3RKYA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkyA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkyA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkyA02
1HKQA 1ON2A 5GMKh 5GAMg 2G7HA 3FB9A 3SB2A 2QQBA 1L3LA 4L0ZB 4LG0B 3CMQA 3IRQA 2CJ9A 2ZMEB 2WWYA 1ZRFA 4EVIA 4KICA 2FE3A 3F6VA 1SD4A 1KQ0A 2ZR2A 1K78A 1F5TA 2IRFG 3ZN0A 2ETHA 4UV9A 1R36A 2HQRA 1SAXA 1D3BA 2XASA 4XU2A 5GMKl 3GEZA 4PCQA 5BOXA 4GXOA 1IXCA 3M4GA 1JRIA 2VXZA 4LJZF 4Y15A 1SFUA 4M78B 4M77C 1EH7A 3KFWX 4J6WA 2EV6A 4MMKA 2RHSA 3QU3A 4XTVA 4OP0A 3HUGA 1YS7A 5LJ5d 3GIBA 2GXBA 1SESA 4OOIA 2P0LA 3M4PA 1L0WA 2RN7A 1XGNA 1BBWA 2BBYA 4BXUA 5BPDA 1HQCA 1IN8A 1TTYA 1LQ1A 3F8MA 1RIOH 1T6SA 2VN2A 4YRPA 1O7LA 4YIIA 3DP7A 1FWZA 3V7RA 3QU6A 1BC7C 1GHCA 3O2PE 1M8VA 2RGVA 5HS8A 2DW4A 4B8XA 2ZT5A 1Y0UA 1XGSA 2ARUA 1ON1A 1FBQA 2FSWA 5ILSA 1FZPB 4XSXF 1J2XA 1O7FA 3RI4A 4KR2A 4IJAA 3GXOA 3RTRA 1UCRA 1XN7A 4OIPF 3L2CA 3QSUA 3U2RA 4HX4A 2HYFA 5CJ9A 1KMNA 4XTUA 3H3ZA 3Q9VA 3F8FA 2DXUA 4HWPA 3J7AO 1ATIA 3A7AA 4YRLA 4ZZDA 3K2ZA 5LJ3g 5DY9A 4WXDA 4N9IA 5GAOm 1TNSA 5GMKj 3GFLA 4M75A 2BV6A 1WLEA 1ZREA 1ZLJA 2GIVA 5GAOr 4G7ZF 2ESNA 1TQIA 2M87A 1AOYA 2ISZA 3ECHA 5GAMf 2P7VB 1IXSB 4AD9A 3PFIA 3F8CA 2PMEA 2FEZA 2FF4A 3MFKA 1D3BB 3INZA 3F21A 1FX7A 1IN5A 3HYIA 3HXVA 1M5Q1 4RS8A 4CXFA 3CO6C 3E6MA 1D3YA 2RVCA 5LJ5e 5JI6A 4UHTA 4R79A 4M77D 2D2WA 2V79A 4UP9A 2RHSB 2KKOA 2UZKA 1HW1A 4DQ2A 3HFNA 4RDXA 3I7FA 4EX5A 4NL3A 2DJZA 4AIKA 4LLGF 3QAHA 3HXWA 2M8EA 3M9AA 4PG3A 3GFIA 1QQIA 2QQ9A 1JBMA 4TVAA 5D8LB 3SWNC 1LYLA 2CJAA 3ZMSA 5K1PA 4KIGA 4J5YA 4YCVA 2DPUA 5ED4A 4ZH4F 4ENKA 2W57A 1B8AA 4P3OA 1LNWA 3WU0A 3CO7C 4Q6GA 1YG2A 4P96A 3RPUA 4MTEA 1Z7UA 4XLPF 3LQQA 3IKLA 2ZFWA 4V2SA 3HHHA 4XTYA 2Z3YA 3BJ6A 2VBWA 2XROA 5BQTA 1WQWA 2ZBKA 4M73A 4C8QF 4YRQA 5GANh 4BNCA 4DPGA 5HLIA 1B7YA 4EJWA 1CGPA 2NNYA 1TW2A 2OAZA 4P5OA 4CS3A 3DXJF 4M75B 3D0SA 4P73A 1H9GA 4CS4A 4LLLA 12ASA 5LEJA 2Q8KA 3REUA 4R1HA 4DNCA 3RESA 5LJ3f 2ZTGA 2ZZEA 4YFXF 2OZUA 4IRGA 3F23A 1EV7A 3IC7A 2XV4S 1USYA 3CUQB 1I6XA 1FP1D 2ZCWA 1FSHA 2ZCEA 2RA2A 1XD7A 4TVYA 2W84A 1MJ9A 4ZYDA 4C8QE 3CTAA 1Z6RA 5GAOl 2RQPA 2I4LA 2Q0OA 2PMUA 1H9TA 2CIMA 4OU0A 3KP6A 4LD5A 1BIBA 1FSEA 4XLNF 3HHGA 1HTTA 1D8KA 1YYVA 2O61A 2XUBA 5GAN5 1Q1HA 3BPVA 5HVQC 4NQWA 5HGQA 3I4PA 2P5IA 4TVAB 1B76A 3DV8A 4M7DF 4L5JA 4M7DA 2OD5A 1EQRA 3JB9F 4EM2A 3TDZC 5L3GA 5DV5A 5D4RA 2F5EA 5HLGA 4JRKA 3GF2A 3JSPA 3TEGA 2YLCA 1MDMA 4HOBA 3T8TA 5JR3A 1IN4A 3HRSA 1TBXA 3ICAA 2HQNA 3MQ0A 2DVEA 2AS5F 3PCOA 1X3UA 1NHAA 3FIFA 3JB9J 5KK1A 5D5UB 3HIFA 4M9SA 5J8FA 4LK1F 3W6JB 3EYIA 1Z9CA 3A31A 4H2VA 4XTWA 4XEMA 3JTGA 3P8TA 1B7YB 2GAUA 4KT5C 5GANj 1QF6A 1L0OC 2HFHA 5E1ZB 4M7DE 2E65A 2ALYB 1TNTA 4L87A 4U0YA 1EFWA 1R23A 3IALA 4G9YA 4KDPA 1WRJA 1FYMA 1PYSA 3GVAA 4FX4A 4M77A 1H4TA 3MCZA 2QTXA 1TQMA 2P4WA 5EEHA 5LRSA 3Q9SA 4C8QG 2I2LA 3S2WA 4RB2C 4H2XB 2DU9A 2ZZFA 2RKHA 5TJJA 4N0BA 2VOPA 4KIFA 3BP8A 4LLNA 2DU7A 4RGUA 2DTIA 1FC3A 5E17F 3I59B 2FXAA 3JB9I 5E8GA 2NAZA 3F22A 1U1SA 4HX7A 3HFVA 1LDKB 4CGZA 2EFPA 2Q7EA 3J81Z 4ZZLA 4GGGA 1DDNA 2E1NA 2H94A 3CDHA 3V7SA 3T1BA 3E6CC 2CGPA 2J5PA 3L4GA 4WWCA 1J9IA 2FBKA 2J3LA 1YW8A 1K79A 3O3KA 5GAOp 2GA1A 1HKSA 1TQPA 2GA2A 2CYYA 3BWGA 4WJ4A 2CW0F 4IHSA 2Q5HA 1XSXA 3KEQA 3A5ZA 4L18B 2ZKZA 3BJUA 4TQFA 4C92F 4RGRA 2EJ9A 2ESHA 5LGUA 2STTA 3KP4A 4P9FA 4KYWA 1KQ2A 2RC4A 2P5LC 4EJVA 4A5MA 1T2KA 1N9RA 11ASA 1R1TA 3ZMDA 3J81K 4EMHA 3G1ZA 4YP0A 1ADYA 1RIQA 2K7LA 3JB9G 3IHUA 4JBAA 2V1XA 4CS2A 4MNUA 3MWMA 1I8FA 2L02A 1KA8A 4M72A 3A5YA 3IKMB 2ODRD 1ZH5A 4D0PA 1I5ZA 3JCMh 4CH3A 4CO8A 3BW1A 4YRGA 4I02A 3RYPA 1I5LA 4XU1A 2D45A 5H20A 2D1HA 3P8YA 2V9VA 2CFXA 2ISYA 3C1DA 4C92E 4I7HA 5H6RA 3RERA 3LAJA 4H2TA 3SWNA 4RB1A 1V3FA 1ODDA 4JUVA 2VBXA 1ASZA 4P9UA 4CH5A 2E5AA 1E1OA 1ZHFA 1S7OA 3FJPA 4M7AF 3HTUA 2VC0A 2P5VA 4YCUA 2QHSA 2EV5A 3FM5A 3GFJA 1HW2A 4Y17A 4LB5A 1WPYA 3L4GB 5ILUA 4KR3A 4X9DA 3HXXA 2L54A 4O6JA 2XAGA 5DD4A 4P71C 3IWZA 5BS6A 2IY5A 2AMCA 3DPTA 4PJOG 4C8QC 1O57A 1NJ2A 3E9HA 4LNSA 1I1GA 2A61A 3JCMf 4OMZA 1HBXG 2JSCA 1EH8A 3I54A 1QBJA 4HZFA 5DEQA 4M7AE 4UVCA 3V8JA 5FLXK 1MJBA 2VE8A 1WYDA 4ZYEA 1S6LA 4TVWA 1UFMA 4L9JA 2UXNA 3HXYA 2B0LA 5D4SA 3NEMA 1ZGAA 3KZYA 2A6EF 3RUXA 2HYGD 1OMIA 5A2QZ 5JFRA 2PG4A 2P7CB 5GAMd 5ICGA 4LFUA 3TO9A 3KE2A 2QM3A 3C3WA 2KJBA 1IL2A 4HDVA 3BOQA 5D8KB 2W85A 4P75C 4C92G 4MQ9F 1C0WA 3I58A 1U3EM 4ON0A 1JHHA 2JPCA 1ZG5A 3CUOA 3SWNB 2ZIOA 1OYYA 2EJGA 1OKRA 2FMLA 3ML6A 5DCFA 2JTVA 4CH6A 4M7DC 3JCMW 1T0FA 2EA4A 2RM4A 2QUFA 1W5SA 5GMKe 4KIBA 5A2QK 3SZTA 3WE2A 3H3UA 3JCMV 1EIYA 4EMKC 4I0BA 2C6YA 3VU3C 1ULYA 1T38A 4HDUA 3M8FA 4I01A 4EQQA 1QE0A 5DCMA 1KU2A 3IG2A 2DI3A 4BHPA 3HRKA 2IY5B 3WE3A 2AMCB 1ZLKA 3HXZA 1SETA 1B9NA 4C8QD 4G7HF 3WTYC 4P55A 4CH4A 1U5TA 1UB9A 4M7AG 1ZG1A 1OYWA 2YX4A 3LA7A 3QP5A 1V4RA 1MGTA 3WGGA 5ICEA 5DUKA 1ZRCA 3KZZA 2PN6A 2EFOA 1RI7A 2YU3A 3E3VA 3EYYA 4G85A 4AH6A 1NJ6A 2XAJA 4XU0A 5L3CA 2DTOA 4H2UA 3EETA 4P74A 1B59A 3VB2A 2HDCA 1R7JA 5GAMh 5LJ3d 1D8JA 2O8XA 1IRGA 2YX7A 3J80Z 3BJAA 4HAMA 1HW5A 4KN7X 1EVKA 1F4KA 4ZYGA 2CWEA 1X55A 3FMQA 1B70A 4WK8F 4M71A 4WI1A 2ZT8A 1FLIA 1YW9A 3QUIA 1XMAA 2FBIA 5DD8A 4HVCA 4KFCA 2XIGA 4M74A 3JB9H 1PUEE 4XEOA 4M7DD 2Y75A 2MH2A 5LGTA 1U2WA 3IL2A 2FOKA 3BY7A 2K27A 3JB9D 5ERIA 3L00A 2QHVA 3V8KA 2O6GE 5GANd 4FX0A 4WXHA 5H6QA 3HTSB 4A0XA 3J80K 4A6DA 2ZO4A 2E10A 3AHUA 3BZ6A 2KIFA 1MKMA 2MD5A 2PLYA 2HTJA 2DU5A 1X2GA 3F3XA 5LJ5g 3GLXA 4C92C 3ZPLA 1K78B 2DZ9A 2G4CA 4L9VA 2LSOA 3OOPA 5JVTA 3FHZA 4LMYA 4Q15A 5D5XB 1LJOA 2MLGA 1IRFA 1J5YA 2E1CA 3LC0A 2ZJ2A 1NJ8A 4YRCA 3TO6A 1XMKA 3WODF 2F5DA 1BJAA 3CLOA 5LBQA 4E70A 1O3RA 3P9CA 1IW7F 1B9MA 4M6YA 2ZINA 2QLZA 2DEQA 4HWRA 2DQRA 3IRRA 3LAPA 1QNTA 1N9WA 3HRMA 4UXNA 1W66A 3MEYA 4G7OF 2RHQA 4HW0A 3LA3A 5LJ3h 3E5UA 4NB5A 3TUPA 4GO1A 5F1RA 1G5HA 2V6CA 3WTZA 5GAMj 2ZT6A 4RCBA 3ZP5A 1G3WA 2ADUA 3O6BB 1IUYA 2K57A 2M45A 1NJ1A 2EV0A 4EJUA 4M7AC 4UVBA 5BMZA 2H27A 2Z33A 3KP3A 2W24A 5GANe 2M5WA 3BPXA 4P71A 2YSRA 3VODA 4WJ3M 2FBHA 1CF7A 2ZR3A 3L1AA 3WTVC 5J6XA 4C8QA 2MLKA 5GAOq 3KP7A 3QPTA 3ULQB 4ESFA 3F8BA 3ZMTA 2VOOA 2ZNJA 3QTCA 1LDJA 2O0YA 2OA4A 3T5XA 3I71A 4G6DA 1TW3A 1YO5C 4G84A 4I09A 4CYDA 4C92D 2ARSA 4BH9A 4ESBA 3IWFA 3HY1A 4EGZA 1Z6TA 1XDSA 2RB6A 3ABUA 4ENMA 3DF8A 2VE9A 3VFZA 3RJPA 3AAFA 2OQGA 5HDNA 5LJ5f 1E17A 4PNOA 1GXPA 2PJPA 4CHUA 4K87A 2FU4A 1KU7A 4YRIA 1EVLA 6PAXA 2HS5A 2J5OA 4P75A 5CVVA 1T98A 1KU3A 4UPAA 5FD5A 1HSJA 2RHQB 2EFNA 1BBUA 1HC7A 1KQ9A 2XAHA 3FM3A 1N9SA 5AIQA 3W3SA 4HBLA 1U6GA 2DKGA 4ETSA 2ZXJA 5LJ3j 5C53B 5GAN2 1R5HA 1Z91A 5AONA 1IF1A 3R61A 2VODA 3EUHA 2EA2A 2CJBA 5D6FA 5D6EA 4TWAA 4XTXA 1X56A 2Y48A 2BEOA 3K0LA 2VT2A 4M7AD 4BHBA 3LFKA 4EMKA 2PMHA 2W25A 4ENJA 1EH6A 1A04A 4ZTZB 3JCMb 2FA5A 1YW7A 3P9IA 1I4K1 3BJOA 4YPFA 2LF8A 3VQWA 1Z1DA 1CF7B 3MF1A 1W7PD 3RF1A 1RNLA 3DQVC 1O3QA 2DK5A 2EJFA 4Y91A 1BI0A 4C8QB 5FO5A 4KN4X 3HOSA 1OYIA 3SXYA 2LDUA 5IT9Z 1U5TC 4LK0F 1JHFA 2ZXFA 4H2SA 4K88A 4YREA 5D5VB 2DZCA 3PQKA 5DUIA 3G73A 1B34A 1F1ZA 3LA2A 1BOAA 1USTA 2ZZGA 3EQLF 2AXLA 2ODRC 2LF7A 5C52B 5E1XA 4FT8A 4O3MA 4ESJA 3NETA 3TGNA 3JCMd 1ZG3A 4XU3A 1LB2A 3TOBA 3K69A 3A32A 4M9ZA 3N4MA 3P8VA 1H641 4AIHA 2FMYA 5K5QA 4J6YA 1G4DA 4IPAA 3RACA 4P74C 4HQMA 1MGQA 1H4VB 4PJOF 2DPDA 2OU2A 4PJOA 1JJCA 2OQRA 1G3TA 2E41A 2JN0A 2P6TA 4EMGA 4HQEA 5IT9K 5L3DA 4RAZA 2IA2A 4HX8A 4IF4A 4NL2A 2PFBA 4MEYF 4H2YA 3RIRA 3ROUA 4XTZA 3KFUA 4M7DB 3BFMA 5KVRA 1EOVA 4HV5A 2PBIA 2RV8A 4U88A 2E3CA 3VQVA 1DPUA 5GAN8 1MDMB 4UV8A 5E8IA 3ZMZA 4P72C 1P92A 3HSRA 3EDPA 3GZ5A 4PJOE 1K6OA 3PCOB 1BI3A 1NYQA 3NENA 1E1TA 1YFHA 1IN6A 1XSDA 4EMSA 2XVCA 3WTUC 4C92A 5ELNA 2HZTA 3HRIA 1VQZA 1JXSA 3LSSA 1BC8C 4P3PA 5ILVA 1LNXA 1FOKA 4E51A 3RYRA 3WU1B 4N9HA 1XB4A 2H6BA 5CLSA 4F7UF 2FYKA 1B34B 4TQDA 3QOPA 4OIRF 3JCMe 1PYSB 2Q2EA 4M77B 4RGXA 4EV0A 2ZNIA 5LGNA 5GMKi 1P6RA 1ZRDA 3NRVA 2GWRA 1KMMA 2EFQA 4U7BA 4GYIA 2LNBA 3PQJA 4A2UA 2ACJA 1J7KA 4U7DA 2GZWA 3RKXA 4X5OA 4RQFA 3QO3A 2VC1A 3W6KB 3JCMX 4G94A 2QENA 3D5LA 4KMFA 4BW9A 5F6FA 1SERA 2FQ3A 2HKOA 1ONVA 1QZZA 1ZGJA 5K5RA 1RZ4A 2YLBA 1G51A 5LHHA 4M7AA 3E6DA 3FMRA 4CZZA 1G3SA 3WTTC 2DT5A 3COAC 1YB3A 4KQEA 4F7UE 1NJ5A 1DPRA 4U0VA 2QYOA 1Z7MA 2HWVA 1R1VA 2VC8A 2NYXA 3BDUA 3KLOA 2FNAA 3I53A 5CAIA 3NEUA 5L3FA 1W7PA 1B1BA 3TDUC 1KGSA 4M9XA 4UVAA 1X54A 1LEAA 3VEPA 3JCMP 2L3DA 2KRFA 3KP5A 1Z7NA 4X9CA 4RCCA 1HKTA 3R0JA 3RGLA 2RNJA 1G3YA 2Z9OA 3HSFA 4HT9A 3GUDA 3OV8A 3KCCA 1H4SA 4IHTA 4YRTA 4CDGA 3K1PA 1WNLA 1REPC 1LVAA 1WKMA 1SD6A 2IJLA 4N0AC 4YFNF 1XCVA 2JPBA 3HRUA 1RUOA 2H09A 3V4GA 4KNYA 4OIQF 4M78F 1KQ1A 5LLQA 1JE8A 1MJAA 3L09A 3M4QA 4RQEA 2ARTA 3SFZA 3JAMZ 2XGTA 1YQAA 3NQOA 4I0AA 3L2ZA 2DXTA 3QHSA 2Z99A 4EGYA 4H2WA 2G9WA 3R4KA 5GAN7 2DTHA 1LDDA 3IKTA 4ZTUB 3ZMVA 3BY6A 3KP2A 2PI0A 4F7UG 4M7AB 2QZ8A 2QVOA 3GYHX 2EL9A 2CSOA 2HR3A 5HS7A 4HLYA 3M8EA 4JRIA 2TDXA 1YCYA 2G7UA 2QQAA 3ZN1A 4UP8A 4M78E 4FHTA 1LJ9A 4YFKF 1W7PB 3JAMK 4S04A 4EM0B 4PZJA 3REXA 3FZVA 2Q7HA 2VBYA 3HY0A 2EFWA 4J6XA 2E7XA 5JHUA 2XKPA 4UNOA 2C7IA 5GAN3 5L3EA 1SFXA 1F9NA 4PHCA 4G6QA 3HTZA 4NHJA 1LEBA 1SMTA 3HSEA 2MBFA 3GWZA 3HFOA 5HDGA 5E20A 3E97A 5GAMe 2O03A 2L4MA 2C8MA 2YPRA 1YFTA 3M7GA 2HGCA 3MZHA 3JCMQ 3K9TA 2I4OA 4JK1X 2F5CA 4PJOC 1P4XA 1Y96A 5E1WA 4HF0A 4A0ZA 3WGHA 2DO7A 3DSQA 3HOTA 4RB0A 3ERED 4NOYA 1FY7A 3F6OA 2HOEA 1FP2A 4S05A 1ZN2A 1SMYF 4QWQA 3FWEA 1FBSA 4B09A 1E22A 4HWOA 1QO0D 5CVUA 4OINF 4U0WA 2CQKA 1TH7A 1ZYRF 1QPMA 2UWMA 2VXEA 1EIYB 4M78G 1GGMA 4P72A 4A0YA 3GW2A 1KYWA 3SQNA 2A6HF 2DLLA 1WU7A 4QVCA 5DCMB 1RUNA 4YYEA 1STZA 1NYRA 4KMUX 3FXQA 1IXRC 2H6CA 4HWTA 1KYZA 1ADJA 1S3JA 1FYFA 1YIOA 4I98B 5EEGA 2CO5A 4PGHA 4Q4ZF 2X4HA 2FB7A 1U5TB 2ELHA 3IKVA 2JRTA 4M75F 2AKWA 1WWXA 4YDQA 1HSTA 2K4BA 1MZBA 1JGSA 4WXCA 1XGMA 4EJOA 2HKXA 3R0AA 4JQFA 4AVPA 3SZPA 1D5VA 1R22A 5I21A 2FRHA 4A6EA 1O3SA 2Z5UA 3QO8A 2VBZA 5TRDA 2XRNA 3FXUA 2RD1A 3UGQA 1BIAA 2EJRA 5LJ3e 1XDUA 3JW4A 3ZMUA 3CUQA 2A68F 5GAN4 4J15A 5D5WB 2DFIA 2HEOA 1FNNA 4XQ3A 4Q47A 1UHMA 1P2FA 5GANg 1Y96B 4PJOD 1IZ1A 4OLFA 4L5IA 2F2EA 4R8HA 3HSBA 2KIMA 4YIFA 5LJ5h 2V1DA 4BYYA 4M75E 4BHCA 1B70B 1PP8F 2R3SA 3WTSC 3P7NA 1MD0A 3WQZA 4Y13A 1FT9A 2DQLA 3QNEA 1FBUA 1R58A 2UXXA 3I5UA 1SD7A 3L7WA 1S29A 2QBYA 2XKOA 5ELOA 1TLHB 3U9GA 3TOAA 1P4AA 5LHIA 2MC3A 1O3TA 2M30A 4YRJA 1YLFA 4EO4A 2NNNA 3JSOA 1H4QA 2IT0A 4UP7A 2DK8A 3E5XA 1VTNC 4JLIA 4YRNA 3I64A 4MHGA 1QZYA 2OBPA 4WX9A 1XCBA 1J75A 5FD6A 2MA3A 4MEXF 4XBFA 1UHWA 2DQ0A 4A54A 3REOA 5GAN6 2AKWB 1H0MA 4YRSA 2XAFA 2WC2A 2ALYA 4N0AA 4RB3C 4HF2A 2FNPA 4MTDA 1U1TA 2P8TA 3GO5A 3RDIA 2WV0A 5F64A 3VQXA 1R5GA 4HV6A 1J59A 1ASYA 3U1DA 4M78C 4RAYA 2D1VA 5HDKA 3WG9A 4BQAA 3BDDA 1I1SA 2Y90A 2CGHA 1WQ7A 4H2XA 1FYLA 4Q48A 2ZIMA 5CYVA 2E1HA 1BM9A 3H92A 2YHTA 4A12A 1IAWA 4M75G 3UH0A 3K1MA 4AIJA 4O5VA 3JTHA 3P9KA 1ZARA 4CICA 1R1UA 4MGRA 3WTXC 3PGGA 2WTEA 1J0RA 2NS0A 4WF2A 3I59A 5LJ5j 3UGTA 2IP2A 5GANf 1YS6A 2EWNA 3I0TA 3GX4X 2Q7GA 2CG4A 2A69F 3A7RA 3FX3A 4YRFA 2DBBA 1C0AA 3VBBA 2QBYB 3TQNA 4AWXB 2DDZA 5BPIA 4L0YB 1SD5A 4M6XA 3TO7A 1FYKA 2A07F 3HFZA 1DP7P 4ZYHA 3BROA 3GZ6A 2P5KA 4MMLA 2DTRA 4HA8A 1T39A 3VOEA 5FFZA 3QRFF 1DUXC 2JZYA 5DDGA 3QP6A 4L9TA 4A5NA 3E6BA 2K86A 4F7ZA 2V1UA 2A5YB 1YFSA 2NRAC 3WTWC 3KETA 5KNNA 3L9FA 2Y0MA 4O2DA 3JCMc 3RKWA 1OPCA 2E64A 5HS9A 3LSQA 2QHUA 4M77F 4ZIBA 1K7AA 3B02A 1IN7A 2DAOA 2IA0A 3MF2A 4M78D 2GXGA 5K1YA 2MH9A 3R6SA 2OZ6A 4HWSA 3MZYA 1G5IA 5CVRA 3G3ZA 3HRTA 1HK9A 4QVDA 1LOJA 2XGXA 4HLXA 1BBYA 3VQYA 3LWFA 2E7WA 3FF5A 5LRRA 1NNHA 5ICFA 2VT3A 2I4MA 4GYGA 3TEHA 2KJCA 1Z05A 4NCXA 5CVJA 2X0LA 3V7CA 4EMKB 2M1BA 4WCGA 1B4AA 1GXQA 2RDPA 4M77E 2J3MA 1U8RA 2ZT7A 2HNIA 3CJNA 5DYMA 1PDNC 4OMYA 2XAQA 1QGPA 4G8XA 4PDKA 3JCMg 3HFZB 5CVIA 2R7DA 3OD1A 4ASNA 3KLNA 4H02A 4I2OA 3QO5A 1W4MA 1X01A 3M1EA 4XRFA 4GCVA 1XGOA 5IT3A 2A3SA 1USSA 4M75C 3SHFA 4TTVA 4L9NA 3MEXA 3T0YA 3K1NA 4F7UA 1YGBA 2IA1A 4YCWA 1KQ8A 4YRMA 4M7DG 2STWA 4IVNA 4K2EA 4IXAA 2PMFA 4YG2F 2PQ8A 1BN5A 1SFEA 3EFRA 3NELA 4YRRA 3MAJA 1U78A 3DFGA 1KOGA 3CUQC 3C7JA 2EK5A 3FMSA 4HT8A 1KU9A 4KUMA 4UUVA 5LHGA 1P4WA 3R60A 2QWWA 5FB2A 3R07A 4PJOB 3RPQA 1JJCB 3WGIA 4OIOF 3JCMJ 1AWCA 1X2HA 3LQRA 3HXUA 2K02A 2BYVE 3B73A 4KA4A 4YROA 1WSUA 3V8LA 5K5OA 1FPQA 5HLHA 3E5QA 5E18F 2ZNYA 4XSZF 3RL6A 3TEHB 4ENNA 4LB6B 1SRYA 5C51B 1YTYA 3UFGA 2KIUA 2COMA 3A7UA 4Q5SF 5LEKA 4M77G 4HYEA 2Q5IA 5GMKm 5FLXZ 3DKWA 3F8NA 4PGGA 3FXRA 1PP7U 1BI1A 1WI9A 2VONA 2XTIA 2HTSA 3A74A 4LG0A 4C92B 3KEOA 1E24A 5E3IA 3F72A 2EAYA 2ZMEA 2YR2A 1HXDA 5K1XA 5FFXA 2JT1A 3ABTA 2LKPA 4A53A 2GQQA 1J5WA 1YFRA 3RKYA 2F5FA 4Z2YA 1E2XA 1XSVA 3ISPA 5J8CA 3ZQ7A 4BAYA 4H0EA 2BGCA 4M75D 4P73C 2ZGWA 4RGSA 4F7UB 2O3FA 4EM1A 2QHTA 2BE5F 1GVJA 1G6NA 2VXFA 3ERRA 3T8RA 4BWAA 1W5TA 2EB7A 4M78A 5HOOA 3N97A 4HF1A 2R7FA 1USYC 5L3BA 4MQVA 4LGWA 4RMFA 4QLCU 2ZNZA 3EFSA 2DQ3A 1B6AA 3C18A 3DPLC 3PZCA 3Q5FA 1WQ2A 5GAOn 2L01A 2L4AA 4IRIA 1I81A 2IW5A 5F5WA 1OR7A 4YRKA 2K4JA 3ELKA 5ICCA 2P6SA 1BI2A 3QPHA 4TV7A 2IPQX 3GFMA 4IRHA 4P3NA 3LSTA 3E9IA 2PEXA 1S7AA 2XHKA 5FGMA 2I4NA 1I27A 2IVMA 1ZAOA 3ECOA 3DEUA 4K86A 1R00A 5AIPA 1S8NA 3TKYA 4EJTA 3QO7A
chains in the Genus database with same CATH superfamily
4Q5WA 1VQNI 3ASOH 4CUGA 3FKJA 2KQWA 3C94A 4L0ZB 2CJ9A 2LYCA 2K9NA 2MCNA 3S2DJ 1WHHA 3F6VA 3FDYA 2KQRA 4ZN3A 3K4LA 4RA2A 4PK4A 2ETHA 3G2BA 3CCEA 2FOWA 2ESWA 1D3BA 5KYYB 2JXBA 1IXCA 4AT1B 1H92A 3ZQHA 2CYZB 4AFQC 4M77C 4OMMA 3WU2C 2DRKA 2DDBA 3KFWX 2EV6A 1E3OC 3QU3A 4XTVA 3HUGA 1YS7A 3GIBA 1XGNA 2KDZA 5HK0A 1HQCA 5FKNA 1LQ1A 3F8MA 4N4GA 3CMMA 3QU6A 4ANJA 1WHLA 3S1MJ 2DW4A 4KITB 3VS2A 3G1OA 3OWTA 1FBQA 2DO3A 4M3FA 5C6SA 2HU9A 4XSXF 1J2XA 4KR2A 5J47A 2F2VA 4LXCA 1XN7A 4OIPF 3JRCA 2P0PA 4XKCA 5CJ9A 2DA9A 2IGNA 2M1HA 2DFFA 2DT6A 4HWPA 3K2ZA 2Y31A 5LJ3g 2Y4YA 4C9YA 3S3OA 4WXDA 4N9IA 1M90U 4ZJZA 3KBGA 1TQIA 4BI4A 1AOYA 1VQ8A 5F27A 3NFCA 2P7VB 1EKEA 3TL4X 3M1CA 2XI9A 4X1VA 1GXIE 3INZA 1QCOA 4OF1A 1M5Q1 1T0JA 3OYLA 3CC7Q 4RS8A 1XS9A 5JI6A 4R79A 2RHSB 1PKSA 4DQ2A 3HFNA 5J4VA 2DJZA 3BE3A 4PG3A 3HKSA 5FKOA 2QQ9A 2WBMA 3SWNC 1LYLA 4J5YA 1H89C 2LY2A 3EGXB 1B8AA 4JS5A 4P3OA 2OTJA 2PVOB 1XTDA 3E19A 3WU0A 3CO7C 4Q6GA 1YG2A 2HI3A 4RUGA 3M0TA 4MTEA 1AEYA 2DIGA 1D1BA 3LQQA 2J6KA 4XTYA 3BJ6A 4J9HA 3VUBA 2LMJA 4BQNA 3DWLE 1JUPA 1K9MU 1YNZA 1QHHD 4LUEA 4CC7A 1Z7LA 2QASA 1H9GA 1OCOH 4LLLA 5LEJA 2Q8KA 3S15J 4S0HB 2ZTGA 2A3LA 2ZZEA 2ATCB 4YFXF 4IRGA 2R7RA 1I1JA 1EV7A 3OW2A 1KK7A 4JJNK 3CMEA 2J6OA 2ZCWA 4XR6A 1SEMA 1U3OA 5FWBA 2DMTA 1IHWA 1ORKA 2GFAA 2I4LA 2CIMA 4XLNF 1D8KA 2RK2A 4KJZA 2V8KA 4NQWA 4TVAB 5FRNA 4M7DF 4IKFA 3BG7A 4L5JA 4M7DA 2DOEA 1YE9A 3X26B 4FYWB 1T0FC 5DV5A 2KRCA 1FOXA 2YLCA 1MDMA 2KZVA 4HOBA 1BR4A 3T8TA 3HOUJ 2QK0A 2D0NA 3GNGA 1LFPA 2KRSA 2JA6J 5IOYA 3FIFA 1SSHA 5D5UB 3HIFA 4GFBA 2D5VA 3A31A 3JTGA 1B7YB 1QF6A 2JNGA 1L0OC 2DNUA 4M7DE 2ALYB 1F36A 1R23A 4G9YA 1UEBA 3FHNA 2FRWA 1PYSA 2KDOA 2Q1ZB 1TQMA 2JVHA 1VYVA 3I56Q 1YCSB 4E2FB 2OTLQ 3OA6A 2ENMA 1WJAA 1X2KA 1Z21A 2MSYA 4N0BA 4N4OB 4KIFA 3BP8A 2DTIA 1WJQA 1FC3A 3PTAA 2XU8A 4ATOA 2FXAA 3JB9I 5E8GA 2E1MC 2Q7EA 4JOMA 2E1NA 3T1BA 2CGPA 1PRMC 3WHBA 1MMAA 2K9MA 1JJ2A 3NPFA 3K7AJ 1YITI 1H3HA 1OOTA 3BWGA 3DB3A 2CW0F 3TVTA 1QMCA 1XSXA 2XF7A 1BA5A 4JJDA 3BJUA 1W6XA 1XQHA 4MFEA 4KYWA 2GQIA 1NK2P 11ASA 1R1TA 1ADYA 2CFOA 3CZ6A 1MIJA 2AKKA 4CS2A 4BY1J 3MWMA 2CQXA 1VQ9T 2X1DA 3P5JA 2CH4W 2D45A 5H20A 2V9VA 3KXTA 4MIMA 1G59A 1WZ2A 5GPCA 1ODDA 3TSZA 1WLPB 2JOYA 1S7OA 4M7AF 3HTUA 2EINH 1YHQA 3VJPA 3UNGC 3BR0A 5BS6A 4N4HA 2W82A 3E9FA 2AMCA 3DPTA 4PJOG 1NLPC 1O57A 1J3TA 1TWFJ 2DERA 1NJ2A 1QVTA 5FU6B 4LNSA 1WCMJ 1NPRA 1KONA 4HZFA 1GLNA 4M7AE 1LCKA 2VE8A 4Y7NJ 4L9JA 2UXNA 1IC8A 2B0LA 5D4SA 2HYGD 1OMIA 1W36C 1M30A 5A2QZ 5JFRA 4J00A 5IY5H 5ICGA 3I56T 1LE8B 1YJNQ 2QM3A 3C3WA 1HDDC 2KJBA 2NVXJ 4HDVA 4C92G 2JPCA 3PFYA 2ZIOA 4BY6B 2O7OA 3LYIA 2M7AA 3JCMW 1Q86U 2EA4A 1W5SA 2VJJA 1W1FA 3FK7A 2V8IA 1OCPA 5A2QK 2L5QA 4DA4A 1K0XA 2LQNA 3JCMV 4I0BA 4F55A 4HDUA 4I01A 1B7TA 1KU2A 1Y7XA 1X2NA 3IG2A 4Y4RA 4BHPA 2PJRB 2IY5B 4RTWA 2L7MP 1B9NA 1D5YA 2DVJA 5FWCA 1AA7A 2YX4A 1Z77A 3QJYA 3LA7A 3X25B 2DDAA 2QQRA 3FXJA 4BY7J 4AYBN 2KRMA 3KZZA 2EFOA 4G85A 3EYYA 4HKEA 1M1FA 4KGZB 2XB0X 2XAJA 3X24B 3FEOA 1M90C 4P74A 2L9NA 5LJ3d 1WJFA 3DEWA 4HNTA 2HVSA 2WAFA 4HAMA 4LVJA 4KN7X 4E7JA 1EVKA 2HVQA 4ZYGA 2OAWA 2CWEA 5IHIA 3EG3A 4WK8F 1SSFA 4M71A 3CCVI 1NM7A 3QUIA 4HVCA 4KFCA 2R7OA 5KCOA 2DMUA 2Z0WA 3CC4Q 4M7DD 2Y75A 2LREA 5F1JA 3BY7A 1U2WA 2K27A 3L00A 5H6QA 1SFKA 4A0XA 2E10A 3BZ6A 2HDWA 1D09B 1ABQA 2ID3A 2HTJA 2LNHB 3EAEA 1YWOA 5LJ5g 3GLXA 3QYBA 1WHJA 4C92C 2NS6A 1K78B 4L9VA 1VQPI 3FHZA 4FIBA 4BKXA 1AHDP 5KE3A 2MLGA 1XMKA 3CCMA 4E70A 1O3RA 2A8EA 3VYSB 1B9MA 3FLGA 1WXBA 2O88A 1QNTA 1N9WA 3HRMA 4C5EA 3MEYA 1K9MC 1IJWC 4HW0A 3LA3A 2HQHA 3REAB 1YJNT 1D0XA 1W70A 5F1RA 2W48A 3WTZA 1SRLA 3ZP5A 2VB6A 1AKHA 2VL8A 3J80E 1NJ1A 2EV0A 5BMZA 4DIQA 2Z33A 3KP3A 2W24A 2KP6A 2OPTA 2JQ7A 4Z88A 2RHZA 2JA5J 4P71A 2DA1A 5J6XA 4C8QA 2MLKA 3QPTA 2KFDA 1W2BA 4J83A 1K8AR 3KPHA 2AKLA 3T5XA 2KYBA 3CBOA 4HSRA 5C3EJ 4I09A 1VQ8I 2ARSA 1JUSA 2RB6A 3ABUA 4ENMA 4CC3A 3AAFA 2KL4A 2OX7A 3S16J 2E60A 3RDVA 2MF2A 1Z0XA 3IP4B 4CHUA 4LD6A 1OEBA 4K87A 2A05A 2DK3A 3PVQA 2GOXB 4HPQA 5CVVA 3VRZA 3HDDA 2EFNA 4XK8E 1JJ6C 2LQKA 1U6GA 1V29B 1Z91A 2HMAA 4A3GJ 1IF1A 2CJBA 3K0LA 4M7AD 3QZ9B 4EMKA 3CC4T 4ENJA 3L2UA 1EH6A 1A04A 2IAIA 1WI7A 2LC4A 3JCMb 2CUEA 2LF8A 3PO2J 1CF7B 3MF1A 3RF1A 1RNLA 4C0DB 3OYAA 3MKWB 3EFOB 3EG2A 3HOSA 4Y3OA 4XLAA 5D5VB 3PQKA 1B34A 2X1CA 3LA2A 3M5AA 1WHUA 4ITVA 3NETA 1X3ZB 3JCMd 4XU3A 1PKTA 1KSWA 2JJ9A 3N4MA 3CMEI 3ZFJA 5K5QA 1NJIC 2O5RA 2HSPA 4IHXA 1H4VB 1N77A 2OQRA 1QVUA 2LBFA 1P7JA 4EMGA 4HX8A 4IF4A 1JI8A 1RAHB 1K4US 4W1UA 2LDMA 4H2YA 4E7ZA 3CMAT 5IOZA 5JHFA 3DEEA 1DPUA 2X4WA 1IRXA 2F48A 4N4IA 4H4KC 1WYXA 1MBFA 3RBBB 4HCBA 5DTDA 4XAXB 1BI3A 1NYQA 3MJXA 3JRAA 2AT1B 3RMQA 2HKNA 3A98A 3HRIA 4XMYA 2VKVA 5HLTA 1BC8C 1GUUA 5ILVA 5CK9A 3EUKL 2VV5A 4N9HA 1H88C 4F7UF 1VQ6Q 4I76A 3JCMe 5IT9E 4M77B 4RGXA 1QVGP 4EV0A 2ZNIA 4IHYA 1S72Q 2EQUA 4DBFA 3M53A 2ACJA 4U7DA 2GZWA 5GAHJ 3W6KB 2Z1DA 3G6ET 2BY1A 2EQMA 1M2VA 3IUOA 2ZXIA 4IUQA 1ONVA 1QZZA 5K5RA 4RMOA 1RZ4A 3BCAA 3E6DA 1G3SA 4F7UE 2HWVA 1WGXA 3BDUA 3GBQA 5CAIA 3RZDJ 2V7FA 2XKOC 4M9XA 4RKUE 1LEAA 4XIDA 1YIJQ 1Q7YU 2KRFA 5L8RE 4X9CA 2DYSH 1HKTA 1Q86C 3HSFA 2AIRB 2AXTC 5TISC 2CP5A 1A0NB 1REPC 2ZZDA 2IJLA 1BJZA 3HRUA 2Q2EB 1OU9A 2CREA 4A3MJ 3V4GA 3M4QA 4RQEA 3SFZA 1V5GA 4LIVA 4RDUA 5IXBA 2Z2SB 2XGTA 3VS4A 3L2ZA 3QHSA 2BTTA 2Z99A 4H2WA 1KC8U 3R4KA 5KYUA 4BI8B 2LQWA 1LDDA 2BXZA 4KT6A 4JX5A 2QZ8A 2EGAA 2R93J 2SRCA 1YHQI 3WVDB 4PSXA 1LVKA 3M8EA 1YCYA 2QQAA 4GBQA 1E6GA 4XLFA 1VQOI 1MMNA 3M8JA 4S04A 4ZDPA 1FXXA 3FZVA 2MGQA 1X1PA 1Y57A 1C0MA 4J6XA 3V42A 5JHUA 2XKPA 2C7IA 5GAN3 1BU1A 1TWGJ 1F9NA 1K0SA 5IPAA 1VQ9A 2LRQA 4NHJA 1LEBA 2YS9A 2DJIA 1XNIA 2X51A 3HFOA 1VQ6T 3HKZN 2O03A 1DJ7B 4BB7A 4J19A 2L4MA 2VUBA 4ELZC 1Z67A 3MZHA 3JCMQ 1S72T 1OCCH 2ME6A 1T95A 1P4XA 1Y96A 4A0ZA 1NJIR 3BLYA 3HOTA 3JAME 1YBYA 2HOEA 3A8LB 1FP2A 3H41A 5GAGJ 2R5ZB 1SMYF 4B09A 1A5JA 4BBSJ 1SG5A 1UJ8A 4PFZA 4HWOA 1QO0D 1WHKA 2CSIA 5J4YA 1G5VA 3GTKJ 4DBQA 1EIYB 4XRMA 4M78G 2EYXA 1P7IA 4D8KA 2DLLA 1RUNA 3K10A 2X4YA 3FXQA 1YIJT 2EIJH 1KYZA 2HQ5A 1ZTRA 2VJ4A 1FYFA 4I98B 5B1BH 1U5TB 4M75F 2AKWA 4WXCA 2HKXA 2DXCA 3I56A 3SZPA 1D5VA 3G4ST 5IHNA 4BI3A 3FK6A 5CKDA 2DETA 2VBZA 1XOVA 4DOVA 3FXUA 2RD1A 3AG1H 1ETWA 3CJRB 3JW4A 3CUQA 3I55I 5GAN4 4J15A 5D5WB 2D1XA 4IEJA 1ZX6A 5GANg 1IZ1A 4L5IA 2KIMA 2V1DA 4M75E 1TUGB 2PMZN 4FT4A 4KT0E 1MH4A 2BZXA 3P7NA 3RSNA 1RAIB 3VYRB 2UUZA 3REBB 2WSEE 3RKQA 5E3OA 2QF7A 2J6FA 2DRMA 1QLYA 5E3MA 2NNNA 3JSOA 2MD0A 4JLIA 1D0YA 1IGNA 1QZYA 2ZMEC 1XCBA 1WHGA 2MA3A 1TS9A 4C5GA 1X58A 2WC2A 4RB3C 1B8IA 4HF2A 1U1TA 3GO5A 4F17A 2XPWA 2CW7A 3CCMI 4HV6A 3ME9A 4M78C 4RAYA 2D1VA 2WY7Q 3BDDA 2YSQA 4AG1C 3M9QA 2CGHA 4A63B 3BCBA 3KUFA 2R7WA 3DKXA 4DYQA 1Y8RB 2E1HA 3H92A 4OMLA 4AIJA 4O5VA 2CKKA 4E7HA 4MGRA 3WTXC 2LJ0A 1YFNA 2NS0A 1OR7C 3UGTA 1PWTA 2Q7GA 4QT7A 3FX3A 3VBBA 3S1QJ 3A01B 4QTRA 4AWXB 5IYCJ 2HL5C 4F3QA 1FYKA 2IBDA 2ELJA 1X2QA 1YJWQ 3GZ6A 3DTIA 4RTUA 4M4ZA 4A4KA 2LD5A 3DU5A 2FX0A 5FFZA 1DUXC 1Z9ZA 5DDGA 3ERMA 4L9TA 3MD2A 2BY2A 3TW7A 1PUFA 4F7ZA 3SEZA 2V1UA 5FW9A 2NRAC 3KETA 1QVPA 4CC4B 1UAAA 4O2DA 2RPNA 1YJNA 3LLRA 3JCMc 3WVEB 4DBRA 4M77F 3QDFA 1K7AA 3KIOA 5EF6A 3JRIA 3MF2A 1EA3A 1ETVA 3HRTA 4QVDA 4HLXA 1UELB 2RHYA 2NLUA 3TEHA 2YU9J 4NCXA 2KAFA 2TRTA 3K70C 4M77E 3BTIA 3G71I 1QGPA 3H1CA 1JB0E 4JJCA 3HFZB 4DYCA 4JJBA 2M9HA 3OL4A 1OQKA 1QVGS 4XRFA 3K4MA 2GTOA 5IT3A 2A3SA 3S1NJ 3LX7A 1USSA 3SHFA 1T33A 1LPQA 3K1NA 4YRMA 4M7DG 2STWA 2R7VA 4IVNA 4K2EA 4IXAA 2IXSA 1Q7YC 4KH0B 3DLLF 3AG4H 3MAJA 1U78A 1UZCA 1VQ4Q 3F0CA 1E3HA 2O9VA 3FMSA 1MNDA 4JZ4A 3R60A 3R07A 1HOMA 4PJOB 4D5CA 4OIOF 3JCMJ 3SFIA 3LQRA 3HXUA 1KQSA 4GDFA 3B73A 4YROA 1GBRA 5HLHA 5E18F 4XSZF 3PIOF 4IURA 3UFGA 3A7UA 2EIKH 2L9VA 3W3CA 1QU3A 5FLXZ 1WI3A 4HVVA 3F8NA 2LCCA 1OPLA 3PUBA 1M9SA 2M2EA 1YJWT 2HAXA 4D6WA 4OMOA 4C92B 3KEOA 1RPWA 3F72A 3ABTA 2LKPA 1YFRA 4PLLA 2EFIA 1YITQ 1V5FA 3ISPA 2XDVA 1AWWA 3OL3A 3FC3A 1KD1U 4BAYA 1K83J 4M75D 3OYMA 5CKBA 5KYYA 2EKOA 2WB1N 4XKBA 4MZMA 2BZTA 1IDZA 2VWFA 1ACMB 4ZTFA 5L3BA 2JTEA 4J9BA 3CMAA 2KZGA 1KG1A 1SVMA 4BGDA 1B6AA 2L01A 3MQZA 3QJ6A 5F5WA 5D6YA 3CCJI 4II1A 5ICCA 2P6SA 3HGGA 1BI2A 3QPHA 3VS3A 1Q81R 2H1LA 3LSTA 4DEYA 1X1BA 1S7AA 5FGMA 4RMNA 2IVMA 2DYIA 1R00A 4EJTA 2RF0A 3QO7A 1HKQA 5GAEJ 3RPUD 2QSGX 5GAMg 3SB2A 4XKVA 2QQBA 1M1KU 2YUPA 3IRQA 1MV3A 3PSFA 3K4NA 3DLMA 3QZ5B 1WJSA 2FE3A 1FYNA 2PNIA 2IRFG 3CC7I 1R36A 1SAXA 2DT7B 2XASA 3G6EA 3S2HJ 1DGRM 2X6OA 3M4GA 4LJZF 1SFUA 1YI2A 2RQWA 2X35A 4MMKA 2RHSA 1VQ4T 3M4PA 4IIMA 1SESA 2RN7A 2LX7A 1BBWA 2BBYA 4J9GA 2QDYB 2KVQG 4MO7A 1FWZA 4LVIA 3EGXA 5HS8A 4EEFG 4B8XA 1X75C 2RK1A 1ON1A 4ELYC 2FL7A 2E5NA 4IJAA 3RTRA 1UCRA 2F1LA 2YWWA 2NS7A 3U2RA 3NWTA 2HYFA 1KMNA 4XTUA 3H3ZA 2DF6A 2DXUA 3L1PA 2XICA 3A7AA 5F0HA 4ZZDA 4YRLA 2NUPA 1R0BG 5DY9A 3NTHA 1TNSA 4QSHA 1ZLJA 2GIVA 4G7ZF 2M87A 3VS6A 5FLMJ 1YITT 4XN3A 4GLKA 3TQ7P 4GY5A 4BQQA 4AFSC 2F5TX 4UB6C 3ZQGA 1NPPA 5GADJ 3CO6C 3HC7A 4M77D 2D2WA 2KKOA 4F93B 2UZKA 3TMOA 2M3AA 4ZDLA 4NL3A 3TP0A 3GFIA 4TVAA 3OSGA 2BHZA 4YCVA 5ED4A 4JZ3A 3QQAA 4RBOA 1PD0A 1LNWA 4BEHA 4YTLA 1EJ9A 3CCVQ 5EDNA 4RTZA 4M73A 3H0FA 3MEVA 4YRQA 2RHUA 2LMDA 4BNCA 4QPQA 1B7YA 2E70A 3C95A 2OAZA 4P73A 2BIVA 2ED1A 1S72A 4C0ZA 1NBEB 3I56I 4DNCA 3RESA 5LJ3f 2OTLI 2OZUA 4AUXA 3F23A 4FYVB 1O75A 3IC7A 2XV4S 1TWHJ 1ZA2B 1VQPQ 1I6XA 1FSHA 2W84A 2Y0SN 4ZYDA 4PJJA 2CUFA 4FSSA 3CTAA 1NG7A 2KI7A 2RQPA 3H5AA 1H9TA 1OCRH 4LD5A 1OCZH 1HTTA 2O61A 2XUBA 1Q1HA 3BPVA 2X4JA 3OYKA 2NUTA 3MEAA 2E3IA 3GNFB 1IG7A 1X19A 2F5EA 4JRKA 2KT1A 4N4NB 3JCUC 2XF6A 4FISA 1TBXA 3ESWB 2KROA 2DVEA 2CH4A 1X3UA 3JB9J 5KK1A 3G4SA 3OBYA 4LK1F 3W6JB 3EYIA 1Z9CA 3P8BB 3CCSQ 4XTWA 4XORA 4H2VA 1GV5A 4KT5C 1QQJA 5EGOB 2HFHA 5E1ZB 2Y9YA 1TNTA 4L87A 2JM9A 2ZFUA 2HD0A 3IALA 5KCHA 1WRJA 3J7YJ 2W4SA 4IIOA 2JT4A 4J9EA 2ZJPF 5D6WA 2GLOA 4BE1A 1IZ6A 2E6ZA 3HL8A 4C8QG 3SEMA 2I2LA 2KGTA 4H2XB 3EG9B 3TEEA 1IV8A 2DU7A 4RGUA 1DU6A 5E17F 1K4SA 3OYBA 4J9FA 5J3BA 2EFPA 3J81Z 2DMQA 2LKXA 4IQ4A 4GGGA 5EZGA 1R71A 2H94A 3CDHA 4WWCA 4PFPA 2FBKA 2L3QA 1Z3XA 2RJFA 1OQYA 4CYCB 1BOBA 2GA1A 1UJYA 3CCVT 2DYBA 4IHSA 3DLAA 2Q5HA 3BR1A 4C92F 3FKIJ 2ESHA 1UGSB 3CCRI 3KP4A 1QKXA 4BQOA 1KQ2A 2RC4A 4E6KG 2P5LC 4EJVA 4A5MA 3ZMDA 3J81K 3CBMA 4EMHA 5TGTA 1RIQA 2DE0X 1YJNI 4MNUA 1KA8A 4M72A 1SPKA 3A5YA 1RADB 4DBHA 2ODRD 5FKKA 4D0PA 1I5ZA 2LC2A 1VQPT 2O9SA 4Y28E 3P8DA 2CMPA 2JW4A 3DTKA 4NUBA 2CFXA 3OR1C 2ISYA 4C92E 5H6RA 2KLOA 3PUFA 2L0KA 4H2TA 4RB1A 2DOAA 4B3AA 4JUVA 2VBXA 1ASZA 4P9UA 1AOJA 1ZHFA 4LUDA 2EYYA 2O01E 4BXXJ 2EV5A 5EEAA 3D5RC 3K6GA 1WPYA 1R0CB 1CSKA 4X9DA 3MO8A 4QW2A 2K2MA 3BTCA 3CC2Q 2DL4A 3CPFA 2XAGA 3H36A 4JX6A 2QGGA 4P71C 3FJ5A 4V2FA 2R4GA 4B9XA 2IY5A 3MP6A 4C8QC 1R49A 1VQNA 3E9HA 2EH3A 1I1GA 2A61A 3JCMf 1KIKA 4OMZA 2JSCA 1BL0A 1JUMA 2GQVA 1WJEA 3CCST 3J7AF 2MG4A 1A36A 5DEQA 1MJBA 1YOVB 3DKMA 4IHWA 3HXYA 1FIAA 2DA2A 3ZCOA 2LG4A 1M1KC 2PG4A 2P7CB 2DFHA 5GAMd 2B7EA 2L9RA 4ZTJA 1OYXA 3ZGKA 2W85A 1OULA 5CQYA 2WA0A 4LDWA 3CCUQ 3I58A 1U3EM 1JHHA 3CC4I 3CUOA 1OYYA 2EJGA 1H3ZA 3LSJA 5IXFA 1U0JA 4CH6A 2XF5A 2JWTA 3LH5A 4KIBA 2JVVA 3H3UA 4EMKC 2C6YA 2DBKA 1T38A 3M8FA 4EQQA 1QE0A 5DCMA 1UB4A 1PRLC 3HRKA 4KBMB 3WE3A 3JRDA 1DU0A 1ZLKA 3HXZA 1SETA 4G7HF 3VWBA 3WTYC 4B48A 4XRSA 3MVPA 4OAYA 1UB9A 2NWMA 1V4RA 2VIXA 1H8AC 5DLOA 4TVRA 3WGGA 1ZRCA 2GTJA 2QXFA 1RI7A 4A3DJ 3A2KA 2RNAA 2DD4A 3W6VA 3A02A 3SEQA 3DPUA 4H2UA 1W36D 3EETA 2ZJQF 3E9GA 1ZSGA 4J8OA 3VB2A 2HOSA 1IO6A 2ID6A 3E2UA 3J80Z 3GTPJ 1HW5A 5KE2A 4B44A 1X55A 3FMQA 4WI1A 1FLIA 1VQ5Q 1XMAA 2FBIA 2XIGA 4M74A 1AWOA 1MSFC 3JB9H 1YJWA 1MBHA 1UTIA 3OOUA 4RTYA 2EVRA 3IL2A 3VYUB 4ZC3A 5ERIA 3V8KA 2O6GE 3K4JA 2IEKA 4WXHA 3CC2T 3J80K 5CPRB 3AHUA 1Y56A 1MKMA 2MD5A 5LD2C 2FO0A 2F69A 2LSOA 2F5VA 3OOPA 2XSDC 4LMYA 1XTAA 5D5XB 1IRFA 4ZGDB 2ZJ2A 1JXMA 3CBPA 7AT1B 1GCQA 3WODF 2E71A 5D7UA 1ABOA 3ULRB 3ER0A 3P9CA 1IW7F 1TSFA 4M6YA 5M5YJ 2ZINA 2QLZA 2DEQA 3HUGB 3IRRA 2R5YB 1W66A 1YN8A 2AHQA 4G7OF 4BD3A 5LJ3h 2WAQN 1XPXA 3E5UA 4GO1A 2V6CA 2ZT6A 4PKCC 3CCUT 4OB0B 1HC8A 4X0GA 1G3WA 2ADUA 1ZSZC 1IUYA 2M45A 3TU4K 4JPBW 4IUPA 5K7HA 1IV6A 1ETKA 3LL7A 3LSPA 3MP8A 2M5WA 2VPLA 3BPXA 3CPWA 1CF7A 4L5EA 5CR2A 3QXEB 1K6YA 3CD6Q 3EFOA 3ULQB 2YXYA 3LSIA 2DA5A 4BDYA 3I3LA 1IGUA 1Y6IA 2O0YA 3I71A 4G6DA 5JLWA 1TW3A 4G84A 4CYDA 4C92D 1Q82C 4ESBA 1VQ4A 1U5SA 2QEXQ 3MCAB 3VFZA 3OIPA 5M5WJ 4F04B 5HDNA 5LJ5f 4JRPA 4PNOA 1GXPA 1KU7A 1WIEA 3L42A 3LSRA 4YRIA 2XSJC 5DM7R 4C5IA 1EVLA 3BR3A 2HS5A 1V1CA 2J5OA 2OC6A 4RTTA 4P75A 1T98A 1KU3A 4E7IA 2RHQB 2NXNB 3FM3A 1N9SA 5AIQA 5KCMA 1HD3A 1ZUUA 4BJ5C 5LJ3j 4AVZA 2QSFX 4XN0A 3R61A 2VODA 5D6FA 5D6EA 2PVGB 4XTXA 4TWAA 1X56A 2K5IA 2LY1A 2DMOA 2PMHA 3AG2H 3EGUA 4ZTZB 1DQUA 1NH3A 1I4K1 1S7EA 1P9QC 1Z1DA 1W7PD 1YITA 2DK5A 3PL8A 2EJFA 5FO5A 3OW2P 3QODA 3BTLA 2LKSA 1VOMA 4C0FA 1VQ6I 4C3IJ 5IT9Z 3IV5A 1JHFA 1K73C 1BK2A 1USTA 3GP8A 5C52B 4O3MA 4B47A 3TOBA 4M9ZA 4J6YA 1G4DA 2ZPBB 4HQMA 3ZQQA 2ZPHB 2DPDA 2OU2A 1QVGA 3SDGA 3UPUA 2F2WA 1JJCA 3L2VA 1C1AA 5GTIC 5IT9K 5EG2A 4NQWB 2E1OA 3OSFA 2HPMA 5CKEA 2PFBA 3KFUA 3ROUA 2IGOA 4M7DB 1EOVA 1A6QA 2RV8A 1YIJI 4XM3A 3H9QA 1D1AA 1M2OA 5GAN8 1MDMB 1LPLA 2EGEA 1P92A 1VA7A 3JRBA 1VQ7I 1IREB 3NENA 2RJDA 3CD6T 1YFHA 2KYMA 1IN6A 1XSDA 2HDDA 1QVFP 4M3BA 1UUEA 3LSSA 4P3PA 2BHYA 4OB1B 1I5OB 4J01A 1FOKA 4E51A 3RYRA 2DL8A 3WHCA 4UUSB 2M0YA 1PYSB 2Q2EA 2RHXA 5HNFA 1P6RA 1ZRDA 2BY3A 3NRVA 1KMMA 2LVSA 2M34A 4X6AJ 4D8DA 3PQJA 4HCKA 3OS5A 3RKXA 3QO3A 2VC1A 3TSWA 3JCMX 2QENA 2JZ2A 4BW9A 2CS7A 4AFUC 5DM6F 2HKOA 2KISA 2YLBA 3FMRA 2DT5A 2E2JJ 3LW5E 3I55T 4KQEA 4U0VA 2QYOA 2K5FA 1PC0A 2CT3A 2VC8A 2NYXA 4J9IA 1N5ZA 3LMMA 2FNAA 3CXCA 1B1BA 3TDUC 2B9SA 1KGSA 2E12A 3VEPA 2WSFE 2DLPA 1UG2A 3OMCA 4KH1B 2GFUA 1BB9A 1Z7NA 1VQMI 3G71Q 2R7UA 4EATA 2H3EB 3GUDA 3OV8A 3S14J 1H4SA 4A3BJ 2FPFA 1PG5B 1TTHB 2I10A 4YFNF 1RLPC 1Q82R 2JPBA 1RUOA 3A1YA 1ETQA 4OIQF 2R5MA 4M78F 1PVEA 4NC8A 4FETA 5LLQA 5IN1A 3JAMZ 3PVLA 3NQOA 2DXBA 2G9WA 5GAN7 2DTHA 1SRMA 3BY6A 1K8AU 1VQKQ 4IZZA 4OGCA 5M9OA 3EUHC 4M7AB 3CCVA 2QVOA 1UE9A 3BDLA 3HJEA 2EKHA 2CSOA 3BG9A 3ZN1A 1V5EA 4M78E 1LJ9A 1E3PA 4YFKF 3JAMK 3F9KA 1V76A 1TP4A 3REXA 2Q7HA 3FXLA 4QQGA 2VBYA 3CCLQ 4E7SA 3FXKA 2DAQA 2CP7A 2V4JC 3H6ZA 1JTYA 2X3XD 2O4XA 4G6QA 2EIFA 2W00A 1VQPA 2MBFA 2CUJA 1K73R 5E20A 3HOZJ 4KGVB 1LUJB 5B66C 2YPRA 2GGRA 1TWCJ 2HGCA 3RQIA 2F4IA 2PTKA 3ZEHA 1TC3C 3WGHA 4BBRJ 2HXIA 4K11A 4NOYA 1FY7A 3UT1A 2PZ1A 3F6OA 2YRVA 4S05A 3PNYA 4E47A 2ZSHB 2K9SA 5IH2A 3FWEA 1Q95G 4OINF 2MW8A 4U0WA 1AHJB 3EGDB 1KJWA 1QPMA 4HSTA 1SKUB 3GW2A 1KYWA 3SQNA 1Y71A 3S17J 3H0DA 3CCSA 3CCJQ 4YYEA 3O8GA 2DOFA 5E3LA 1IXRC 1ADJA 3AFHA 4C3HJ 3VPRA 2CO5A 4PGHA 2P84A 3GTMJ 3IKVA 1WWXA 3G71T 1XGMA 2E19A 1W0TA 4QQDA 4AVPA 1R22A 5I21A 2FRHA 1O3SA 2Z5UA 3O8VA 5TRDA 3UGQA 2QQ8A 3ZMUA 4A3KJ 3UR3C 2A68F 2DFIA 1GFCA 1I07A 1Y8QB 2QA4Q 4OLFA 2GBQA 4R8HA 2F2EA 4YIFA 5LJ5h 4IOAF 3EPZA 4BYYA 2L7ZA 2CP3A 3M0SA 1PP8F 1EZZB 2BZ8A 3WTSC 3Q1JA 1MD0A 1VQKT 1FBUA 1R58A 2UXXA 3I5UA 1YJWI 3A01A 2IS1A 3HHTB 1S29A 5ELOA 1TLHB 3U1KA 1LKXA 1FIPA 1O4XA 3TOAA 2MWOA 5LHIA 1R9TJ 2L3RA 2M30A 1RKTA 4YRJA 3QWXX 2A0FB 3JR9A 3CLQA 2IT0A 5HODA 2EBPA 1B72B 3E5XA 2X85A 3CCLT 3CDLA 4MHGA 1GCPA 2OBPA 4JS4A 2KDSA 3ZQLA 3REOA 4A4GA 2HL3A 4MTDA 2DL7A 2FRYA 2XC7A 3CCEQ 2WV0A 5F64A 1KHCA 3VQXA 2X3WD 1R5GA 4PJMA 1J59A 1ASYA 3U1DA 5HDKA 2X6WA 4BQAA 4M3GA 1I1SA 1OI1A 1TG0A 4Y33A 4IO9F 1BW6A 2ZIMA 4QPOA 2COYA 2RI3A 1VNDA 1IAWA 3JTHA 3CF5F 1VQLI 2KY9A 3PGGA 3OYJA 2WTEA 1J0RA 4WF2A 3I59A 5LJ5j 1W1WE 5GANf 1W2BP 1YS6A 2DBBA 2HNHA 1C0AA 3OW2S 3M0QA 3TQNA 1D1CA 5BPIA 4L0YB 2NOJB 2COBA 1SD5A 4M6XA 2B63J 2A07F 3HFZA 4XKWA 2FPDA 2KMTA 3CCJT 2P5KA 2F5KA 5KYWB 1T39A 2IPOB 3RQ4A 4B3XA 2RMOA 3QP6A 4A5NA 1RI0A 2K86A 2EW3A 1VQ4I 1YFSA 3WTWC 1V55H 4A4FA 1ZR2A 3PFSA 1OPCA 3LSQA 3LGFA 4ZIBA 3DBLB 3CCUA 4M78D 3CC7T 1AZEA 3MZYA 1G5IA 1UHCA 4WTOB 2XGXA 2E7WA 1WJ5A 1Y1VJ 2VQCA 3FF5A 3HBLA 4CCKA 5LRRA 1NNHA 1PSFA 2VT3A 2I4MA 2KJCA 4DOWA 3ZQIA 1Z05A 4RM3A 2X0LA 1SHGA 1JJ8C 1CKBA 4EMKB 3T9NA 2RDPA 1OV3A 1U8RA 1QVFS 3HPHA 5C44J 3CJNA 5DYMA 2M9UA 3PT9A 4E7KA 3JCMg 1SVLA 3KLNA 5GTHC 4I2OA 1W4MA 2AQEA 1X01A 2MABA 3M1EA 1NJIU 2VKNA 3OB9A 4YCWA 5HY6A 1MMGA 2HCKA 5HKCA 2R7XA 2PQ8A 1BN5A 1SFEA 3EFRA 3NELA 4YRRA 3CCET 3C7JA 2EZHA 5LHGA 1P4WA 2QWWA 5FB2A 2MK5A 4LVKA 2LBFB 3VRYA 4FM4B 5HCKA 2D6FA 3RCOA 4KA4A 1WSUA 1FPQA 2YUQA 5ECAA 3RL6A 2K3PA 1YJ9Q 3A4CA 2DMNA 1VYUA 3OYEA 1AZGB 4XONA 4BL0B 3K70D 1VQOA 2EPDA 2DODA 1K8AC 1NYFA 4A53A 2GQQA 4Z2YA 1XSVA 1OZ2A 4Z02A 4P73C 2ZGWA 4RGSA 4GRIA 4F7UB 4BUPA 3ERRA 1W5TA 2EB7A 3CCRQ 1YWPA 2ZPGB 2AK5A 4XK4A 4PUSA 3Q3SA 1M2VB 2OTLT 3DPLC 4RLFA 2FVUA 4NS5A 1Q1VA 2L4AA 4IRIA 3ELKA 4MLOA 4HG2A 4C0GA 2QQSA 2YUSA 1RL2A 3DCFA 2FHDA 4BJ6C 4K86A 5AIPA 1S8NA 4OB3B 1MNMC 4F16A 4FYXB 1U9NA 2BXYA 1ON2A 2CUBA 5GMKh 2Y0SA 4IUVA 2M16A 4LG0B 3CMQA 4B4CA 2WWYA 3UA7A 4OMNA 1WJCA 2CW8A 1SD4A 4JP0A 1KQ0A 2ZR2A 3VYGA 3BR6A 4LD9K 2HQRA 3MKLA 4L6V5 4XU2A 3GEZA 5BOXA 4GXOA 5DS9A 2F4OB 4ABZA 3MKYB 1JXOA 1EH7A 2R7TA 2GXBA 3QIIA 1I50J 3I55A 4BXUA 1N8RR 1IN8A 1TTYA 1RIOH 5KAFC 2VN2A 2PU9B 2N8GA 4YIIA 4OMQA 3V7RA 2L89A 1ETOA 2E34A 1BC7C 1GHCA 1M8VA 2ZT5A 1MBGA 1XGSA 2ARUA 2FSWA 3RZOJ 1FZPB 1YJ9T 3RI4A 2VJIA 3I4MJ 4HX4A 2MWPA 1ZBJA 3OYHA 2XD0A 5M3MJ 3VKIA 3M56A 5GAOm 5FU6C 5GMKj 1D0ZA 2BV6A 2K40A 1WLEA 2ESNA 4LE9A 1YX3A 2ISZA 5GAMf 3NGPA 2M4GA 4C3JJ 3PFIA 2PMEA 2KMUA 3F21A 3HYIA 3QOEA 3HXVA 2ED0A 2ICWG 4CXFA 1NLOC 3E6MA 2RVCA 3CCRT 1EIFA 2FD5A 2V79A 2Y4XA 2HKQB 1HW1A 3ZQFA 4RDXA 2HEQA 1G8XA 2K9GA 3QAHA 3M9AA 1B3QA 1QQIA 4XRSG 3TREA 3ZMSA 4KIGA 2E5KA 1RAAB 4BY6C 4ZH4F 4ENKA 4QIWN 3FXOA 3M0RA 2V9KA 3C2HA 1Z7UA 2YT6A 3IKLA 2ZFWA 1ZGWA 3HHHA 3CCSI 2Z3YA 2XROA 5BQTA 1X1CA 4NC7A 1WQWA 4C8QF 5GANh 1U9OA 3MZ8A 2LRDA 2CV2A 1CGPA 4PJLA 5EGOA 4CS3A 4M75B 4HXJA 3D0SA 1PYVA 4BS9A 12ASA 4DOZA 3UF4A 4L5GA 4UUTA 1USYA 3CUQB 3TBIA 3DBRB 1FP1D 5EG0A 1XD7A 2X48A 2RA2A 1MJ9A 2VUMJ 2DFUA 4C8QE 1MBKA 2VGNA 1Z6RA 2QCOA 5GAOl 2PUKB 1W2BS 1T08B 1TT5B 2Q0OA 5KYNA 1R5ID 1BIBA 1FSEA 3HHGA 1YYVA 5HVQC 5HGQA 3I4PA 1B76A 3DV8A 1QP3A 1X2MA 2KSSA 4A93J 3QG1A 3TDZC 5L3GA 3CP8A 1KFZA 2E2HJ 3G71A 2RQQA 1BCOA 1IN4A 1PJRA 2HQNA 2AS5F 3PCOA 2MOXA 4XEMA 3P8TA 2GAUA 5CKHA 5GANj 4W97A 2DCEA 1B8IB 2OI3A 4C2MJ 2HVRA 1EFWA 3SD4A 4FX4A 1H4TA 2QTXA 1MNEA 3E7LA 1Q81U 2LLKA 5EEHA 1JGGA 2FG0A 3Q9SA 3S2WA 4RB2C 2ZZFA 4KUIA 5TJJA 4D7MA 2VOPA 1M3CA 4BXFA 5B5EC 4HX7A 3CC2I 1O9SA 1PD1A 1DDNA 5FU7C 3BQZA 3V7SA 3E6CC 2J5PA 3CCLA 1J9IA 2J3LA 1YW8A 1K79A 3O3KA 1NK3P 4C2UA 5J1RA 4A3CJ 2BW3B 5IP7J 1B07A 2PX9A 1HKSA 2CYYA 3PMIA 3A5ZA 4L18B 4RGRA 2VGMA 2STTA 3CQZJ 1NZ9A 1T2KA 4HCZA 4JDSA 3G1ZA 2HQXA 4YP0A 1WXUA 3OSVA 2WAEA 2K7LA 3JB9G 3IHUA 5IYBJ 2IIMA 4MZTA 2V1XA 2EIMH 2HOTA 1GCQC 3G1JA 3KFVA 3NTIA 3IKMB 5AYFA 2RREA 3CCUI 4CH3A 4CO8A 3BW1A 1QWEA 3RYPA 4XU1A 3HGYA 2G3RA 2D1HA 3P8YA 3C1DA 4I7HA 1M27C 3RERA 2RQTA 4LDUA 1V3FA 1TU0B 2X9HA 2LJ1A 2JA7J 2E5AA 1E1OA 1ZSZA 2VC0A 5J3LA 4CCNA 3CCJA 3FM5A 1ZUKA 3QYHB 1HW2A 4LB5A 5EJCA 3L4GB 1IB8A 2L54A 4O6JA 1UG0A 4L59A 4KULA 5DD4A 4B6MA 1NEGA 2JK3A 4C0DC 4FSXA 4BU2A 2K79A 4BE0A 1EH8A 2L7FP 2HZYA 4UVCA 3V8JA 3HP9A 1VQ7Q 4ZYEA 2DN0A 1S6LA 5K7FA 2JUFA 1KQSP 3CC7A 5K7ZA 3NEMA 3LSHA 3RUXA 2CUDA 1EFNA 4P5NA 1X27A 3OBWA 3OYCA 1JT6A 5AT1B 4LFUA 5FLVA 3NAUA 2VASA 3TO9A 3KE2A 1F1BB 1OLTA 1UGPB 2KK4A 1IL2A 2OCCH 3L2WA 3BOQA 5D8KB 1VQ5I 4P75C 4MQ9F 4M3EA 5J39A 4ON0A 3RR6A 4Y52J 1XG1A 1BW5A 5GJVB 3SWNB 5F04A 1RAEB 2BUDA 5DCFA 1ACIA 1M3AA 2QUFA 3PMTA 2GCXA 3B6CA 3WE2A 3C12A 1FOYA 3OMYA 3OS2A 1VIFA 2QGUA 5FLXE 1Y07A 4E4HA 5JVGF 1FMWA 2RNGA 4C8QD 2ZC2A 2A37A 2Y9ZA 3HM5A 1OYWA 2LQ8A 1MGTA 4EDUA 1VQMQ 2F6CA 4XQFA 2PN6A 3E3VA 1A35A 4RAGA 1XMXA 2F4MB 2R5YA 4XU0A 5L3CA 2DTOA 2VVKA 3OYYA 1JEGA 4CCOA 5GAMh 5LL6S 2A7YA 1D8JA 2O8XA 2YX7A 4G6TB 3F70A 2A5WA 1LFUP 1B70A 2JMCA 4E7LA 2ZT8A 2P0WA 1YW9A 2KXCA 3GZNB 3I4NJ 2K3YA 1OX9A 2W7NA 1X69A 3CD6I 3UA6A 5LGTA 2FOKA 3VUZA 3EH1A 2QHVA 3S6WA 4IUUA 3HTSB 4A6DA 2ZO4A 1ETYA 3Q0VA 9ANTA 4J9DA 4R55A 3F3XA 4YEJA 2P0KA 2QEXI 2PVDB 3S93A 5E3NA 1X3WB 3ZPLA 2G4CA 3GTJJ 3KYDB 1LJOA 2E1CA 1NJ8A 1VQ7T 4YRCA 3TO6A 1VFCA 4RLQA 2OTLA 3MN2A 5B3SH 3OYDA 5FKMA 1MH3A 4HWRA 1G2BA 1I3QJ 2DQRA 3LAPA 4A3JJ 3AT1B 2RHQA 4P1WA 4NB5A 2C0OA 3TUPA 2A6TA 5GAMj 4FE4A 4RCBA 2EZKA 2K57A 4EJUA 4ME7A 2E1MB 2ZPFB 3URGA 2XMFA 2A36A 4FW2A 4HRIA 3VODA 2J7IA 4WJ3M 3TP3A 3L1AA 1K9AA 4R56A 3JSCA 5GAOq 2NUPB 3KYCB 3F8BA 1TT0A 2VOOA 3QTCA 3GTGJ 1WGSA 1LDJA 1N75A 4BH9A 3IWFA 4XLCA 4EGZA 5C4XJ 2LTOA 1VQ9Q 1JTXA 3RJPA 4IL6C 1E17A 3LNQA 1VQMT 2PJPA 3IQLA 2R7QA 1YP5A 1M4ZA 3FDRA 4ZN1A 6PAXA 2KIQA 2YUNA 1HSJA 2JMAA 1YX5A 3W2AA 1HC7A 1YJ9A 1OZ3A 3W3SA 4HBLA 3ZBDA 2DKGA 2K9QA 2ECCA 5C53B 1R5HA 5AONA 3L2RA 2V8JA 3EUHA 1Q81C 4BEHB 2BEOA 2VT2A 3H0HA 2QGFB 4JX4A 1G2HA 3LOCA 1O3QA 4Y91A 1TWAJ 4KN4X 3EH2A 1WXTA 3ZXSA 2LDUA 4D5FA 1U5TC 1R6RA 4LK0F 3OQ5A 5A0DA 4K88A 4YREA 4UUSA 3CCRA 1F1ZA 2G0EA 2ZZGA 3EQLF 2ODRC 4FT8A 1QVFA 4ESJA 2GXAA 2K3FA 1RAGB 1LB2A 2BY0A 3VS7A 2MMPA 5JLXA 4IPAA 4A3IJ 3RACA 5CQXA 3I9QA 4I99C 2JN0A 2P6TA 2M0OA 4HQEA 2LY9A 3U21A 3TCJA 2DL3A 4C2TA 1IO2A 4RG8A 4NL2A 2NUTB 2Y69H 4MEYF 3RIRA 4XTZA 2ELKA 5KH6A 1HCRA 4FTHA 2DMPA 4ZGEB 2V26A 2DEUA 4UB8C 4QKUA 2E3CA 3VQVA 2LJ3A 4UV8A 5E8IA 3G1LA 3ZMZA 1VQLQ 1W4SA 1FJLA 2VLAA 3HSRA 4JRQA 1K6OA 1E1TA 3M4OJ 2MYSA 4EMSA 2XVCA 5ELNA 3K4BA 1YRNA 1HLVA 1VQZA 1JXSA 3MEWA 5FJ8J 1LNXA 1HSQA 2HYJA 2X6YA 1XB4A 5CLSA 4TQDA 5FKLA 3HXLA 3FISA 5GMKi 2XRLA 3QPSA 4J7IA 1N27A 4GYIA 4A2UA 1JU5C 1J7KA 4PSWA 3VS1A 1VQKI 3SZGA 3D5LA 3HTRA 5F6FA 1SERA 4KRTA 2EQKA 2P4TA 1TXQA 1ZGJA 2IGKA 3MEUA 1G51A 5LHHA 4M7AA 3CC4A 3WTTC 3COAC 4XL9A 2AO9A 1NEBA 1Z7MA 2CP2A 2RH2A 3J81E 2AZVA 5L3FA 3CCLI 1X6OA 4Z89A 2DILA 1X54A 1WX6A 3ASKA 3JCMP 1JKPC 2L3DA 3X20B 2DJQA 2CV0A 1KHIA 3S8PA 3KP5A 3IH2A 1KQSS 2JSPA 2DA3A 2K9LA 1N6AA 1X43A 3RGLA 1G3YA 2JTFA 2Z9OA 1TWBA 4FE7A 4IHTA 3M0PA 2K6DA 4YRTA 4CDGA 2DIQA 1WNLA 1LVAA 5IP9J 1WKMA 3C0CA 3BZCA 4KNYA 4DZPA 3UWNA 1KQ1A 2OCEA 1R8OB 2ARTA 4BE2A 2DBMA 1Y0MA 1YQAA 4I0AA 2DXTA 3W2WA 2F2XA 1I6HJ 3HPGA 2R58A 3G1MA 5CKFA 4ZTUB 3KP2A 2PI0A 4E6RA 2E3HA 2EBIA 3EGDA 4B9WA 4LN2A 4AM3A 5HS7A 1RC9A 4JRIA 2BOLA 5D6XA 2G7UA 3VV0A 4UP8A 4FHTA 1W7PB 4II3A 4RAFA 3I9V2 4CRIA 4JYKA 9ATCB 1VQLT 4EM0B 3OYFA 3HY0A 2QYZA 5EC7A 1MMDA 5LFAA 3PE0A 2XGEA 3ASNH 3MKDA 2X4XA 1X1DA 1SMTA 1QWFA 2CP6A 3VYHB 2HPIA 3GWZA 3LFUA 2D0QB 5E79C 2C8MA 3VSLA 1YFTA 1WJRA 4DYRA 2QA4I 3UDCA 1QZEA 3K9TA 2I4OA 2EZIA 4JK1X 2F5CA 4PJOC 5E1WA 4HF0A 3CCQQ 5F0FA 3DSQA 1K1ZA 3ERED 3CESA 4XLEA 2CQ7A 1ZN2A 1OJLA 4QWQA 1FBSA 1E22A 2JA8J 2CQKA 1TH7A 5EYRA 1ZYRF 1M1EB 3CDIA 1S9HA 3VDXA 2VXEA 3P8HA 1X4PA 1H8KA 4P72A 4A0YA 2VPRA 2CSQA 2A6HF 3H35A 1WU7A 3AG3H 4QVCA 5DCMB 2M0MA 1UHSA 2DXIA 1NYRA 1QPIA 1B72A 1MHNA 4HWTA 2LFBA 1RKWA 4J7FA 1YIOA 2X4HA 2FB7A 2XHCA 3D7SB 1GL5A 1BYMA 2BE7D 3O5ZA 2K4BA 1QA6A 2H3JA 1JGSA 4EJOA 2MI6A 3CCEI 2ZB9A 2KR3A 4JQFA 2RQVA 1J09A 3CCYA 2AHJB 2EZLA 1BIAA 2EJRA 5LJ3e 2D9TA 1XDUA 3S32A 1WJBA 2JA2A 1NYGA 3O8HA 1IGQA 3DTEA 1FNNA 4Q47A 1XJWB 4CA0A 3CMAQ 3K4CA 5I2MA 3HSBA 5KHDA 3KZIC 1BBZA 1OISA 4Z8AA 2R3SA 5FU7B 1FT9A 2DQLA 4OMPA 2LVMA 1AVZC 3U9GA 4FCYA 2HQEA 2MC3A 1YLFA 3LH0A 3LSMA 5KYWA 1IUFA 3CJTB 2GF7A 2DK8A 3I64A 2E36A 2NVUB 4CI0C 5FD6A 4HEA2 3META 2OV7A 2OF7A 4XBFA 1UHWA 1VQ6A 2DQ0A 4A54A 5GAN6 1H0MA 4MDXA 5KYXB 2ALYA 4PL6A 1ZHIA 4N0AA 4DEXA 2FNPA 3RDIA 4NDLA 1GVDA 3MHXA 2COZA 3H0IA 2RAEA 3G6EQ 3WG9A 4LDYA 1YI2Q 2ZJRF 2Y90A 1WQ7A 1RLQC 3QWLA 3CCQT 3CPWP 3CEYA 3GTOJ 3K1MA 3P9KA 1ZARA 2HZDA 2LX9A 3J7ZI 1RAFB 4NBQA 2OTJI 1CKAA 2XDPA 2HBWA 2IP2A 2EWNA 3I0TA 3GX4X 2A69F 1TZLA 2XGCA 2QBYB 1YIJA 2DDZA 1Q82U 4ZYHA 2DA7A 2HXOA 4HNUA 3BROA 2DTRA 4AIDA 5B1AH 1VQ7A 2QI2A 2CUZA 1UGRB 2NYSA 3E0JB 2HQAA 1NG6A 3E6BA 3GTLJ 2QKMB 5KNNA 2Y0MA 2NVTJ 1PM3A 3H9GA 3RKWA 2R92J 5HS9A 2E64A 2DAOA 2X6XA 2BE9B 2XG8D 2IA0A 2GXGA 1M90R 3IH4A 3R6SA 3IH3A 3DB4A 2GIZA 4HWSA 2O31A 3G3ZA 1JKRC 4LIUA 1HK9A 1YJ9I 1GT0C 1BBYA 5F08A 3LWFA 3K4KA 2OJ2A 1TUCA 4KISA 5ICFA 3D5SC 5CVJA 1SC7A 1GBQA 2M1BA 1GXQA 1UFFA 2J3MA 1K73U 2IS2A 1GFDA 3A0HC 4AYBA 2CP0A 5CVIA 1FTTA 1WFWA 3PO3J 4ASNA 4ESRA 1ZKGA 4IHVA 4OAZA 5CIUA 1VQMA 3BT9A 2O9LA 4TTVA 4L9NA 3MEXA 3T0YA 4F7UA 4YELA 2IA1A 3AL0C 4CCLA 1ENHA 4M3DA 1QKWA 3HOYJ 2R0QC 2MFZA 2M8GX 5HK3A 3GCMA 1KU9A 1JQQA 4KUMA 4UUVA 3RPQA 1JJCB 1LE8A 1K9MR 4A3FJ 1AWCA 1YI2T 1X2HA 3LSKA 1I0CA 2NVQJ 2K02A 3PM1A 1GDTA 2XAUA 3V8LA 2LT4A 5IHKA 2ZNYA 5C4JJ 3S3MA 1IRZA 3BG5A 1CQTA 5C51B 3H3VK 2M4KA 2COMA 2K7AA 1RETA 4BJTA 1MW7A 4Q5SF 3ABMH 5LEKA 2Q5IA 5GMKm 2FPEA 3DKWA 3FXRA 4AG2C 1WI9A 1FEXA 2LCSA 3HOXJ 3HOWJ 2XTIA 1Z3YA 3H0GJ 2JN6A 5CQEA 3A74A 4LG0A 1E24A 3VSKA 2PJRA 2YR2A 5FFXA 3RKYA 4PFOA 3G4SQ 1E2XA 2K3BA 3ZQ7A 1WHMA 2BGCA 2EYWA 1VUBA 2DPPB 2O3FA 1GVJA 1G6NA 2VXFA 3T8RA 4BWAA 4D9JA 1ZQ1A 2HOAA 3N97A 3GLLA 4NC6A 2R7FA 1USYC 4C5HA 2DFEA 3MMYB 4LGWA 4MQVA 4RMFA 3RNJA 4NNJA 2ZNZA 3CXCP 1I39A 3PZCA 4OMFB 3GOXA 1I81A 4YRKA 1ZUYA 2K4JA 2I5UA 3SDBA 2M51A 2A28A 4TV7A 3GPLA 3GFMA 4IRHA 4P3NA 3E9IA 2PEXA 2XHKA 1WA7A 3DEUA 3TKYA 2LNVA 2G7HA 3FB9A 1MBJA 5F0CA 3BR5A 1L3LA 3DU6A 2ZMEB 1ZRFA 4EVIA 4KICA 3OIQA 1K78A 1F5TA 3ZN0A 2LR8A 4UV9A 2E4HA 5GMKl 4PCQA 1I3AA 1XX5A 2JS2A 2OJED 1AWJA 4LVLA 1HYOA 1JRIA 2VXZA 2YUOA 4Y15A 4M78B 3HZJA 4J6WA 4OP0A 2P0LA 5LJ5d 1L0WA 4OOIA 4ZYAA 5BPDA 2EYQA 1T6SA 2V1QA 1VYTA 4YRPA 1O7LA 3DP7A 1M1GA 2J05A 3CJQB 3O2PE 2NOGA 2RGVA 1AU7A 1G83A 1Y0UA 5ILSA 2CQNA 1O7FA 3Q0UA 2RQRA 3GXOA 3L2CA 2RHIA 3QSUA 3PNWC 3A8OB 4A4HA 2VYTA 4XNFA 3Q9VA 1SHFA 1NG2A 3F8FA 2QDLA 3NWSA 4YIRX 3J7AO 1ATIA 2YRCA 2EQRA 2H8HA 2O4XB 3GFLA 4M75A 1VQNQ 1ZREA 5GAOr 1RACB 3ECHA 1M3BA 1UMQA 1IXSB 4AD9A 3F8CA 2FEZA 1SF9A 2FF4A 3MFKA 2L7KA 2LK2A 3CP2A 1D3BB 2DTZA 1FX7A 1IN5A 3I35A 3R6NA 3OSSC 4RM2A 1QCFA 1TUDA 1D3YA 5LJ5e 3BR2A 4UHTA 1GRIA 4UP9A 2CS3A 2IVWA 3I7FA 4EX5A 4AIKA 4LLGF 3HXWA 2M8EA 1SFOJ 2E6NA 1JT0A 1JBMA 3UATA 5D8LB 2CJAA 5K1PA 1OPKA 2DPUA 2V1NA 1VQLA 2W57A 2ECZA 1HF0A 3SFMA 3X28B 1OU8A 3OR2C 3QPLA 4P96A 3RPUA 2EPFA 2WACA 4IUTA 4XLPF 1N25A 4V2SA 1AWXA 2VBWA 3PJRA 2EQJA 2ZBKA 1C6VX 2V9PA 4Y92A 3DBHB 3QBYA 4UC4A 2QKLB 3C2GA 4DPGA 5HLIA 4EJWA 2XB5A 2C0TA 2NNYA 3A8MB 1TW2A 2X1EA 4P5OA 1Q86R 3DXJF 1OFCX 4CS4A 1MMSA 3REUA 4R1HA 2DL5A 2L3PA 2M0CA 3TEDA 3CPWS 2MC4A 2ZCEA 4TVYA 5CQGA 2V6EA 8ATCB 2PMUA 2WADA 4OU0A 3KP6A 3RMSA 3EG0A 3JREA 5GAN5 2P5IA 3BG3A 2OD5A 1EQRA 4OVAA 4XOTA 3JB9F 4EM2A 5D4RA 1VQ5T 5HLGA 3GF2A 3JSPA 3TEGA 2BW3A 2JTMA 5JR3A 3GBGA 3HRSA 2FQ4A 3ICAA 3MQ0A 1BKBA 4CH7A 1NHAA 2MAMA 4M9SA 5J8FA 5I22A 1VQNT 2E65A 3MP1A 3PSIA 4U0YA 2H8RA 2VXDA 4X34A 4KDPA 2Y30A 1FYMA 3DKYA 3GVAA 4M77A 3MCZA 4B1RA 2P4WA 5LRSA 3JRFA 1UECA 2KE9A 2I8DA 2DU9A 2RKHA 3M55A 1T8IA 4LLNA 2WV1A 3I59B 4J9CA 2CDTA 2NAZA 3F22A 1U1SA 4I6ZA 3HFVA 1LDKB 4CGZA 4ZZLA 3L4GA 3FIWA 1WJDA 2K5CA 5GAOp 2FJ1A 3HKZA 3THKA 1TQPA 2GA2A 3W2VA 2CV1A 4WJ4A 5J26A 3KEQA 2ZKZA 4TQFA 2DYRH 2EJ9A 5LGUA 1N8RU 4P9FA 2QTVA 1N9RA 3QYEA 4IOCF 2DM1A 2B8AA 5C0MA 2KBTA 4JBAA 2H8WA 3NHNA 3DLLA 2A08A 2L8DA 1I8FA 3CCQA 4CZCA 2L02A 2CU7A 1ZH5A 2QEXT 3EHRA 4LDXA 3JCMh 4YRGA 3HG9A 4I02A 4JLGA 1FMKA 1I5LA 2V1RA 3ABKH 3CQTA 1F43A 1ARKA 3LAJA 2WSCE 3SWNA 1JJ2P 4CH5A 3PIOA 3FJPA 1BR2A 2P5VA 4YCUA 2QHSA 3GFJA 3OY9A 4FW1A 4Y17A 5EZHA 5ILUA 3A1PA 4KR3A 3HXXA 1KC8C 3HEFA 3IWZA 4LDVA