3RL5A

Rat metallophosphodiesterase mpped2 h67r mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
279
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTRSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Metallophosphoesterase MPPED2
total genus 91
structure length 279
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl5A00
2O8AA 3QFMA 1Z2XA 2ZBMA 4H1SA 2YVTA 1M63A 3CK2A 4ORBA 5JJTA 3N5UA 1S3LA 3H63A 4M0VA 3H61A 4I5NC 3RL3A 1QFCA 1SU1A 1S95A 4OR9A 4B2OA 1S8EA 3C5WC 2HY1A 4JA7A 5J28A 1S70A 2IE3C 3ZTVA 3DSCA 2HYOA 3KBPA 2BQ8X 2IAEC 3EGHA 1S3MA 4MOVA 4UT3B 3LL8A 3IB8A 4ZX2A 2WDCA 4H2IA 4UT3A 2GJUA 3H66A 3HVQA 3TGHA 4DHLA 1HPUA 4DSYA 1TCOA 4YKEA 3E7BA 4ORAA 2JOGA 4KBPA 4H2BA 1KBPA 4MP0A 2NYMC 5INBA 3K7WC 1XM7A 4IL1A 1UF3A 4FBKA 3QG5C 1T71A 1NNWA 4FBWA 3AUZA 3E7AA 1T70A 4MOYA 1OIDA 1FJMA 2AHDA 3P71C 3QFKA 1II7A 4V0VA 3H64A 3H68A 4I5LC 1S3NA 3ZU0A 3K7VC 3PSOA 2NXFA 2BDXA 4G9JA 4O24A 2QFRA 2Z72A 3H62B 4LU9A 1U32A 2Q8UA 1IT6A 4J6OA 3DSDA 1MF8A 3THNA 2WDFA 1WAO1 3PSNA 4DT2A 2P6BA 2USHA 4H2GA 2WDEA 4JA9A 1QHWA 2R17A 2CV9A 1OIEA 3H69A 5GTUA 3QFOA 1UTEA 2HYPA 4Q7FA 4ORCA 3DW8C 2KKNA 3QFNA 4TUIA 4XPNA 2IE4C 1HO5A 2NPPC 4UWQA 3JYFA 2Z1AA 5IOHA 5B8IA 2DFJA 3IVDA 1HP1A 2A22A 3ICFA 1OI8A 3H60A 2XMOA 5EQVA 1G5BA 4O43A 1USHA 4H1YP 2WDDA 2QJCA 1XZWA 4HD0A 2NYLC 2O8GA 4IYPC 4NZVA 3AV0A 3RL4A 1AUIA 3FGAC 4WWLA 1V73A 1Z2WA 5JPEA 4H2FA 3EGGA 3T1IA 3RL5A 4KKZA 3V4YA 4O5GA 3IVEA 2QFPA 4LTYA 5C1VA 3THOB 5JPFA 4F0ZA 4UT2A 1W24A 3C9FA 3IB7A 5HPEA 2Z06A 2BCDA 3H67A 4V0XA 3GVEA 1JK7A 4FCXA 1WARA 4O4KA 4V0WA 4TUGA 4LACC 4FBQA 5F3WA 5DNYA 4ZVZA 3RQZA
chains in the Genus database with same CATH superfamily
2O8AA 3QFMA 1Z2XA 2ZBMA 4H1SA 2YVTA 1M63A 3CK2A 4ORBA 5JJTA 3N5UA 1S3LA 3H63A 4M0VA 3H61A 4I5NC 3RL3A 1QFCA 1SU1A 1S95A 4OR9A 4B2OA 1S8EA 3C5WC 2HY1A 4JA7A 5J28A 1S70A 2IE3C 3ZTVA 3DSCA 2HYOA 3KBPA 2BQ8X 2IAEC 3EGHA 1S3MA 4MOVA 4UT3B 3LL8A 3IB8A 4ZX2A 2WDCA 4H2IA 4UT3A 2GJUA 3H66A 3HVQA 3TGHA 4DHLA 1HPUA 4DSYA 1TCOA 4YKEA 3E7BA 4ORAA 2JOGA 4KBPA 4H2BA 1KBPA 4MP0A 2NYMC 5INBA 3K7WC 1XM7A 4IL1A 1UF3A 4FBKA 3QG5C 1T71A 2ZOAA 1NNWA 4FBWA 3AUZA 3E7AA 1T70A 4MOYA 1OIDA 1FJMA 2AHDA 3P71C 2DXNA 3QFKA 1II7A 4V0VA 3H64A 3H68A 4I5LC 1S3NA 3ZU0A 3K7VC 3PSOA 2NXFA 2BDXA 4G9JA 4O24A 2QFRA 2Z72A 3H62B 4LU9A 1U32A 2Q8UA 1IT6A 2YEQA 4J6OA 1MF8A 3DSDA 3THNA 2WDFA 1WAO1 3PSNA 4DT2A 2P6BA 2USHA 4H2GA 2WDEA 4JA9A 1QHWA 2R17A 2CV9A 1OIEA 3H69A 5GTUA 3QFOA 1UTEA 2HYPA 4Q7FA 4ORCA 3DW8C 2KKNA 3QFNA 4TUIA 3E0JA 4XPNA 2IE4C 1HO5A 2NPPC 4UWQA 3JYFA 2Z1AA 5IOHA 5B8IA 2DFJA 3IVDA 1HP1A 2A22A 2ZO9B 3ICFA 1OI8A 3H60A 2XMOA 5EQVA 1G5BA 4O43A 1USHA 4H1YP 2WDDA 2QJCA 1XZWA 4HD0A 2NYLC 2O8GA 4IYPC 4NZVA 3AV0A 3RL4A 1AUIA 3FGAC 4WWLA 1V73A 1Z2WA 5JPEA 4H2FA 3EGGA 3T1IA 3RL5A 4KKZA 3V4YA 4O5GA 3IVEA 2QFPA 4LTYA 5C1VA 3THOB 5JPFA 4F0ZA 4UT2A 2DXLA 1W24A 3C9FA 3D03A 3IB7A 5HPEA 2Z06A 2BCDA 3H67A 4V0XA 3FLOA 1JK7A 3GVEA 4FCXA 1WARA 4O4KA 4V0WA 4TUGA 4LACC 4FBQA 5F3WA 5DNYA 4ZVZA 3RQZA
chains in the Genus database with same CATH topology
2O8AA 3QFMA 1Z2XA 2ZBMA 4H1SA 2YVTA 1M63A 3CK2A 4ORBA 5JJTA 3N5UA 1S3LA 3H63A 4M0VA 3H61A 4I5NC 3RL3A 1QFCA 1SU1A 1S95A 4OR9A 4B2OA 1S8EA 3C5WC 2HY1A 4JA7A 5J28A 1S70A 2IE3C 3ZTVA 3DSCA 2HYOA 3KBPA 2BQ8X 2IAEC 3EGHA 1S3MA 4MOVA 4UT3B 3LL8A 3IB8A 4ZX2A 2WDCA 4H2IA 4UT3A 2GJUA 3H66A 3HVQA 3TGHA 4DHLA 1HPUA 4DSYA 1TCOA 4YKEA 3E7BA 4ORAA 2JOGA 4KBPA 4H2BA 1KBPA 4MP0A 2NYMC 5INBA 3K7WC 1XM7A 4IL1A 1UF3A 4FBKA 3QG5C 1T71A 2ZOAA 1NNWA 4FBWA 3AUZA 3E7AA 1T70A 4MOYA 1OIDA 1FJMA 2AHDA 3P71C 2DXNA 3QFKA 1II7A 4V0VA 3H64A 3H68A 4I5LC 1S3NA 3ZU0A 3K7VC 3PSOA 2NXFA 2BDXA 4G9JA 4O24A 2QFRA 2Z72A 3H62B 4LU9A 1U32A 2Q8UA 1IT6A 2YEQA 4J6OA 1MF8A 3DSDA 3THNA 2WDFA 1WAO1 3PSNA 4DT2A 2P6BA 2USHA 4H2GA 2WDEA 4JA9A 1QHWA 2R17A 2CV9A 1OIEA 3H69A 5GTUA 3QFOA 1UTEA 2HYPA 4Q7FA 4ORCA 3DW8C 2KKNA 3QFNA 4TUIA 3E0JA 4XPNA 2IE4C 1HO5A 2NPPC 4UWQA 3JYFA 2Z1AA 5IOHA 5B8IA 2DFJA 3IVDA 1HP1A 2A22A 2ZO9B 3ICFA 1OI8A 3H60A 2XMOA 5EQVA 1G5BA 4O43A 1USHA 4H1YP 2WDDA 2QJCA 1XZWA 4HD0A 2NYLC 2O8GA 4IYPC 4NZVA 3AV0A 3RL4A 1AUIA 3FGAC 4WWLA 1V73A 1Z2WA 5JPEA 4H2FA 3EGGA 3T1IA 3RL5A 4KKZA 3V4YA 4O5GA 3IVEA 2QFPA 4LTYA 5C1VA 3THOB 5JPFA 4F0ZA 4UT2A 2DXLA 1W24A 3C9FA 3D03A 3IB7A 5HPEA 2Z06A 2BCDA 3H67A 4V0XA 3FLOA 1JK7A 3GVEA 4FCXA 1WARA 4O4KA 4V0WA 4TUGA 4LACC 4FBQA 5F3WA 5DNYA 4ZVZA 3RQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8A A;  3QFM A;  1Z2X A;  2ZBM A;  4H1S A;  2YVT A;  1M63 A;  3CK2 A;  4ORB A;  5JJT A;  3N5U A;  1S3L A;  3H63 A;  4M0V A;  3H61 A;  4I5N C;  3RL3 A;  1QFC A;  1SU1 A;  1S95 A;  4OR9 A;  4B2O A;  1S8E A;  3C5W C;  2HY1 A;  4JA7 A;  5J28 A;  1S70 A;  2IE3 C;  3ZTV A;  3DSC A;  2HYO A;  3KBP A;  2BQ8 X;  2IAE C;  3EGH A;  1S3M A;  4MOV A;  4UT3 B;  3LL8 A;  3IB8 A;  4ZX2 A;  2WDC A;  4H2I A;  4UT3 A;  2GJU A;  3H66 A;  3HVQ A;  3TGH A;  4DHL A;  1HPU A;  4DSY A;  1TCO A;  4YKE A;  3E7B A;  4ORA A;  2JOG A;  4KBP A;  4H2B A;  1KBP A;  4MP0 A;  2NYM C;  5INB A;  3K7W C;  1XM7 A;  4IL1 A;  1UF3 A;  4FBK A;  3QG5 C;  1T71 A;  1NNW A;  4FBW A;  3AUZ A;  3E7A A;  1T70 A;  4MOY A;  1OID A;  1FJM A;  2AHD A;  3P71 C;  3QFK A;  1II7 A;  4V0V A;  3H64 A;  3H68 A;  4I5L C;  1S3N A;  3ZU0 A;  3K7V C;  3PSO A;  2NXF A;  2BDX A;  4G9J A;  4O24 A;  2QFR A;  2Z72 A;  3H62 B;  4LU9 A;  1U32 A;  2Q8U A;  1IT6 A;  4J6O A;  3DSD A;  1MF8 A;  3THN A;  2WDF A;  1WAO 1;  3PSN A;  4DT2 A;  2P6B A;  2USH A;  4H2G A;  2WDE A;  4JA9 A;  1QHW A;  2R17 A;  2CV9 A;  1OIE A;  3H69 A;  5GTU A;  3QFO A;  1UTE A;  2HYP A;  4Q7F A;  4ORC A;  3DW8 C;  2KKN A;  3QFN A;  4TUI A;  4XPN A;  2IE4 C;  1HO5 A;  2NPP C;  4UWQ A;  3JYF A;  2Z1A A;  5IOH A;  5B8I A;  2DFJ A;  3IVD A;  1HP1 A;  2A22 A;  3ICF A;  1OI8 A;  3H60 A;  2XMO A;  5EQV A;  1G5B A;  4O43 A;  1USH A;  4H1Y P;  2WDD A;  2QJC A;  1XZW A;  4HD0 A;  2NYL C;  2O8G A;  4IYP C;  4NZV A;  3AV0 A;  3RL4 A;  1AUI A;  3FGA C;  4WWL A;  1V73 A;  1Z2W A;  5JPE A;  4H2F A;  3EGG A;  3T1I A;  3RL5 A;  4KKZ A;  3V4Y A;  4O5G A;  3IVE A;  2QFP A;  4LTY A;  5C1V A;  3THO B;  5JPF A;  4F0Z A;  4UT2 A;  1W24 A;  3C9F A;  3IB7 A;  5HPE A;  2Z06 A;  2BCD A;  3H67 A;  4V0X A;  3GVE A;  1JK7 A;  4FCX A;  1WAR A;  4O4K A;  4V0W A;  4TUG A;  4LAC C;  4FBQ A;  5F3W A;  5DNY A;  4ZVZ A;  3RQZ A; 
#chains in the Genus database with same CATH topology
 2O8A A;  3QFM A;  1Z2X A;  2ZBM A;  4H1S A;  2YVT A;  1M63 A;  3CK2 A;  4ORB A;  5JJT A;  3N5U A;  1S3L A;  3H63 A;  4M0V A;  3H61 A;  4I5N C;  3RL3 A;  1QFC A;  1SU1 A;  1S95 A;  4OR9 A;  4B2O A;  1S8E A;  3C5W C;  2HY1 A;  4JA7 A;  5J28 A;  1S70 A;  2IE3 C;  3ZTV A;  3DSC A;  2HYO A;  3KBP A;  2BQ8 X;  2IAE C;  3EGH A;  1S3M A;  4MOV A;  4UT3 B;  3LL8 A;  3IB8 A;  4ZX2 A;  2WDC A;  4H2I A;  4UT3 A;  2GJU A;  3H66 A;  3HVQ A;  3TGH A;  4DHL A;  1HPU A;  4DSY A;  1TCO A;  4YKE A;  3E7B A;  4ORA A;  2JOG A;  4KBP A;  4H2B A;  1KBP A;  4MP0 A;  2NYM C;  5INB A;  3K7W C;  1XM7 A;  4IL1 A;  1UF3 A;  4FBK A;  3QG5 C;  1T71 A;  2ZOA A;  1NNW A;  4FBW A;  3AUZ A;  3E7A A;  1T70 A;  4MOY A;  1OID A;  1FJM A;  2AHD A;  3P71 C;  2DXN A;  3QFK A;  1II7 A;  4V0V A;  3H64 A;  3H68 A;  4I5L C;  1S3N A;  3ZU0 A;  3K7V C;  3PSO A;  2NXF A;  2BDX A;  4G9J A;  4O24 A;  2QFR A;  2Z72 A;  3H62 B;  4LU9 A;  1U32 A;  2Q8U A;  1IT6 A;  2YEQ A;  4J6O A;  1MF8 A;  3DSD A;  3THN A;  2WDF A;  1WAO 1;  3PSN A;  4DT2 A;  2P6B A;  2USH A;  4H2G A;  2WDE A;  4JA9 A;  1QHW A;  2R17 A;  2CV9 A;  1OIE A;  3H69 A;  5GTU A;  3QFO A;  1UTE A;  2HYP A;  4Q7F A;  4ORC A;  3DW8 C;  2KKN A;  3QFN A;  4TUI A;  3E0J A;  4XPN A;  2IE4 C;  1HO5 A;  2NPP C;  4UWQ A;  3JYF A;  2Z1A A;  5IOH A;  5B8I A;  2DFJ A;  3IVD A;  1HP1 A;  2A22 A;  2ZO9 B;  3ICF A;  1OI8 A;  3H60 A;  2XMO A;  5EQV A;  1G5B A;  4O43 A;  1USH A;  4H1Y P;  2WDD A;  2QJC A;  1XZW A;  4HD0 A;  2NYL C;  2O8G A;  4IYP C;  4NZV A;  3AV0 A;  3RL4 A;  1AUI A;  3FGA C;  4WWL A;  1V73 A;  1Z2W A;  5JPE A;  4H2F A;  3EGG A;  3T1I A;  3RL5 A;  4KKZ A;  3V4Y A;  4O5G A;  3IVE A;  2QFP A;  4LTY A;  5C1V A;  3THO B;  5JPF A;  4F0Z A;  4UT2 A;  2DXL A;  1W24 A;  3C9F A;  3D03 A;  3IB7 A;  5HPE A;  2Z06 A;  2BCD A;  3H67 A;  4V0X A;  3FLO A;  1JK7 A;  3GVE A;  4FCX A;  1WAR A;  4O4K A;  4V0W A;  4TUG A;  4LAC C;  4FBQ A;  5F3W A;  5DNY A;  4ZVZ A;  3RQZ A; 
#chains in the Genus database with same CATH homology
 2O8A A;  3QFM A;  1Z2X A;  2ZBM A;  4H1S A;  2YVT A;  1M63 A;  3CK2 A;  4ORB A;  5JJT A;  3N5U A;  1S3L A;  3H63 A;  4M0V A;  3H61 A;  4I5N C;  3RL3 A;  1QFC A;  1SU1 A;  1S95 A;  4OR9 A;  4B2O A;  1S8E A;  3C5W C;  2HY1 A;  4JA7 A;  5J28 A;  1S70 A;  2IE3 C;  3ZTV A;  3DSC A;  2HYO A;  3KBP A;  2BQ8 X;  2IAE C;  3EGH A;  1S3M A;  4MOV A;  4UT3 B;  3LL8 A;  3IB8 A;  4ZX2 A;  2WDC A;  4H2I A;  4UT3 A;  2GJU A;  3H66 A;  3HVQ A;  3TGH A;  4DHL A;  1HPU A;  4DSY A;  1TCO A;  4YKE A;  3E7B A;  4ORA A;  2JOG A;  4KBP A;  4H2B A;  1KBP A;  4MP0 A;  2NYM C;  5INB A;  3K7W C;  1XM7 A;  4IL1 A;  1UF3 A;  4FBK A;  3QG5 C;  1T71 A;  2ZOA A;  1NNW A;  4FBW A;  3AUZ A;  3E7A A;  1T70 A;  4MOY A;  1OID A;  1FJM A;  2AHD A;  3P71 C;  2DXN A;  3QFK A;  1II7 A;  4V0V A;  3H64 A;  3H68 A;  4I5L C;  1S3N A;  3ZU0 A;  3K7V C;  3PSO A;  2NXF A;  2BDX A;  4G9J A;  4O24 A;  2QFR A;  2Z72 A;  3H62 B;  4LU9 A;  1U32 A;  2Q8U A;  1IT6 A;  2YEQ A;  4J6O A;  1MF8 A;  3DSD A;  3THN A;  2WDF A;  1WAO 1;  3PSN A;  4DT2 A;  2P6B A;  2USH A;  4H2G A;  2WDE A;  4JA9 A;  1QHW A;  2R17 A;  2CV9 A;  1OIE A;  3H69 A;  5GTU A;  3QFO A;  1UTE A;  2HYP A;  4Q7F A;  4ORC A;  3DW8 C;  2KKN A;  3QFN A;  4TUI A;  3E0J A;  4XPN A;  2IE4 C;  1HO5 A;  2NPP C;  4UWQ A;  3JYF A;  2Z1A A;  5IOH A;  5B8I A;  2DFJ A;  3IVD A;  1HP1 A;  2A22 A;  2ZO9 B;  3ICF A;  1OI8 A;  3H60 A;  2XMO A;  5EQV A;  1G5B A;  4O43 A;  1USH A;  4H1Y P;  2WDD A;  2QJC A;  1XZW A;  4HD0 A;  2NYL C;  2O8G A;  4IYP C;  4NZV A;  3AV0 A;  3RL4 A;  1AUI A;  3FGA C;  4WWL A;  1V73 A;  1Z2W A;  5JPE A;  4H2F A;  3EGG A;  3T1I A;  3RL5 A;  4KKZ A;  3V4Y A;  4O5G A;  3IVE A;  2QFP A;  4LTY A;  5C1V A;  3THO B;  5JPF A;  4F0Z A;  4UT2 A;  2DXL A;  1W24 A;  3C9F A;  3D03 A;  3IB7 A;  5HPE A;  2Z06 A;  2BCD A;  3H67 A;  4V0X A;  3FLO A;  1JK7 A;  3GVE A;  4FCX A;  1WAR A;  4O4K A;  4V0W A;  4TUG A;  4LAC C;  4FBQ A;  5F3W A;  5DNY A;  4ZVZ A;  3RQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...