3RL4A

Rat metallophosphodiesterase mpped2 g252h mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
275
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGHIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Metallophosphoesterase MPPED2
total genus 91
structure length 275
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl4A00
2BQ8X 1HO5A 4V0WA 3ZU0A 3E7AA 3IVDA 3PSNA 2O8GA 3AV0A 3IB7A 4YKEA 2HYPA 3H64A 3EGGA 3T1IA 4LU9A 4DHLA 1W24A 2KKNA 4FCXA 4MOYA 4ORBA 3HVQA 3H63A 1OIEA 3H60A 3H62B 5GTUA 1S3MA 1WAO1 1XZWA 2IE3C 4M0VA 1S95A 1QFCA 1SU1A 3QFOA 1KBPA 3C5WC 2NYMC 2WDDA 4ORAA 4XPNA 2CV9A 1IT6A 2R17A 2QFRA 3CK2A 3PSOA 4H2IA 4DT2A 4JA9A 1OIDA 2YVTA 2QFPA 1II7A 4JA7A 1S3NA 4Q7FA 3P71C 4B2OA 4ORCA 2XMOA 3DSDA 2WDCA 3N5UA 2IAEC 1HPUA 4LACC 3QFMA 5DNYA 5INBA 1Z2WA 4UT3B 4V0VA 3RL3A 2GJUA 2P6BA 5JPEA 4O24A 3H61A 4DSYA 4MP0A 2Q8UA 3RL5A 4KKZA 3H68A 5JJTA 4ZX2A 1UF3A 5F3WA 4UT2A 1TCOA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 2O8AA 2Z06A 4H2BA 4O5GA 4V0XA 4H1YP 4UWQA 3V4YA 2WDFA 2Z72A 3DW8C 3E7BA 4ZVZA 3ZTVA 1S8EA 5J28A 1FJMA 1WARA 3RQZA 1OI8A 1T70A 1HP1A 3JYFA 4I5LC 4KBPA 3C9FA 4TUIA 2HYOA 3K7VC 5IOHA 1JK7A 3H69A 4J6OA 2NXFA 5B8IA 3THNA 1UTEA 2NYLC 1MF8A 3KBPA 5JPFA 4MOVA 4OR9A 1AUIA 4NZVA 4H2FA 1U32A 4F0ZA 3DSCA 1G5BA 2BCDA 3QG5C 3H66A 1QHWA 3ICFA 1XM7A 4LTYA 4HD0A 1USHA 4FBWA 3IB8A 1S3LA 1T71A 1Z2XA 3EGHA 2USHA 4TUGA 4IYPC 3IVEA 3QFNA 3THOB 3QFKA 1S70A 4IL1A 2ZBMA 2BDXA 3GVEA 4O4KA 4FBKA 2JOGA 4H2GA 4O43A 4G9JA 3FGAC 4H1SA 2DFJA 4UT3A 2A22A 3LL8A 1V73A 2HY1A 1NNWA 3TGHA 2QJCA 2AHDA 3K7WC 4FBQA 5EQVA 4WWLA 1M63A 5C1VA 5HPEA 3AUZA 2Z1AA
chains in the Genus database with same CATH superfamily
2BQ8X 1HO5A 4V0WA 3ZU0A 3E7AA 3IVDA 3PSNA 2O8GA 3AV0A 3IB7A 4YKEA 2HYPA 3H64A 3EGGA 3T1IA 4LU9A 4DHLA 2YEQA 1W24A 2KKNA 4FCXA 4MOYA 4ORBA 3HVQA 3H63A 1OIEA 3H60A 3H62B 5GTUA 1S3MA 1WAO1 1XZWA 2IE3C 4M0VA 1S95A 1QFCA 1SU1A 3QFOA 1KBPA 3C5WC 2NYMC 2WDDA 4ORAA 4XPNA 2CV9A 1IT6A 2R17A 2QFRA 3CK2A 3PSOA 2ZO9B 4H2IA 4DT2A 2DXLA 1OIDA 2YVTA 2QFPA 4JA9A 3FLOA 1II7A 4JA7A 1S3NA 4Q7FA 3P71C 4B2OA 4ORCA 2XMOA 3DSDA 2WDCA 2ZOAA 3N5UA 2IAEC 1HPUA 4LACC 3QFMA 5DNYA 5INBA 1Z2WA 4UT3B 4V0VA 3RL3A 2GJUA 2P6BA 5JPEA 4O24A 3H61A 4DSYA 4MP0A 2Q8UA 3RL5A 4KKZA 3H68A 5JJTA 4ZX2A 1UF3A 5F3WA 4UT2A 1TCOA 3E0JA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 2O8AA 2Z06A 4H2BA 4O5GA 4V0XA 4H1YP 4UWQA 3V4YA 2WDFA 2Z72A 3DW8C 3E7BA 4ZVZA 3ZTVA 1S8EA 5J28A 1FJMA 1WARA 3RQZA 1OI8A 1T70A 1HP1A 3JYFA 4I5LC 4KBPA 3C9FA 4TUIA 2HYOA 3K7VC 5IOHA 1JK7A 3H69A 4J6OA 2NXFA 5B8IA 3THNA 1UTEA 2NYLC 1MF8A 3KBPA 5JPFA 4MOVA 4OR9A 1AUIA 4NZVA 4H2FA 1U32A 4F0ZA 3DSCA 1G5BA 2BCDA 3QG5C 3H66A 1QHWA 3ICFA 1XM7A 4LTYA 4HD0A 1USHA 4FBWA 3IB8A 1S3LA 1T71A 1Z2XA 3EGHA 2USHA 4TUGA 4IYPC 3IVEA 3QFNA 3THOB 3QFKA 1S70A 4IL1A 3D03A 2ZBMA 2BDXA 3GVEA 4O4KA 4FBKA 2JOGA 4H2GA 4O43A 4G9JA 3FGAC 4H1SA 2DFJA 4UT3A 2DXNA 2A22A 3LL8A 1V73A 2HY1A 1NNWA 3TGHA 2QJCA 2AHDA 3K7WC 4FBQA 5EQVA 4WWLA 1M63A 5C1VA 5HPEA 3AUZA 2Z1AA
chains in the Genus database with same CATH topology
2BQ8X 1HO5A 4V0WA 3ZU0A 3E7AA 3IVDA 3PSNA 2O8GA 3AV0A 3IB7A 4YKEA 2HYPA 3H64A 3EGGA 3T1IA 4LU9A 4DHLA 2YEQA 1W24A 2KKNA 4FCXA 4MOYA 4ORBA 3HVQA 3H63A 1OIEA 3H60A 3H62B 5GTUA 1S3MA 1WAO1 1XZWA 2IE3C 4M0VA 1S95A 1QFCA 1SU1A 3QFOA 1KBPA 3C5WC 2NYMC 2WDDA 4ORAA 4XPNA 2CV9A 1IT6A 2R17A 2QFRA 3CK2A 3PSOA 2ZO9B 4H2IA 4DT2A 2DXLA 1OIDA 2YVTA 2QFPA 4JA9A 3FLOA 1II7A 4JA7A 1S3NA 4Q7FA 3P71C 4B2OA 4ORCA 2XMOA 3DSDA 2WDCA 2ZOAA 3N5UA 2IAEC 1HPUA 4LACC 3QFMA 5DNYA 5INBA 1Z2WA 4UT3B 4V0VA 3RL3A 2GJUA 2P6BA 5JPEA 4O24A 3H61A 4DSYA 4MP0A 2Q8UA 3RL5A 4KKZA 3H68A 5JJTA 4ZX2A 1UF3A 5F3WA 4UT2A 1TCOA 3E0JA 2WDEA 4I5NC 3RL4A 2NPPC 3H67A 2IE4C 2O8AA 2Z06A 4H2BA 4O5GA 4V0XA 4H1YP 4UWQA 3V4YA 2WDFA 2Z72A 3DW8C 3E7BA 4ZVZA 3ZTVA 1S8EA 5J28A 1FJMA 1WARA 3RQZA 1OI8A 1T70A 1HP1A 3JYFA 4I5LC 4KBPA 3C9FA 4TUIA 2HYOA 3K7VC 5IOHA 1JK7A 3H69A 4J6OA 2NXFA 5B8IA 3THNA 1UTEA 2NYLC 1MF8A 3KBPA 5JPFA 4MOVA 4OR9A 1AUIA 4NZVA 4H2FA 1U32A 4F0ZA 3DSCA 1G5BA 2BCDA 3QG5C 3H66A 1QHWA 3ICFA 1XM7A 4LTYA 4HD0A 1USHA 4FBWA 3IB8A 1S3LA 1T71A 1Z2XA 3EGHA 2USHA 4TUGA 4IYPC 3IVEA 3QFNA 3THOB 3QFKA 1S70A 4IL1A 3D03A 2ZBMA 2BDXA 3GVEA 4O4KA 4FBKA 2JOGA 4H2GA 4O43A 4G9JA 3FGAC 4H1SA 2DFJA 4UT3A 2DXNA 2A22A 3LL8A 1V73A 2HY1A 1NNWA 3TGHA 2QJCA 2AHDA 3K7WC 4FBQA 5EQVA 4WWLA 1M63A 5C1VA 5HPEA 3AUZA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQ8 X;  1HO5 A;  4V0W A;  3ZU0 A;  3E7A A;  3IVD A;  3PSN A;  2O8G A;  3AV0 A;  3IB7 A;  4YKE A;  2HYP A;  3H64 A;  3EGG A;  3T1I A;  4LU9 A;  4DHL A;  1W24 A;  2KKN A;  4FCX A;  4MOY A;  4ORB A;  3HVQ A;  3H63 A;  1OIE A;  3H60 A;  3H62 B;  5GTU A;  1S3M A;  1WAO 1;  1XZW A;  2IE3 C;  4M0V A;  1S95 A;  1QFC A;  1SU1 A;  3QFO A;  1KBP A;  3C5W C;  2NYM C;  2WDD A;  4ORA A;  4XPN A;  2CV9 A;  1IT6 A;  2R17 A;  2QFR A;  3CK2 A;  3PSO A;  4H2I A;  4DT2 A;  4JA9 A;  1OID A;  2YVT A;  2QFP A;  1II7 A;  4JA7 A;  1S3N A;  4Q7F A;  3P71 C;  4B2O A;  4ORC A;  2XMO A;  3DSD A;  2WDC A;  3N5U A;  2IAE C;  1HPU A;  4LAC C;  3QFM A;  5DNY A;  5INB A;  1Z2W A;  4UT3 B;  4V0V A;  3RL3 A;  2GJU A;  2P6B A;  5JPE A;  4O24 A;  3H61 A;  4DSY A;  4MP0 A;  2Q8U A;  3RL5 A;  4KKZ A;  3H68 A;  5JJT A;  4ZX2 A;  1UF3 A;  5F3W A;  4UT2 A;  1TCO A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  2O8A A;  2Z06 A;  4H2B A;  4O5G A;  4V0X A;  4H1Y P;  4UWQ A;  3V4Y A;  2WDF A;  2Z72 A;  3DW8 C;  3E7B A;  4ZVZ A;  3ZTV A;  1S8E A;  5J28 A;  1FJM A;  1WAR A;  3RQZ A;  1OI8 A;  1T70 A;  1HP1 A;  3JYF A;  4I5L C;  4KBP A;  3C9F A;  4TUI A;  2HYO A;  3K7V C;  5IOH A;  1JK7 A;  3H69 A;  4J6O A;  2NXF A;  5B8I A;  3THN A;  1UTE A;  2NYL C;  1MF8 A;  3KBP A;  5JPF A;  4MOV A;  4OR9 A;  1AUI A;  4NZV A;  4H2F A;  1U32 A;  4F0Z A;  3DSC A;  1G5B A;  2BCD A;  3QG5 C;  3H66 A;  1QHW A;  3ICF A;  1XM7 A;  4LTY A;  4HD0 A;  1USH A;  4FBW A;  3IB8 A;  1S3L A;  1T71 A;  1Z2X A;  3EGH A;  2USH A;  4TUG A;  4IYP C;  3IVE A;  3QFN A;  3THO B;  3QFK A;  1S70 A;  4IL1 A;  2ZBM A;  2BDX A;  3GVE A;  4O4K A;  4FBK A;  2JOG A;  4H2G A;  4O43 A;  4G9J A;  3FGA C;  4H1S A;  2DFJ A;  4UT3 A;  2A22 A;  3LL8 A;  1V73 A;  2HY1 A;  1NNW A;  3TGH A;  2QJC A;  2AHD A;  3K7W C;  4FBQ A;  5EQV A;  4WWL A;  1M63 A;  5C1V A;  5HPE A;  3AUZ A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 2BQ8 X;  1HO5 A;  4V0W A;  3ZU0 A;  3E7A A;  3IVD A;  3PSN A;  2O8G A;  3AV0 A;  3IB7 A;  4YKE A;  2HYP A;  3H64 A;  3EGG A;  3T1I A;  4LU9 A;  4DHL A;  2YEQ A;  1W24 A;  2KKN A;  4FCX A;  4MOY A;  4ORB A;  3HVQ A;  3H63 A;  1OIE A;  3H60 A;  3H62 B;  5GTU A;  1S3M A;  1WAO 1;  1XZW A;  2IE3 C;  4M0V A;  1S95 A;  1QFC A;  1SU1 A;  3QFO A;  1KBP A;  3C5W C;  2NYM C;  2WDD A;  4ORA A;  4XPN A;  2CV9 A;  1IT6 A;  2R17 A;  2QFR A;  3CK2 A;  3PSO A;  2ZO9 B;  4H2I A;  4DT2 A;  2DXL A;  1OID A;  2YVT A;  2QFP A;  4JA9 A;  3FLO A;  1II7 A;  4JA7 A;  1S3N A;  4Q7F A;  3P71 C;  4B2O A;  4ORC A;  2XMO A;  3DSD A;  2WDC A;  2ZOA A;  3N5U A;  2IAE C;  1HPU A;  4LAC C;  3QFM A;  5DNY A;  5INB A;  1Z2W A;  4UT3 B;  4V0V A;  3RL3 A;  2GJU A;  2P6B A;  5JPE A;  4O24 A;  3H61 A;  4DSY A;  4MP0 A;  2Q8U A;  3RL5 A;  4KKZ A;  3H68 A;  5JJT A;  4ZX2 A;  1UF3 A;  5F3W A;  4UT2 A;  1TCO A;  3E0J A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  2O8A A;  2Z06 A;  4H2B A;  4O5G A;  4V0X A;  4H1Y P;  4UWQ A;  3V4Y A;  2WDF A;  2Z72 A;  3DW8 C;  3E7B A;  4ZVZ A;  3ZTV A;  1S8E A;  5J28 A;  1FJM A;  1WAR A;  3RQZ A;  1OI8 A;  1T70 A;  1HP1 A;  3JYF A;  4I5L C;  4KBP A;  3C9F A;  4TUI A;  2HYO A;  3K7V C;  5IOH A;  1JK7 A;  3H69 A;  4J6O A;  2NXF A;  5B8I A;  3THN A;  1UTE A;  2NYL C;  1MF8 A;  3KBP A;  5JPF A;  4MOV A;  4OR9 A;  1AUI A;  4NZV A;  4H2F A;  1U32 A;  4F0Z A;  3DSC A;  1G5B A;  2BCD A;  3QG5 C;  3H66 A;  1QHW A;  3ICF A;  1XM7 A;  4LTY A;  4HD0 A;  1USH A;  4FBW A;  3IB8 A;  1S3L A;  1T71 A;  1Z2X A;  3EGH A;  2USH A;  4TUG A;  4IYP C;  3IVE A;  3QFN A;  3THO B;  3QFK A;  1S70 A;  4IL1 A;  3D03 A;  2ZBM A;  2BDX A;  3GVE A;  4O4K A;  4FBK A;  2JOG A;  4H2G A;  4O43 A;  4G9J A;  3FGA C;  4H1S A;  2DFJ A;  4UT3 A;  2DXN A;  2A22 A;  3LL8 A;  1V73 A;  2HY1 A;  1NNW A;  3TGH A;  2QJC A;  2AHD A;  3K7W C;  4FBQ A;  5EQV A;  4WWL A;  1M63 A;  5C1V A;  5HPE A;  3AUZ A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 2BQ8 X;  1HO5 A;  4V0W A;  3ZU0 A;  3E7A A;  3IVD A;  3PSN A;  2O8G A;  3AV0 A;  3IB7 A;  4YKE A;  2HYP A;  3H64 A;  3EGG A;  3T1I A;  4LU9 A;  4DHL A;  2YEQ A;  1W24 A;  2KKN A;  4FCX A;  4MOY A;  4ORB A;  3HVQ A;  3H63 A;  1OIE A;  3H60 A;  3H62 B;  5GTU A;  1S3M A;  1WAO 1;  1XZW A;  2IE3 C;  4M0V A;  1S95 A;  1QFC A;  1SU1 A;  3QFO A;  1KBP A;  3C5W C;  2NYM C;  2WDD A;  4ORA A;  4XPN A;  2CV9 A;  1IT6 A;  2R17 A;  2QFR A;  3CK2 A;  3PSO A;  2ZO9 B;  4H2I A;  4DT2 A;  2DXL A;  1OID A;  2YVT A;  2QFP A;  4JA9 A;  3FLO A;  1II7 A;  4JA7 A;  1S3N A;  4Q7F A;  3P71 C;  4B2O A;  4ORC A;  2XMO A;  3DSD A;  2WDC A;  2ZOA A;  3N5U A;  2IAE C;  1HPU A;  4LAC C;  3QFM A;  5DNY A;  5INB A;  1Z2W A;  4UT3 B;  4V0V A;  3RL3 A;  2GJU A;  2P6B A;  5JPE A;  4O24 A;  3H61 A;  4DSY A;  4MP0 A;  2Q8U A;  3RL5 A;  4KKZ A;  3H68 A;  5JJT A;  4ZX2 A;  1UF3 A;  5F3W A;  4UT2 A;  1TCO A;  3E0J A;  2WDE A;  4I5N C;  3RL4 A;  2NPP C;  3H67 A;  2IE4 C;  2O8A A;  2Z06 A;  4H2B A;  4O5G A;  4V0X A;  4H1Y P;  4UWQ A;  3V4Y A;  2WDF A;  2Z72 A;  3DW8 C;  3E7B A;  4ZVZ A;  3ZTV A;  1S8E A;  5J28 A;  1FJM A;  1WAR A;  3RQZ A;  1OI8 A;  1T70 A;  1HP1 A;  3JYF A;  4I5L C;  4KBP A;  3C9F A;  4TUI A;  2HYO A;  3K7V C;  5IOH A;  1JK7 A;  3H69 A;  4J6O A;  2NXF A;  5B8I A;  3THN A;  1UTE A;  2NYL C;  1MF8 A;  3KBP A;  5JPF A;  4MOV A;  4OR9 A;  1AUI A;  4NZV A;  4H2F A;  1U32 A;  4F0Z A;  3DSC A;  1G5B A;  2BCD A;  3QG5 C;  3H66 A;  1QHW A;  3ICF A;  1XM7 A;  4LTY A;  4HD0 A;  1USH A;  4FBW A;  3IB8 A;  1S3L A;  1T71 A;  1Z2X A;  3EGH A;  2USH A;  4TUG A;  4IYP C;  3IVE A;  3QFN A;  3THO B;  3QFK A;  1S70 A;  4IL1 A;  3D03 A;  2ZBM A;  2BDX A;  3GVE A;  4O4K A;  4FBK A;  2JOG A;  4H2G A;  4O43 A;  4G9J A;  3FGA C;  4H1S A;  2DFJ A;  4UT3 A;  2DXN A;  2A22 A;  3LL8 A;  1V73 A;  2HY1 A;  1NNW A;  3TGH A;  2QJC A;  2AHD A;  3K7W C;  4FBQ A;  5EQV A;  4WWL A;  1M63 A;  5C1V A;  5HPE A;  3AUZ A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...