA 1ZRFA 1D3BB 3W2WA 2VB6A 2G7UA 5LL6S 4XK8E 2DU7A 4H2SA 4HVWA 5CKBA 1WNLA 1XX5A 1ZQ1A 4HX4A 4ESRA 3NGPA 1I5ZA 1ZH5A 4M7DC 2RDPA 4B48A 4JZ4A 3HRKA 1KU9A 2ZJPF 4ZTFA 2O31A 1YLFA 4EPCA 2ZO4A 2D9TA 3HOTA 1X54A 5IXBA 1REPC 3V8KA 2XPWA 1IW7F 3GTOJ 4J5YA 3GWZA 2I4NA 1OQYA 3IQLA 2Z2SB 3NHNA 2DDBA 3SZPA 5LJ5g 4PJOC 1AWOA 1WH5A 2DXUA 5C4XJ 1WHLA 1UHMA 1JJ6C 2NWMA 2CP7A 3NEUA 4M6YA 5I22A 2R5MA 1SAXA 2V8KA 4XTXA 2DKGA 4F04B 3BW1A 2WADA 3C2BA 1VQ6A 2ZTGA 1HD3A 2HQAA 1Z7LA 3CUQB 3JCMX 1VQNT 1VA7A 4E7ZA 3NFCA 3VQWA 3QWYA 4AC0A 3BTCA 2QM3A 1VQNQ 2EA2A 2M9UA 4A6EA 5HS7A 4FU6A 3FXRA 1GCQC 3E3VA 2M1BA 4M7DB 3TBIA 1QVFA 3I55A 4EMKA 2RKHA 11ASA 4G84A 1X01A 3VYTB 1S3JA 4L9NA 4HCBA 5ERIA 3ESWB 4Q47A 2ZPEB 5GTHC 2HQXA 2E5QA 4ZYHA 2HBWA 2GA1A 1FOKA 2LMJA 4XTUA 4A5MA 2X3XD 1SEUA 5E1WA 4PJOB 3CXCS 2DA4A 3E2UA 1FX7A 3EGDB 3KEOA 2XG8D 4C0ZA 1NJIC 4HVCA 4YELA 1PC0A 5E3MA 3LYIA 2BHYA 2HL5C 1YS7A 3DPTA 3RPUD 2M0CA 1PWTA 1V4RA 1KC8R 1YP5A 3TO9A 3JAMZ 2HPMA 5IT9K 1SEMA 2JVGA 1U9NA 3F70A 4FSSA 5GAOp 2QHTA 3GYHX 1U1SA 2DAOA 2G4CA 1UE9A 1EV7A 3R6SA 2FL7A 3DV8A 1S8NA 3V4GA 4JYKA 1YRNB 4BE2A 3KE2A 3WODF 3M0QA 2F5VA 1LE8B 1PD0A 1NJ8A 2OI3A 4JLIA 5KYUA 2BOLA 5E3NA 5I2MA 1TSFA 2ESWA 5EZHA 3LSKA 2W00A 3FLGA 1H4QA 4YPFA 2ED0A 4ASNA 3BOQA 2DMUA 4M6VA 2FJ1A 1SERA 2EH3A 3HGYA 3NETA 1KHIA 1BI2A 4ESFA 4CGZA 1RR7A 2F5DA 1N25A 2X6YA 2KRFA 1VQLT 4XSZF 1GVDA 2H8RA 3QWXX 2P5KA 3CC4A 1RZ4A 2F1LA 3S2WA 3MZ8A 2RPNA 2E64A 4KR3A 4DJAA 2XIDA 2L4AA 1WXBA 2M0YA 1JTYA 5LGUA 1PRMC 2GIVA 4YYEA 3FXJA 3CMEQ 3GTJJ 4MDXA 2PMFA 3CCQQ 4M9ZA 1JBMA 1HOMA 1LQ1A 2CH4W 1P4AA 4RA2A 1GXQA 5L3FA 2D45A 1OX9A 2JSPA 1YCSB 2ZZEA 4BDYA 1OCZH 1E3OC 1RUWA 2O4XB 3CC4I 3MKYB 5EGOA 5DUKA 4MMKA 4OMLA 5FKNA 5GAMj 2L3QA 3E19A 4NUBA 3GLXA 4HF1A 1Z3YA 3WU1B 3QYEA 1UG2A 3VFZA 3TDZC 3FMSA 2RO0A 4C5HA 3CCLA 3VV0A 3OSFA 5IT9E 3M4YA 2ZXFA 4LLLA 2A61A 2H94A 4JPBW 1OOTA 1RKWA 2FPDA 1I3AA 3CF5F 4XRSG 2LNBA 1ZBXA 3H5NA 5IXFA 2L89A 3CO6C 1K79A 1SPKA 3OYLA 2SEMA 4FT4A 1PUFB 3AG3H 4F7UA 3RESA 1Y96B 2QQ9A 1YX5A 3JCMP 3BWGA 5K1YA 2ECCA 1RI7A 2LC4A 1T3LA 1I8FA 4PJNA 4R8HA 5KHDA 1WLPB 2B7EA 2OQRA 3TEDA 3ZMTA 4C92F 3M54A 3RUXA 1BBZA 4A0YA 2KR3A 1YN8A 2VXZA 3ICAA 1SKUB 2K5LA 3KCCA 1H641 3JCMd 4HVVA 4HSRA 3PQKA 4A3LJ 5HLIA 4V2FA 1ETOA 3G1LA 5LJ3f 5CKHA 2DTZA 4E47A 5EEGA 3BPXA 3AFHA 1YITT 4P73C 4UUVA 3CCLI 3CCMQ 1UGVA 3PNTA 1M90U 4KN7X 1WHKA 3EG9B 4C3JJ 4II2A 4M9XA 1YITQ 3HFZA 2JT1A 4M75C 2VGNA 4OAZA 4PSWA 3CCRT 4FSXA 4CC7A 3REXA 3VUBA 1PNJA 1K7AA 2DBMA 1QVUA 2VKHA 1RAIB 2DQ0A 3MP8A 2ALYA 1JJ2A 4J9DA 5JI6A 2OTLT 5FW9A 3TEHA 1X56A 5FLMJ 2BE9B 3O8VA 5K7ZA 1P92A 2GXBA 1B8IB 5FRMA 5D8LB 2IS6A 2IRFG 3MWMA 3SDGA 2HKQB 4OGCA 1OCCH 2RGVA 1X2HA 1R36A 3OMGA 5GANf 2WSFE 2F2WA 3O8HA 4ATOA 1X1PA 4HPQA 4RGUA 1R5ID 1UGQB 5GAHJ 1H89C 3E5UA 5E1XA 4BXUA 5ICFA 1OULA 1RABB 1JE8A 2A28A 4KGXB 2V8JA 5E3OA 3DU6A 4Q5WA 2R58A 3F0CA 3A01A 3H92A 3EGXB 1M1GA 4QTRA 2JUCA 2ZXHA 3E6BA 1AKHA 2P0KA 4X34A 7AT1B 3MO8A 1TG0A 2DMQA 2W85A 3ABMH 4U87A 2XIGA 1RKTA 1E7OA 4Z88A 3JW4A 3A74A 2OZ6A 1OKRA 3LGFA 3HYIA 3OS0A 4IVNA 1EZZB 2ARTA 3LSPA 3JCUC 2PNIA 1VQ9I 4OOIA 1OISA 3K4CA 4YRVA 2MD0A 1I5OB 4M7DD 2H3EB 3ZQHA 1OQKA 3LSMA 1VOMA 2HDCA 4KMFA 1CSKA 1RAFB 4CC4B 5LEKA 2QQ8A 2Z1DA 5FRNA 5KCOA 1KMNA 4O3MA 3HFVA 2FMYA 4RB1A 2X4HA 3ZR8X 4AH6A 1VQPT 4OMOA 4PJOD 2YXYA 3HHTB 1BCMA 4M78G 1ZLKA 4RMOA 2DFHA 2QA4Q 1FMWA 4IHYA 1MJAA 2DIQA 3CCJT 5BMZA 2XDVA 3LWFA 4W1UA 3W3SA 4YIIA 2NLUA 1OR7A 4L0ZB 3QYGB 2DX1A 3RTRA 2IY5A 2ZZFA 4DOZA 2M0OA 2JT4A 2DQLA 3IH4A 1F5TA 3R6OA 4M77A 1OFCX 1WJ5A 1OCOH 3LSHA 2G9WA 2ZPFB 1RUOA 1QVFS 1YHQT 2CP5A 1SVMA 1IHWA 3H8ZA 1IN4A 3ZEHA 2M5WA 2R3SA 4HLYA 2LJ1A 2LQ8A 4ZGJB 4AFSC 4BHPA 1WLEA 1YHQQ 3C1DA 1S5LC 2DA2A 1EIYA 4RGRA 3VQYA 1SVOA 2FQ4A 1X69A 1B34A 2GAUA 2CMPA 3OW2P 1YIJA 4BAYA 3RKQA 3IKTA 2QQRA 3DBHB 2DLLA 2BY1A 5IHNA 1ZAOA 2IEKA 1ZGAA 1DGWY 2QEXA 4HWRA 4Z89A 4RTUA 1U3OA 3VRYA 3VUZA 1UFMA 4ENMA 2XDBA 3ROUA 3G71A 2DPDA 2BVLA 3B02A 3FHNA 3DEWA 4EX5A 2LR8A 5KYYA 1QZZA 2EJFA 3O8GA 3HTRA 3ZN0A 2CP6A 2FPFA 5LJ3h 2QXFA 3IWFA 1DP3A 3L4GA 1T0JA 4U0VA 4ENKA 2E4HA 3U1DA 3V7CA 2EBIA 3JB9F 5CO7A 4M7AG 3QWLA 3IRRA 5M5WJ 1KD1R 3OQ5A 1WHUA 3X25B 1XSDA 2IG0A 3M4OJ 2W24A 2IA0A 2BVMA 3ELKA 3RKWA 4F91B 4PFOA 2YSQA 1XGOA 3NWTA 1YIJI 3HG9A 1Y57A 3ASNH 1NYQA 1ZSZA 1XS9A 5JVTA 1W5CC 2EGCA 4Y28E 3KYLA 3VBBA 3G71I 3EFOA 1Q81C 5E1ZB 3PMIA 1E24A 3K2AA 2VPLA 4M3DA 1IXSB 2RNJA 1SAUA 4LB5A 3QHSA 4FX4A 2AQEA 4TVAB 4DBHA 2DVJA 3A98A 1OEBA 2I0NA 3GTQJ 1YG2A 2DA9A 4KT5C 2COWA 5C52B 3EFRA 2PFBA 1V76A 2VONA 3HPWA 3CC2I 4ESJA 4C2MJ 3CBOA 2DFFA 3H36A 4LDUA 2C7IA 5F0FA 4LG3A 3VWBA 2GNCA 4XKWA 4KGVB 3KFVA 4BEHA 5E17F 2IIMA 2RN8A 2FB7A 3VSLA 1UJ8A 2WWYA 2M7BA 2PMHA 2EINH 4LDYA 3HB9A 3HGGA 2LLKA 3GW2A 2E5KA 3JSOA 2XMFA 3MF2A 2OCCH 3NTHA 4DNCA 4PJ0C 1XGMA 4P75A 4QLCU 2JVVA 1VQ6Q 3PTAA 3UATA 3URGA 4HXJA 4GFBA 4P9FA 2XC7A 2R5YB 5LJ5e 1QNTA 4CCMA 2DAQA 1HLVA 2OV7A 3B6AA 2KHMA 4Y13A 4JX6A 1LPQA 3ERRA 4AVPA 3IAS2 2NAZA 4HVUA 2OTJA 2YR2A 1KU2A 2Y9ZA 4F92B 2FRHA 4I01A 3I55Q 4XEOA 1H4VB 1OV3A 2DT6A 3NAUA 4J9HA 1WJRA 1WJFA 4KDPA 5DLOA 5J1UA 4UVCA 1IDYA 1QP2A 3R0JA 2RA2A 2CDTA 2RHUA 3ER0A 3WXMB 4BXXJ 4KIFA 2ARUA 4NC6A 1LYLA 4IKFA 2KDOA 2XUBA 4IHVA 1ZHIA 2NUTA 3M07A 1YYVA 3ZMDA 2M4GA 3W2AA 4JQFA 3NMZC 5KYWA 4C92C 1FYKA 5LHHA 1JJCA 5GAOl 4MFEA 5IOZA 4AU7A 4CHUA 4Y3OA 4M7DG 1IZ1A 1ZGWA 4J9IA 2RQVA 2AKWB 2JN6A 3A31A 2E7WA 2UZKA 1SRYA 4DYQA 1B7YA 3M1EA 4EM0B 2GGRA 1ZHFA 3MZYA 4YRFA 2FPEA 1ZG5A 1GFDA 3HFNA 3PUFA 3SYTA 3S3NA 2I4OA 4HWPA 3FIFA 2Q8KA 3HY0A 1LVKA 2ZPGB 3LA3A 1VQOT 1MH3A 3IP4B 4XL9A 4M75D 3TVTA 2X4JA 1ODDA 1WHHA 4IO9F 1T95A 1JJ2S 1IN6A 2QQBA 1AWXA 3S2DJ 4CYCB 5F1JA 3M57A 4Z8AA 3FXMA 1SFEA 1JUMA 1UZCA 1QPMA 3M0RA 3DB3A 4I76A 5D5WB 1RR8C 4JRKA 2FMLA 5CLSA 2OPTA 1NJ5A 2W57A 5KYXA 4DW6A 4M9SA 1XCBA 4C92B 2VBXA 4P71A 3CC4Q 1W36C 4EMHA 3GCMA 2BW3A 4G8XA 1SF9A 1S72I 4N4HA 3BG5A 3I4MJ 3DLLA 3SEQA 2HYJA 1X1CA 3REBB 3UH0A 2VVKA 2UXNA 1KC8U 5CAIA 4C8QC 4M78E 3KLNA 2DXCA 2UXXA 4IIMA 2CG4A 2H1LA 4EMSA 2ZJ2A 3QUIA 2ATCB 1Y39A 4OMQA 2HYFA 4XTZA 2DXTA 1M1KR 4KR2A 2HNIA 3H0DA 2RQRA 4LK0F 2HOSA 1FZPB 3CD6A 1WHMA 1WH7A 3AHUA 3REAB 2DDZA 3QPLA 1Y8QB 1MIJA 3QZ9B 2DE0X 2RNAA 3UA6A 4C0DB 3ZGKA 3ECOA 1U8RA 2NVYJ 5KYNA 5ICCA 2MSYA 1I6HJ 5IAYA 5AONA 4HRIA 3E9IA 3N97A 3CCSA 1SRMA 5TGTA 3WHBA 1C6VX 2Z99A 4OWRB 3I7FA 1SFKA 2YT6A 3CCLQ 3AKZA 3J80K 1NHAA 3EH2A 2KJCA 2X51A 2W4SA 3VS7A 3Q5FA 3M4GA 2CFXA 4X6AJ 1BA5A 3P9CA 4A2UA 3VPRA 2K3FA 1Q82C 2M34A 2MH9A 1GCPA 3PNVA 1R5HA 1SD7A 3Q3SA 5HLTA 3ZQIA 2VODA 5ELNA 2CQNA 4I2OA 3M0SA 4X9CA 1I1SA 4CS4A 3QU3A 4U0WA 3OYNA 4J01A 1IDZA 1W7PB 1VYVA 2P5IA 3C7JA 5H6QA 1E17A 1K73C 4V2SA 4AVZA 3CCSI 2CT3A 2J05A 1UDLA 2PVDB 4E70A 2KRHA 4HQEA 2WY7Q 2HSPA 3ZL7C 4OIOF 3PNYA 4GYIA 4M7AE 2CS3A 3ZMVA 1KHCA 3BG3A 3G7ZA 5GAN6 1TWGJ 2NVUB 1A04A 1R1TA 4L5IA 5KCMA 4HKEA 3DQVC 2DA1A 3D5SC 1YW9A 1BR4A 2CQQA 2EPDA 3OR2C 4KUIA 3VU3C 1SSHA 3J7ZI 3LA2A 1WSUA 3TL4X 4F7UF 4GO1A 2CGPA 2QK0A 4BUGA 2KLOA 5IYCJ 4RQEA 2VKVA 4HNTA 3CZ6A 1KGSA 1Z9QA 1VQ9T 1X3ZB 2ZT8A 2O9LA 5CCAA 3LQRA 4LUDA 1S6LA 1N8RR 3MEVA 5DCMB 2E10A 1BJZA 1MMNA 2MH2A 2KEAA 2Z5UA 2KY9A 2M9HA 3SWNB 2PJRA 2BXZA 4RGXA 1DPUA 4HX8A 1R8OB 1B72B 1DPRA 3W6VA 3LOCA 1ZSGA 2QKMB 1HK9A 4MGRA 1YQAA 2AXTC 3MCAB 4D5FA 3ZCOA 3J80E 2DFIA 2DFEA 4ZTUB 3L2UA 1M1FA 1DGRM 2I5UA 3GO5A 3L2RA 4JLGA 4Y15A 2FVUA 1LOJA 3JCMf 1K0XA 2E2JJ 5LD2C 1ENHA 4ZZDA 3WVEB 2QQAA 3D5RC 1M27C 2DF6A 1PJRA 1B76A 1JRIA 1HA8A 2MC4A 5GMKh 4L18B 2PMUA 1KU7A 1IGQA 5J26A 3EYYA 5GAMg 3D0SA 3C4SA 4ABZA 3HTUA 5A2QK 4LVKA 2CQ7A 4P72A 1X2KA 4ZIBA 3ABKH 2P0QA 3M4PA 3ZQ7A 4BY7J 2BZ8A 2NNYA 4ZDLA 3KX2A 3U23A 3R07A 1FXXA 1RAEB 2LQNA 1H4TA 3F21A 4KRTA 1KIKA 3TEEA 2DYBA 1Z9ZA 3SEZA 4XRSA 3GP8A 1B70B 3ZQCA 2RJEA 1WJAA 4A4GA 1QMCA 2CKKA 1YGBA 2C0IA 5CQYA 1VYTA 2VPRA 5EEAA 2DQRA 3WTTC 2DXIA 2QAZA 4M73A 2KAFA 1QA6A 2RD1A 1H8KA 1FPQA 2EZLA 1MNDA 2B63J 1PUEE 3I58A 2HVRA 1XG1A 4M7DE 4RMFA 2P7VB 2ADUA 2DETA 4PFPA 5GMKm 1B9NA 3CCUT 2QSGX 3D1NI 3HOWJ 3ABUA 3K7AJ 1Z91A 2RHSB 1AVZC 3A32A 3QODA 2K9NA 3A8HB 4IPAA 5HS9A 1R0CB 2ZFUA 1VIFA 2J5PA 2OBPA 5LJ5j 4PJOE 2VLAA 2YPRA 2WAEA 2IGNA 3GFMA 1UB4A 4XLCA 3OYDA 4OMMA 4UV9A 1YIJQ 3VS3A 1UGPB 4EATA 2V79A 3DEEA 2F4OB 3ZXSA 2ROLA 2FZKB 2QEXQ 1F43A 3J7AO 2EQKA 4C92D 1BM9A 3IH2A 3G71Q 2OAZA 4G85A 4JZ3A 4O2DA 4IXAA 2LNVA 4FASD 5EDNA 2HQNA 2J6KA 2HQEA 3A1PA 3CESA 1CF7A 2RK2A 4M77F 2HQ5A 2C0OA 1TQPA 1IXCA 3DTKA 2FBKA 1XCVA 1MD0A 3UT1A 4HV5A 4GLKA 3JV3A 3HXVA 3GFJA 5A2QE 2HOAA 3CC2T 1EX4A 2CZ7B 4C5GA 2NUZA 4J9EA 4F93B 1TT5B 4A3JJ 1WJQA 1IHVA 2O8XA 4BDZA 1IB8A 2O03A 3DB4A 5FU7C 1DU6A 1VQ5A 5I21A 2W0ZA 5KE2A 3OR1C 3MP1A 3V7SA 4UUTA 3DBRB 4Y52J 2X6XA 5TISC 3A0BC 2QLZA 1AT1B 1Z7NA 1T3SA 3EHQA 2CUFA 1YJWA 1BI0A 5H20A 1IXRC 4GGGA 1MSEC 4HF0A 2BY2A 3U1KA 2QYZA 5DUIA 1SD5A 2LJ0A 2QHSA 3CMAI 3MMYB 1WI7A 1FNNA 2BKDN 5CIUA 1W5SA 3AG2H 2R0QC 1G51A 1LFUP 1TXQA 3Q9VA 1W36D 4EJUA 3C12A 2D8JA 3CCVA 2O0YA 2X35A 3BQYA 2A6HF 1NG7A 3M8JA 4EDUA 2JW4A 5FLVA 3CCEA 4WXHA 1UHSA 1VQ5I 3BTJA 2V1XA 2EBPA 3FM3A 1X1BA 1KQ0A 4C8QD 3QJYA 4KGZB 4M78A 2DYRH 2P0LA 2DO3A 3CP2A 3O2PE 1YJWI 1CKAA 3L2QA 2ZPHB 2ID6A 2IW5A 3HXXA 1WXUA 4NC8A 1KD1U 1XQHA 1YFTA 4YRQA 4CH7A 2FE3A 2OF7A 2F4MB 1O3SA 2NVTJ 1OMIA 2WSCE 2XHCA 3PIOA 3GZ5A 2VQCA 3UDCA 3M58A 1MV3A 4II1A 4WCGA 3N05A 3CCVI 3I54A 1GDTA 3FBIB 2YU3A 2OTJQ 1VQMA 1LB2A 1ZARA 2ETHA 2VKDA 1IC8A 4M3GA 4E6RA 3Q0WA 2R7SA 1H88C 2R7TA 3I35A 3H0IA 3HUGA 4WJ3M 1NH3A 2TDXA 1U9OA 3A2KA 1JO8A 5LJ3e 1EA3A 3S3MA 2E6NA 4JX5A 3JAMK 2R7XA 4IHWA 1ZA2B 3CPWA 4ZTZB 2PBIA 4FQGA 2OA4A 5CKDA 3HHGA 2F5FA 4OP0A 2EFQA 3TQNA 4IHXA 1E2XA 1GFCA 2VE8A 3G1ZA 2LT1A 1LDDA 3OIOA 5TJJA 2CO5A 1ATIA 2IA1A 3WGHA 3KETA 2LQKA 2KXCA 2XKPA 2K85A 3HP9A 3TU4K 2LY1A 1SD4A 3WTYC 1TLHB 2H27A 2ZSHB 1S72T 4I0BA 4Z2YA 4LVIA 4IIOA 1O57A 1AOYA 4M7AA 3K70C 1W70A 1AZEA 4C3IJ 1RAAB 3MVPA 1PHTA 2ICWG 2VJ5A 2O9VA 1J3TA 5GANe 2HDWA 1UCRA 3MJXA 2EWNA 2O7OA 2EV5A 1K83J 5F08A 4YRNA 3I64A 3BTLA 5EG2A 1YI2A 2MWPA 3CQTA 1JKQC 3AT1B 1Y1WJ 1FOXA 4XLFA 4XLEA 1QVGA 1EH7A 2VV5A 3DTEA 2KDZA 3JRAA 1VQKA 3DKXA 1JGGA 3K4BA 5ICGA 5FD5A 3L09A 3I0TA 3BR1A 3ULRB 2HEOA 2ESNA 2XVCA 1VQ8A 1D5YA 2DILA 4CCJA 2DLPA 5L3EA 1G5VA 3HHHA 2F4IA 3M59A 1TOVA 4TQDA 3NELA 5EGOB 1FOYA 3C0CA 2HVSA 1K8AC 2NRAC 3A5YA 2DK5A 2W1OA 2DOAA 3ISPA 4EVIA 4PG3A 4GXOA 2FO0A 1YI2I 3K10A 1T33A 1YW8A 4RTWA 3IL2A 4KMUX 2ZNYA 1T0HA 3HPHA 2LCSA 1VQKI 1I5LA 4A53A 4BHCA 3PNWC 4C0FA 2LOOA 1LNXA 3JAME 1WRJA 3TEGA 2DCEA 2FD5A 3AG4H 4AIHA 5BQTA 3CD6Q 2XRLA 1UG0A 2M0MA 5GTIC 1VQ8I 2VXFA 4F7UB 4KULA 1X6OA 1OU9A 2VXDA 3EG1A 2W7NA 3S15J 3HSEA 4P3OA 4EJWA 5IT3A 2QHUA 3VB2A 3I56A 4TQFA 3GLLA 2EK5A 5K1XA 2IGOA 3Q0UA 3LW5E 4L5JA 3M9QA 4YFNF 3JCMW 1TWAJ 2ZT6A 3ERED 3FDYA 1TL8A 3CCSQ 4K11A 2NYXA 4PSXA 5JR3A 3N4MA 4OB2B 2ESHA 1KD1C 4PDKA 3DLLF 3MQ0A 3QO5A 4PLIA 3GFLA 1R71A 3HRSA 3KEYA 2CH4A 5AIPA 4AIKA 4KH0B 4F3QA 3DFGA 4BW9A 4AFZC 2L3DA 1GV2A 4S05A 4X9DA 4HOBA 4A6DA 1R4MB 4J6XA 5BPIA 1SETA 4D1QA 1FIPA 3M55A 1ORKA 4B3AA 1O3TA 2RH2A 2DT5A 3JB9J 2X4WA 3META 3TEHB 2ME6A 1GVJA 2Q1ZB 4RUGA 1M1KU 5D5UB 4DBFA 1ERDA 2JTVA 4CH4A 4XU0A 3A8LB 1IUFA 3OOPA 3HL8A 3CCQI 2OX7A 2ZAEA 2V6EA 2JMCA 1SG5A 1EJ9A 2E2IJ 2NUPA 5HOOA 5LGTA 3A01B 2XGCA 3FDRA 2C06A 1Q81R 4J9CA 2ZBKA 3L2WA 5GAOn 5F0CA 5FKKA 2HKNA 2A68F 1WHGA 3KIOA 2A0FB 3D7SB 1OR7C 4GRIA 4LUEA 1FP2A 1Q86C 5LJ5d 3PVLA 3BDDA 3G6EA 3KYCB 1KYWA 4MZPA 1W2BA 2DVEA 1QU3A 5FROA 3MKWB 4QQ6A 2XD0A 4M77C 2O9SA 3IAM2 3M5AA 1RNLA 2BBYA 5K7HA 3E0JB 2RK1A 2AXLA 3M8EA 5JVGF 3X20B 3F8MA 3L42A 3I3LA 1LE8A 1B4AA 4KT6A 4CZCA 2RVCA 1GL5A 5DM7R 2E2HJ 1AU7A 1ZK8A 1WJBA 4B47A 1HCRA 2HOEA 3FIWA 2W10A 1M8MA 4GBQA 3LSJA 1YW7A 3RGLA 1JHHA 2WB1N 2KQRA 4YCWA 4RB3C 4DQ2A 2DK8A 5HK0A 4OMYA 2HU9A 5GADJ 3HSFA 3PUBA 1TS9A 2LREA 2QSHX 1M1EB 1KQSA 2EFPA 2Z9OA 3V8LA 1MBFA 3MEYA 1SSFA 4G6TB 2EILH 4R0KA 2MABA 2MYSA 1IRZA 1XJWB 4BNCA 3GMEA 1UEBA 1MBGA 3CDHA 5GAMh 3RYRA 4LD9K 2QWWA 3VS4A 3LSTA 4HWTA 4PJLA 4M77B 1GXIE 2Q7EA 1HF0A 3BJ6A 3QKJA 1G5IA 1LFPA 2EV6A 4HW0A 2JPBA 1N8RU 4KUDK 4XTVA 5DDGA 4QW2A 5J4VA 2ZZDA 5LGNA 2KT0A 1JKRC 3LH0A 1I3QJ 2CQXA 1SESA 2H6BA 1ZSZC 3JCMV 2PQWA 2ZR3A 2YS9A 1D09B 3CJNA 1Z67A 1WJDA 3UFGA 3OY9A 1MJBA 1STZA 3P8HA 4AFUC 1B34B 4H2VA 4PUSA 4LN2A 4DEXA 4XMYA 2EQUA 2HKOA 5EF6A 3L1PA 2VYTA 2EQMA 1ZELA 3E97A 3FBNB 1YJ9A 5KAFC 4EJTA 2QGFB 4BY1J 1GHCA 3QP5A 2OAWA 1RESA 3M0TA 1OCRH 2XAHA 3DKWA 3F9KA 2XHKA 3JB9G 2M7AA 1BBUA 1UHWA 2CW7A 3S1MJ 3PCOA 4CSWA 3FRNA 5KYYB 5L3BA 2Y0SA 4UVAA 2FHDA 4RB2C 4OB1B 3MCZA 1B9MA 3R0AA 3TOAA 4KITB 3KP2A 2FXAA 1WJCA 1JGSA 4NBQA 1X2GA 3CXCP 1G3YA 1IRFA 2CJBA 3E7LA 3MEUA 1QVPA 3CPWS 3H0GJ 1Y7XA 3V42A 1F9NA 1Y8RB 2LD5A 3UR3C 2NS0A 2KPMA 1H3ZA 1M1KC 1ZSZB 1WI3A 1B8AA 4P75C 2VQHA 4M4ZA 3JCMJ 5D6FA 3PMTA 2VOOA 1UG1A 3E5QA 2XF7A 2E1MC 4CCKA 3CMAT 4UHTA 4RLQA 4E7IA 1UTIA 1NJIU 3BY6A 2ISYA 4YFXF 2COMA 4ZYDA 4XONA 3I4PA 2CGHA 5LJ3j 4PHCA 3EG9A 3JRGA 2YDLA 4OU0A 1PYSA 2Q7GA 1BOAA 1D3YA 1OYXA 2DL4A 1WQ7A 2GWRA 2QA4I 2LKPA 3RMQA 3K70D 1VTNC 4LLNA 4JUVA 1B1BA 4YRGA 4M75F 2J3LA 2JPCA 4V19K 3MPUB 5GMKe 5C0MA 3G3ZA 3HOVJ 3CDLA 1VQ5Q 2GIZA 1TW2A 3OS2A 2F48A 1QVGS 2JXBA 2JS2A 5CVVA 1M30A 2E1HA 1B8IA 3QOEA 1YJWQ 4HF2A 2AIRB 2O5RA 3HRUA 2EZKA 1BI3A 3WTXC 3ZN1A 2W82A 3ZPLA 1BW6A 1E1OA 2JK3A 5L23A 1FYLA 4A4KA 1QF6A 3P9KA 2XPVA 5GANj 3AL0C 4U7BA 1ABQA 4TVWA 4U7DA 2LZ6B 1MDMB 1HXDA 2F2EA 4E7SA 1ZREA 3ABLH 4UP7A 1YJNA 1F1ZA 4A3DJ 1C1AA 5IPAA 2LDMA 3PZCA 4L59A 1HW1A 2HVQA 4KFCA 1VQ4T 3CCVQ 2AKKA 1XSVA 2AHJB 2GXGA 3CCEQ 2QSFX 2XU8A 2ZMEB 3TW6A 2GLOA 5B66C 1Z9CA 4EEFG 3JRFA 1WQ2A 5ELOA 1BOBA 4YRPA 1WVRA 2RHQA 4HZFA 2R7VA 1J9IA 2Z33A 4YRKA 2YRVA 1I1JA 4KA4A 1K73R 1PDNC 1A0NB 2HGCA 2WAFA 2GQQA 3E9FA 2R5ZB 2V8IA 3GIBA 1YJNI 2CQKA 5FFXA 1F4KA 1FMKA 1N8RC 5KYWB 2ZJQF 1APLC 4P71C 1EH6A 2MG4A 5CVJA 2AMCA 4AMCA 4JOMA 4QWQA 2EFWA 2QHVA 2HTSA 1X3WB 3ECHA 2EIJH 3C2HA 2K3BA 2IS1A 1PKTA 5LBQA 2VE9A 3QNEA 5IP6A 1LFBA 2DOEA 4A3MJ 4W97A 4M78F 3GTKJ 2D5VA 3BJOA 3W3CA 1UHFA 5HLGA 2WAQA 2X4XA 1AWJA 2EW3A 4N0BA 3MP6A 4IUQA 4MZTA 4QIWN 3S8PA 2X1EA 1ZR2A 2QUFA 1WZOA 2HOTA 3LGLA 3CC7A 2LKXA 3F3XA 1BR1A 2BEOA 2KGTA 3GFIA 4NC7A 1TUGB 4D8KA 2J5OA 1XSXA 3GPLA 3GVAA 3OMYA 5IP9J 2VOPA 4A3EJ 3HOZJ 3NARA 4WXDA 4DBQA 5DYMA 5KYXB 2JMWA 3QDRB 5J47A 3J81E 1QPIA 3ZMZA 3VRZA 2J7IA 4LMYA 2QYOA 5C6SA 2BW3B 1YFRA 2W84A 1I50J 1Z7UA 4CC3A 5F6FA 3F23A 3HXYA 3REUA 5B1BH 1VQ6I 2KYMA 5M9OA 3T8TA 1XTAA 4EGZA 4NQWA 1YI2Q 2NYSA 3UNGC 1U78A 2EQJA 1VQ7A 4LVMA 1USTA 1Z0XA 3RKYA 2A5WA 2WA0A 1BI1A 3DP7A 4P74A 4LG0A 3H1CA 3MZHA 1DQUA 1W2BS 1IO6A 1VQKQ 1NEBA 3CC7I 1EFNA 5C53B 2X6WA 2KISA 1YBYA 3T8RA 4TVRA 4ME7A 3RKXA 3MHXA 4M77D 3FEOA 5M3MJ 5GPAA 4M3BA 1VQ8Q 3I55I 3RIRA 2OUMA 1ZYRF 3OYAA 3JCMe 4RDUA 1BK2A 1XB4A 3G4SA 2MF2A 5IY5H 4EJOA 3RJPA 4XN0A 2VBWA 2P5LC 4P3PA 1X3UA 3ZMUA 2X6OA 2XPUA 3QU6A 1WHJA 2V1UA 2L9RA 2CP3A 1VQZA 4AFQC 2V1QA 1YO5C 2RMOA 3ZRGA 1BN5A 5F04A 3H0HA 1ARKA 2ELHA 2HZTA 2Y0SN 1OYWA 1K0SA 1SRLA 1Z7MA 1CKBA 4UB6C 1R1UA 3REOA 3JRDA 3BZ6A 1UJYA 3IWZA 2HSEB 5A0DA 1KQSS 2MFZA 2EJ9A 1IRXA 1A35A 2DJIA 2GBQA 1IL2A 3A0HC 4XLPF 1UFFA 4KUMA 3VYSB 1U06A 5HS8A 4MQ9F 2N8GA 4TVAA 1FT9A 3LSRA 4A4EA 1HSTA 2HR3A 2DIGA 1NG2A 3ASOH 3G4SI 2BY3A 5FWBA 3VQVA 1VQNA 5E8IA 1VYUA 2RQUA 3I56Q 2OD5A 4WX9A 4Z02A 3CMET 1HKTA 1Y71A 2FNPA 3VOEA 3SFZA 4S0HB 2M1HA 4EQQA 2UUZA 4KQEA 1UGRB 3CCQT 4YCUA 1ITYA 1MMGA 5AT1B 4AIDA 2K5IA 2EGEA 5DTDA 2EZHA 3DF8A 2KK4A 3VS1A 4FM4B 5JLWA 3DU5A 3NEMA 3R61A 2WACA 5DM7F 2M30A 2DBBA 1NJ1A 2JJ7A 2Q7HA 2FEZA 1B07A 2L4MA 2ZZGA 2KRMA 1T98A 2KRCA 2VKEA 5D6XA 2R5YA 4O6JA 2CREA 2VT3A 1LKXA 3EPZA 1XMKA 1JXSA 4R1HA 3BR5A 1KK7A 3ULQB 2L9VA 4UV8A 2GQIA 3KZIC 3M0UA 3HTSB 1FOWA 4CI0C 1QVFP 2KROA 4UY8I 3L00A 2WV1A 1D0ZA 1S9HA 1S7OA 4M6XA 2ZPIB 3G1JA 4PJJA 3K69A 4P72C 3S1QJ 2Q5IA 1D1CA 4MEYF 2V9VA 1P7IA 3A8GB 1WGSA 3SJMA 5L8RE 2CUBA 3BR3A 3SEMA 4J00A 3UKGA 2PJRB 4BHBA 3K1NA 2JA6J 5LRSA 1J2XA 2L7ZA 4I7HA 4IEJA 1BIBA 2ZC2A 4KISA 1NG6A 2H09A 1Y6IA 1HC8A 5KK1A 2MLKA 1Z77A 2XGEA 3S16J 3K4JA 3K0LA 1ASZA 4CC2A 1EFWA 1O7LA 4HQMA 2AKWA 2ZJRF 4HDVA 5FU6C 4A3CJ 3CCMT 2DT7B 5LHIA 2RHXA 4DYRA 4H02A 5C4JJ 4XOPA 2GTJA 4E2FB 1NZ9A 2CZ1B 4OIPF 2DOFA 2XI9A 2BE5F 2PZ1A 3HXUA 5CQGA 1M3BA 4FYYB 1VQLA 1C0WA 2CIMA 3UWNA 4Y33A 3FB9A 1N78A 3WGGA 1PSFA 2BZTA 3OYGA 1KQ9A 4EMGA 2RJDA 5DM6F 3FZVA 4ZJZA 3OYFA 2BZYA 3JRIA 3QSUA 2DD4A 2D8HA 4C30A 2J6FA 1RLPC 1LEBA 4UUSA 3S1RJ 4IHTA 1ONVA 1J5YA 4FISA 2C6YA 2CWEA 1AOJA 4J15A 3VS2A 2FUG2 2DEQA 4YRCA 1PM3A 1GGMA 9ATCB 3H9JA 4QPQA 5GMKj 2MW8A 2I10A 4BU2A 1Q81U 1G2BA 2WAQN 1VUBA 1UMQA 1VFCA 4JRQA 2HI3A 4J19A 5FU6B 1AD5A 2DJQA 4IRIA 2EIFA 1DP7P 2IS4A 1VQLI 4IQ4A 3J7YJ 1SANA 3W6KB 2O3FA 2HBPA 1H9TA 4JRIA 2F5EA 1LCKA 1Y56A 3P7NA 3L2CA 2DMTA 2GZWA 1TQIA 2YUSA 1G5HA 4C8QF 1E0EA 5CKFA 4LVJA 1A5JA 5LJ5f 4KNYA 4RTZA 2RHYA 2V1NA 5IYBJ 2K9SA 4M75B 1KFZA 4HG2A 4RTTA 3FXQA 4A3KJ 2EGAA 2HWVA 4WWCA 4OB0B 1KZHA 2QBYB 4ENNA 2A3LA 3OV8A 4BI4A 1O4XA 1PD1A 4YREA 1QLYA 4JJBA 4MMLA 4FHTA 1R00A 5J39A 6PAXA 3JSCA 1D8KA 3HXLA 3EUHA 2GA2A 3LFKA 4G12A 3HTZA 3QXEB 3F8CA 1QP3A 1L0WA 1OCTC 4RDXA 2PQ8A 3HKSA 1V5EA 4I0AA 2KBTA 1Z6TA 2QA4T 1CF7B 2P84A 4FT8A 2JTEA 4PKCC 2VBZA 2FU4A 1V5FA 1X55A 3VSKA 1DU0A 4IRHA 2X3WD 5FGMA 3RL6A 2P6SA 2F6CA 2XASA 2DQ3A 2MK5A 1SFOJ 3K4NA 4M78C 1ULYA 2VT2A 4IF4A 4B1RA 4HCCA 1LJ9A 2LVSA 2M2EA 3KFWX 3CCRA 3K4LA 3WE3A 5DS9A 2MOXA 1D8JA 1W7PA 1Y07A 1V55H 1R22A 3LMMA 4HNUA 1FBQA 1AWWA 1O75A 1LEAA 2VC0A 4XQ3A 2OTLA 4A0XA 3P8VA 3EYIA 4QVCA 3IRQA 3OYEA 2FSWA 1K8AR 3O3KA 2HL3A 4D0PA 1MBHA 3HOUJ 3K6GA 1RC9A 4KIGA 1WWXA 2LX7A 3S1NJ 2M51A 1JJ2P 3OYKA 1H8AC 3P8DA 1L3LA 2KNBB 4D7NA 3WU2C 5BOXA 1D1BA 2XAUA 2LYCA 1IO2A 3CCRI 2R7ZJ 5GJWB 1A6QA 4I6ZA 2FRYA 3HXZA 2WY8Q 1OYIA 1TU0B 5L3GA 3HKZA 4M78B 1X6GA 3JRZA 3BP8A 2RHZA 3FKIJ 1UGSB 1X1DA 3WU0A 5DCMA 3VS6A 2JUFA 3TSZA 3SWNA 2STTA 2ZINA 2VGMA 4A3GJ 1E1TA 1IRGA 3MEAA 1B72A 1RI9A 1TC3C 2RQTA 4BBRJ 3M0PA 2LG4A 2J3MA 1I6XA 5DLQE 4V2GA 2ENMA 1YJNQ 3SZGA 3FKJA 3I5RA 1E6HA 1LPLA 3GXOA 2LF8A 2G7HA 1K9MR 4ZNXA 4E7LA 2YUNA 4Y4RA 2JA7J 2EYWA 4RLFA 3LC0A 2QEXI 2F2VA 4HNVA 2JJ9A 5GAOq 3PGGA 3QYHB 3V8JA 4CS3A 1A6IA 1VQPA 1Y0UA 3OYJA 1RLQC 3P8BB 2GM4A 1PG5B 1NYRA 3VKIA 3TUPA 1SC7A 3BDLA 3HUGB 4XKVA 4LGWA 3UGTA 2HZDA 2Z16A 2VASA 4LNSA 1ETVA 2Q0OA 2DTHA 3WGIA 2SRCA 4F17A 5L3DA 3CCJA 1MZBA 1FTTA 2DRMA 4YRLA 3TREA 4LLGF 4ENJA 2ZGWA 5CVUA 5GMKi 4I09A 2EFIA 5M3FJ 1HSJA 1JB0E 1RI0A 1YWOA 2F5KA 4HCKA 3PFSA 1JJ8C 4A69C 1Q7YC 3HPGA 3UA7A 4EM2A 1HSQA 5E18F 1XC5A 2K6DA 4IRGA 1BIAA 2C8MA 4B8XA 2ZIMA 4G7OF 8AT1B 3MEWA 4ZN3A 4XLAA 3H5AA 1PP8F 4RS8A 1YHQA 2ELJA 2CUJA 4F16A 5E8GA 4XBFA 2LJ3A 1G3TA 3E6MA 1B70A 1W4MA 4U88A 4Q5SF 2R7OA 3VS0A 5LJ5h 1FEXA 1VQ6T 5K5QA 4G7ZF 2O6GE 3A1YA 1USSA 2GOMA 2RJCA 4EV0A 2Z0WA 3J81Z 5M5YJ 4OMPA 2JA2A 1IREB 2A05A 1Q86R 4NNJA 3CPFA 2B8AA 4C5IA 3CCJI 2MBFA 1Q82U 1ZLMA 2X4YA 2PUOB 3OYHA 2AK5A 2L0KA 4WCIA 2V6CA 4DGWB 1F1BB 1HKSA 3CC7Q 5LJ3g 3VQXA 1TUDA 3I55T 3EH1A 1G6NA 4IUPA 2ZXJA 4UXNA 1XGNA 1FLIA 5H6RA 2R57A 1RAHB 3HFOA 5TRDA 4AM3A 4N4IA 4DOWA 2E71A 2IJLA 2OZUA 2LY9A 1K73U 4GDFA 4D8DA 2DNUA 4QKUA 1WJEA 2R7FA 5GAMd 2FEIA 4BB7A 1X4OA 2KE9A 4NCXA 2RN7A 3BZCA 4LOCA 3NRVA 4PLLA 1QGPA 4QT7A 3BC8A 4MDWA 5ILUA 5BS6A 1W1WE 2I4MA 2VC8A 3WTZA 1VQ7Q 2A07F 1R5GA 2KZVA 3BJAA 5DY9A 4OF1A 2Z3YA 5GANg 1V5GA 3PFYA 1E3HA 1XGSA 1S7EA 1M8VA 3DPLC 3HXWA 1T2KA 3DKMA 1HDPA 3G4ST 1BR2A 1J75A 2OTJI 3Q9SA 1ETQA 3FXOA 2LP0A 5H2FC 1TWBA 1JUSA 3HBLA 2JN0A 4XU3A 4IUTA 4J6WA 3G4SQ 2GQVA 1GRIA 4PJOG 3N5BB 3LAPA 2BHZA 4YROA 4CH5A 1M2VB 4M71A 4OIRF 1KSWA 2R7UA 4XKCA 4N9IA 2ARSA 3HSRA 2CZ0B 3C95A 2BTTA 1FSHA 4BJTA 1X2NA 1SVLA 2LBFA 3INZA 3T0YA 4XRFA 2QGGA 5GAOm 4YRIA 1TWCJ 4DBRA 2YWWA 2Y30A 4BE0A 2IVWA 2DXBA 3SHFA 1FMVA 2EIKH 3CC4T 1GV5A 2YX7A 3H3UA 2DFUA 4MO7A 3CLQA 3BTIA 1J09A 2EYZA 3GTLJ 4KT0E 4BL0B 2KRNA 4M77E 2Y4XA 3IKLA 2A7YA 3T9NA 2JS0A 3R4KA 1PCXA 5GAN7 3F6OA 3HM5A 3KLOA 1M5Q1 1U8BA 1ACMB 1USYA 2F69A 4ZZLA 3PFIA 2FF4A 2XAGA 4EM1A 3A8OB 1ZGJA 4F7ZA 3RDIA 2P8TA 2CUDA 2L54A 1NLOC 2K7AA 1MNMC 4WJ4A 4BY6C 3RZDJ 1D0XA 1I1GA 3VYUB 2WC2A 3H9NA 4CICA 2HDAA 4AYBA 4RQFA 3QG1A 3QZ5B 1HDDC 3CMQA 2DK3A 3EUAA 2NUPB 1NPPA 1QVTA 2A37A 4AUXA 1OI1A 1RUNA 2RNGA 2V9KA 2YU9J 3S6WA 1Z6RA 4OGEA 4A63B 1T38A 1EOVA 2L8DA 1IGNA 2CV1A 3CCLT 3E9GA 4QPOA 4OINF 5J3LA 1QW1A 3HKZN 5B5EC 4TV7A 2EQIA 4FYXB 5D6WA 2BV6A 4LJZF 1V29B 4OAYA 2V4JC 1WYDA 4BGDA 3FJ5A 2FZCB 1MBJA 5M5XJ 1ZUYA 1RPWA 5GAN4 2WV0A 5HLHA 2XF5A 2PVGB 2V9PA 2VQGA 4ZH4F 1TQMA 3VDXA 1FYNA 4NB5A 5C44J 5C3EJ 4M78D 5K5OA 1K78A 1VQOA 2L2PA 3HL2A 3CD6I 2RQQA 4C8QB 5CVIA 2JA8J 2ZCWA 2RF0A 4Y91A 1TWHJ 2QQSA 4BY6B