3RL5A

Rat metallophosphodiesterase mpped2 h67r mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
279
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTRSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Metallophosphoesterase MPPED2
total genus 91
structure length 279
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl5A00
2QJCA 4IL1A 2DFJA 2WDEA 2QFRA 3PSNA 3E7BA 4LTYA 2ZBMA 3RQZA 2QFPA 1XZWA 5GTUA 3CK2A 3DSCA 1U32A 4H1YP 4ORAA 3V4YA 5JPFA 4DSYA 4O4KA 3IVEA 3RL3A 1M63A 3H64A 1SU1A 3T1IA 4KKZA 1W24A 2HY1A 4HD0A 2XMOA 4MOVA 4O5GA 3PSOA 4B2OA 2KKNA 2BCDA 3GVEA 4UT2A 2WDDA 2NYLC 1G5BA 4H2GA 1S3MA 2NXFA 3K7WC 3ZU0A 2Z1AA 4O43A 2BQ8X 4ORCA 4TUGA 3H67A 2IAEC 4WWLA 3QFKA 3P71C 2AHDA 4V0VA 3DSDA 1T71A 4MOYA 3QFNA 1OIDA 1JK7A 3TGHA 2JOGA 2O8GA 3C5WC 4UT3A 4LACC 5JJTA 1XM7A 3ZTVA 1S70A 4UT3B 3QG5C 3QFOA 4Q7FA 4V0XA 5JPEA 1NNWA 1UF3A 1UTEA 1HPUA 1OIEA 3RL4A 2CV9A 1IT6A 4ORBA 4TUIA 4LU9A 2Q8UA 2O8AA 4JA7A 3JYFA 1II7A 4JA9A 5IOHA 1S3NA 1S8EA 1WAO1 5F3WA 1Z2WA 4H2BA 1MF8A 4DHLA 1AUIA 3H69A 2HYOA 3E7AA 3LL8A 3H63A 4I5NC 4FBWA 2USHA 3AV0A 2IE3C 5HPEA 1V73A 3N5UA 4UWQA 5EQVA 4ZVZA 1QHWA 5B8IA 1USHA 3K7VC 4H2FA 3H62B 1T70A 4OR9A 3FGAC 2A22A 4MP0A 3THOB 4J6OA 4H1SA 2NPPC 5C1VA 2Z06A 3H66A 1QFCA 1KBPA 3H60A 2YVTA 3H61A 4YKEA 2P6BA 4F0ZA 3RL5A 3QFMA 2HYPA 3KBPA 1OI8A 1S3LA 4O24A 4KBPA 1Z2XA 5INBA 3EGHA 1FJMA 4FCXA 2GJUA 3H68A 1S95A 1WARA 4H2IA 4IYPC 4DT2A 2WDFA 3DW8C 3IB7A 3THNA 1HO5A 5J28A 2Z72A 4XPNA 2IE4C 4FBKA 1HP1A 4FBQA 3EGGA 4V0WA 2BDXA 2NYMC 3IVDA 3C9FA 4ZX2A 1TCOA 3HVQA 2WDCA 4G9JA 5DNYA 3IB8A 3ICFA 4I5LC 4M0VA 3AUZA 2R17A 4NZVA
chains in the Genus database with same CATH superfamily
2QJCA 4IL1A 2DFJA 2WDEA 2QFRA 3PSNA 3E7BA 4LTYA 2ZBMA 3RQZA 2QFPA 1XZWA 5GTUA 3CK2A 3DSCA 1U32A 2ZO9B 4H1YP 4ORAA 3V4YA 5JPFA 4DSYA 4O4KA 3FLOA 3IVEA 3RL3A 1M63A 3H64A 1SU1A 3T1IA 4KKZA 1W24A 2HY1A 4HD0A 2XMOA 4MOVA 4O5GA 3PSOA 4B2OA 2KKNA 2BCDA 3GVEA 4UT2A 2WDDA 2NYLC 1G5BA 4H2GA 1S3MA 2NXFA 3K7WC 3ZU0A 2Z1AA 4O43A 2BQ8X 4ORCA 4TUGA 3H67A 2IAEC 4WWLA 3QFKA 3P71C 2AHDA 4V0VA 3DSDA 1T71A 4MOYA 3QFNA 1OIDA 1JK7A 3TGHA 2JOGA 2O8GA 3C5WC 4UT3A 4LACC 5JJTA 1XM7A 3ZTVA 1S70A 3D03A 4UT3B 3QG5C 3QFOA 4Q7FA 4V0XA 5JPEA 1NNWA 1UF3A 1UTEA 1HPUA 1OIEA 3RL4A 2CV9A 1IT6A 4ORBA 4TUIA 4LU9A 2Q8UA 2O8AA 4JA7A 3JYFA 1II7A 4JA9A 5IOHA 1S3NA 1S8EA 1WAO1 5F3WA 1Z2WA 4H2BA 1MF8A 4DHLA 1AUIA 3H69A 2HYOA 3E7AA 3LL8A 3H63A 4I5NC 4FBWA 2USHA 3AV0A 2IE3C 5HPEA 1V73A 2YEQA 3N5UA 4UWQA 5EQVA 4ZVZA 1QHWA 5B8IA 1USHA 3K7VC 4H2FA 3H62B 1T70A 4OR9A 3FGAC 2A22A 4MP0A 3THOB 4J6OA 4H1SA 2NPPC 5C1VA 2DXLA 2Z06A 3H66A 1QFCA 1KBPA 3H60A 2YVTA 3H61A 4YKEA 2P6BA 4F0ZA 3RL5A 3QFMA 2HYPA 3KBPA 1OI8A 1S3LA 4O24A 4KBPA 1Z2XA 5INBA 3EGHA 1FJMA 4FCXA 2GJUA 3H68A 1S95A 1WARA 4H2IA 4IYPC 4DT2A 2WDFA 3DW8C 3IB7A 3THNA 1HO5A 5J28A 2Z72A 4XPNA 2IE4C 4FBKA 1HP1A 4FBQA 3EGGA 4V0WA 2BDXA 2NYMC 3IVDA 3C9FA 4ZX2A 1TCOA 3HVQA 2WDCA 4G9JA 2DXNA 5DNYA 3IB8A 3ICFA 3E0JA 4I5LC 4M0VA 2ZOAA 3AUZA 2R17A 4NZVA
chains in the Genus database with same CATH topology
2QJCA 4IL1A 2DFJA 2WDEA 2QFRA 3PSNA 3E7BA 4LTYA 2ZBMA 3RQZA 2QFPA 1XZWA 5GTUA 3CK2A 3DSCA 1U32A 2ZO9B 4H1YP 4ORAA 3V4YA 5JPFA 4DSYA 4O4KA 3FLOA 3IVEA 3RL3A 1M63A 3H64A 1SU1A 3T1IA 4KKZA 1W24A 2HY1A 4HD0A 2XMOA 4MOVA 4O5GA 3PSOA 4B2OA 2KKNA 2BCDA 3GVEA 4UT2A 2WDDA 2NYLC 1G5BA 4H2GA 1S3MA 2NXFA 3K7WC 3ZU0A 2Z1AA 4O43A 2BQ8X 4ORCA 4TUGA 3H67A 2IAEC 4WWLA 3QFKA 3P71C 2AHDA 4V0VA 3DSDA 1T71A 4MOYA 3QFNA 1OIDA 1JK7A 3TGHA 2JOGA 2O8GA 3C5WC 4UT3A 4LACC 5JJTA 1XM7A 3ZTVA 1S70A 3D03A 4UT3B 3QG5C 3QFOA 4Q7FA 4V0XA 5JPEA 1NNWA 1UF3A 1UTEA 1HPUA 1OIEA 3RL4A 2CV9A 1IT6A 4ORBA 4TUIA 4LU9A 2Q8UA 2O8AA 4JA7A 3JYFA 1II7A 4JA9A 5IOHA 1S3NA 1S8EA 1WAO1 5F3WA 1Z2WA 4H2BA 1MF8A 4DHLA 1AUIA 3H69A 2HYOA 3E7AA 3LL8A 3H63A 4I5NC 4FBWA 2USHA 3AV0A 2IE3C 5HPEA 1V73A 2YEQA 3N5UA 4UWQA 5EQVA 4ZVZA 1QHWA 5B8IA 1USHA 3K7VC 4H2FA 3H62B 1T70A 4OR9A 3FGAC 2A22A 4MP0A 3THOB 4J6OA 4H1SA 2NPPC 5C1VA 2DXLA 2Z06A 3H66A 1QFCA 1KBPA 3H60A 2YVTA 3H61A 4YKEA 2P6BA 4F0ZA 3RL5A 3QFMA 2HYPA 3KBPA 1OI8A 1S3LA 4O24A 4KBPA 1Z2XA 5INBA 3EGHA 1FJMA 4FCXA 2GJUA 3H68A 1S95A 1WARA 4H2IA 4IYPC 4DT2A 2WDFA 3DW8C 3IB7A 3THNA 1HO5A 5J28A 2Z72A 4XPNA 2IE4C 4FBKA 1HP1A 4FBQA 3EGGA 4V0WA 2BDXA 2NYMC 3IVDA 3C9FA 4ZX2A 1TCOA 3HVQA 2WDCA 4G9JA 2DXNA 5DNYA 3IB8A 3ICFA 3E0JA 4I5LC 4M0VA 2ZOAA 3AUZA 2R17A 4NZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJC A;  4IL1 A;  2DFJ A;  2WDE A;  2QFR A;  3PSN A;  3E7B A;  4LTY A;  2ZBM A;  3RQZ A;  2QFP A;  1XZW A;  5GTU A;  3CK2 A;  3DSC A;  1U32 A;  4H1Y P;  4ORA A;  3V4Y A;  5JPF A;  4DSY A;  4O4K A;  3IVE A;  3RL3 A;  1M63 A;  3H64 A;  1SU1 A;  3T1I A;  4KKZ A;  1W24 A;  2HY1 A;  4HD0 A;  2XMO A;  4MOV A;  4O5G A;  3PSO A;  4B2O A;  2KKN A;  2BCD A;  3GVE A;  4UT2 A;  2WDD A;  2NYL C;  1G5B A;  4H2G A;  1S3M A;  2NXF A;  3K7W C;  3ZU0 A;  2Z1A A;  4O43 A;  2BQ8 X;  4ORC A;  4TUG A;  3H67 A;  2IAE C;  4WWL A;  3QFK A;  3P71 C;  2AHD A;  4V0V A;  3DSD A;  1T71 A;  4MOY A;  3QFN A;  1OID A;  1JK7 A;  3TGH A;  2JOG A;  2O8G A;  3C5W C;  4UT3 A;  4LAC C;  5JJT A;  1XM7 A;  3ZTV A;  1S70 A;  4UT3 B;  3QG5 C;  3QFO A;  4Q7F A;  4V0X A;  5JPE A;  1NNW A;  1UF3 A;  1UTE A;  1HPU A;  1OIE A;  3RL4 A;  2CV9 A;  1IT6 A;  4ORB A;  4TUI A;  4LU9 A;  2Q8U A;  2O8A A;  4JA7 A;  3JYF A;  1II7 A;  4JA9 A;  5IOH A;  1S3N A;  1S8E A;  1WAO 1;  5F3W A;  1Z2W A;  4H2B A;  1MF8 A;  4DHL A;  1AUI A;  3H69 A;  2HYO A;  3E7A A;  3LL8 A;  3H63 A;  4I5N C;  4FBW A;  2USH A;  3AV0 A;  2IE3 C;  5HPE A;  1V73 A;  3N5U A;  4UWQ A;  5EQV A;  4ZVZ A;  1QHW A;  5B8I A;  1USH A;  3K7V C;  4H2F A;  3H62 B;  1T70 A;  4OR9 A;  3FGA C;  2A22 A;  4MP0 A;  3THO B;  4J6O A;  4H1S A;  2NPP C;  5C1V A;  2Z06 A;  3H66 A;  1QFC A;  1KBP A;  3H60 A;  2YVT A;  3H61 A;  4YKE A;  2P6B A;  4F0Z A;  3RL5 A;  3QFM A;  2HYP A;  3KBP A;  1OI8 A;  1S3L A;  4O24 A;  4KBP A;  1Z2X A;  5INB A;  3EGH A;  1FJM A;  4FCX A;  2GJU A;  3H68 A;  1S95 A;  1WAR A;  4H2I A;  4IYP C;  4DT2 A;  2WDF A;  3DW8 C;  3IB7 A;  3THN A;  1HO5 A;  5J28 A;  2Z72 A;  4XPN A;  2IE4 C;  4FBK A;  1HP1 A;  4FBQ A;  3EGG A;  4V0W A;  2BDX A;  2NYM C;  3IVD A;  3C9F A;  4ZX2 A;  1TCO A;  3HVQ A;  2WDC A;  4G9J A;  5DNY A;  3IB8 A;  3ICF A;  4I5L C;  4M0V A;  3AUZ A;  2R17 A;  4NZV A; 
#chains in the Genus database with same CATH topology
 2QJC A;  4IL1 A;  2DFJ A;  2WDE A;  2QFR A;  3PSN A;  3E7B A;  4LTY A;  2ZBM A;  3RQZ A;  2QFP A;  1XZW A;  5GTU A;  3CK2 A;  3DSC A;  1U32 A;  2ZO9 B;  4H1Y P;  4ORA A;  3V4Y A;  5JPF A;  4DSY A;  4O4K A;  3FLO A;  3IVE A;  3RL3 A;  1M63 A;  3H64 A;  1SU1 A;  3T1I A;  4KKZ A;  1W24 A;  2HY1 A;  4HD0 A;  2XMO A;  4MOV A;  4O5G A;  3PSO A;  4B2O A;  2KKN A;  2BCD A;  3GVE A;  4UT2 A;  2WDD A;  2NYL C;  1G5B A;  4H2G A;  1S3M A;  2NXF A;  3K7W C;  3ZU0 A;  2Z1A A;  4O43 A;  2BQ8 X;  4ORC A;  4TUG A;  3H67 A;  2IAE C;  4WWL A;  3QFK A;  3P71 C;  2AHD A;  4V0V A;  3DSD A;  1T71 A;  4MOY A;  3QFN A;  1OID A;  1JK7 A;  3TGH A;  2JOG A;  2O8G A;  3C5W C;  4UT3 A;  4LAC C;  5JJT A;  1XM7 A;  3ZTV A;  1S70 A;  3D03 A;  4UT3 B;  3QG5 C;  3QFO A;  4Q7F A;  4V0X A;  5JPE A;  1NNW A;  1UF3 A;  1UTE A;  1HPU A;  1OIE A;  3RL4 A;  2CV9 A;  1IT6 A;  4ORB A;  4TUI A;  4LU9 A;  2Q8U A;  2O8A A;  4JA7 A;  3JYF A;  1II7 A;  4JA9 A;  5IOH A;  1S3N A;  1S8E A;  1WAO 1;  5F3W A;  1Z2W A;  4H2B A;  1MF8 A;  4DHL A;  1AUI A;  3H69 A;  2HYO A;  3E7A A;  3LL8 A;  3H63 A;  4I5N C;  4FBW A;  2USH A;  3AV0 A;  2IE3 C;  5HPE A;  1V73 A;  2YEQ A;  3N5U A;  4UWQ A;  5EQV A;  4ZVZ A;  1QHW A;  5B8I A;  1USH A;  3K7V C;  4H2F A;  3H62 B;  1T70 A;  4OR9 A;  3FGA C;  2A22 A;  4MP0 A;  3THO B;  4J6O A;  4H1S A;  2NPP C;  5C1V A;  2DXL A;  2Z06 A;  3H66 A;  1QFC A;  1KBP A;  3H60 A;  2YVT A;  3H61 A;  4YKE A;  2P6B A;  4F0Z A;  3RL5 A;  3QFM A;  2HYP A;  3KBP A;  1OI8 A;  1S3L A;  4O24 A;  4KBP A;  1Z2X A;  5INB A;  3EGH A;  1FJM A;  4FCX A;  2GJU A;  3H68 A;  1S95 A;  1WAR A;  4H2I A;  4IYP C;  4DT2 A;  2WDF A;  3DW8 C;  3IB7 A;  3THN A;  1HO5 A;  5J28 A;  2Z72 A;  4XPN A;  2IE4 C;  4FBK A;  1HP1 A;  4FBQ A;  3EGG A;  4V0W A;  2BDX A;  2NYM C;  3IVD A;  3C9F A;  4ZX2 A;  1TCO A;  3HVQ A;  2WDC A;  4G9J A;  2DXN A;  5DNY A;  3IB8 A;  3ICF A;  3E0J A;  4I5L C;  4M0V A;  2ZOA A;  3AUZ A;  2R17 A;  4NZV A; 
#chains in the Genus database with same CATH homology
 2QJC A;  4IL1 A;  2DFJ A;  2WDE A;  2QFR A;  3PSN A;  3E7B A;  4LTY A;  2ZBM A;  3RQZ A;  2QFP A;  1XZW A;  5GTU A;  3CK2 A;  3DSC A;  1U32 A;  2ZO9 B;  4H1Y P;  4ORA A;  3V4Y A;  5JPF A;  4DSY A;  4O4K A;  3FLO A;  3IVE A;  3RL3 A;  1M63 A;  3H64 A;  1SU1 A;  3T1I A;  4KKZ A;  1W24 A;  2HY1 A;  4HD0 A;  2XMO A;  4MOV A;  4O5G A;  3PSO A;  4B2O A;  2KKN A;  2BCD A;  3GVE A;  4UT2 A;  2WDD A;  2NYL C;  1G5B A;  4H2G A;  1S3M A;  2NXF A;  3K7W C;  3ZU0 A;  2Z1A A;  4O43 A;  2BQ8 X;  4ORC A;  4TUG A;  3H67 A;  2IAE C;  4WWL A;  3QFK A;  3P71 C;  2AHD A;  4V0V A;  3DSD A;  1T71 A;  4MOY A;  3QFN A;  1OID A;  1JK7 A;  3TGH A;  2JOG A;  2O8G A;  3C5W C;  4UT3 A;  4LAC C;  5JJT A;  1XM7 A;  3ZTV A;  1S70 A;  3D03 A;  4UT3 B;  3QG5 C;  3QFO A;  4Q7F A;  4V0X A;  5JPE A;  1NNW A;  1UF3 A;  1UTE A;  1HPU A;  1OIE A;  3RL4 A;  2CV9 A;  1IT6 A;  4ORB A;  4TUI A;  4LU9 A;  2Q8U A;  2O8A A;  4JA7 A;  3JYF A;  1II7 A;  4JA9 A;  5IOH A;  1S3N A;  1S8E A;  1WAO 1;  5F3W A;  1Z2W A;  4H2B A;  1MF8 A;  4DHL A;  1AUI A;  3H69 A;  2HYO A;  3E7A A;  3LL8 A;  3H63 A;  4I5N C;  4FBW A;  2USH A;  3AV0 A;  2IE3 C;  5HPE A;  1V73 A;  2YEQ A;  3N5U A;  4UWQ A;  5EQV A;  4ZVZ A;  1QHW A;  5B8I A;  1USH A;  3K7V C;  4H2F A;  3H62 B;  1T70 A;  4OR9 A;  3FGA C;  2A22 A;  4MP0 A;  3THO B;  4J6O A;  4H1S A;  2NPP C;  5C1V A;  2DXL A;  2Z06 A;  3H66 A;  1QFC A;  1KBP A;  3H60 A;  2YVT A;  3H61 A;  4YKE A;  2P6B A;  4F0Z A;  3RL5 A;  3QFM A;  2HYP A;  3KBP A;  1OI8 A;  1S3L A;  4O24 A;  4KBP A;  1Z2X A;  5INB A;  3EGH A;  1FJM A;  4FCX A;  2GJU A;  3H68 A;  1S95 A;  1WAR A;  4H2I A;  4IYP C;  4DT2 A;  2WDF A;  3DW8 C;  3IB7 A;  3THN A;  1HO5 A;  5J28 A;  2Z72 A;  4XPN A;  2IE4 C;  4FBK A;  1HP1 A;  4FBQ A;  3EGG A;  4V0W A;  2BDX A;  2NYM C;  3IVD A;  3C9F A;  4ZX2 A;  1TCO A;  3HVQ A;  2WDC A;  4G9J A;  2DXN A;  5DNY A;  3IB8 A;  3ICF A;  3E0J A;  4I5L C;  4M0V A;  2ZOA A;  3AUZ A;  2R17 A;  4NZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...