3RL4A

Rat metallophosphodiesterase mpped2 g252h mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
275
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGHIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Metallophosphoesterase MPPED2
total genus 91
structure length 275
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl4A00
3QFOA 1II7A 1KBPA 2BCDA 2JOGA 3H68A 4F0ZA 1WAO1 1S3NA 2QJCA 3H69A 4O24A 4DHLA 1QFCA 3P71C 4UWQA 2O8GA 2CV9A 4IYPC 3AV0A 3RL4A 4UT2A 4ORCA 5GTUA 1IT6A 3IB8A 3H66A 3QFNA 4V0XA 1S95A 3ICFA 2USHA 1U32A 3K7VC 2A22A 4H2FA 4H2IA 3PSOA 1OI8A 2O8AA 4B2OA 4KKZA 3N5UA 4MOVA 1MF8A 1USHA 1Z2XA 4UT3A 4ORBA 3K7WC 4H1YP 3DSDA 3H64A 3QFMA 5IOHA 1M63A 3EGHA 3C9FA 5INBA 3CK2A 3JYFA 4O4KA 1OIEA 2IE3C 2Z06A 2QFPA 1UF3A 4HD0A 2Z1AA 3THOB 4ZVZA 3RQZA 1S3MA 4O43A 5F3WA 4FBKA 4XPNA 2WDFA 1UTEA 4ZX2A 2QFRA 4YKEA 1T70A 2XMOA 1AUIA 1NNWA 5JJTA 2IAEC 2NPPC 2R17A 3IVDA 1V73A 2ZBMA 2BDXA 4Q7FA 5JPFA 4WWLA 2WDDA 4H1SA 3LL8A 1T71A 5B8IA 5DNYA 4MOYA 3H62B 3TGHA 3THNA 4JA9A 4J6OA 4TUGA 1FJMA 1S8EA 4JA7A 2GJUA 3RL3A 3IB7A 4O5GA 2HYOA 4I5LC 5C1VA 4UT3B 4OR9A 3E7BA 3ZU0A 2IE4C 2YVTA 1XM7A 4V0WA 3DSCA 3QG5C 4DT2A 1S70A 5JPEA 5EQVA 4V0VA 2HY1A 4I5NC 2NXFA 4IL1A 4ORAA 3IVEA 1S3LA 2HYPA 3QFKA 3H61A 4MP0A 2DFJA 4LU9A 2NYLC 1JK7A 4FBQA 3T1IA 3GVEA 1W24A 1HPUA 4H2BA 4G9JA 4TUIA 3ZTVA 3EGGA 3DW8C 3KBPA 2P6BA 3V4YA 1SU1A 4H2GA 2Q8UA 1QHWA 2AHDA 4LACC 3FGAC 1G5BA 3H60A 4NZVA 1WARA 3H67A 2NYMC 4DSYA 4M0VA 1Z2WA 1HP1A 4FBWA 1OIDA 3HVQA 3H63A 2BQ8X 3RL5A 4LTYA 1HO5A 3C5WC 1XZWA 2WDEA 2WDCA 4FCXA 3E7AA 4KBPA 5HPEA 1TCOA 3AUZA 2KKNA 5J28A 2Z72A 3PSNA
chains in the Genus database with same CATH superfamily
3QFOA 1II7A 3FLOA 1KBPA 2BCDA 2JOGA 3H68A 4F0ZA 1WAO1 1S3NA 2QJCA 3H69A 4O24A 4DHLA 1QFCA 3P71C 4UWQA 2O8GA 2CV9A 4IYPC 3AV0A 3RL4A 4UT2A 4ORCA 5GTUA 1IT6A 3IB8A 3H66A 3QFNA 4V0XA 1S95A 3ICFA 2USHA 1U32A 3K7VC 2A22A 4H2FA 4H2IA 3PSOA 1OI8A 2O8AA 4B2OA 4KKZA 3N5UA 4MOVA 1MF8A 2ZO9B 1USHA 1Z2XA 4UT3A 4ORBA 3K7WC 4H1YP 3DSDA 3H64A 3QFMA 5IOHA 1M63A 3EGHA 3C9FA 5INBA 3CK2A 3JYFA 4O4KA 1OIEA 2IE3C 2Z06A 3E0JA 2QFPA 1UF3A 4HD0A 2Z1AA 3THOB 4ZVZA 3RQZA 1S3MA 4O43A 5F3WA 4FBKA 2YEQA 4XPNA 2WDFA 1UTEA 4ZX2A 2QFRA 4YKEA 1T70A 2XMOA 1AUIA 1NNWA 5JJTA 2IAEC 2NPPC 2R17A 3IVDA 1V73A 2ZBMA 2BDXA 4Q7FA 5JPFA 2ZOAA 4WWLA 2WDDA 4H1SA 3LL8A 1T71A 5B8IA 5DNYA 4MOYA 3H62B 3TGHA 3THNA 4JA9A 4J6OA 4TUGA 1FJMA 1S8EA 4JA7A 2GJUA 3RL3A 3IB7A 4O5GA 2HYOA 4I5LC 5C1VA 4UT3B 4OR9A 3E7BA 3ZU0A 2IE4C 2YVTA 1XM7A 4V0WA 3DSCA 3QG5C 4DT2A 1S70A 5JPEA 5EQVA 4V0VA 2HY1A 4I5NC 2NXFA 4IL1A 4ORAA 3IVEA 1S3LA 2HYPA 3QFKA 3H61A 4MP0A 2DFJA 4LU9A 2NYLC 1JK7A 4FBQA 3T1IA 3GVEA 2DXNA 1W24A 1HPUA 4H2BA 4G9JA 4TUIA 3ZTVA 3EGGA 3DW8C 3KBPA 2P6BA 3V4YA 1SU1A 4H2GA 2Q8UA 1QHWA 2AHDA 4LACC 3FGAC 1G5BA 3H60A 4NZVA 1WARA 3H67A 2NYMC 4DSYA 4M0VA 1Z2WA 2DXLA 3D03A 1HP1A 4FBWA 1OIDA 3HVQA 3H63A 2BQ8X 3RL5A 4LTYA 1HO5A 3C5WC 1XZWA 2WDEA 2WDCA 4FCXA 3E7AA 4KBPA 5HPEA 1TCOA 3AUZA 2KKNA 5J28A 2Z72A 3PSNA
chains in the Genus database with same CATH topology
3QFOA 1II7A 3FLOA 1KBPA 2BCDA 2JOGA 3H68A 4F0ZA 1WAO1 1S3NA 2QJCA 3H69A 4O24A 4DHLA 1QFCA 3P71C 4UWQA 2O8GA 2CV9A 4IYPC 3AV0A 3RL4A 4UT2A 4ORCA 5GTUA 1IT6A 3IB8A 3H66A 3QFNA 4V0XA 1S95A 3ICFA 2USHA 1U32A 3K7VC 2A22A 4H2FA 4H2IA 3PSOA 1OI8A 2O8AA 4B2OA 4KKZA 3N5UA 4MOVA 1MF8A 2ZO9B 1USHA 1Z2XA 4UT3A 4ORBA 3K7WC 4H1YP 3DSDA 3H64A 3QFMA 5IOHA 1M63A 3EGHA 3C9FA 5INBA 3CK2A 3JYFA 4O4KA 1OIEA 2IE3C 2Z06A 3E0JA 2QFPA 1UF3A 4HD0A 2Z1AA 3THOB 4ZVZA 3RQZA 1S3MA 4O43A 5F3WA 4FBKA 2YEQA 4XPNA 2WDFA 1UTEA 4ZX2A 2QFRA 4YKEA 1T70A 2XMOA 1AUIA 1NNWA 5JJTA 2IAEC 2NPPC 2R17A 3IVDA 1V73A 2ZBMA 2BDXA 4Q7FA 5JPFA 2ZOAA 4WWLA 2WDDA 4H1SA 3LL8A 1T71A 5B8IA 5DNYA 4MOYA 3H62B 3TGHA 3THNA 4JA9A 4J6OA 4TUGA 1FJMA 1S8EA 4JA7A 2GJUA 3RL3A 3IB7A 4O5GA 2HYOA 4I5LC 5C1VA 4UT3B 4OR9A 3E7BA 3ZU0A 2IE4C 2YVTA 1XM7A 4V0WA 3DSCA 3QG5C 4DT2A 1S70A 5JPEA 5EQVA 4V0VA 2HY1A 4I5NC 2NXFA 4IL1A 4ORAA 3IVEA 1S3LA 2HYPA 3QFKA 3H61A 4MP0A 2DFJA 4LU9A 2NYLC 1JK7A 4FBQA 3T1IA 3GVEA 2DXNA 1W24A 1HPUA 4H2BA 4G9JA 4TUIA 3ZTVA 3EGGA 3DW8C 3KBPA 2P6BA 3V4YA 1SU1A 4H2GA 2Q8UA 1QHWA 2AHDA 4LACC 3FGAC 1G5BA 3H60A 4NZVA 1WARA 3H67A 2NYMC 4DSYA 4M0VA 1Z2WA 2DXLA 3D03A 1HP1A 4FBWA 1OIDA 3HVQA 3H63A 2BQ8X 3RL5A 4LTYA 1HO5A 3C5WC 1XZWA 2WDEA 2WDCA 4FCXA 3E7AA 4KBPA 5HPEA 1TCOA 3AUZA 2KKNA 5J28A 2Z72A 3PSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFO A;  1II7 A;  1KBP A;  2BCD A;  2JOG A;  3H68 A;  4F0Z A;  1WAO 1;  1S3N A;  2QJC A;  3H69 A;  4O24 A;  4DHL A;  1QFC A;  3P71 C;  4UWQ A;  2O8G A;  2CV9 A;  4IYP C;  3AV0 A;  3RL4 A;  4UT2 A;  4ORC A;  5GTU A;  1IT6 A;  3IB8 A;  3H66 A;  3QFN A;  4V0X A;  1S95 A;  3ICF A;  2USH A;  1U32 A;  3K7V C;  2A22 A;  4H2F A;  4H2I A;  3PSO A;  1OI8 A;  2O8A A;  4B2O A;  4KKZ A;  3N5U A;  4MOV A;  1MF8 A;  1USH A;  1Z2X A;  4UT3 A;  4ORB A;  3K7W C;  4H1Y P;  3DSD A;  3H64 A;  3QFM A;  5IOH A;  1M63 A;  3EGH A;  3C9F A;  5INB A;  3CK2 A;  3JYF A;  4O4K A;  1OIE A;  2IE3 C;  2Z06 A;  2QFP A;  1UF3 A;  4HD0 A;  2Z1A A;  3THO B;  4ZVZ A;  3RQZ A;  1S3M A;  4O43 A;  5F3W A;  4FBK A;  4XPN A;  2WDF A;  1UTE A;  4ZX2 A;  2QFR A;  4YKE A;  1T70 A;  2XMO A;  1AUI A;  1NNW A;  5JJT A;  2IAE C;  2NPP C;  2R17 A;  3IVD A;  1V73 A;  2ZBM A;  2BDX A;  4Q7F A;  5JPF A;  4WWL A;  2WDD A;  4H1S A;  3LL8 A;  1T71 A;  5B8I A;  5DNY A;  4MOY A;  3H62 B;  3TGH A;  3THN A;  4JA9 A;  4J6O A;  4TUG A;  1FJM A;  1S8E A;  4JA7 A;  2GJU A;  3RL3 A;  3IB7 A;  4O5G A;  2HYO A;  4I5L C;  5C1V A;  4UT3 B;  4OR9 A;  3E7B A;  3ZU0 A;  2IE4 C;  2YVT A;  1XM7 A;  4V0W A;  3DSC A;  3QG5 C;  4DT2 A;  1S70 A;  5JPE A;  5EQV A;  4V0V A;  2HY1 A;  4I5N C;  2NXF A;  4IL1 A;  4ORA A;  3IVE A;  1S3L A;  2HYP A;  3QFK A;  3H61 A;  4MP0 A;  2DFJ A;  4LU9 A;  2NYL C;  1JK7 A;  4FBQ A;  3T1I A;  3GVE A;  1W24 A;  1HPU A;  4H2B A;  4G9J A;  4TUI A;  3ZTV A;  3EGG A;  3DW8 C;  3KBP A;  2P6B A;  3V4Y A;  1SU1 A;  4H2G A;  2Q8U A;  1QHW A;  2AHD A;  4LAC C;  3FGA C;  1G5B A;  3H60 A;  4NZV A;  1WAR A;  3H67 A;  2NYM C;  4DSY A;  4M0V A;  1Z2W A;  1HP1 A;  4FBW A;  1OID A;  3HVQ A;  3H63 A;  2BQ8 X;  3RL5 A;  4LTY A;  1HO5 A;  3C5W C;  1XZW A;  2WDE A;  2WDC A;  4FCX A;  3E7A A;  4KBP A;  5HPE A;  1TCO A;  3AUZ A;  2KKN A;  5J28 A;  2Z72 A;  3PSN A; 
#chains in the Genus database with same CATH topology
 3QFO A;  1II7 A;  3FLO A;  1KBP A;  2BCD A;  2JOG A;  3H68 A;  4F0Z A;  1WAO 1;  1S3N A;  2QJC A;  3H69 A;  4O24 A;  4DHL A;  1QFC A;  3P71 C;  4UWQ A;  2O8G A;  2CV9 A;  4IYP C;  3AV0 A;  3RL4 A;  4UT2 A;  4ORC A;  5GTU A;  1IT6 A;  3IB8 A;  3H66 A;  3QFN A;  4V0X A;  1S95 A;  3ICF A;  2USH A;  1U32 A;  3K7V C;  2A22 A;  4H2F A;  4H2I A;  3PSO A;  1OI8 A;  2O8A A;  4B2O A;  4KKZ A;  3N5U A;  4MOV A;  1MF8 A;  2ZO9 B;  1USH A;  1Z2X A;  4UT3 A;  4ORB A;  3K7W C;  4H1Y P;  3DSD A;  3H64 A;  3QFM A;  5IOH A;  1M63 A;  3EGH A;  3C9F A;  5INB A;  3CK2 A;  3JYF A;  4O4K A;  1OIE A;  2IE3 C;  2Z06 A;  3E0J A;  2QFP A;  1UF3 A;  4HD0 A;  2Z1A A;  3THO B;  4ZVZ A;  3RQZ A;  1S3M A;  4O43 A;  5F3W A;  4FBK A;  2YEQ A;  4XPN A;  2WDF A;  1UTE A;  4ZX2 A;  2QFR A;  4YKE A;  1T70 A;  2XMO A;  1AUI A;  1NNW A;  5JJT A;  2IAE C;  2NPP C;  2R17 A;  3IVD A;  1V73 A;  2ZBM A;  2BDX A;  4Q7F A;  5JPF A;  2ZOA A;  4WWL A;  2WDD A;  4H1S A;  3LL8 A;  1T71 A;  5B8I A;  5DNY A;  4MOY A;  3H62 B;  3TGH A;  3THN A;  4JA9 A;  4J6O A;  4TUG A;  1FJM A;  1S8E A;  4JA7 A;  2GJU A;  3RL3 A;  3IB7 A;  4O5G A;  2HYO A;  4I5L C;  5C1V A;  4UT3 B;  4OR9 A;  3E7B A;  3ZU0 A;  2IE4 C;  2YVT A;  1XM7 A;  4V0W A;  3DSC A;  3QG5 C;  4DT2 A;  1S70 A;  5JPE A;  5EQV A;  4V0V A;  2HY1 A;  4I5N C;  2NXF A;  4IL1 A;  4ORA A;  3IVE A;  1S3L A;  2HYP A;  3QFK A;  3H61 A;  4MP0 A;  2DFJ A;  4LU9 A;  2NYL C;  1JK7 A;  4FBQ A;  3T1I A;  3GVE A;  2DXN A;  1W24 A;  1HPU A;  4H2B A;  4G9J A;  4TUI A;  3ZTV A;  3EGG A;  3DW8 C;  3KBP A;  2P6B A;  3V4Y A;  1SU1 A;  4H2G A;  2Q8U A;  1QHW A;  2AHD A;  4LAC C;  3FGA C;  1G5B A;  3H60 A;  4NZV A;  1WAR A;  3H67 A;  2NYM C;  4DSY A;  4M0V A;  1Z2W A;  2DXL A;  3D03 A;  1HP1 A;  4FBW A;  1OID A;  3HVQ A;  3H63 A;  2BQ8 X;  3RL5 A;  4LTY A;  1HO5 A;  3C5W C;  1XZW A;  2WDE A;  2WDC A;  4FCX A;  3E7A A;  4KBP A;  5HPE A;  1TCO A;  3AUZ A;  2KKN A;  5J28 A;  2Z72 A;  3PSN A; 
#chains in the Genus database with same CATH homology
 3QFO A;  1II7 A;  3FLO A;  1KBP A;  2BCD A;  2JOG A;  3H68 A;  4F0Z A;  1WAO 1;  1S3N A;  2QJC A;  3H69 A;  4O24 A;  4DHL A;  1QFC A;  3P71 C;  4UWQ A;  2O8G A;  2CV9 A;  4IYP C;  3AV0 A;  3RL4 A;  4UT2 A;  4ORC A;  5GTU A;  1IT6 A;  3IB8 A;  3H66 A;  3QFN A;  4V0X A;  1S95 A;  3ICF A;  2USH A;  1U32 A;  3K7V C;  2A22 A;  4H2F A;  4H2I A;  3PSO A;  1OI8 A;  2O8A A;  4B2O A;  4KKZ A;  3N5U A;  4MOV A;  1MF8 A;  2ZO9 B;  1USH A;  1Z2X A;  4UT3 A;  4ORB A;  3K7W C;  4H1Y P;  3DSD A;  3H64 A;  3QFM A;  5IOH A;  1M63 A;  3EGH A;  3C9F A;  5INB A;  3CK2 A;  3JYF A;  4O4K A;  1OIE A;  2IE3 C;  2Z06 A;  3E0J A;  2QFP A;  1UF3 A;  4HD0 A;  2Z1A A;  3THO B;  4ZVZ A;  3RQZ A;  1S3M A;  4O43 A;  5F3W A;  4FBK A;  2YEQ A;  4XPN A;  2WDF A;  1UTE A;  4ZX2 A;  2QFR A;  4YKE A;  1T70 A;  2XMO A;  1AUI A;  1NNW A;  5JJT A;  2IAE C;  2NPP C;  2R17 A;  3IVD A;  1V73 A;  2ZBM A;  2BDX A;  4Q7F A;  5JPF A;  2ZOA A;  4WWL A;  2WDD A;  4H1S A;  3LL8 A;  1T71 A;  5B8I A;  5DNY A;  4MOY A;  3H62 B;  3TGH A;  3THN A;  4JA9 A;  4J6O A;  4TUG A;  1FJM A;  1S8E A;  4JA7 A;  2GJU A;  3RL3 A;  3IB7 A;  4O5G A;  2HYO A;  4I5L C;  5C1V A;  4UT3 B;  4OR9 A;  3E7B A;  3ZU0 A;  2IE4 C;  2YVT A;  1XM7 A;  4V0W A;  3DSC A;  3QG5 C;  4DT2 A;  1S70 A;  5JPE A;  5EQV A;  4V0V A;  2HY1 A;  4I5N C;  2NXF A;  4IL1 A;  4ORA A;  3IVE A;  1S3L A;  2HYP A;  3QFK A;  3H61 A;  4MP0 A;  2DFJ A;  4LU9 A;  2NYL C;  1JK7 A;  4FBQ A;  3T1I A;  3GVE A;  2DXN A;  1W24 A;  1HPU A;  4H2B A;  4G9J A;  4TUI A;  3ZTV A;  3EGG A;  3DW8 C;  3KBP A;  2P6B A;  3V4Y A;  1SU1 A;  4H2G A;  2Q8U A;  1QHW A;  2AHD A;  4LAC C;  3FGA C;  1G5B A;  3H60 A;  4NZV A;  1WAR A;  3H67 A;  2NYM C;  4DSY A;  4M0V A;  1Z2W A;  2DXL A;  3D03 A;  1HP1 A;  4FBW A;  1OID A;  3HVQ A;  3H63 A;  2BQ8 X;  3RL5 A;  4LTY A;  1HO5 A;  3C5W C;  1XZW A;  2WDE A;  2WDC A;  4FCX A;  3E7A A;  4KBP A;  5HPE A;  1TCO A;  3AUZ A;  2KKN A;  5J28 A;  2Z72 A;  3PSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...