3RLIA

Crystal structure of monoacylglycerol lipase from bacillus sp. h257 in complex with pmsf
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
243
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGLPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 98
structure length 243
sequence length 249
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rliA00
2ZJ7A 5H3HA 5HK9A 3IDAA 5C81A 3LCRA 4DMCA 2PSDA 2GBCA 2XDWA 1MX1A 4M0FA 5ALSA 3C6ZA 3C8DA 3ILSA 4BAZA 3FAKA 4FNMA 1XZDA 5C8XA 4E11A 1YSCA 3D59A 1G5FA 1GQRA 1G66A 3STTA 4YX9A 1QIJA 2VJBA 4AX4A 2AJDA 5EFZA 3KWJA 3R40A 4H7DA 1XFDA 1DT3A 5HF6A 1UXOA 4OB6A 1DWQA 1MTZA 5ALMA 4C4ZA 3DQZA 1H2ZA 5AKIA 2O2GA 4UBIA 5LLSA 4OSEA 4DNQA 3WK7A 1QFSA 2OAEA 4HAIA 1BCSA 1DWPA 4ROTA 3W2TA 5HKAA 3N2ZB 3I28A 4V2IA 4HXEB 1MAAA 4N5IX 4DIUA 5EGNA 2XMGA 2I78A 2ONCA 4G4GA 2HRRA 2WUGA 3NUZA 3F97A 4K6HA 2XMDA 5BOVA 4X93A 4X00A 4JH0A 4EZIA 4OB8A 4X92A 4UHCA 3DEAA 4CG1A 3OPMA 4CG3A 5T4BA 1CEXA 2PSFA 2QZPA 5ALJA 3EF3A 3V9AA 5IVKA 1K6EA 5AOCA 2XUJA 4Y2JA 5AKYA 3M3DA 4ARAA 4BZZA 2JGKA 5AK4A 3JW8A 3NGMA 3IUJA 3WIOA 5HF9A 4P08A 4M0EA 1CUYA 4G8CA 5IVHA 3B12A 3M81A 3BDIA 2VSQA 4J0DA 1L7AA 4W1QA 5A7FA 2R8BA 3WK9A 1QIFA 1GQSA 3ESDA 2AJ8A 1THTA 1YB6A 4KACA 5AI0A 4X85A 2DHEA 3T4UA 3PFBA 5ALQA 4JNCA 5ALEA 4K5QA 4A16A 1E8MA 5AKXA 1VOTA 1K8QA 1ZGCA 2O2IA 4ZRDA 1K63A 2QUBA 3SWWA 5HKBA 1HPLA 4J0JA 3DDUA 3C5VA 1SOMA 1LPBB 2AJLI 4QDZA 2GYVA 3IIIA 1ZI6A 5ALWA 5AJHA 1GPKA 5HZGA 2OCKA 1LPOA 4QEKA 1IMJA 3OTQA 3STUA 5K3AA 3DKRA 4Q34A 1ZICA 5A62A 3D7RA 4LYDA 3WKCA 2VA9A 2GBGA 3SK0A 2HU7A 3QMWA 1E5TA 5KWJA 5E4JA 1CQWA 2B4KA 3WWDA 3OC0A 5FLKA 6YASA 1TIBA 2K2QB 4PQEA 1H2WA 2QJRA 4X6XA 1L7QA 5DLPA 2Z8XA 3NOXA 2W6CX 2V97A 4K6KA 3HC7A 3WA7A 3ESBA 4Y2TA 3V1NA 4OPMA 1LPNA 3WZMA 4L0CA 3QVMA 5AK6A 3CN7A 3Q0TA 1DX6A 3IBTA 1VJ5A 3I2JA 1CUHA 4X91A 1HLGA 5SYMA 5DTJA 1Z68A 3FYUC 1RP1A 3FLEA 3DS8A 2BUAA 1QIGA 2H7CA 2JBWA 2VAXA 1GPNA 4UBMA 3E1GA 4YPVA 3FYUB 1AZWA 2VQ6A 3L1HA 5HCUA 2DR0A 5EI5A 2Z3ZA 5AM4A 3DD5A 2JEZA 5CW2A 1WB4A 1TCCA 2XB6A 1XZMA 4Y9SA 1ZGBA 3D4LA 5T4EA 3ZI7A 1CUXA 2XQFA 1W6RA 5DTIA 2IIVA 4F21A 2WFMA 1WHSA 1R3DA 3FYUA 1AMNA 1G4HA 2G5PA 2RI6A 4W1PA 2WUFA 5JANA 1EB9A 2PSHA 2XUDA 4B83A 4GI1A 4Y2UA 3F9CA 4QLAA 4B9AA 3WLAA 2WQZA 4HS9A 4X95A 2D0DA 1O6GA 4PSUA 4XIIA 3SX4A 1JMYA 1ZJ4A 1XZIA 2R11A 3G0DA 1Q83A 1XRPA 1UOQA 5LYYA 1BCRA 1THGA 4BDTA 2HM7A 1EB8A 4IH9A 3O0DA 1R88A 2IX9A 1F0NA 3LS2A 1EX9A 1H22A 4AN1A 3W05A 4Y2SA 3RLIA 4B80A 2JEYA 3STYA 4A5SA 1Y7HA 5KBYA 4H7KA 1ODSA 1UKCA 4AQDA 4AO6A 2WUDA 1W75A 4IO0A 5FKJA 4W1SA 3BF7A 4FLMA 2DSNA 2HU5A 4JUIA 1VA4A 3C8HA 1QJ4A 3WA6A 1PFQA 2JGLA 2OCGA 3STXA 3ZWQA 1EXWA 3T52A 4S0XA 1AURA 5CH3A 1XRMA 2J3QA 4FFVA 3YASA 4C4YA 3KDAA 3MUNA 1MU0A 1AKNA 3WK8A 5AH0A 5EHNA 4RE6A 1C4XA 1VLQA 4AB1A 3BE8A 4X7BA 1EK1A 2BKLA 3WI7A 2WJ4A 1CUIA 3V48A 1JJBA 1MX9A 5IVDA 3A2NA 2PPLA 3FBWA 4H77A 2X5XA 5C8ZA 2Y1KA 4UHBA 5E4YA 5ALGA 1JMKC 5DYYA 5AM1A 5A7HA 3VVMA 1XZHA 2GBFA 5K3FA 4A23A 1CUAA 1TKRA 2ROQA 2C5FA 5CXUA 4EUSA 3BWXA 4AMZA 5IVIA 4UHEA 3WKEA 5J3JA 5KREA 1Q84A 1VXOA 3C43A 4F60A 4MYSA 4KEAA 3FVRA 3O95A 1JU4A 4MWTA 1R9MA 3AZQA 4RNCA 4FMPA 1UWCA 3E4DA 4XWGA 4Q3KA 2OLEA 4BB0A 4GLBA 1WM1A 4TPKA 2PX6A 5D3KA 3IVMA 1FFBA 1RYYA 2P8SA 2XUIA 3WL5A 1A8UA 5ALNA 3V1KA 5ALTA 4Y2QA 4E15A 1CV2A 2PUJA 3F67A 2WUEA 1LZLA 2HHAA 3I2HA 4GXNA 2OPHA 4EBBA 1JU3A 3A70A 3TJMA 5D3ZA 3HXKA 2YYSA 5FOQA 2FJ0A 1D07A 4BC1A 4L72A 5I9IA 3PI6A 4ETWA 3CN9A 4UFNA 1QIIA 4F5ZA 5BWBA 3GELA 5ALYA 1IUNA 1WOMA 2C7BA 1GGVA 1AC5A 5DWDA 4DNOA 4NVRA 5EIAA 1XKLA 1NU8A 1CUUA 4QNNA 1Q0ZA 5AKZA 1OXMA 2Y6VA 4X90A 2BGNA 2HIHA 4QWWA 1TAHA 4FNGA 2ZJFA 3NWOA 4K2AA 3ANSA 1ZI9A 5E2IA 3R3YA 1ORVA 5ALFA 2QS9A 1LPAB 3O4JA 1XZLA 5AI4A 1EHYA 1P0QA 1M33A 3FSGA 5HFNA 3O4GA 4DNPA 4UBOA 1YA4A 3G9UA 3X3HA 3IUQA 1BROA 1PJAA 4GWLA 1EH5A 2HA6A 2QXUA 4GECA 5C8VA 1A8QA 3WL6A 2QKYA 2HA3A 2Z3WA 3I6YA 5E4TA 1SCKA 1BEZA 5JZSA 3KWFA 1UOOA 3UMJA 4QA9A 1NU6A 3N0TA 4KR0A 1ISPA 4EY7A 4E14A 4H7HA 4WY5A 1AX9A 2O7RA 2PVSA 4KJXA 1MNQA 4ZWNA 1UZAA 3H2GA 1MNAA 2BJHA 4H7FA 3WIBA 5HK8A 4AO7A 1JJIA 2PU7A 1YCDA 2WIGA 3L1JA 1X2EA 1C7JA 2WHRA 3FYTA 4C87A 3QZUA 4J0CA 1VE7A 3G9ZA 4UBKA 4N8SA 2XUGA 3WL8A 1XLWA 4K6GA 1CUWA 4UFPA 1GZ7A 3RK4A 2DHDA 5A7GA 4LXIA 3F8SA 4FWBA 1DQZA 2J3DA 1N8SA 3KXPA 1DT5A 4U2BA 2XUPA 2AJBA 1XQWA 3VDXA 1W52X 1WB6A 3CCCA 4UBLA 3PE6A 4EY6A 5ALIA 4W9RA 3C6BA 5A6VA 4JYPA 4QE3A 2WU3A 5K3EA 4EHBA 1IUPA 2WKWA 1WPRA 1QIMA 1UK6A 1YR2A 1S8OA 3O9VA 1L7RA 5JAUA 2H7XA 2ZVDA 1CUZA 1UKAA 2Y2UA 1MAHA 2OGZA 3K2IA 1EDDA 2J4FA 1VZ2A 2ZYSA 1ACLA 4C4XA 1QTRA 4BAGA 2VATA 2PUHA 2RHWA 1XZCA 4X97A 4H7EA 5IH7A 4HXFB 4X71A 3W04A 4BDSA 1W76A 5AKHA 2WG2A 4LYEA 4XJVA 4BYMA 4FOLA 3HRHA 1QE3A 2C0PA 4FHZA 1ZD2P 1GPLA 3G7NA 2Q0XA 4UPDA 2CUTA 1QOZA 3WYDA 4CIAA 5ALZA 1HQDA 2RIPA 3H1AA 3ZLTA 1UKBA 1LNSA 5AP9A 3ED1A 3G9XA 1GT6A 4J0IA 1W1IA 1CUCA 3WWOA 3VJLA 1ACJA 1BN6A 3ESAA 2JGJA 1AGYA 1MPXA 3G0BA 5AOBA 3PUHA 5F4ZA 1ETHA 3G0CA 3H2JA 1JFRA 1GXSA 4BP8A 1R9NA 3WMRA 4G5XA 4TGLA 3QMMA 1J2EA 3WYNA 4Q82A 1CUDA 2VAVA 4AXBA 4W63A 1TCBA 2W22A 2WSLA 2ZYHA 2CJPA 4MXDA 2VJDA 2OCLA 4BRZA 1DQYA 1EVEA 2AJCA 2PU5A 4J0GA 1YAJA 5JADA 4Y2PA 2B61A 2OQIA 4UUQA 1P0IA 5LZ8A 1VXRA 3O9MA 3M83A 1UT6A 3DOIA 4Q3OA 2QOEA 3D3NA 2HRQA 4FFWA 1A7UA 4IQ4A 3STWA 5LKRA 4H0CA 4OYLA 2WIFA 1WHTA 3I2GA 2XMSA 1LBSA 1YASA 4KYVA 5D6OA 2G63A 5CBKA 5ALDA 2YASA 2YH2A 4HXGA 2XI4A 5JYCA 3E3AA 3GUUA 2CMFA 1MJ5A 1R50A 2BGRA 3BIWA 4G4IA 3W9BA 2DCMA 4C01A 2PSEA 5CT8A 1A88A 4UFOA 4X3CA 1AUOA 2VTVA 4OB7A 1XRQA 3O4IA 5HQ3A 4FLEA 3QPAA 3VJMA 3FWHA 3WWEA 5ALLA 4B0OA 1FJ2A 2XUKA 2YXPX 4MQMA 3ESCA 1J07A 1BS9A 4UBJA 2CB9A 5AICA 4DM7A 1LZKA 3LP5A 4U2FA 1EVQA 4U2CA 4H7JA 3AIMA 5T4HA 4J7AA 1LPMA 4OU4A 1JT2A 1XLUA 4X94A 2HFJA 2QJWA 4B0PA 1Y37A 2O7VA 2WFLB 7YASA 3EIOA 1XQVA 1T4MA 1U2EA 5LZ2A 1CUBA 1QZ3A 5JALA 3L1IA 3I1YA 1E89A 1U65A 2HA4A 3FLBA 1W4LA 3GROA 2WJ6A 4J0KA 1E3QA 4O08A 3KD2A 5HF5A 4WDRA 4E46A 1CUGA 4WFKA 1QIEA 4H7IA 3UUEA 1R4ZA 5CRIA 4EA6A 3HACA 2JGMA 3BL8A 1DTEA 5K3BA 2JIDA 3MVEA 5AK3A 2H9YA 2B9VA 4NMWA 2DQZA 1ODCA 2BCEA 2OCIA 3ANTA 4KE6A 4MEBA 4BVLA 4DTCA 1N1MA 2V96A 3R3VA 2VF2A 1KEZA 2X8BA 5CT4A 4X6UA 3G0IA 4KAFA 3ZPXA 1B41A 5CH8A 2XMCA 5LZ7A 1LPPA 5K3DA 1QFMA 2XQIA 5JZ9A 3FSGD 2E3JA 3D2BA 4HRYA 3BJRA 3DL4A 1CRLA 4Z49A 1IZ7A 3TGLA 4UHDA 5DJ5A 1YB7A 2G4LA 4B84A 3WJ1A 2GZSA 4IHAA 3G8YA 5CURA 3WKDA 1LPSA 5AHXA 2XQGA 3JWEA 2RGUA 1UK9A 4AMYA 1YAHA 5EHQA 1KU6A 3QM1A 3E0XA 3H19A 1BN7A 3FVTA 5K3CA 2D5LA 3I6MA 5BV7A 1A8SA 5CT9A 4J03A 3EQ8A 4QWMA 3HYSA 5KWIA 5AM0A 5A71A 4PSDA 5JASA 4QZVA 4BTLA 5AOAA 2UZ0A 2DHCA 4AN0A 4ZI5A 1MN6A 1H23A 1CFJA 3DJYA 4L9AA 1X2BA 4P9NA 1F8UA 1JKMA 4FBMA 4BCBA 2JF0A 1FFDA 1DWOA 4QDTA 1BE0A 1EDBA 2ZYRA 3FCYA 2WHPA 3WJ2A 5I7UA 1IUOA 3IURA 4I4CA 3U0VA 3VVLA 4BBZA 4PF1A 5FP0A 2I3DA 4XVCA 4BZWA 4F0JA 2JGFA 1H2YA 5JAHA 4I19A 3MUOA 4LXGA 3W06A 1YA8A 4Q05A 3I2KA 1SCQA 1XRLA 4CCWA 1Q0RA 2Y2VA 4ZGBA 1CIJA 1E8NA 5FPPA 4YK7A 2PM8A 4CIBA 3FCXA 4H18A 3HEAA 5ALPA 2QR5A 5DNUA 4DSAA 2PL5A 2V98A 3CXUA 3K6KA 1CPYA 4JEIA 1VE6A 2OGTA 2RHTA 4G4JA 1VZ3A 2QM0A 3B5EA 1EI9A 1BU8A 3HJUA 4AZ0A 5K5EA 3VJKA 2WTMA 2VJAA 3WQHA 4RGYA 2G5TA 3OURA 3AJAA 1BEEA 4W1RA 5CH5A 5T4FA 3IUNA 2X76A 1GKKA 4WCVA 5HF8A 1YS2X 2VJCA 5CT5A 4B9EA 4C89A 4WDQA 1XRNA 1HKHA 3WKBA 2ZJ6A 1N5RA 5ALRA 3D0KA 2RONA 5ALVA 4XX1A 4ZV7A 3C45A 5FPQA 2XLBA 1XZEA 1JJFA 3AZOA 4NZZA 4H35A 4LHEA 1CVLA 3BJMA 3AILA 5AKJA 4X6YA 4QDUA 2XQJA 2JGEA 4BTVA 1LBTA 1ZD5A 3IB3A 5ALUA 3F96A 1GKLA 4L3WA 3A2MA 4LXHA 4OCZA 2C58A 3C6XA 2WU4A 5FUMA 4Y2RA 2PSJA 1ZIXA 1DU4A 2WHPB 2XMBA 1U4NA 4QDXA 5JZBA 2XMZA 1CLEA 1CUFA 5EHXA 3HI4A 3QITA 4U2EA 1QGED 3QBJA 4KRXA 4Q1VA 1ZOIA 1HL7A 5FRDA 5LZ5A 4FDMA 1SC9A 2VT6A 3S2ZA 4J0HA 2HDWA 4BCDA 3D2AA 1YS1X 2O2HA 2Z8ZA 4DYHA 1QO7A 2VEOA 5ISMA 5JD6A 2XUFA 4WFJA 2BAGA 1ZIYA 3R3UA 3R3WA 4WFIA 4PNZA 3KOOA 2FJPA 1MO2A 2H1IA 2XMQA 1FFCA 5CMLA 3M82A 1NX9A 2Y6UA 4MQLA 5HFAA 3H17A 4JYMA 1P0PA 2XMRA 3H18A 4KRYA 2QVBA 4CG2A 2QRUA 4BP9A 4HZGA 3BIXA 4WY8A 3H0CA 2I3ZA 4G8BA 4DMHA 2QT9A 1EK2A 4G9GA 3VXKA 3QYJA 5AI5A 1VKHA 2C0QA 5ALKA 4TVKA 1IVYA 4EY8A 2WJ3A 4RE5A 2DQYA 2I03A 5LIPA 4BE4A 5JD4A 2C5GA 5AIBA 2WHQA 3C6YA 2WG1A 4B82A 4BE9A 4ZV9A 1TK3A 3ZV7A 3AZPA 2EDCA 3CCBA 5IKXA 3A2LA 1Y7IA 4GEGA 4GDMA 2WFLA 1BRTA 2XQKA 1ODTC 4QLOA 1XZJA 4DMKA 4BAUA 3AUKA 3R3XA 3BDVA 2C4HA 2XE4A 1CQZA 1LLFA 3HLKA 3V1LA 4DLNA 5AI9A 3F98A 5DNWA 5BWCA 5ALHA 4ITVA 2HADA 5DNVA 4INZA 4MWSA 3TRDA 4BCCA 1N5MA 4EY4A 3QMVA 1TCAA 5ESRA 3RKSA 4KE8A 3WL7A 4BC0A 1QIKA 4U2GA 4C6HA 2FX5A 2PBLA 1QIDA 1H2XA 2CEKA 2HA0A 3EQ7A 2HA2A 5FDFA 1WPXA 4PO3X 1XZGA 2GYWA 2OQVA 1O6FA 1ZD3A 2DFPA 4GBGA 4DNFA 5LP1A 1P0MA 3IULA 3R41A 2B20A 4MEAA 1TRHA 4KE7A 5K3FB 2J4CA 5CXXA 4FKBA 5JAPA 1XRRA 3DKKA 1CUSA 2ORYA 4U2DA 4C88A 3C87A 4FLFA 2WG0A 5JAOA 3FOBA 5ALOA 5A2GA 1UOPA 3VKFA 5JARA 1XZFA 3W9UA 3QPDA 1T2NA 3WZLA 4I3FA 3DNMA 3PF8A 2ZSIA 1U8EA 4GW3A 5LKAA 2HU8A 2IITA 5HQ3B 4UHFA 5JIBA 3HZOA 4D9JA 3G9TA 3EQ9A 2CZQA 4FTWA 2AXEA 1JI3A 3BF8A 2HFKA 4N8EA 2NW6A 2HA5A 1VA5A 3H1BA 4Y2XA 3I2FA 1IZ8A 2BUBA 2ES4A 1CR6A 3LLCA 4FBLA 5AM5A 3DYVA 3H2KA 2XLCA 2XT0A 4BVJA 1DINA 3G0GA 3SC2A 3Q8WA 3V1MA 1EA5A 1LGYA 4UHHA 3I1IA 5FV4A 4ZXFA 4EY5A 5FXMA 1MT3A 3PICA 2ACEA 4IH4A 4Y2YA 3UUFA 1XZKA 1K5PA 3H2HA 1F0PA 3RM3A 3U1TA 1E66A 2GBIA 3PFCA 3H04A 3DOHA 2WTNA 3AFIA 1SCIA 4N5HX 1ORWA 1WB5A 2CBGA 3TEJA 1QLWA 4Y2VA 2LIPA 5LZ4A 4KAJA 3PF9A 2OG1A 5AKLA 3ICVA 1UK7A 4OYYA 4CCYA 1X70A 2HL6A 4BATA 1ZJ5A 1PV1A 4M0MA 4DSZA 2RAUA 4IH1A 1J1IA 1EINA 2ZSHA 5DYTA 3STVA 3AIKA 4KAAA 3WWCA 5CT6A 1XKTA 3C5WP 2QMQA 1R1DA 1E8DA 5AKKA 1J06A 3VISA 2WILA 5EIEA 4ZREA 2XUOA 3I2IA 4HTAA 3WWPA 1USWA 1XQYA 3IUMA 3A6ZA 3GZJA 5AO9A 1SFRA 3DL7A 4B81A 2GZRA 4G9EA 1RWQA 1B6GA 4ARBA 5LZ9A 2OGSA 1XQXA 2QTBA 4G1FA 4OUKX 3P2MA 3KSRA 2OXEA 2FUKA 3R0VA 4PV7A 3HSSA 4P93A 1ZD4A 1ZI8A 1UFOA 3RARA 4GHWA 1FFAA 3G02A 3FNBA 3HABA 4MYDA 1UK8A 2XUHA 3ZLUA 4HRXA 4RPCA 2WFZA 3WK4A 3DLTA 5AM2A 4BVKA 4Q3LA 3BXPA 3K9BA 4DMFA 1QIHA 1F6WA 1XZBA 1FFEA 1HBJA 4CI9A 2XUQA 2OAGA 5DYWA 3GBSA 1WCYA 1OILA 3JYHA 4KE9A 4CFSA 2H7YA 2QUAA 3QH4A 2BFNA 4CCYB 3WK6A 3FLAA 5SYNA 4B6GA 4B7ZA 1MX5A 3ICWA 2WIKA 1TQHA 3WKAA 4BRSA 5AK5A 4LIPD 1G42A 5AKGA 2GYUA 1C7IA 2PKYX 5AIAA 3AIOA 3I6ZA 3MGAA 3OOSA 2CKMA 4P92A 1I6WA 3EBLA 2QXTA 4WJLA 4YASA 2ACKA 4G8DA 5C7YA 4NS4A 1XROA 5CTAA 2VT7A 4HVTA 2Z5GA 4UBNA 3GFFA 4DGQA 1DX4A 3AINA 5AI8A 1OCEA 3O4HA 5I8PA 1CUJA 4PW0A 1AQLA 1XLVA 1QO9A 4Y7DA 2EDAA 1CUEA 3LIPA 4MJ3A 1XZAA 2JGIA 4QDOA 2V9ZA 4PSCA 4OD0A 5ALXA 2WM2A 3C70A 3GA7A 5EIHA 3PDCA 2ZYIA 5AKEA 1QONA 3ZLVA 3DCNA 4N8DA 1EDEA 4AO8A 3B3QA 2EEPA 3OM8A 1K4YA 1KU0A 3OG9A 4OU5A 4J3JA 2BUCA 1QTIA 1FSSA 3D2CA 3H2IA 5AM3A 3R3ZA 3PUIA 2HA7A 4B85A 5JATA 3S8YA 5EHZA 5AI6A 4EB0A 3D5EA 1HDEA 3QPCA 5JD5A 2WIDA 1CUVA 2WLSA 2WIJA 4AZ3A 3WK5A 5YASA 3DYIA 4LKOA 5D7BA 2XUAA 2ECFA 3IA2A 3LIIA
chains in the Genus database with same CATH superfamily
1ZRMA 3K30A 4G5FA 4OHBA 3IDAA 1BXZA 1F3OA 2W00A 3UV6A 3EDRA 1BXRA 3DZFA 3ETEA 4HQNA 4I50A 1NT4A 1RZRA 5DHFA 4JJIA 3E1SA 5ALSA 1Z17A 2I7VA 5EE9A 3ILSA 5CR9A 5L9AA 1XMQB 1CR1A 3F7MA 5ERYA 4EB6B 5IC5A 4BV8A 4R1PA 5F1OA 4A0SA 4RIHA 2Z9CA 3RUIA 3KPYA 3AJDA 4DLPA 3L6DA 2BGUA 5KVSA 1GQRA 5IMSA 3VPAA 4PGAA 5A1TA 3WJAA 2JLQA 3ILYA 5E7JA 2ZUDA 5AFSA 3B78A 1Q17A 1T3HA 2NXWA 4EYKA 1NV9A 4BUZA 1FB5A 4UE6A 3CZPA 2AUMA 3AEZA 4M83A 3B3JA 3SU8A 4ESHA 1CZHA 1GQQA 3MJCA 3R40A 5EKXA 3NWBA 2ONZA 1GZ6A 1LI7A 3VOBA 1L4KA 1XFDA 1Y1SA 3LW8A 4NF2A 5BWOA 3T5PA 1GL3A 3QE9Y 5LMNB 1C8LA 1PK8A 1QFYA 2ZATA 4M3NA 4OSOA 1P1BA 5F76A 3VU9B 4C4ZA 2CBZA 3DQZA 5CA0B 2NTJA 4CLRB 1P1FA 4AAYA 3D3WB 4QOSA 1QYCA 2OCBA 3I34X 4M9ZA 4RESA 4ZOLB 4F85A 2OCAA 3Q8LA 2I34A 1J5EB 4YFYA 4PLPA 3DOOA 3FDJA 3IYLW 4NDAA 1L4FA 4UBIA 3Q9NA 4ZJPA 3IR5A 2LUOA 1G6KA 2P6NA 3BE5A 3PD1A 5AXBA 2X0FA 1W5FA 1YRQA 2WJAA 2YDXA 4ZK2A 4E5MA 1S3GA 2YRXA 1T3LA 4MKIA 4ZTZB 4EG8A 1FDSA 3KL2A 3AFOA 2O6LA 1TPZA 1RBZA 1SIOA 3GNQA 4DUZB 3D1JA 2Q6VA 3I28A 4A8PA 3FNGA 1HR0B 2YN0A 2P9YA 5KYKA 1JHDA 4LDZA 2E21A 2ZTHA 1XKQA 4V2IA 1UPFA 2WF7A 3NP9A 1DBSA 5EZSA 2CJXA 4TKZA 9GPBA 5EP1A 4EKDA 3N2GA 1TMKA 4DIUA 3PQ3A 1CJCA 3CNQS 5LP6F 1IBKB 3ZJ4A 3OQPA 1EE9A 3F97A 3BD8A 4R2HA 5EE0A 3AL2A 3PNLA 1ZXLA 2XMDA 2CE2X 4MINA 4X93A 3TSWA 4A9AA 3TJZA 3GFVA 2BFOA 1IK6A 4OB8A 4BO2A 3GVHA 4MWDA 4Y6OA 1KJWA 3EYWA 3Q87B 1Z63A 4UHCA 2G83A 1PFVA 3DZIA 3LF2A 4JROA 4L85A 4HBGA 3C5HA 3BN3A 1RQGA 3HRKA 1CEXA 5M3BA 4Y1RB 2R4TA 1IQ0A 4I6JA 2B2CA 2OZKA 3RIGA 4DB4A 3V9AA 1U9CA 2GTPA 3C4VA 4QNRA 3TNFA 3RHZA 4C06A 1EQ2A 3V2IA 5IM4F 1FDRA 3G85A 4OL9A 2IU6A 1IB6A 1MB2A 1UPXA 2XSZD 3OZCA 1ZL0A 2EAUA 4QQ8A 4UMDA 4Y3UA 4EYGA 4WZBB 1JKXA 4YRIA 4GNRA 4KL8S 4ZO9A 1C1XA 3N2GB 3O94A 4FNAA 5AKYA 2FR1A 4HADA 3TLAA 4CT4B 4MLDA 4MUHA 3RQIA 1EE2A 3OETA 4DJ5X 2ZCJA 2JGKA 1M2EA 1PNOA 3NGMA 4FDVA 3UHFA 5KSZA 3GZTB 5KQGA 3RYIB 2B8NA 2H5IA 2EWVA 4G2NA 4MPDA 5LB2A 3HDQA 2P68A 2P9QA 3G2HA 1QR6A 2JZNA 2ZRDA 2C2XA 4DPLA 4DXAA 2ET6A 2J3KA 5EL0A 1ZYUA 1H3EA 5IVHA 3PQ5A 4QJ3A 1Q3HA 3M81A 3BDIA 3QF4A 2QTTA 4EGCB 3HZHA 2XGJA 1N5DA 2QLJA 1JNXX 1KPGA 9LDBA 2QNIA 2WMDA 4J0DA 1EQAA 3ECSA 2EOAA 4OQXA 2I3GA 1ZL2A 1VHDA 2LVBA 2R6HA 2CVQA 3HCAA 2G80A 3L0SA 4WN9A 4C3VA 3KIPA 2EJTA 1SURA 2R8BA 3O93A 3WK9A 4C07A 4MW1A 4RA6B 1LDMA 2X8AA 3B5IA 1NMEA 1T26A 4UARA 3DV0B 1MIHA 4UUNA 2C20A 3TBHA 3VH2A 1PP4A 2AJ8A 2OB2A 3GJ0A 5BNIA 1S1MA 1KDTA 2FUG1 3PX7A 3G5TA 4KACA 4BB9A 2DHEA 4XR9A 5D85A 3T4UA 1CIVA 4ARZB 3DO8A 1GPAA 3ZCXA 2AC4A 1UPAA 3PFKA 1BQEA 3OSUA 4HB0A 1LD3A 2FP4B 4IXWA 3NKVA 5IHPA 4UUAA 4BKMA 4CG0A 5MFPA 2B6HA 5DBFA 4K5QA 1XQ6A 3AVOA 4AG5A 5H5JA 3UMMA 4N3CA 2OM2A 4A16A 3WTBA 4S05A 1V11A 3DKVA 3K4QA 1E8MA 3A04A 5G0VA 3PHIA 1Z25A 2ZSAA 3NGLA 4HLCA 4YJ3A 1JHOA 1Z29A 1EZ4A 1VOTA 2Y1GA 1K8QA 2WAXA 4F9GA 3N59A 1GV0A 2C03A 3ELUA 4RJKA 4ZRDA 3TXXA 4ACBA 3P94A 3SN6A 2QW8A 3AEUB 3IAHA 1SUFA 4X1YA 5DF1A 2HDOA 1NYTA 3TLGA 3UV7A 3GH3A 1K7FB 2R65A 3EZXA 3K2QA 3DDUA 2W58A 1K0UA 2JATA 2RH5A 1VG0B 3Q0EA 4GI2A 3TR5A 2OV3A 3A6DA 5LUAA 3L02A 4DOMA 4HFNA 1LSSA 2AJLI 2G08A 2GYVA 1ZI6A 3P1JA 4LMBA 2YWFA 2PO5A 1BKYA 4CEIA 1LPOA 1QG6A 2QL7A 2GPTA 4TMXA 5SZHB 1WXEA 3TDKA 3STUA 3RSZA 4BEJA 1ZK0A 1PJ8A 4JUCA 2OFFA 1LK5A 4OGFA 4DABA 3FAZA 3FHLA 3JQGA 3BH7A 4QOFA 4Q34A 1KJIA 2NNWB 3BBPA 3EMDA 4UUMA 1JS1X 4FQ5A 2LKDA 1UC5B 1VRWA 3EWNA 5EJIA 2WJGA 3T9BA 3WKCA 2C07A 2VA9A 3CKMA 4Z1OA 1WG8A 3KUDA 2GBPA 1SAYA 1NQUA 2MCFA 2GVNA 1C9DB 1FYEA 2IDJA 3KUKA 3QMWA 3AF3A 4HB3A 1G5TA 4JBIA 5AW5A 4ZAYA 1VLZA 3EIFA 2VTDA 2PLWA 5HM6A 1U9IC 2FG7C 2XKJE 3DFFA 1SKUA 2UV8A 3OC0A 2D4HA 4QG7A 2IWHA 5IASA 4FYIA 3D3JA 4YMIA 1BFKA 1TIBA 3M8KA 4CMGA 1XLTA 4ZGGA 1K08A 1V25A 2FEWB 4CU2A 3HY3A 3OT4A 5LP6C 2N1BA 2QJRA 4HYQA 4J90A 5ULLA 4R1MA 3PHGA 2RI0A 4X6XA 2EZUA 3JVDA 2AX4A 5FBRB 3ZYZA 5CAEA 5CLIA 5HILA 1Q5PA 3NOXA 4UMEA 3L8FA 5KNDH 2YXEA 4R51A 5DRYA 5DM60 1HQYE 3QW2A 5CK4A 3WA7A 4V0RA 3S2EA 1KZ9A 3V1NA 3U4IA 4IEEA 1I1OA 2H4HA 2FDXA 1LPNA 2IA5A 3P9NA 3WZMA 4BFLA 3UN1A 1NPTO 4LCBA 2AQKA 3ZE2B 2GK7A 3UATA 2AMLA 1Q21A 1U3GA 4FGWA 2JH8A 5AK6A 3RU9A 1X1DA 4K8RB 5FLEX 4U7JA 5D5PA 2FSIA 3KHSA 3Q0TA 4C0JA 5KNDA 2IEAA 1UL1X 4I9NA 1QJCA 2W2LD 5EUBA 2J0QA 4KQFA 4C4OA 1PSZA 3M1YA 4C29A 2J07A 4RD6A 1O5IA 2X86A 2GZAA 2NQ8A 4FYMA 1ECBA 4Q39A 5K51A 2E6UX 3IV9A 4XIGS 4F71A 3AVVA 4LJ6A 5E9QA 1QDEA 4HDRB 4HVAA 2BISA 1N3LA 3DHNA 2A5JA 3EFEA 3FLEA 2EFDB 3IHTA 5CGZA 3DS8A 3HN6A 4CUZA 4CQNA 5IYZB 1A2OA 1BSVA 1NNSA 2BBSA 1TJPB 2I54A 3H83A 3TW8A 3BE4A 1QYDA 2XGGA 1QIGA 3OIYA 4KVZA 5CIQA 4QUBA 3NHRA 2VAXA 5LC1A 4FINA 4RSRA 4HZUB 5DBHX 2J5XA 4IEFB 4QM7A 1TUBA 1ULZA 1OF1A 3H0KA 1FYFA 1TM2A 4RF4A 3GFQA 2H11A 3PXCX 4NBLA 2X77A 3L1HA 3RSFA 1RJFA 1M67A 1YACA 3HM2A 4P7KA 1NW3A 4RS4A 4YLYA 5IDXA 4OHVA 2LZ0A 2VTBA 1NXQA 4LVOA 5TQJA 2GZDA 1W85A 2VDWB 5JT1A 3HFGA 2W4QA 2LCQA 2Z3ZA 1L7DA 4BFXA 1IXSB 3KOMA 1EGAA 5KYVA 5CW2A 1TCCA 2XB6A 2DWOA 4CN8A 3JQAA 5DTQA 4Q1EA 3MS7A 3KYDA 1UADA 1ZGBA 1L4NA 3B85A 1EJ2A 2WZQA 4P3NA 2UUOA 1DI0A 4YP7A 3IQFA 1HY3A 3A1TA 1GL6A 3GZNA 2BHRA 3F6SA 3QI7A 4JQSA 4ZAZA 3ZWYA 4B1FA 1JBQA 1CCWA 2O4CA 3OZXA 1N2OA 4QBKA 4UNIA 5DTRA 1FRVA 3ILHA 2HT1A 4QREA 2O1EA 2O5RA 3NH9A 5BO5A 3D7MA 1SPXA 2C2BA 4HAXA 4P7BA 4RD2A 5JWRA 1I3MA 3FDXA 4PYRA 3TRKA 4L3OA 1R3DA 2BFEA 2Q9UA 3KOWA 4MV0A 4B4UA 3V4PB 4IILA 5D5HA 2K6GA 4W7IA 2C9CA 1YZHA 1CZNA 1G4HA 2GPYA 1RCUA 2WUFA 3D02A 3HKBB 3KVYA 4B3XA 1PZEA 2FZ4A 2JNWA 1EB9A 2I87A 3OX3A 4LSMA 5A5VA 3GJTA 3D6VA 2ZW9A 4JYAB 4MRAA 5JSKA 3OE5A 1WX1A 2DH6A 5DFAA 5AUQA 3CPSA 5AW0A 1SVKA 4Q9NA 3KEGA 3P97A 3QFHA 3REQB 1JYEA 2JGNA 2AEFA 3HBMA 3EIHA 3PXUA 1HQKA 3F71A 4B9AA 1E3MA 4JUBA 3OQVA 4LC9A 4U02A 4M8IA 5LMCA 4YWHA 2PK3A 3SSNA 1HQCA 4HS9A 3TIXB 2D0DA 4LSZA 1NA5A 4EG4A 2GFIA 1M83A 4TSRA 5DCUA 1X8KA 1O6GA 3DDZX 1BJTA 4PSUA 4XIIA 3WP0A 2C9YA 1ZSYA 3WDMA 2QZ4A 2QI9C 1II0A 4KXXA 4KO4S 3C8ZA 1ZJ4A 1VRCA 3COVA 3WRVA 1U2TA 1YBFA 2R11A 3OCUA 5C7LO 2Z4SA 2FZEA 5LYYA 1NM5A 3T1QA 2NU8A 2A1IA 4BDTA 2Z8YA 3P4YA 2OYSA 1BMDA 3AUUA 4L9SA 4L4ZA 2B0JA 2IX9A 4NZ9A 3TMAA 4ER5A 2PL1A 3V55A 4F9FA 2IYQA 3TRFA 4D9HA 1JLSA 3MWLA 3ENQA 4EDFA 2F1HA 1A8PA 1H22A 3BQ9A 3NJ8A 4XGQA 4Z4IA 4WK0B 1GPJA 1R6UA 4I6GA 2GF9A 4PZDA 2WWVD 2XT9A 5BSEA 2CSUA 2FW0A 2IODA 4J4BA 4LYAA 3D6FA 9ABPA 2WZDA 1YTUA 5F78A 1EFRA 4PLTA 1MRNA 3LA8A 1LEHA 1QV7A 1SB8A 1NW7A 4XGIA 1P9RA 5FEMA 2I7CA 2H8KA 2QB5A 3LE8A 4FHFA 4KQXA 1Z45A 2M1ZA 3T7EA 1CC1S 4BMOB 5B3JC 1OD6A 2WUDA 1GLGA 2G72A 2PPVA 5B4TA 1P74A 5FKJA 4JHXA 2LV8A 4W1SA 2DSTA 1GTRA 5KJCA 2JFXA 5EJGA 1K92A 4EI2A 4EX6A 4P31A 4RD0A 2EBUA 1RMTA 4OXKA 2IIBA 4JUIA 4WHMA 1ZOSA 3KAPA 3C8HA 3GIDA 4GBED 4LFCB 3UJCA 4XJXA 2JGLA 3KAJA 3N76A 5KJ6A 4NCNA 2PZ8A 2EGUA 4H4DA 3V33A 1XAHA 1ZONA 1WTAA 3PDUA 3DR5A 4QAQA 4EQ6B 5JCOC 5BOSA 3F6CA 2E55A 2HCTA 2Q28A 3L7JA 1J0DA 1U8CB 5EEHA 3NG1A 4EHKA 5CVTA 1M76A 5LU9A 3BD7A 3MJFA 3DONA 2DYKA 5CH3A 1XRMA 4LQDA 2CSXA 3PS9A 4WAUA 3AXTA 2REBA 1Q6ZA 5DSTA 3R4CA 1BU5A 1ESEA 3JQPA 3SQOA 3AG5A 5BSTA 1PHPA 1UBUS 3OPQA 1A2BA 4UNQA 5EHNA 4OUDB 2VDMB 5JMTA 1QGDA 4NOMA 2NUPB 1VG9B 1TDJA 2HXGA 2AWOA 2IYVA 4RE6A 1KOGA 3RSOA 1UWVA 4Q4AA 2ZJ4A 3OTHA 4YYEA 2C3YA 1ZUNB 2NSHA 1JAYA 2QYHA 1JLLA 1H2AS 2HHJA 3C1TA 4LZZA 5IG2A 1M2JA 2WJ4A 4FE4A 3SYMA 1UC8A 3EQZA 3GPCA 2PVCA 5F1PA 4ESEA 4Z1MD 3L0IB 1YZLA 2BH9A 1PJSA 1BEUB 1YS7A 3PGXA 4PLHA 1DKOA 5DOVA 3TF5A 3E9CA 3AEKB 5IVDA 3U3KA 3FI0A 1E1CB 3KSAC 1X1AA 2PPLA 1K06A 5GTDA 2RGYA 4LZAA 1TAUA 1XRJA 2GYYA 3T35A 2Y1KA 1BG6A 4EHFA 1NQXA 3VR5H 1T2AA 4B6PA 1QGUA 2PX8A 3DOEA 3IQHX 4MP3A 3ZHQA 3GIWA 3CNBA 3K9GA 1RWXA 2VLBA 1GG9A 4IIJF 2FEMA 1U81A 4RV4A 4ZGWA 1F8YA 2P6MA 3KKMA 1DKRA 3UOWA 2XMPA 3ONWA 1I2CA 5KJ1A 4PLGA 1Y8RA 4EL5A 1ADJA 4O1MA 2Q3FA 4TTJA 4TV8B 4JDUA 1E3EA 4BN0A 4BNTA 4PY2A 1K6IA 2OPBA 3QELA 1XZHA 1Z37A 2XYHA 5K3FA 5J63A 4A23A 5AD1A 3L2OB 1DC8A 1H5NA 2B1JA 5D6NA 1R8JA 2HSWA 1C1YA 2FVYA 3Q7QA 5EOVA 4OHZA 3FZEA 2GESA 5I7EA 2QYOA 3NQ41 5EQJB 1JIXA 3QA3E 1B0PA 3IEIA 3ICPA 3KR2A 4FT4A 4DC1A 3S8EA 5HGXA 2NTVA 4KV9A 2B8EA 1SULA 3OQIB 5CXUA 3A58B 1G18A 4E2XA 1PSWA 2JFYA 3L8GA 4MR8A 1ABEA 1QHNA 3M9XA 2EZ9A 3JD3A 1N6KA 2EKBA 3L6EA 4CL0A 4UHEA 1CETA 4D9EA 3UA3A 2B7BA 5COQA 3DMNA 1H1DA 5L7TA 5J3JA 3HU1A 1Q0QA 3SQXA 1LRJA 5E3HA 3C43A 4JQYA 5T5QA 3OCVA 1GG8A 1AU9A 1TADA 2XE6A 4F60A 4AK9A 1UWLA 2NXEA 4B3CA 1X3SA 4KXUA 2CWDA 1J97A 1MO4A 2XA1A 3KQPA 3UKOA 3R7DA 3SBDA 1R0XA 1G60A 4F86A 1Z6XA 1MRSA 3LUDA 1YZUA 3FVRA 1EZZA 2ECOA 2PTGA 3CW8X 1T9HA 4FMPA 4ZPJA 3R76A 4PCVA 2B1IA 3E4DA 3O3NB 5LP6B 2AFIB 5CB4F 1TJNA 4LX0A 3M6WA 3G88A 1BDMA 4JP3A 4XM0A 2RKBA 4BOYA 5LJIA 4YTEA 5KOHB 1FNSA 4TWRA 2IDZA 2IXBA 3FPGA 3P71T 3BK1A 3C5CA 3X43A 1HM5A 5EP4A 3OUTA 7ABPA 4GLBA 5FR1A 2GZHA 1B15A 3VYVA 1RR6A 1VSTA 4TMTA 4TPKA 3WB1A 3ERCA 4AKIA 1QSGA 4JT9A 3IVMA 1FFBA 1M8PA 1ZEJA 1J1UA 2XCTB 2P8SA 3MIZA 1X7XB 3DWEX 4TSKA 4OI4A 5H3CA 2XUIA 3J80A 3IQIX 4AJ2A 3R2JA 1U80A 4Y2QA 2ZM5A 1JVSA 3B3FA 3NI2A 1JXMA 3V4RA 4KYTA 4IIEA 3SYRA 2GARA 1ZW1A 3AKEA 4RXTA 5D3ZA 1TVMA 1XB2A 1ES9A 1P61B 2X5OA 2GMWA 4EEXA 3H5AA 4GOLD 3EOBI 3WDKA 4TXLA 4ZI2A 2Y8EA 2XB4A 1YGYA 3D3EA 4YP9A 2GJSA 4ZVVA 1WW2A 4CNBA 1D07A 3QSGA 2CLHB 4BC1A 4BX0A 3AVTA 1XVAA 4QRDA 1SOAA 4MIKA 5KYXA 2VPZA 4MS4B 3IUBA 2R751 4MKHA 5AW2A 2A9JA 1J20A 3QXGA 1L5VA 1P1JA 4MUMA 1UBRS 3V8PA 1NWCA 3DE0X 1BGWA 3OC6A 3CN9A 1L3CA 3T5TA 4ARZA 2C8JA 2ODQA 4F5ZA 5BWBA 4CL3A 5EIFA 3LTEA 1ONSA 4ACAA 1CQJB 2F4NA 4PO1A 1TTPB 1NLFA 4G85A 2J33A 1ZCAA 4EVQA 1RQNA 3SIXA 1Y5RA 3UCXA 4D80A 1FJGB 4GRAA 1GGVA 1AC5A 1M1YA 1JNYA 3H8WA 4L1KA 2OEPA 3F3YA 3FOFC 3TZQA 3GLIE 2HLDD 5TV2A 1T2EA 1W34A 4YBRA 2RK4A 4MB0A 4QGBA 3RSQA 1JSRA 4EP1A 2GCEA 2Y0EA 2W2LA 5EIAA 5AVRA 1VLHA 2EJWA 4XD2A 1V71A 1UMBA 4HAOA 4P82A 1CUUA 3CVXA 1WNFA 3GDGA 4WESA 2CMDA 4QNNA 3D4BA 3GJ6A 3JVUA 1AKMA 4FFSA 4M89A 4H3KB 1C41A 1H94A 3WFIA 2X6QA 2B4RO 4HUJA 5F7ZA 5FWYB 4B6QA 4X90A 3LHIA 3P2YA 4F56A 1PZGA 1XP8A 4TZ0A 2IGBA 4XEHA 1YE8A 2R6R1 3NR2A 4E2WA 4PZCA 4RL4A 1E5XA 2ZJFA 1Y80A 4CKEB 2JFOA 5JAQA 2OZPA 1J24A 4RV5A 3VR4A 1D2HA 2OFWA 3B53X 1ZI9A 1BTOA 3CB2A 3DVRX 4FGLA 4UDNA 5E2IA 3TL2A 1DIHA 1PVOA 2F1KA 4JA2A 4ZICA 1M1ZA 5ALFA 2JJ1D 1F7UA 3ELDA 2Q5CA 1NW5A 3UJAA 4ZT4A 4TT8A 3T9AA 1Q7GA 4KDRA 3WHKA 3UBMA 1JEAA 1ENZA 4BP3A 1RFLA 3ZWKA 2WWIA 1AUQA 3C7DB 3S1AA 1KAOA 3EGOA 3EISA 1QM5A 1JL3A 1P0QA 2AG5A 4YREA 1G2OA 5BMVA 4RVUA 2XDQB 3FSGA 1XYYA 3LZDA 1XNRB 3LECA 3MTQA 1V48A 3G9UA 4H1UA 4J3FA 3X3HA 1Z8HA 3OD1A 4GWLA 1MR3F 2W8BB 3CH6A 3QOWA 2HA6A 3K2BA 4LMPA 4RY8A 4PZEA 5LMZA 4CEJA 2AC7A 4HAVA 1TCVA 2QKYA 2ZJ0A 4A0HA 2HA3A 2R5NA 2Z3WA 1QQ7A 1IDN1 3I6YA 4MCHA 4XQCA 1N25A 2IQ5A 1HKUA 5FPSA 1Q57A 3UT5A 3ZR4B 5B7GA 3WY9A 1ACMA 3KWFA 3PUKA 1L5GB 5JZSA 1RAGA 4CIVA 1HA3A 2FWIA 2BI7A 4WT7A 3C4JA 2VCYA 3BH6A 4KQ9A 4NRDA 2OKGA 3B52X 1YU6A 2QN1A 4IRMA 4O4HF 8GPBA 1ZOOA 1QQBA 2PGIA 3JWHA 2N3ZA 2E6KA 4X1IA 4RMGA 1T5TA 3KKPA 5L7YA 2IC5A 2GZ1A 1VRVA 4RK5A 4F96A 1DO0A 2D54A 2CNLA 2J08A 2Y1OA 1Y33E 4X1KA 3ZQ6A 1FTQA 2PHZA 1PK9A 3H05A 1HEIA 4ZWNA 4A2CA 1BXKA 3JZDA 1O95A 1E4OA 2JA2A 3EZNA 3PPIA 3K15A 3SX0A 2IUUA 2R68A 1V4BA 3GLFE 1V7ZA 1TM4E 3NORA 3B6ZA 5CU7A 4RZ3A 1YCDA 2ONJA 5FOWA 1N2HA 1C7JA 3FMFA 3DZDA 3EVBA 1XTUA 5TEWA 5BV1A 3G9ZA 1R4NB 2JLWA 1P2VA 1YKFA 2CFTA 2EFEB 2YCBA 4U63A 5AJYA 2XUGA 5FF9A 3WYCA 3L79A 4AF7A 5DOZA 3GXOA 3MBIA 3W4JA 1UDCA 5EWMA 3V7NA 2GJAA 1F8FA 4ZAWA 3VU1A 3K20A 1XLWA 3KQNA 3QXJA 2ZG6A 4UFPA 3OZGA 4TN1A 2X5KO 4GICA 3C3EA 1Z4NA 2P0YA 4S1OA 3E03A 1QB8A 2QMUA 2ZPTX 3AETA 1Q16A 1A1SA 2DQKA 3Q98A 1RAHA 5DP1A 5A7GA 3F8SA 4KDEA 1VP3A 4DW8A 4H4EA 1L2TA 3HFJA 3T1HB 2IF2A 3KQMA 1XD2A 1B7GO 2YHAA 1DQZA 4GRIA 4UMVA 3ZVLA 1DFHA 3A1NA 3HFRA 2G6TA 3OFND 4PCAA 1N8SA 3Q5EA 4UASA 3IAAA 1K8ZB 3HBFA 4YMWA 3ZWBA 1HT1E 1W48A 2AJBA 3JATB 2POQX 3KHUA 1C2YA 2H9AA 4YJFB 3KETA 2H1LA 1V96A 3BC1A 4RF5A 4ZODA 3WWYA 1JEDA 1II8A 1NN1A 3RTBA 1YR8A 3IEXA 3MRTA 4I1SA 4QGFA 2BMWA 2H4FA 3QBTA 4WNAB 3C6BA 4XZ3A 3RYCB 5E38A 4V0QA 4Q18A 1G17A 3RABA 3ISJA 1DZ3A 4B3RB 3OTWA 2QPOA 2ZR9A 3D5TA 2OC4A 4LGCA 1MGPA 4GM0A 3C7AA 2J5QA 4GBJA 3DVAA 1NYQA 3RIXA 2IYTA 5KZMB 1F0YA 1YOVB 2WYOA 1WP4A 4MCAA 5C52B 1S8OA 3O9VA 4D9NA 3ITEA 2O0MA 3QUCA 2PS3A 5ETJA 1UKAA 1NRXA 1P3DA 2V55B 4WNIA 2Y2UA 1T24A 5A3VA 5SY6A 1TM7E 3JARB 5D51S 1JDJA 4PHFA 3K2IA 4R7ZA 4IFIA 3QG5A 1IM8A 2X42A 3OPYI 4PBSA 3IOBA 4D0GA 4HHEA 1ZSNA 5IAKA 3O1JC 3M6XA 3RS4A 4BAGA 3OU6A 1J2JA 4Z99A 4YDQA 3ABIA 3F6PA 2IYFA 3FJYA 3HI6A 1N6IA 1SQFA 4D0SA 4AY6A 2Q1SA 1Z5VA 2JI7A 2VDLB 4JLUA 2NPOA 3D64A 1K7CA 2PX2A 2VPTA 3DBVO 3EFOA 3EUFA 4ONEA 4X97A 5G3ZA 2COKA 1VIVA 1DEHA 1PEYA 4ALJA 3H1GA 4H7EA 1QP0A 1WMEA 3H1PA 2XCIA 1Y34E 5J2TB 1PVVA 3GP8A 2B4AA 1ULAA 2CWWA 4FFOA 4KC0A 4U7PB 4I55A 1FRZA 1P1HA 2WU0A 4M4SA 3VV3A 1XLTC 3V4FA 3ZDAA 4HVLA 4QVIA 4O4LF 2G7ZA 4FOLA 1TJ5A 1A2KC 2J3MA 3HRHA 1JAIA 2VHTA 3F5QA 4IIJA 1QE3A 3GJRA 4MDHA 5JE8A 2FQYA 4WK2B 2PMEA 2D2FA 3F7NA 2JLSA 3FHJA 1KEEB 4FHZA 1OWPA 2CXQA 2VP9A 4MAFA 5H0IA 5REQA 4DLVA 1OLOA 4IGKA 1N32B 2V65A 4UPDA 3LFUA 2CUTA 1QOZA 3CX7A 4WD3A 5A4DA 8OHMA 2P78A 1H6BA 1EHIA 5J9FA 1BAPA 2RIPA 3H1AA 4IKPA 4JSYA 4NK5A 3ZLTA 3KJFA 1PWEA 3VH1A 1MJFA 2ZPAA 4CMKA 1LNSA 1JFVA 2JFHA 2FHPA 2VDRB 1TUIA 2X0NA 3GNLA 3G9XA 1CF2O 3EGXA 3IDQA 4UDYX 5AP9A 4AF6A 2XRZA 2FSGA 4EMSA 3I37X 1HG0A 2WWFA 4R9NA 2R8YA 1T2UA 3E9ZA 4FDUA 3AFMA 4M0PA 2O2DA 1KNQA 3CEHA 4S1WA 3VAYA 2QD4A 5BR7A 1OW3B 1F9EA 3CZAA 3GAZA 3WO0A 4BKPA 5A4JA 1ETHA 3H2JA 2YVUA 1GXSA 3UWSA 5E6SA 1R9NA 5JDCC 4TZTA 3TEMA 4MKXA 4P3OA 4M7OA 3QK7A 2OORA 3C3MA 4G1BA 4WN3A 1ML3A 3A6EA 4CQLA 2QTLA 2D7CA 5JTUA 4R1OA 1J2EA 3L93A 1JR2A 2RBGA 1E3JA 3H84A 2IZ6A 1Q2UA 3WYNA 4NL4H 1NXTA 2VDOB 2KLBA 4TM7A 3QXHA 1RVDA 1WAMA 3DZCA 1P73A 3VYTB 5TE9A 3R6GA 3T5CA 1NHGA 2AN3A 4TKMA 2XYRA 1CNEA 1OV4A 1NVDA 2FQQA 3OEEA 4LF8B 1PCXA 3QVTA 2W22A 3RYIA 4B3BA 4M1YA 4D9CA 4LSWA 3K96A 1E6EA 2YS7A 4G1CA 3QTTA 3I73A 4UW9A 1VQ1A 2VJDA 2OCLA 3W5IA 1IN5A 2JD0A 1XA3A 2ZDGA 2YQ4A 3RJTA 3AR9A 3RSCA 3PE4A 2B94A 3JY6A 1EVEA 2CHQA 2EQ5A 3ZBTA 1WLSA 1SJ9A 2I66A 2OL4A 3KZNA 3CTPA 4FX2A 1C0EA 4J0GA 1JR3E 1O94A 2HEGA 4MVJG 3SYKA 1YAJA 3OT1B 3L1VA 1QH9A 2B61A 4DFDA 3CVJA 1VXRA 4QOEA 4D6YA 2B69A 3TLCA 2QI9F 1V37A 3A3PA 4KXMA 1EWQA 2I65A 3N6RA 3LOPA 1V4NA 3O03A 4K9OA 3ZCUA 4KO8A 2Q7XA 4KGDA 2X0KA 1Y6QA 1NP3A 1WZEA 1XE3A 2JCXA 4BMDA 5JCZA 1AJEA 1A7UA 2J87A 4IQ4A 4WXMA 4H0CA 3GLGE 2P3OA 4B5LA 2XMSA 2Z83A 2V1UA 2YUTA 4DDUA 1OYWA 4P2BA 3WGQA 5D6OA 2PMCA 1MW9X 3FPHA 3IAUA 2G76A 2G63A 4IX9A 4QUEA 2YASA 3TNJA 5LOVF 1SBIA 1M5TA 2YH2A 4K9MA 3HJRA 1R6VA 3AYXB 1MW8X 1V7QA 4I1PA 1FVFA 5HKOA 3IMCA 1GADO 4BNDB 1AKVA 4EVRA 1KS2A 2C8VA 3PUVA 1U8ZA 2YHIB 4RHUA 4O5OA 3AHGA 4LYHA 3SS7X 2CMFA 1MJ5A 1XEWX 3DZJA 3TBFA 4CPDA 3CR8A 3FX2A 4ZT6A 2HPZA 2HK8A 1RPJA 4QJBA 3O1IC 2BGRA 4YFVA 2OXIA 2R25B 3DQPA 3DV9A 4UCQA 3L7CA 3MB5A 4WZBE 2IYSA 5F21A 5P21A 2GXAA 2FZKA 4OA5A 3IT3A 1OIVA 3L6OO 3BFKA 3OOYA 1DX9A 1F5NA 1T6NA 2REXB 1I7QB 4DV5B 1Q77A 1PYGA 3MCUA 2VTVA 3DLCA 4LCJA 3P9ZA 4OB7A 3BMOB 4WKNA 5EXPA 3RAFC 3BICA 1GZHB 3B3GA 2I76A 1TMYA 3KYIB 4LRWA 4DUYB 4A6DA 5HQ3A 2QP4A 3VJMA 2EJCA 5TIIA 5K1ZA 3QFCA 1YBMA 4B0OA 1HXHA 1FJ2A 1D7OA 2XUKA 5BNFA 5LBIA 2IWRA 5K0GA 1FJXA 2IBSA 2NV2B 3QELB 1SKQA 3G68A 4MCIA 4JI2B 3RVRA 2R7NA 3V8RA 1AE1A 3TSCA 3F0TA 1PFKA 1FQOA 2CFOA 4BO6A 4DY4A 3ECAA 1RYHA 4QPCA 3MMNA 5AICA 4HYEA 2Q5HA 5JZVA 3PLAE 1E9VA 4DM7A 1KXZA 1DKQA 2P2GA 3AV3A 1T36B 4UVGA 4WLFA 3L0PA 1KJQA 3AT1A 3A6JA 3IESA 4U2FA 5BVHB 4WE3A 1RXEA 3PNSA 2F4VB 3VZDA 3N0WA 1S7GA 3DDHA 4N4AA 3RBAA 4YRBA 1JEYA 1B0AA 1L4LA 4AJOA 4LGYA 3OHSX 3SZOA 1GN9A 4LRYA 2P9EA 4I3HA 5EWJA 3FPEA 1NQAO 1P60A 5HCIA 5HRUA 1NJ5A 1NVBA 4NEHB 5DTEA 5E3JA 2FKAA 3RTCA 4EIWA 1N57A 3E27A 4Q47A 4YRFA 2XRMA 4G5RA 1VPTA 3JTEA 4FGSA 4CMIB 3S5JA 5B3KA 3HXMA 1CYEA 1OY1A 1KPHA 3WISA 3DFUA 5LPNA 5HW0A 2CMGA 2O7VA 2WFLB 5TGDA 5BSMA 1H4QA 3EH1A 4LUCA 5I6DA 7YASA 3OX2A 1YL5A 1GD1O 1SBYA 2HSDA 2I2WA 3ESQA 2W9XA 1YCHA 4KPUB 4YRSA 4NLLA 4OXXA 5JALA 2Q3BA 4TRJA 4PG6A 1C9EA 2RAPA 4ILEA 2PEZA 5JEEA 1U65A 3A6PC 2ZYAA 1JX6A 2VZ0A 3W6UA 4WASA 5IAAA 4EKNB 1D2MA 3IR6A 3DHYA 4DN6A 1O0BA 2WMYA 2QMOA 5AVOA 1WUIS 4E1AA 1HF3A 1IHOA 3GROA 2SBTA 2FI1A 1E3QA 4MV1A 3P96A 2WVJA 3RVNA 4DCGA 5TMDA 4E2ZA 3EJ6A 3G6KA 4MV8A 2IYOA 1D0VA 3JU3A 4L4SA 4E46A 1CUGA 1E1MA 2YWDA 1QIEA 5JTTA 1Y1LA 2IGTA 1D8TA 1KFJB 1NUPA 2VWPA 4V0KA 5CRIA 4OI1A 2YOHA 1LX6A 1W5SA 1L5YA 1QYIA 2A5YB 3GCDA 3HACA 3I9OA 3LYAA 3MCTA 1FC0A 2KHZA 1RRGA 3DPSA 4GVLA 3T0GA 3U26A 1S8FA 2JIDA 2QMEA 4BHTA 2HIAA 3MVEA 5M04A 4CM9A 2O54A 1J2UA 1DPFA 3DMFA 1H42A 4Q9JA 4E5UA 4Z5XA 5H68A 1MDFA 3U9LA 4A0FA 5C34B 5E6RA 1EX1A 4HB2A 3G1WA 2Z6AA 4NMWA 1IPEA 1HI9A 1LDBA 2DQZA 2SKCA 3DBRB 5FFFA 3UAWA 3TZ6A 1KZ7B 2PUEA 1D2AA 3TZKA 3UYKA 2Q4OA 2Y4NA 2ZAYA 2ZAOA 3ZH9B 3VM6A 4B48A 2PGJA 2ZJ1A 1B76A 4DTCA 2ZIXA 1TZ2A 1KC3A 1DTSA 3S29A 1DDIA 1E6UA 3FRIA 1AKRA 3PA6A 3F5DA 4II3A 3ESZA 2AKYA 4BNKA 3H4VA 1X19A 3KZXA 4QQNA 2WZCA 5I5EA 1U90A 1J0AA 1V3TA 4JSRA 3KR9A 1DAEA 1IIBA 3BXFA 4H16A 2FEAA 3W7AA 4NCAA 4LC1A 1LH0A 3BX1A 1QDLB 3F90A 4F12A 1JDNA 3OZAA 3C3KA 4OQZA 4DQDA 4XASA 3RUPA 1R16A 2FPPB 2RK6A 2XCUA 1NVGA 2VYQA 4NSNA 5G40A 4NESA 5BQFA 2GNAA 1I3CA 2R1TA 1W2GA 1FL9A 2XQIA 3BIOA 3Q7SA 4I36A 4JJAA 4RTKA 4BO8A 3G82C 3TTUA 3TTSA 2OG2A 5TEVA 1S6YA 5LDHA 3RASA 3U3JA 2C2KA 2V7EA 1RSZA 4KN6A 1E2IA 5DK4A 5IAOA 3GNTA 1N6NA 2QGNA 4UAGA 4B3TB 4Q93A 1IZ7A 3NTUA 2JHFA 5BMOA 4URYR 1XVVA 4UZEA 5DJ5A 1YB7A 3GFSA 3JZFA 4NOKA 1DLIA 4R7TA 2JCVA 5SICE 2GWRA 4CDRA 2D62A 2JJMA 4LWQA 4B84A 1ZPDA 2NOAA 3DWGA 4TWAA 1FP4B 4PHTA 3GL9A 1NBIA 3W77A 3OZDA 4C2UA 1GV1A 1Z82A 5CURA 3GY0A 2QN6A 2X19A 3ON5A 3TWOA 5AHXA 2XQGA 3JWEA 2RGUA 2PYIA 4GEKA 5F2NA 1OBOA 2CVHA 3GYBA 3R6WA 3V2HA 4OHFA 1FRNA 1YAHA 5EHQA 2WAOA 4XWOA 4C7OB 3E0XA 1PJ4A 4GNKA 1YZFA 4Y9UA 3H19A 1BN7A 4IDQA 5I9TA 3SHOA 1ZN8A 1EK5A 3H4MA 3HLTA 3L8ZA 4YT2A 2C54A 2W4MA 1Y6GA 4CMIA 2GKOA 4JLVA 4RIGA 4UDXX 5BN3B 4EF4A 5BV7A 1N5KA 1RKBA 2BELA 1V39A 4LI0A 2QY9A 2PKXA 3OY7A 5JHGB 2Z6UA 1D2RA 1HLDA 4RKFA 1IQUA 1HK7A 1ZGGA 4DMLA 5JLAA 5JASA 2VSOA 1DQPA 2NN3C 2IVZA 3CZ9A 4PC6A 4N0MA 2DHCA 2Z09A 4GZMA 1BH6A 1E3TA 2ZUVA 3R7NA 2IKSA 2QVLA 2B6NA 4ZI5A 1R6XA 5F2EA 1TQ2A 4M9RA 5A3QA 1DC7A 1QRRA 3DJYA 1H2HA 4X20B 1RQPA 1O7JA 5LXTA 4Z9YA 1RI3A 1F51E 3RSHA 1NN5A 3OTIA 4B43A 3OQMA 3HZRA 2WJVA 1NR1A 3VR4H 1F8UA 3PHCA 1DC5A 4D82A 2ZS9A 2IOYA 3QF7A 1IE3A 1NMYA 4FBMA 2GD1O 4IGIA 1VSUA 5D87A 2J9XB 3ROMA 2DB3A 3PUWA 2HQOA 1FFDA 2A5FA 3A8TA 4QDTA 1BE0A 2JAQA 1EDBA 3ND8A 4Q37A 4EA7A 1FFGA 4LXQA 3BL6A 2BRUC 2ZYRA 4B4VA 2XDAA 3PP8A 2ZR7A 3WJ2A 2V9CA 5KPJA 4I4CA 2F8LA 3OIVA 4M1ZA 3HNRA 3I45A 5E1OA 5B1IA 3V7UA 4B87A 3GARA 3W5DA 2AJTA 4P36A 5DCLA 3MTIA 1LDNA 1WY5A 3Q9SA 4F0JA 5JCPA 1WXHA 5C3UA 5KTOA 4QGAA 2Z9BA 4ZCSA 1EM6A 5KQPA 3RE1A 3CEAA 3CVOA 3UGTA 2WKRA 3IMEA 4MUBA 1KFBB 1R5JA 1GITA 1YA8A 4M7RA 2BR4A 4GMKA 4Q05A 2IK8A 1ZNYA 3QQ5A 2R48A 1G8AA 2ID9A 5B53A 4K86A 3GLRA 1SCQA 3M2PA 1KEKA 3AF6A 4RGQA 5DX8A 4JCOA 4NXMB 1GO2A 1NLMA 1TA0A 2VF7A 3K3PA 1ZCBA 1Z0JA 3LRPA 2HNBA 1EGVB 2XPCA 5DYNA 5HXAA 3H75A 2IYWA 2IP4A 3UUWA 3BJIC 4Z4CA 2SHKA 1E8NA 1NXPA 3ELBA 2DXIA 4M1TA 2GPSA 4L22A 1UANA 5DRTA 2PM8A 2ZQZA 2DWPA 5AOVA 3T1VA 1GEEA 1RP7A 2C2ZA 3HEAA 3HB9A 2C4WA 4NIMA 2EC5A 3WVNA 4E4RA 4BFTA 4GX0A 5DNUA 3CXUA 1D6MA 4OBEA 2R8PA 1J8DA 3FMOB 3GG2A 2A35A 1N92A 4YR7A 2OGTA 2ANBA 1NOKA 2KQUA 2QRGA 2VP3A 2JPDA 3IUEA 2B1GA 1DAKA 2CHFA 2UZAA 3IT0A 3EFOB 3LV8A 3VR6D 3U31A 1CQJA 3R77A 4LDJA 3SS8A 1N7HA 1C7FA 1YB5A 1COZA 1W4ZA 1EI9A 4W4TA 4TLDA 1BU8A 1E7MA 4CIXA 1VGRA 2PIAA 1O3YA 2WWHA 4HQ0A 1WQ1R 4L50A 3QPWA 4MDEA 1P5FA 4C3UA 3ISVA 4IWYA 4O2BB 1A69A 2DPMA 4PPFA 4RH1A 4TTRA 4KFRA 2XUZA 2HWUA 5IT4A 2IYLD 3MINB 5T4FA 3K31A 3IUNA 2Q9CA 5LQJA 4DWVA 3GRZA 1AKEA 4ZA2A 1YHZA 2DBRA 3MSXA 2R60A 4PZLA 2W90A 1CKEA 4D4IA 2ID7A 2JAHA 5T3YA 3TL6A 3ZDQA 1GGFA 1P44A 1RPNA 3WICA 1P9LA 2NAPA 3BZWA 5HEKA 4JJZA 5HRCA 4OP2A 5E1DA 1KZGB 4B9EA 4CFYA 2AN9A 1GQYA 2JFNA 4N3AA 2MWMA 1SBHA 3C15C 3O4VA 3GUYA 4CGZA 4NCKA 2VBIA 4NYJR 2ZJ6A 5A3SA 5ALRA 4MV9A 3SOZA 1VBFA 2RONA 2JKVA 3MF4A 4FC7A 1EDOA 2X4GA 4YXWA 3NDRA 1TD1A 1J4AA 1KSJA 2IUFA 1DXYA 4EG7A 3C45A 5H1YA 2H57A 1RWBA 1BMTA 3WLLA 1N6RA 3P19A 4IDDA 2N75A 3DYBA 1IJKA 1NIJA 1CVLA 1NUQA 2WSSA 4X6YA 5AKJA 8AT1A 2BVNA 3B8EA 1USGA 3BILA 3AVYA 3KAQA 3WRXA 1QUEA 3W2IA 4BTVA 3GCZA 2OZEA 3GW8A 4BFSA 4M6WA 3RGGA 4B3JA 4FHDA 3IIMA 5ALUA 3PCXA 1GKLA 4FJ2A 4L3WA 4NNOA 2FPWA 4EW6A 4JI0B 3I58A 3EZ6A 5IM4A 1COWD 4RIFA 5DE3A 3HR7A 4KKVA 4XAQA 4BVGA 1OZAA 3FG9A 3VH4A 4BFCA 3QOXA 1W1UA 2E7ZA 3OMXA 4OHMA 1A9TA 3MD9A 3WBBA 4NJOA 3DLHA 3H1EA 3DMHA 1U7WA 2FF7A 3VO1A 5L3RA 3R7FA 3AP3A 3B70A 4ZYYA 1TNDA 2QP3A 3HPQA 5TVGA 2G67A 3U5ZB 4LF7B 5J4HA 3NALA 2IZZA 2XMBA 1Z5WA 2Y9MB 3OESA 1SXPA 2O57A 4W5HA 2WB2A 3CT6A 5GZ6A 4FXPA 5CFZA 4I5EA 1E0JA 2HR1A 4AP6A 3VGJA 3E2IA 1T3SA 1E59A 2VSYA 1A5SB 1TMGE 4ZDWA 4C4PA 1OFGA 1R66A 2XMZA 4KH1A 4LQ4A 4B47A 3ZY3A 4ZYTA 4JENA 1PV4A 2PUBA 1CUFA 1IONA 3V8MA 4DCUA 2NMVA 3ZNOA 3BWDD 3K0FA 2Z1MA 1DXQA 3ND7A 3N2LA 4I9HA 4RZQA 2JFBA 1Y1QA 3M9LA 3E8MA 3QBJA 4JITA 1DG9A 1ZOIA 3DC7A 2PQMA 4FI3C 4MKFA 4Z7JA 3KXKA 5CVJA 1QE0A 5LZ5A 4ZZ3A 1PJ3A 2VT6A 2YXLA 5MDHA 1U5BA 3SHQA 2XT6A 1ARZA 2PMFA 3CCFA 4PBRA 2PD6A 4G56A 3D2AA 2PZLA 2O2HA 3L7MA 4CKXA 1N9GA 4WCFC 2ARKA 1XWWA 2N46A 2W0MA 1QO7A 2P5UA 2VEOA 2ZIFA 3AY7A 4KOAA 1CERA 5PNTA 2BAGA 5JS8A 5H80A 1UCFA 2JHCA 4PAQA 4DQLA 2VHZA 5IT5A 2F62A 1ZIYA 2RCYA 1XJQA 2YWBA 3IQXA 1JSLA 2EATA 3R3UA 1D1TA 4IDNA 3WXBA 3OCXA 2ZI5A 3H8JA 4PNZA 3OZTA 3TEFA 5FUQA 2WC1A 3EZLA 3ZD8A 1E4YA 5DV9A 4FN5A 2IW3A 2RHGB 2I2XB 1O96A 4F45A 2F8TA 4M1EA 2IBMA 1E3SA 3BFPA 3CLKA 3M82A 1P4AA 2VF8A 2OFOA 3BS4A 2ZM6B 1XD9A 1SPBS 4GU5A 4JYMA 3ZK9A 2FSVA 2XMRA 3J81k 2JAOA 1Z7GA 3LC2O 2V4ZA 4HNQA 1AKWA 3VUEA 3OEYA 4CG2A 3OKFA 5BN3A 4EPRA 3PQDA 4P54A 4M9QA 1GR0A 2EF1A 4HZGA 1U2SA 3O9ZA 3DG9A 4EG3A 1SHZA 3RNOA 4A2PA 2F67A 2VTEA 1J1ZA 3G7SA 1RAIA 2P9JA 4QNMA 4JGGA 3T3EA 3ZQJA 1Y1RA 2QE7A 5B3JA 4QUIA 4DMHA 1ZP6A 1E4EB 4UULA 2VBCA 3PC2A 5A5FA 1P81A 3QXSA 3OX4A 3V32A 4KITB 5EMLA 4G9GA 4GKVA 5FFMA 1ABBA 2G0TA 1BCRB 1UDXA 1PGPA 1QHHB 4LQCA 4P3XA 2PKEA 3ME5A 3MJRA 5ALKA 2CD9A 4TVKA 4XB1A 4I4TB 4EY8A 4JXKA 3NGXA 4HGQA 4UTOA 2QUZA 3T3HA 3Q1LA 3OCCA 4K9DA 4YMSA 4BE4A 1P7PA 3P20A 5JD4A 3PFIA 4D4HA 1GCAA 3V4VB 2GCPA 1KF0A 1QF9A 4JC8A 1WCWA 1S89A 2HJGA 1N2IA 3QWIA 1TYAE 4W99A 1W5EA 3W6OA 3NETA 1TK3A 3U60B 2AFHA 5K99A 5KVVA 1G41A 2EDCA 2QAJA 2Q5IA 4U7GA 5CLGA 3ZE8A 5KEIA 3A2LA 3ZJTA 4L4RA 1Y7IA 1C30B 3OCZA 1VHQA 1GGHA 3NBMA 1H05A 3QKSA 1ZVKA 3TAXA 4GDMA 2DFVA 3CLUC 1BRTA 2VRBA 1ODTC 3CS3A 1OROA 1MKYA 1N8NA 3W2HA 5B2EA 2ZRKA 2FWAA 4P2GA 2GRUA 2V45A 1VE1A 2Q5JA 1H4SA 3GV0A 2I91A 5KOJA 2VZ9A 1DIBA 3M70A 1A98A 3O2JA 1A0OA 4JT4A 5FWAA 3WLJA 2QU7A 1R5BA 4B3HA 2O8BA 4MIYA 4UUBA 3RVSA 1NWHA 3TLKA 1NI3A 1T1GA 1UDWA 2C4HA 2FW8A 1TPYA 1G21A 2Q5QA 3BDVA 2ZYUX 4H7PA 1T9GR 1Z56C 1PGNA 1AK9A 4OHUA 2QLBA 4CTJA 5LYJA 4FMBB 4KVAA 4AULA 3G89A 4WV3A 4RM2A 4LJ5A 5FI1B 4PZAA 4BX8A 1LXCA 5C8YF 4FFNA 4KXNA 5AVVA 4GOOD 3S81A 4YUXA 3O91A 3CE9A 4FMDF 4INZA 4LBWA 1U3UA 1YC5A 2JB9A 2BFCB 5C1PA 4IUBS 3IBFA 3EZ9A 3W2FA 2XD4A 4NCXA 3QMVA 4HK4A 2BR5A 5JFGA 2HSJA 3AM4A 3TQTA 1UJ5A 1WMDA 3I42A 1MB3A 3MTBA 4R69A 3UPUA 4BEWA 5LL6P 2D0IA 1E1KA 1S3SA 4MR7B 3LU1A 3GGCA 4MVJP 2IHVA 3IPAA 4XYLA 1IH8A 3UCFA 1L4GA 2CHUA 3K8QA 3IODA 4KE8A 4BN4A 1Y3HA 1RQ2A 3VNQA 3I8OA 4UE2A 1WV1A 3KHKA 4IVNA 3CB4A 2YX1A 2ONYA 1W0JD 3HJBA 3N2KB 4G0QA 3JYPA 4QUKA 3DVAB 3SZRA 3BZBA 3R3JA 1OYVA 3IALA 2FX5A 3PGJA 3IBSA 4JZYA 4NOLA 5IM5A 3IJPA 1H2XA 3IR7A 4RKYA 5K0LA 4LF4B 1X9IA 2Z2YA 3AHHA 2CEKA 4XQGA 5DASA 4MWCA 5FDFA 4MZXA 4FB5A 3QP9A 3R8FA 4K28A 1RHKA 2OQVA 1O6FA 1S8AA 2H5LA 2NVBA 1GAJA 3NKLA 3CU5A 4JEHA 4L6CA 4LDPA 3UNXA 3WBJA 4CF5A 4EFKA 4MS4A 4DNFA 5LP1A 2NSDA 4F2HA 4KZKA 3R41A 1QHYA 1ISHA 1GLNA 3VPGA 1WPGA 1FMJA 4MEAA 5LLTA 2CXSA 4EY3A 1UT8A 4Y9RA 721PA 2OESA 3GMTA 4BBPA 1E9AA 2WP0A 3LQFA 3L7BA 4EI7A 3JQDA 2ZBUA 1XRRA 4P4SB 3VH3A 2A33A 4AWXA 5EQFA 1XMJA 1UDBA 1VYUA 2GN4A 1H0SA 4RPLA 1W5BA 2EKZA 3IUSA 3PD0A 1SUPA 2ZVPX 3SR0A 5BN4B 1KR2A 4I55B 1EXNA 1X1BA 2I6GA 4G1EB 4Q1AA 3T5MA 4EF6A 4PN3A 5JAOA 3UXHA 4WKBA 2IEIA 4CM9D 5LR6A 5H70A 2J0UA 1E2GA 2M32A 5A2GA 5BXYA 3PDIA 1GL7A 1SC3A 2F48A 3NIWA 3TOZA 5AW4A 2X0IA 1SG6A 4HN4B 3MD0A 4DA7A 1P72A 2M9MA 4RFVA 2GNOA 3U7GA 5ARCA 1HE1C 1JP7A 3HJAA 3DNMA 2ZSIA 3JQRA 4JELA 3TW4A 4RHTA 3IIJA 1WP9A 2QVCA 3IUPA 2A4MA 1RPTA 3UGJA 4NFHA 2H1OA 2VJPA 2FSUA 2PR2A 2AI3A 4QATA 2W83A 5HQ3B 1Q1AA 1U7ZA 4KWIA 1V1MA 2BOVA 4I5DA 4M55A 1L4YA 1PEKE 3F3SA 3ZV6A 3G9TA 4AYWA 3X44A 3T3MB 2RE8A 4DYDA 3A4LA 1JDBC 4GS5A 1FEZA 3NYRA 3EAGA 4N6NA 1JQBA 1QHIA 5I7RA 1QLHA 3PRHA 2NW6A 2ZI7A 2GZ3A 4LVUA 3TCNA 5I4CA 1H65A 1VA5A 3H1BA 5BUSA 5F5NA 3VI3B 1W2HA 1ZJ6A 1Q1NA 5DM1A 2PUFA 1XX6A 1I6MA 3DEHA 2YJ6A 3NUQA 4NS1A 2UZIR 3V2GA 4OFWA 5F3RA 3UK0A 5AQ1A 2Q27A 4BLVA 4F4UA 3H4TA 1CR6A 3IAEA 1GGMA 1Z33A 2CL7X 1RWWA 5AM5A 5SZIA 3FPJA 1OX6A 3KM0A 1B1CA 5GZ3A 1E9DA 3D8RA 3L92A 2QM7A 2SCUB 1K75A 3JVVA 5CM9C 5DZSA 4DIDA 4EUNA 2ZBQA 5LDDC 1HNXB 1GRRA 5GV7A 1HT3A 3WQQA 1PT6A 4PN7A 4Z0HO 3V1MA 3T3OA 5DBOA 1L6RA 4IDOA 2WR8A 1K9VF 3QENA 3ZS9A 3TOVA 1NJSA 4O4IF 4BNGA 2CV0A 4W9NC 1VIMA 3CF4A 2ZB3A 1PQWA 2XNHA 3GA0A 4WX2B 5CYOA 3TLEA 2Y71A 5JCXA 2FPIB 2UUBB 2X9QA 2DWUA 3G2PA 4RJJA 3PL5A 1MT3A 3PICA 4B3MB 4KIJA 4KIGA 1V2HE 4EH1A 5FWXB 4YJ2A 5AXDA 1AF4A 2J32A 2OR3A 1WBDA 1D9ZA 2J6HA 1EHCA 1KOLA 1BS1A 3PNYA 3TLXA 1AN0A 2AR9A 1CDZA 3L0ZA 4JUDX 3U1TA 2HRDA 2WA1A 4YMHA 2QROA 5DTMA 2GBIA 4X63A 1KYTA 5LA6A 3PFCA 3OM0A 3OBBA 4OBWA 1ADCA 3ETLA 4X3PA 2Y66A 3DOHA 3ZZMA 2O20A 3AVXA 2AHRA 2ZU6A 1FPMA 1SCIA 1T5HX 3AFIA 1PTJC 2X0JA 3FJ1A 3F5FA 3QJ5A 3SP1A 1M8GA 3QBEA 3HRIA 3UAZA 5JH7A 3DXYA 4GMXA 2G1KA 1KH1A 1PIWA 1VC2A 2IHYA 3CQ9A 3OFKA 3KYJB 4PU0A 1M1YE 1KERA 1TJ4A 2MYNA 4N3BA 5A03A 3ORFA 3N0VA 3SC3A 4RACA 4YQEA 4ARVA 3FYCA 3FNIA 4CGYA 3UH0A 1XCLA 3PF9A 4JDPA 1KI6A 1JFSA 5AKLA 1U8YA 2WM3A 3HCFA 3WIEA 4DCVA 1MENA 1B0ZA 1AHNA 2P4HX 3ICVA 4TKVB 5CITA 3SYTA 3R5TA 4EHNA 1ORTA 1WU8A 1M75A 2WVAA 3RODA 3LQRA 3G2QA 4FIDA 3CYFA 5HIAA 4GX1A 3R4VA 1YDMA 2AQ8A 4NZOA 4ZT7A 4FI3F 4PG7A 4ZV4A 5TGTA 4D6XA 4NECA 1BHSA 2JFVA 2ZYGA 1KEWA 5HVNA 1C7RA 3UBTA 4FBGA 5KSPA 4TYYA 2EIHA 2QE7D 3E2PA 3EVDA 4J7UA 1J1IA 1CFZA 1GPWB 1KK0A 1JWBB 1KJJA 4FJ1A 3VAZA 4B3GA 4DR1B 3Q5GA 3UFBA 3PB3A 2W8BA 3E9DA 1T5LA 2V8BA 3V4ZA 1UM8A 1V47A 4ARCA 1AUVA 1XKTA 2V7UA 4YEDA 4BV3A 4YCSA 5JPCA 1UQTA 1W30A 2ONKA 4AJEA 1F0KA 4G25A 4INAA 3WGZA 1E8DA 1CSEE 1BOFA 3L4BA 2AZDA 2X6RA 4HGYA 1BW9A 4KQGA 1J06A 3N2NA 5AKKA 5DGCA 3RJ9A 2FR0A 3PJRA 2YZMA 1A9YA 1VG1A 2ZYVX 2AUNA 1W35A 4RTLA 3L8MA 4LG1A 2B99A 4D4JA 3WWPA 1WD5A 5FBZA 3RRXA 4DRZA 3A6ZA 4LJSA 2FPPA 2JVJA 4QPNA 5AO9A 3PXDA 4NJEB 5CW1A 3F1KA 1TLLA 2HCRA 3THOA 3ADCA 4B81A 4A0RA 2CDRA 4EKIA 1M6VB 1ZD9A 4FGKA 2GZRA 2J6BA 1QK4A 4X8MA 1R0KA 2R84A 4G1MB 1B6GA 4N0EA 1E60A 5K0CA 1YK1A 1TFUA 5LZ9A 5AVWA 3LH5A 4PGGA 3I9MA 1XQXA 1T8UA 4HEHA 3LX5A 4TSFA 5B1EA 2YFQA 1L5ZA 4ZD6A 4L4YA 4GLJA 1XPUA 3ROEA 1TU3A 2DERA 3KSRA 4C3OB 2KB0A 3LQ1A 2OXEA 3MOIA 2CEAA 2FUKA 1TU0A 1A4XA 5HYVA 4E21A 1XALA 3KJIA 2GEFA 1VB3A 3OZSA 4PV7A 3VOTA 4DEXA 4K3UA 1J7KA 3HSSA 5HS4A 4NR0A 5JSFA 3LJKA 3GZ4A 2BEUB 2DC1A 1K7SN 3TBKA 3WL4A 4E31A 5MHTA 4KXVA 3UH1A 2AKEA 3OEHD 3SC2B 4LFBB 1UKZA 1Y5LA 4DDVA 3S68A 5AVXA 3FNBA 2OBXA 2Z43A 2GB4A 2E1PA 1RQXA 3AF1A 1H2FA 1T29A 4TWIA 4AZTA 2Y0PA 2AT1A 5ICSA 5AJUA 2WD7A 4GI7A 3AR7A 5JFTA 1V43A 4P7FA 4F2GA 1WSBA 1WZ2A 2CV1A 4ZYVA 2NO7A 3BSFA 3B6KA 4ZK6A 2AEEA 4RM3A 4D57A 5H59A 1D2EA 2WFZA 2OBBA 4KU4A 5DEIA 2CHVA 1G8JA 1J2YA 1PR2A 3GLQA 1T2FA 1P6XA 2PBFA 4WNAA 2OP0A 5TMPA 4CJXA 4BECA 1KBOA 2XEXA 3Q10A 4AUMA 2YY6A 2GERA 3SIRA 4DMFA 4B32A 3F46A 3KTAB 2PL9A 2C84A 3D7KA 1F6WA 3K0EA 5B58T 3O7MA 3IP7A 4JZKA 2A9OA 2I6QA 2C7OA 2RMKA 4XD7D 1XZBA 5B4VA 4R3NA 4EHAA 3LOUA 2XUQA 3KB6A 1K3TA 3OX1A 1WCYA 2CBXA 3KVOA 5GJCA 5TQ2A 3ANLA 3I32A 2A67A 2MSKA 1USVA 2ZTVA 1WXIA 4KE9A 2CL5A 4P4SA 2BW0A 5B3AA 4I2NA 5HG0A 2I29A 4RZXA 2A0YA 1SBTA 3FGNA 2BFNA 1DIAA 4E5VA 1UJNA 4B46A 3ZW7A 5CXQA 4BGDA 1NMSA 3NBQA 3FSRA 4CCYB 4I55F 2D4AA 2PZJA 1ESNA 4J6FA 4AT1A 5HP4A 4B6GA 3PA8A 3PQ7A 1DCKA 1TECE 3ICWA 2Q07A 4JOBA 1TQHA 2J0UB 3WKAA 4RHXA 2CVZA 3LKDA 1TIPA 1VCNA 2QYSA 3IUYA 2MT9A 2EKDA 2GYUA 4U9IS 3A37A 4CVNA 2GUGA 3MGAA 4H3VA 3EC2A 3OOSA 4C21A 1O1YA 2CKMA 4R9VA 1YS6A 3EBLA 3NHBA 4YY3B 2W37A 3EPRA 5GJWC 3LY5A 2QXTA 1ZD1A 4N7MA 3WAKA 3S44A 1HUQA 1WUKS 4JJ8A 4MWGA 3ZIUA 4LBYA 3X1WA 3NHYA 4BGEA 3ETNA 2Y0DA 3S99A 1X0VA 4PXAA 3ENKA 2OYRA 5EMJA 5KYWA 3IHLA 3F6BX 4NS4A 4QELA 2BFAA 1GSIA 4U7DA 4L5YA 1OQAA 5A9RA 1XNGA 4HVTA 2Z5GA 1XJWA 3KEFA 3M49A 4AD8A 3GRYA 4DGQA 4V1CI 1EYZA 1G20E 4M54A 2GCIA 1P39A 4DLAA 2G70A 3N0XA 1UBLS 3O4HA 3HH8A 4M36A 1C50A 2F3UA 1J56A 4FOTA 5F7XA 3OZ7A 5EPEA 4O4LA 4WQMA 3MGBA 1OV6A 2VCHA 1XLVA 3VKGA 3MT0A 1F60A 3UT6A 5BV2P 1FP4A 1NUAA 4GP7A 1V6SA 1WVIA 2ODWA 3VR3A 2I80A 2WSMA 4D0LB 1SC6A 1BS2A 1CUEA 3C4QA 4MLPA 3TVTA 3Q3HA 2ZJ5A 3LIPA 5EXSA 3HO6A 1LFAA 5J5CA 4LRUA 4BGUA 3MNFA 3T1NA 1WDTA 2FCRA 4TLAA 1UXJA 1EKXA 3CIOA 4GYKA 2V9ZA 4IDFA 1ESCA 5FOVA 1P9NA 4J7CA 3KEMA 4TQAA 1R0LA 5G0UA 2BRUA 3C70A 1DC6A 1VLJA 3QWFA 2AFHB 2AI1A 1V35A 2GEVA 2NZ8A 1A9ZA 3QKSB 5EJ7A 1F4LA 5LMUB 3EA4A 4O25A 1YDGA 1AZLA 1SEVA 3AJ8A 2C5BA 3BXXA 2PXXA 2RGEA 2RKOA 3A31A 4OKIA 3IOEA 4K05A 2K7ZA 2H52A 1BX1A 1K4KA 3IMKA 4GOMD 2HMUA 3ASUA 3KKZA 6ADHA 1JE0A 3PFGA 1SRRA 3ND5A 4CIDA 2Q0SA 1RABA 4ENSA 5CFPA 3FKSD 1US8A 4DZRA 4OQNA 1QTNA 4KKXB 2BM9A 5J4YA 1EVYA 4KUEA 3AUFA 4GP9A 5TMBA 1K4YA 1KU0A 3WNBA 2PQ2A 5A6SA 3E7XA 4IWNA 4P22A 4JYBA 2RSLA 3EVZA