3RL5A

Rat metallophosphodiesterase mpped2 h67r mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
279
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTRSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase MPPED2
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 91
structure length 279
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl5A00
1UF3A 1U32A 4O5GA 1T70A 3DSCA 2KKNA 2BQ8X 1Z2XA 3K7VC 5C1VA 5GTUA 4H2GA 4NZVA 3KBPA 1S70A 4LTYA 3T1IA 3PSOA 1NNWA 4J6OA 2BCDA 2USHA 3H62B 3RQZA 3PSNA 1IT6A 3ICFA 3CK2A 3E7AA 1M63A 3HVQA 1G5BA 4KBPA 3QFKA 3H64A 4I5LC 5HPEA 4LACC 4TUIA 3JYFA 3RL5A 4IL1A 5EQVA 4M0VA 3THOB 3RL4A 1WAO1 4DSYA 4TUGA 3H67A 3V4YA 1XZWA 4Q7FA 4XPNA 1HO5A 1XM7A 4MP0A 4V0VA 3THNA 2R17A 1UTEA 2IE4C 2BDXA 4OR9A 1S95A 4B2OA 5JJTA 2A22A 2ZBMA 1V73A 3EGHA 1WARA 2WDCA 4H1YP 1S3LA 2NYLC 2NXFA 1SU1A 3FGAC 4MOYA 3IVEA 3N5UA 4JA7A 4ORCA 4UT2A 1T71A 3QFNA 1MF8A 2WDDA 3P71C 3H68A 2QJCA 2P6BA 4IYPC 4DT2A 3IVDA 2WDFA 4H2FA 2Q8UA 3QFMA 2IE3C 3H61A 4O43A 4HD0A 4WWLA 2HY1A 3TGHA 4G9JA 3ZTVA 3QFOA 1HP1A 1HPUA 4DHLA 4LU9A 2Z06A 4UWQA 1FJMA 1OIEA 3LL8A 3GVEA 5B8IA 5JPEA 1OI8A 3ZU0A 4MOVA 1S3NA 1II7A 2Z1AA 2O8GA 3C9FA 4JA9A 2DFJA 2CV9A 3QG5C 1S8EA 2HYOA 3DW8C 3E7BA 2NYMC 3K7WC 1TCOA 5INBA 3AV0A 3H66A 4UT3B 3H63A 2QFPA 3DSDA 4ORAA 4ZVZA 5JPFA 2Z72A 2AHDA 4FBKA 1QHWA 4I5NC 4O24A 2NPPC 4V0WA 2WDEA 4O4KA 5DNYA 3IB8A 2IAEC 4H1SA 2HYPA 2YVTA 4FCXA 5IOHA 1S3MA 4V0XA 1W24A 3AUZA 4KKZA 5F3WA 1Z2WA 4FBQA 2QFRA 3EGGA 4YKEA 4ZX2A 1AUIA 4H2IA 4F0ZA 2O8AA 3H60A 3IB7A 4UT3A 1USHA 3RL3A 5J28A 1JK7A 1QFCA 2JOGA 2XMOA 2GJUA 4ORBA 4FBWA 1OIDA 3C5WC 4H2BA 3H69A 1KBPA
chains in the Genus database with same CATH superfamily
2ZO9B 1UF3A 3D03A 1U32A 4O5GA 1T70A 3DSCA 2KKNA 2BQ8X 1Z2XA 3K7VC 2DXLA 5C1VA 5GTUA 4H2GA 4NZVA 3KBPA 1S70A 4LTYA 3T1IA 3PSOA 1NNWA 4J6OA 2BCDA 2USHA 3H62B 3RQZA 3PSNA 1IT6A 3ICFA 3CK2A 3E7AA 1M63A 3HVQA 1G5BA 4KBPA 3QFKA 3H64A 4I5LC 5HPEA 4LACC 4TUIA 3JYFA 3RL5A 4IL1A 5EQVA 4M0VA 3THOB 3RL4A 1WAO1 2DXNA 4DSYA 4TUGA 3H67A 3V4YA 1XZWA 4Q7FA 4XPNA 1HO5A 1XM7A 4MP0A 4V0VA 3THNA 2R17A 1UTEA 2IE4C 2BDXA 4OR9A 1S95A 4B2OA 5JJTA 2A22A 2ZBMA 1V73A 3EGHA 1WARA 2WDCA 4H1YP 1S3LA 2NYLC 2NXFA 1SU1A 3FGAC 4MOYA 3IVEA 3N5UA 4JA7A 4ORCA 4UT2A 1T71A 3QFNA 1MF8A 2WDDA 2ZOAA 3P71C 3H68A 2QJCA 2P6BA 4IYPC 4DT2A 3IVDA 2WDFA 4H2FA 2Q8UA 3QFMA 2IE3C 3H61A 4O43A 4HD0A 4WWLA 2HY1A 3TGHA 4G9JA 3ZTVA 3QFOA 1HP1A 1HPUA 4DHLA 4LU9A 2Z06A 4UWQA 1FJMA 1OIEA 3LL8A 3GVEA 5B8IA 5JPEA 1OI8A 3ZU0A 4MOVA 1S3NA 1II7A 2Z1AA 2O8GA 3C9FA 4JA9A 2DFJA 2CV9A 3QG5C 1S8EA 2HYOA 3DW8C 3E7BA 2NYMC 3K7WC 2YEQA 1TCOA 5INBA 3AV0A 3FLOA 3H66A 4UT3B 3H63A 2QFPA 3E0JA 3DSDA 4ORAA 4ZVZA 5JPFA 2Z72A 2AHDA 4FBKA 1QHWA 4I5NC 4O24A 2NPPC 4V0WA 2WDEA 4O4KA 5DNYA 3IB8A 2IAEC 4H1SA 2HYPA 2YVTA 4FCXA 5IOHA 1S3MA 4V0XA 1W24A 3AUZA 4KKZA 5F3WA 1Z2WA 4FBQA 2QFRA 3EGGA 4YKEA 4ZX2A 1AUIA 4H2IA 4F0ZA 2O8AA 3H60A 3IB7A 4UT3A 1USHA 3RL3A 5J28A 1JK7A 1QFCA 2JOGA 2XMOA 2GJUA 4ORBA 4FBWA 1OIDA 3C5WC 4H2BA 3H69A 1KBPA
chains in the Genus database with same CATH topology
2ZO9B 1UF3A 3D03A 1U32A 4O5GA 1T70A 3DSCA 2KKNA 2BQ8X 1Z2XA 3K7VC 2DXLA 5C1VA 5GTUA 4H2GA 4NZVA 3KBPA 1S70A 4LTYA 3T1IA 3PSOA 1NNWA 4J6OA 2BCDA 2USHA 3H62B 3RQZA 3PSNA 1IT6A 3ICFA 3CK2A 3E7AA 1M63A 3HVQA 1G5BA 4KBPA 3QFKA 3H64A 4I5LC 5HPEA 4LACC 4TUIA 3JYFA 3RL5A 4IL1A 5EQVA 4M0VA 3THOB 3RL4A 1WAO1 2DXNA 4DSYA 4TUGA 3H67A 3V4YA 1XZWA 4Q7FA 4XPNA 1HO5A 1XM7A 4MP0A 4V0VA 3THNA 2R17A 1UTEA 2IE4C 2BDXA 4OR9A 1S95A 4B2OA 5JJTA 2A22A 2ZBMA 1V73A 3EGHA 1WARA 2WDCA 4H1YP 1S3LA 2NYLC 2NXFA 1SU1A 3FGAC 4MOYA 3IVEA 3N5UA 4JA7A 4ORCA 4UT2A 1T71A 3QFNA 1MF8A 2WDDA 2ZOAA 3P71C 3H68A 2QJCA 2P6BA 4IYPC 4DT2A 3IVDA 2WDFA 4H2FA 2Q8UA 3QFMA 2IE3C 3H61A 4O43A 4HD0A 4WWLA 2HY1A 3TGHA 4G9JA 3ZTVA 3QFOA 1HP1A 1HPUA 4DHLA 4LU9A 2Z06A 4UWQA 1FJMA 1OIEA 3LL8A 3GVEA 5B8IA 5JPEA 1OI8A 3ZU0A 4MOVA 1S3NA 1II7A 2Z1AA 2O8GA 3C9FA 4JA9A 2DFJA 2CV9A 3QG5C 1S8EA 2HYOA 3DW8C 3E7BA 2NYMC 3K7WC 2YEQA 1TCOA 5INBA 3AV0A 3FLOA 3H66A 4UT3B 3H63A 2QFPA 3E0JA 3DSDA 4ORAA 4ZVZA 5JPFA 2Z72A 2AHDA 4FBKA 1QHWA 4I5NC 4O24A 2NPPC 4V0WA 2WDEA 4O4KA 5DNYA 3IB8A 2IAEC 4H1SA 2HYPA 2YVTA 4FCXA 5IOHA 1S3MA 4V0XA 1W24A 3AUZA 4KKZA 5F3WA 1Z2WA 4FBQA 2QFRA 3EGGA 4YKEA 4ZX2A 1AUIA 4H2IA 4F0ZA 2O8AA 3H60A 3IB7A 4UT3A 1USHA 3RL3A 5J28A 1JK7A 1QFCA 2JOGA 2XMOA 2GJUA 4ORBA 4FBWA 1OIDA 3C5WC 4H2BA 3H69A 1KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UF3 A;  1U32 A;  4O5G A;  1T70 A;  3DSC A;  2KKN A;  2BQ8 X;  1Z2X A;  3K7V C;  5C1V A;  5GTU A;  4H2G A;  4NZV A;  3KBP A;  1S70 A;  4LTY A;  3T1I A;  3PSO A;  1NNW A;  4J6O A;  2BCD A;  2USH A;  3H62 B;  3RQZ A;  3PSN A;  1IT6 A;  3ICF A;  3CK2 A;  3E7A A;  1M63 A;  3HVQ A;  1G5B A;  4KBP A;  3QFK A;  3H64 A;  4I5L C;  5HPE A;  4LAC C;  4TUI A;  3JYF A;  3RL5 A;  4IL1 A;  5EQV A;  4M0V A;  3THO B;  3RL4 A;  1WAO 1;  4DSY A;  4TUG A;  3H67 A;  3V4Y A;  1XZW A;  4Q7F A;  4XPN A;  1HO5 A;  1XM7 A;  4MP0 A;  4V0V A;  3THN A;  2R17 A;  1UTE A;  2IE4 C;  2BDX A;  4OR9 A;  1S95 A;  4B2O A;  5JJT A;  2A22 A;  2ZBM A;  1V73 A;  3EGH A;  1WAR A;  2WDC A;  4H1Y P;  1S3L A;  2NYL C;  2NXF A;  1SU1 A;  3FGA C;  4MOY A;  3IVE A;  3N5U A;  4JA7 A;  4ORC A;  4UT2 A;  1T71 A;  3QFN A;  1MF8 A;  2WDD A;  3P71 C;  3H68 A;  2QJC A;  2P6B A;  4IYP C;  4DT2 A;  3IVD A;  2WDF A;  4H2F A;  2Q8U A;  3QFM A;  2IE3 C;  3H61 A;  4O43 A;  4HD0 A;  4WWL A;  2HY1 A;  3TGH A;  4G9J A;  3ZTV A;  3QFO A;  1HP1 A;  1HPU A;  4DHL A;  4LU9 A;  2Z06 A;  4UWQ A;  1FJM A;  1OIE A;  3LL8 A;  3GVE A;  5B8I A;  5JPE A;  1OI8 A;  3ZU0 A;  4MOV A;  1S3N A;  1II7 A;  2Z1A A;  2O8G A;  3C9F A;  4JA9 A;  2DFJ A;  2CV9 A;  3QG5 C;  1S8E A;  2HYO A;  3DW8 C;  3E7B A;  2NYM C;  3K7W C;  1TCO A;  5INB A;  3AV0 A;  3H66 A;  4UT3 B;  3H63 A;  2QFP A;  3DSD A;  4ORA A;  4ZVZ A;  5JPF A;  2Z72 A;  2AHD A;  4FBK A;  1QHW A;  4I5N C;  4O24 A;  2NPP C;  4V0W A;  2WDE A;  4O4K A;  5DNY A;  3IB8 A;  2IAE C;  4H1S A;  2HYP A;  2YVT A;  4FCX A;  5IOH A;  1S3M A;  4V0X A;  1W24 A;  3AUZ A;  4KKZ A;  5F3W A;  1Z2W A;  4FBQ A;  2QFR A;  3EGG A;  4YKE A;  4ZX2 A;  1AUI A;  4H2I A;  4F0Z A;  2O8A A;  3H60 A;  3IB7 A;  4UT3 A;  1USH A;  3RL3 A;  5J28 A;  1JK7 A;  1QFC A;  2JOG A;  2XMO A;  2GJU A;  4ORB A;  4FBW A;  1OID A;  3C5W C;  4H2B A;  3H69 A;  1KBP A; 
#chains in the Genus database with same CATH topology
 2ZO9 B;  1UF3 A;  3D03 A;  1U32 A;  4O5G A;  1T70 A;  3DSC A;  2KKN A;  2BQ8 X;  1Z2X A;  3K7V C;  2DXL A;  5C1V A;  5GTU A;  4H2G A;  4NZV A;  3KBP A;  1S70 A;  4LTY A;  3T1I A;  3PSO A;  1NNW A;  4J6O A;  2BCD A;  2USH A;  3H62 B;  3RQZ A;  3PSN A;  1IT6 A;  3ICF A;  3CK2 A;  3E7A A;  1M63 A;  3HVQ A;  1G5B A;  4KBP A;  3QFK A;  3H64 A;  4I5L C;  5HPE A;  4LAC C;  4TUI A;  3JYF A;  3RL5 A;  4IL1 A;  5EQV A;  4M0V A;  3THO B;  3RL4 A;  1WAO 1;  2DXN A;  4DSY A;  4TUG A;  3H67 A;  3V4Y A;  1XZW A;  4Q7F A;  4XPN A;  1HO5 A;  1XM7 A;  4MP0 A;  4V0V A;  3THN A;  2R17 A;  1UTE A;  2IE4 C;  2BDX A;  4OR9 A;  1S95 A;  4B2O A;  5JJT A;  2A22 A;  2ZBM A;  1V73 A;  3EGH A;  1WAR A;  2WDC A;  4H1Y P;  1S3L A;  2NYL C;  2NXF A;  1SU1 A;  3FGA C;  4MOY A;  3IVE A;  3N5U A;  4JA7 A;  4ORC A;  4UT2 A;  1T71 A;  3QFN A;  1MF8 A;  2WDD A;  2ZOA A;  3P71 C;  3H68 A;  2QJC A;  2P6B A;  4IYP C;  4DT2 A;  3IVD A;  2WDF A;  4H2F A;  2Q8U A;  3QFM A;  2IE3 C;  3H61 A;  4O43 A;  4HD0 A;  4WWL A;  2HY1 A;  3TGH A;  4G9J A;  3ZTV A;  3QFO A;  1HP1 A;  1HPU A;  4DHL A;  4LU9 A;  2Z06 A;  4UWQ A;  1FJM A;  1OIE A;  3LL8 A;  3GVE A;  5B8I A;  5JPE A;  1OI8 A;  3ZU0 A;  4MOV A;  1S3N A;  1II7 A;  2Z1A A;  2O8G A;  3C9F A;  4JA9 A;  2DFJ A;  2CV9 A;  3QG5 C;  1S8E A;  2HYO A;  3DW8 C;  3E7B A;  2NYM C;  3K7W C;  2YEQ A;  1TCO A;  5INB A;  3AV0 A;  3FLO A;  3H66 A;  4UT3 B;  3H63 A;  2QFP A;  3E0J A;  3DSD A;  4ORA A;  4ZVZ A;  5JPF A;  2Z72 A;  2AHD A;  4FBK A;  1QHW A;  4I5N C;  4O24 A;  2NPP C;  4V0W A;  2WDE A;  4O4K A;  5DNY A;  3IB8 A;  2IAE C;  4H1S A;  2HYP A;  2YVT A;  4FCX A;  5IOH A;  1S3M A;  4V0X A;  1W24 A;  3AUZ A;  4KKZ A;  5F3W A;  1Z2W A;  4FBQ A;  2QFR A;  3EGG A;  4YKE A;  4ZX2 A;  1AUI A;  4H2I A;  4F0Z A;  2O8A A;  3H60 A;  3IB7 A;  4UT3 A;  1USH A;  3RL3 A;  5J28 A;  1JK7 A;  1QFC A;  2JOG A;  2XMO A;  2GJU A;  4ORB A;  4FBW A;  1OID A;  3C5W C;  4H2B A;  3H69 A;  1KBP A; 
#chains in the Genus database with same CATH homology
 2ZO9 B;  1UF3 A;  3D03 A;  1U32 A;  4O5G A;  1T70 A;  3DSC A;  2KKN A;  2BQ8 X;  1Z2X A;  3K7V C;  2DXL A;  5C1V A;  5GTU A;  4H2G A;  4NZV A;  3KBP A;  1S70 A;  4LTY A;  3T1I A;  3PSO A;  1NNW A;  4J6O A;  2BCD A;  2USH A;  3H62 B;  3RQZ A;  3PSN A;  1IT6 A;  3ICF A;  3CK2 A;  3E7A A;  1M63 A;  3HVQ A;  1G5B A;  4KBP A;  3QFK A;  3H64 A;  4I5L C;  5HPE A;  4LAC C;  4TUI A;  3JYF A;  3RL5 A;  4IL1 A;  5EQV A;  4M0V A;  3THO B;  3RL4 A;  1WAO 1;  2DXN A;  4DSY A;  4TUG A;  3H67 A;  3V4Y A;  1XZW A;  4Q7F A;  4XPN A;  1HO5 A;  1XM7 A;  4MP0 A;  4V0V A;  3THN A;  2R17 A;  1UTE A;  2IE4 C;  2BDX A;  4OR9 A;  1S95 A;  4B2O A;  5JJT A;  2A22 A;  2ZBM A;  1V73 A;  3EGH A;  1WAR A;  2WDC A;  4H1Y P;  1S3L A;  2NYL C;  2NXF A;  1SU1 A;  3FGA C;  4MOY A;  3IVE A;  3N5U A;  4JA7 A;  4ORC A;  4UT2 A;  1T71 A;  3QFN A;  1MF8 A;  2WDD A;  2ZOA A;  3P71 C;  3H68 A;  2QJC A;  2P6B A;  4IYP C;  4DT2 A;  3IVD A;  2WDF A;  4H2F A;  2Q8U A;  3QFM A;  2IE3 C;  3H61 A;  4O43 A;  4HD0 A;  4WWL A;  2HY1 A;  3TGH A;  4G9J A;  3ZTV A;  3QFO A;  1HP1 A;  1HPU A;  4DHL A;  4LU9 A;  2Z06 A;  4UWQ A;  1FJM A;  1OIE A;  3LL8 A;  3GVE A;  5B8I A;  5JPE A;  1OI8 A;  3ZU0 A;  4MOV A;  1S3N A;  1II7 A;  2Z1A A;  2O8G A;  3C9F A;  4JA9 A;  2DFJ A;  2CV9 A;  3QG5 C;  1S8E A;  2HYO A;  3DW8 C;  3E7B A;  2NYM C;  3K7W C;  2YEQ A;  1TCO A;  5INB A;  3AV0 A;  3FLO A;  3H66 A;  4UT3 B;  3H63 A;  2QFP A;  3E0J A;  3DSD A;  4ORA A;  4ZVZ A;  5JPF A;  2Z72 A;  2AHD A;  4FBK A;  1QHW A;  4I5N C;  4O24 A;  2NPP C;  4V0W A;  2WDE A;  4O4K A;  5DNY A;  3IB8 A;  2IAE C;  4H1S A;  2HYP A;  2YVT A;  4FCX A;  5IOH A;  1S3M A;  4V0X A;  1W24 A;  3AUZ A;  4KKZ A;  5F3W A;  1Z2W A;  4FBQ A;  2QFR A;  3EGG A;  4YKE A;  4ZX2 A;  1AUI A;  4H2I A;  4F0Z A;  2O8A A;  3H60 A;  3IB7 A;  4UT3 A;  1USH A;  3RL3 A;  5J28 A;  1JK7 A;  1QFC A;  2JOG A;  2XMO A;  2GJU A;  4ORB A;  4FBW A;  1OID A;  3C5W C;  4H2B A;  3H69 A;  1KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...