3RLIA

Crystal structure of monoacylglycerol lipase from bacillus sp. h257 in complex with pmsf
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
243
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGLPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
publication title The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 98
structure length 243
sequence length 249
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rliA00
3W9BA 1TCCA 1ORVA 3QBJA 4N8EA 2PPLA 3ZLTA 3NOXA 5CT6A 1MNQA 3H2HA 4ROTA 2RHWA 4Y2VA 1EK2A 2RONA 1UK8A 5AKHA 3V48A 4F21A 1ODTC 3LLCA 2XMQA 2VJDA 2QJRA 4GHWA 1H2XA 2HRQA 3DEAA 4U2EA 3W06A 5ALHA 1AMNA 2PSFA 2QMQA 3KWFA 1GPNA 1MO2A 4J3JA 1HDEA 1Q0ZA 4KAFA 5ALGA 5HQ3A 3ED1A 4CCWA 2PSJA 3I2GA 4FNGA 4WFKA 1XRMA 2AJDA 2I78A 3IUQA 4HXFB 2QOEA 4FOLA 4TGLA 3DNMA 5HZGA 4UFNA 1C7IA 4L9AA 1UOOA 3H2JA 5DNVA 4BP8A 1QOZA 4DGQA 2Y2VA 2FX5A 4Y7DA 4AXBA 1AX9A 4AZ0A 1JMKC 3DJYA 3N0TA 1N5MA 5ALFA 3UUEA 2I03A 4ZXFA 2OGSA 4Q34A 3SC2A 4QLOA 4WY5A 1CUSA 4GWLA 5C8VA 3C8HA 4N8DA 2VEOA 4LXGA 4BDTA 4EZIA 3C6XA 3FWHA 5ALZA 1XRLA 4OB6A 2XUPA 2J3DA 4IH9A 2WFLB 4H7HA 4IO0A 5HF9A 2HA5A 5AKKA 3NUZA 4UHFA 2CB9A 2YXPX 1QIIA 2PVSA 1UFOA 3VISA 4ZV7A 5J3JA 3KXPA 5AI9A 1M33A 3G9TA 4WY8A 2VQ6A 4Y2RA 5T4FA 3A6ZA 3QM1A 4H7JA 3H0CA 4A23A 1SCIA 5FPQA 2ROQA 3I1IA 4DM7A 1HL7A 5FUMA 2ZJ6A 1XZLA 2HA0A 1ZOIA 4OU5A 2WKWA 1H2WA 3C5WP 1TKRA 4F60A 1J06A 1F6WA 3R3VA 3HEAA 4C6HA 2BKLA 1UKBA 3ESCA 1G4HA 1TIBA 4Y2SA 5FRDA 2ACKA 2X8BA 1IZ8A 5D6OA 4BCDA 5BV7A 5ALWA 2OLEA 5BWBA 2WJ6A 2VT7A 3K2IA 3H2GA 4U2DA 5HKAA 2IITA 3DLTA 3HJUA 1Y7HA 5CURA 1MU0A 1BN7A 2WJ3A 4CCYA 2JGEA 5CW2A 1E8MA 2PU5A 2XMCA 1P0QA 5DTJA 2ZJFA 4J0KA 4X6YA 1BN6A 4Q3KA 2RIPA 4LIPD 5ALUA 2OGTA 3W2TA 3SK0A 3KD2A 3F9CA 1EINA 1EHYA 4GXNA 1J07A 5A7FA 5E4YA 2EDCA 3LS2A 2G4LA 4FNMA 4S0XA 4AQDA 4KRXA 1QO7A 3IULA 1VJ5A 1DT5A 1WOMA 5C7YA 3A2LA 3BE8A 3BIWA 2QM0A 2HA7A 3ESDA 2O2GA 1O6FA 5HK8A 1HLGA 4Z49A 4FMPA 1XZFA 4AN1A 4YX9A 1CR6A 4K6HA 2JGMA 2PU7A 1VA5A 3Q8WA 2X76A 4Y2YA 1EVEA 2PX6A 1IVYA 1GXSA 1RYYA 2I3ZA 4MWTA 4ZI5A 1ZJ4A 4B83A 5CBKA 1GZ7A 3H19A 2VAVA 4XIIA 1QIDA 4F0JA 4CIBA 4YK7A 4MWSA 4WDQA 4ZWNA 3LCRA 3I6YA 1OILA 4KAJA 5IKXA 3I2FA 2QRUA 5YASA 1CUJA 1Y7IA 5EGNA 1G66A 5AI5A 4G5XA 5K3AA 1LGYA 3I28A 4DNPA 2XI4A 4WDRA 3G0CA 4W1PA 4Y2TA 4ARAA 3O95A 2YH2A 1CUCA 3ILSA 5JZ9A 3MGAA 4G4JA 4XX1A 2OPHA 4I19A 1KU6A 5FLKA 4LXHA 3F97A 4FLEA 1YAJA 2RAUA 4AO8A 2AJLI 1MPXA 2CJPA 1C4XA 2WQZA 2GBGA 3PI6A 1DWOA 5DJ5A 1QZ3A 1EDBA 3D0KA 5DYYA 5AICA 5LKRA 1XZKA 5ALXA 1QONA 2DQYA 2H1IA 1W52X 4AB1A 4GI1A 3AZOA 4BVLA 2XLCA 3EF3A 4KR0A 2ZYIA 5AM5A 4EY4A 2XB6A 2WUGA 5HQ3B 1AQLA 4FFWA 2DCMA 1H23A 1UK7A 2XQJA 3AIOA 2QZPA 3HSSA 5D7BA 3H17A 1U8EA 3ESBA 2JGFA 4G1FA 4PSDA 5EIAA 5SYNA 3TRDA 4L3WA 3H2KA 1O6GA 3QPAA 4J03A 2WTMA 4B85A 4DSZA 1XRNA 4DYHA 4IHAA 1DQZA 4Q3LA 5KWJA 4KE6A 3V1NA 1HPLA 3V1KA 2BGNA 1WM1A 3W05A 3AILA 4KYVA 4X94A 3CXUA 2J4CA 1JFRA 2OQVA 4H35A 4Q82A 4DMHA 1CLEA 1LPSA 3IVMA 1E8NA 4HXGA 5H3HA 2V97A 3WZLA 3D7RA 2O2HA 3D3NA 1S8OA 4G8CA 3ZPXA 2H9YA 3R41A 3L1HA 1LLFA 2J3QA 2VT6A 1F0PA 2R8BA 1T2NA 4BCBA 2ZSIA 2CZQA 4U2CA 5F4ZA 2I3DA 5CXUA 3I2KA 4UFPA 2FUKA 2AXEA 1G42A 3C5VA 4X97A 2AJ8A 2QUBA 1LBSA 2Y6UA 2B4KA 3F8SA 4J0DA 1CUFA 3QMWA 1JU4A 4NS4A 4LYEA 3R0VA 1E5TA 1CIJA 3DQZA 2OGZA 5A7HA 2JGJA 3S8YA 2XQGA 2WG1A 3G8YA 4B6GA 1CQWA 5CRIA 2WU3A 4B81A 1FFDA 2XUHA 4K2AA 4OUKX 1QIFA 1R4ZA 2HM7A 3AJAA 5CMLA 3CN7A 3FVTA 1TRHA 2W6CX 1ACLA 2WIFA 5LZ4A 1R50A 1EK1A 3NWOA 2BUCA 2QR5A 5AOCA 3D2CA 1IUOA 1CUIA 2XDWA 2GBFA 1YB6A 4RGYA 4BE4A 1CUXA 2QXUA 3WK5A 1T4MA 2AJCA 4HS9A 1C7JA 2DHCA 4HAIA 1XLVA 5EHZA 2WILA 5IVDA 4ZRDA 4GEGA 3QZUA 2DR0A 1QJ4A 1GQSA 1QIHA 4Y9SA 4QDOA 5JAHA 2D0DA 1QTRA 1CV2A 4U2FA 3PFBA 4N5IX 4L0CA 1DQYA 1BE0A 3RKSA 5FPPA 1DX4A 3V1MA 3B12A 1MJ5A 1QIKA 2WUFA 3JW8A 2XQFA 5ALSA 4CG3A 5JADA 1N1MA 1SCQA 3AINA 4MYSA 3IIIA 3R3YA 2G63A 3G9XA 2QTBA 2PUJA 3STYA 5T4EA 3TJMA 4J0GA 2ZSHA 4J0IA 1CUYA 2VATA 1NX9A 1NU6A 1IZ7A 5D3KA 4X7BA 2ZYSA 3IUNA 5JYCA 2AJBA 2GBIA 2JGIA 3STTA 2P8SA 5ALNA 4BZZA 4C4YA 1AUOA 4KJXA 4C01A 3Q0TA 2B61A 4DNFA 4ZV9A 3OC0A 1LZKA 4W1SA 1ZI8A 1F8UA 4QE3A 4BC1A 4UHCA 4AZ3A 1MTZA 1A8UA 2OAEA 3FBWA 1JI3A 1ORWA 6YASA 3A2NA 3BWXA 4PW0A 5AO9A 3WKEA 4H0CA 4FBMA 2HU7A 2R11A 1LPPA 1XRPA 1XZHA 4EB0A 1BEZA 3CN9A 4Q1VA 4B9AA 5AK6A 3R3WA 4OB7A 2WSLA 3O4IA 1WCYA 2GBCA 5C8ZA 1XZMA 3TGLA 4UPDA 1R1DA 1EVQA 4BC0A 3VDXA 2VTVA 2WJ4A 5AI8A 2OXEA 2V96A 2QJWA 1QE3A 2WUEA 5JD4A 1USWA 3I2JA 4OYLA 3YASA 4C89A 1ZI9A 2ZYRA 3JYHA 4EA6A 3P2MA 4PSCA 3C6BA 4UBOA 3WK7A 1VKHA 4G8DA 1QO9A 1ZD4A 1EDDA 1CUBA 1CUDA 2DFPA 1LNSA 4OD0A 3DCNA 1N5RA 3M81A 3D4LA 3WKCA 4DMCA 2ACEA 1WB5A 3C8DA 4UBMA 5AIAA 1UZAA 3ICWA 5CT4A 1GPKA 3QITA 4U2BA 3PUHA 2G5TA 1QTIA 1ACJA 2DSNA 1CEXA 5CT5A 4X90A 4QEKA 1B6GA 4HRYA 4BAZA 1XZDA 4QWMA 3C87A 4FLMA 2ECFA 1AZWA 5ALRA 3WQHA 2JGKA 3IB3A 3CCCA 5KBYA 1ZIXA 1GGVA 3BXPA 4FKBA 1YASA 4OPMA 2H7YA 1A7UA 1FJ2A 1JJBA 3KOOA 2XMBA 3BL8A 5ALTA 3AFIA 2VJCA 2YASA 4GECA 5FXMA 3WIBA 4UFOA 4OB8A 2QVBA 3WJ2A 1X2EA 5EIEA 4X91A 1X70A 3WI7A 4KRYA 3O9VA 1XROA 5ALDA 2XLBA 3EQ9A 5LP1A 4X95A 5DNWA 4BTLA 4J0HA 3QYJA 3T4UA 1R88A 1WHSA 1L7QA 1JT2A 1JMYA 5AKXA 4DSAA 5HK9A 2BAGA 4TPKA 4PNZA 2GZRA 1A8SA 2IX9A 3KDAA 4MJ3A 2OCGA 4K5QA 1RP1A 1VA4A 2GYWA 3G9UA 2ES4A 1BEEA 1ZI6A 2VSQA 3WMRA 5ALYA 5ALPA 1YR2A 1UK9A 2PL5A 5LZ8A 1WB4A 3KWJA 5AKZA 2WG0A 3OOSA 3W04A 3PUIA 5AI4A 1TAHA 2HRRA 5K3FA 1K6EA 1VZ2A 3PE6A 4BYMA 5LZ9A 1BCRA 2HA3A 5BOVA 2JEZA 5JZSA 5JALA 2XQKA 4Y2JA 1XZBA 4UHEA 1H2ZA 3KSRA 4DNOA 5I9IA 2WTNA 5HF8A 1SFRA 4FDMA 3UUFA 3I6MA 4FTWA 1EDEA 4KEAA 1DT3A 4P93A 3E1GA 4UBIA 1U4NA 2XMSA 4KE9A 1GKKA 5HF6A 3WK4A 2X5XA 1LPOA 4IH4A 3OURA 4RNCA 1UT6A 2CUTA 4AX4A 5JANA 5FV4A 3EBLA 3HLKA 3WWEA 5I7UA 1W75A 4OSEA 2XUDA 3I1YA 1WPXA 4X3CA 1A88A 1UK6A 5AK3A 3VVLA 2B9VA 5AI0A 1JJFA 2HU8A 5HCUA 4CG2A 3A70A 2HA6A 4B84A 1ZIYA 1GPLA 5IVHA 2XE4A 3QPCA 3QMMA 3WLAA 4LHEA 4EUSA 4J7AA 2WM2A 3A2MA 3OPMA 1ISPA 1Q84A 4G4IA 5DYTA 1FSSA 3O4GA 1JKMA 2WIJA 4H7DA 3FNBA 1P0IA 3IDAA 2Z3ZA 2D5LA 4L72A 4P92A 4BRZA 4G9EA 5AM3A 1ZGBA 1MT3A 2JIDA 2E3JA 1VE6A 5AJHA 3G7NA 3DKKA 4DLNA 4LXIA 3JWEA 1CVLA 5AM1A 3VKFA 5LYYA 1CUVA 3H2IA 4DMKA 1X2BA 3DOIA 1Y37A 2C0QA 2HA2A 5JD6A 1UOQA 4FHZA 4J0JA 1MX5A 3UMJA 4YPVA 4ZGBA 2GYUA 1LPMA 4G9GA 5AP9A 1THTA 5JIBA 2FJ0A 1XKTA 3FVRA 4DIUA 4K6KA 2Y2UA 1QIGA 2BGRA 3FSGA 3FSGD 3R3XA 4EHBA 5JAUA 3WK6A 1XQXA 5IVIA 4X6UA 3S2ZA 2GZSA 5AKLA 5LZ5A 4ITVA 3EIOA 1GT6A 3DDUA 4GW3A 1EXWA 4HVTA 1VLQA 1K5PA 2VA9A 2XQIA 4E46A 5DWDA 2OCKA 2RGUA 1RWQA 3HC7A 2JF0A 2XUQA 3PICA 3R3ZA 2XUAA 5SYMA 1K63A 1PFQA 4PV7A 4H7FA 5D3ZA 3D5EA 1MAAA 3WA7A 2YYSA 3HACA 5CH8A 1YSCA 1G5FA 1QIEA 1XQVA 1VE7A 2XMZA 4C4ZA 2PSEA 3E0XA 3WWPA 1SOMA 2Y6VA 5HFAA 5ALLA 3VJKA 1UKCA 1CUAA 1THGA 3C43A 3AIKA 5ALOA 4B9EA 4BDSA 3DYIA 4P08A 3FYUC 1UWCA 2QUAA 5CXXA 5EI5A 5AI6A 3H1BA 1ZICA 1XZIA 5AKIA 1LZLA 2V9ZA 4JYPA 3WYDA 5AM4A 3LIPA 1XZEA 4AO6A 4V2IA 4MYDA 1OXMA 1DWPA 4Q05A 4X00A 3IUMA 4FBLA 3WK9A 1Z68A 1YCDA 3GZJA 1Q83A 2QKYA 5ALEA 3DKRA 4CFSA 3OTQA 4RE6A 1H22A 5JD5A 4P9NA 4H77A 3HXKA 4BRSA 3TEJA 2NW6A 3L1JA 2WIGA 3PFCA 4BVKA 3LIIA 4ETWA 4XJVA 4DMFA 3F67A 1W76A 1U65A 4N8SA 2O7RA 3AZQA 4CIAA 2WLSA 5ALKA 1UOPA 4X85A 5AK5A 3BJMA 1TK3A 4INZA 1E8DA 2CEKA 4HXEB 5FDFA 5EIHA 4UHBA 1EH5A 2Z8ZA 5LIPA 1BCSA 4QA9A 1DX6A 1IMJA 4PSUA 1YS1X 1XLWA 1YAHA 1UKAA 3DD5A 3HRHA 3BDVA 1J1IA 2K2QB 5EHQA 5FOQA 1XLUA 5AOAA 3X3HA 1MAHA 2B20A 1R9MA 3B3QA 5K3FB 4AMYA 1P0MA 1YB7A 5K3CA 2WHQA 3W9UA 5ALIA 2VJAA 1FFCA 2OQIA 3WKAA 4QNNA 4UBNA 3QVMA 3IBTA 4MQMA 3QMVA 1U2EA 4KE8A 4CG1A 1FFBA 3GA7A 1MX9A 1SC9A 2GYVA 4E15A 4BE9A 1MX1A 3I2IA 1HKHA 3HI4A 3I2HA 2ORYA 2WFZA 1K8QA 1YA4A 3HYSA 1BU8A 1BRTA 3V9AA 3ANTA 4B82A 3PDCA 2WHRA 5I8PA 4WFJA 1ZJ5A 3FYTA 3WL6A 2FJPA 2WIKA 3BIXA 3FYUB 3GUUA 4BCCA 2C5FA 2ZYHA 3BJRA 3GFFA 4A5SA 3ESAA 3H18A 4MQLA 2WIDA 3BF8A 3D2AA 1E3QA 3FLAA 3WL8A 4X6XA 4JEIA 1TCAA 1CQZA 4J0CA 2HFKA 4Y2QA 2ZJ7A 3E4DA 4A16A 4NVRA 5ISMA 3V1LA 5A71A 3OG9A 1XZAA 3DOHA 3L1IA 5BWCA 5A62A 1CUEA 5A2GA 4XWGA 4EY5A 4BATA 1MNAA 5AHXA 4JUIA 1EI9A 1XQYA 1PJAA 3DS8A 3WYNA 3NGMA 4X71A 1B41A 4RE5A 3WWCA 4AO7A 3G0IA 3ANSA 3WL5A 3ZLUA 1SCKA 3GBSA 3SX4A 2WG2A 4JH0A 1ZD5A 1ZD3A 1OCEA 3BF7A 4G8BA 5IVKA 4KACA 1N8SA 3M83A 2QXTA 3R3UA 3M82A 5AIBA 4H18A 4QWWA 4QZVA 4Q3OA 4X93A 1DTEA 3WWOA 4C87A 2XUIA 3RM3A 5C8XA 1F0NA 1HQDA 1VOTA 2RI6A 3WL7A 1JU3A 1L7RA 2DQZA 4YASA 2WHPA 4BP9A 3WKBA 2BCEA 1R3DA 3ZLVA 4GLBA 4EY6A 1E89A 2VJBA 3U0VA 3G0GA 2VAXA 4FWBA 4KE7A 4LYDA 4EY8A 1XKLA 4LKOA 1BS9A 4EY7A 2XUFA 1VZ3A 2HADA 5JAPA 5IH7A 4FFVA 2HL6A 5JARA 1PV1A 4XVCA 3RARA 2JEYA 2RHTA 4MXDA 5KREA 1MN6A 1IUNA 3VVMA 1XRQA 2JBWA 4UHDA 3WJ1A 5AM2A 1ZD2P 4TVKA 5JASA 5CH5A 2Z3WA 2HFJA 5A7GA 4ZREA 3RK4A 1DWQA 3IUJA 4RPCA 4BB0A 2WUDA 1TQHA 5ALQA 2C7BA 1A8QA 3G0DA 3K6KA 4H7EA 1DU4A 2VF2A 1ZGCA 2G5PA 4M0FA 1GKLA 4G4GA 1DINA 2HA4A 5DTIA 4BAUA 3HZOA 3C6ZA 4QDZA 4UUQA 4AN0A 2XUGA 2JGLA 4KAAA 4QDXA 5ALJA 3H04A 2C58A 4EBBA 4F5ZA 5LZ2A 3WK8A 2XUOA 1Q0RA 2J4FA 3EQ8A 2HIHA 2OCIA 3O9MA 3PF9A 4M0EA 2Q0XA 1WHTA 3QH4A 1QIJA 3GELA 4JYMA 5AKYA 1CRLA 5T4BA 5JAOA 3K9BA 5E4TA 4HZGA 4HTAA 3RLIA 4CI9A 3FLEA 1W6RA 4W9RA 3N2ZB 5AOBA 3STUA 5ESRA 4BTVA 1FFAA 1R9NA 5AKEA 1J2EA 1QGED 2EDAA 3O4HA 5K3DA 3AUKA 3U1TA 5E2IA 2IIVA 3C70A 1YA8A 4IQ4A 5T4HA 3FYUA 5AK4A 4Y2UA 1CPYA 5K5EA 1HBJA 3MUOA 5HF5A 3G02A 5E4JA 4K6GA 1FFEA 1WB6A 1AURA 4W1QA 4UBLA 5CTAA 1TCBA 2CMFA 3MVEA 3FOBA 4FLFA 4DNQA 4I4CA 4B7ZA 4W63A 4HRXA 1CUZA 2DHDA 3OM8A 2PUHA 2Z8XA 5AKJA 2BUBA 4IH1A 5AH0A 5C81A 2UZ0A 1D07A 1I6WA 1W4LA 3O4JA 4JNCA 3R40A 4NZZA 2BJHA 2WFLA 1AC5A 4MEAA 4BBZA 2XUJA 3ZI7A 2HU5A 1CUWA 5AKGA 5KWIA 5LKAA 2XUKA 4MEBA 4O08A 1LPAB 3DL7A 1XZJA 3C6YA 4OYYA 1GQRA 4U2GA 3AZPA 2O7VA 2ZVDA 1VXRA 5A6VA 4QDTA 2QT9A 5CT9A 3H1AA 2EEPA 2H7CA 1XFDA 7YASA 3DL4A 5FKJA 3ZV7A 3D2BA 3G9ZA 2C4HA 4N5HX 4UBJA 3STVA 3FLBA 5ALMA 3F96A 3C45A 2CBGA 1LPNA 4B80A 4PO3X 4WFIA 1EB8A 3VJMA 5EHNA 2W22A 3PF8A 4B0OA 2C0PA 2Y1KA 4BZWA 1XZCA 1KU0A 3E3AA 4M0MA 1XRRA 3ZWQA 5LLSA 3BDIA 4NMWA 1WPRA 4C4XA 1EA5A 1QFSA 4OU4A 4Y2PA 4BVJA 2HDWA 4GDMA 5DYWA 2OG1A 5DNUA 3FCYA 1H2YA 1L7AA 3VJLA 4D9JA 1CUGA 3LP5A 3WZMA 2O2IA 4X92A 2LIPA 1JJIA 1ETHA 3WA6A 3M3DA 1CUUA 1QLWA 4QDUA 3IURA 4ARBA 2PSHA 4OCZA 2XT0A 1ODCA 1QFMA 4PQEA 5JZBA 1ODSA 4UBKA 5JATA 3ICVA 2PM8A 2OAGA 1AGYA 4E11A 3D59A 3SWWA 2PKYX 1QIMA 3O0DA 4BAGA 2WU4A 4DTCA 4PF1A 2C5GA 3B5EA 4I3FA 1CUHA 1W1IA 5EHXA 3VXKA 3G0BA 4WCVA 3FAKA 1CFJA 3HABA 2XMGA 5FP0A 3F98A 5DLPA 3T52A 4B0PA 5CT8A 2CKMA 1AKNA 2Z5GA 4E14A 3STXA 2HHAA 2WHPB 1KEZA 5K3BA 5EFZA 3EQ7A 1BROA 4H7IA 1IUPA 2PSDA 4QLAA 1P0PA 5HFNA 2ONCA 1LBTA 1EB9A 3STWA 5HKBA 1NU8A 1LPBB 3FCXA 5CH3A 3GROA 2DHEA 3WWDA 5ALVA 2OCLA 3WIOA 2H7XA 2WFMA 5LZ7A 3I6ZA 5K3EA 2BUAA 3DYVA 1VXOA 3IA2A 4GBGA 2BFNA 1YS2X 4CCYB 3WKDA 3CCBA 4W1RA 4AMZA 3MUNA 2QS9A 4H7KA 4Y2XA 4UHHA 1EX9A 5AM0A 2XMDA 3AIMA 2PBLA 1K4YA 2XMRA 1UXOA 4C88A 1XZGA 2V98A 4WJLA 1XQWA 1E66A 3QPDA
chains in the Genus database with same CATH superfamily
2ZTUA 1PUXA 4ZC1A 2PXAA 1BNCA 1T1EA 4HYQA 2OBFA 3QBJA 1YL7A 3GLKA 3MFQA 3B8EA 1UKZA 1FTGA 1TPZA 3V6MA 4RDHA 1KFBB 2JFXA 2OL4A 3LXRA 2O05A 5EJEA 4HNTA 3B85A 3BQMB 5H1YA 3ICCA 3I9V6 4MW0A 4BVHA 2OP1A 3LUCA 4XVQA 2XCQA 4V1CI 3REQA 3ELYA 4JL6A 4JKYA 1DMSA 4FMCF 3V8EA 1IN4A 4X20A 2JARA 4L4SA 2CNNA 2DKNA 1G59A 1LTQA 1Q50A 5ECYA 1ZUHA 4Y2VA 3ZDZB 4BMNA 2O0JA 2PTGA 3USZA 4E5DA 1QRTA 1ZQ1A 3ITEA 1H8HD 1UXHA 2XNKA 1ST3A 2CE2X 1YBFA 1C8LA 1HE3A 5ELXA 2HMVA 4GHWA 2VJDA 2QJRA 2NUAB 3RASA 2BSXA 3TQFA 1GCOA 2NQTA 2HRQA 4MV1A 4EHIA 2A1UA 3LKVA 4QRHA 1AMNA 2QMQA 3OLZA 3WY9A 4AP5A 1MO2A 1HDEA 4BLWA 4YJFA 3K9WA 3CLHA 2IYPA 4JOCA 3VU8A 1Q6YA 4EVQA 2BMEA 1N0UA 1ECLA 2BF4A 4CCWA 4B0PA 4FWTA 2IYYA 4EJSB 4REOA 1I14A 1U8AA 3ETNA 2E0IA 2B94A 2B99A 5DGTA 1XRMA 3R9XB 1TCVA 3NPMA 3WO1A 5IJWA 3IE1A 3FI0A 1BE1A 2VF7A 2I78A 4RWEA 5JUWA 1RHKA 3KR2A 2JGRA 1SUWA 2FN8A 4OQLA 4RADA 4HUJA 2BL4A 4YUYA 2OM2A 1E1QD 2QOEA 5M3BA 5GGXA 4V0LA 1P2TA 1JPVA 1OW3B 2A4MA 4Q1DA 1PWYE 2B9EA 3U6KA 3KK0A 3M1LA 4C1NA 4OH1A 3L79A 4M89A 1G3MA 1PGJA 1DRVA 3IBCA 4LZJA 1L5GB 4CKEB 1DB3A 4WXHA 1XZ8A 4M7PA 3N76A 2JD0A 2D1RA 2FSUA 1OC4A 5IYZB 1GLGA 4YRJA 4NFSA 2GSDA 1QOZA 5HILA 2XNDA 1WMDA 5IDYA 3KL4A 3WLFA 4E22A 1QH1A 2Y2VA 2YMMA 2QIOA 2G04A 3IC5A 5E0OA 1O0CA 2FX5A 4G36A 5F5NA 3GOQA 4QPPA 3PQ8A 3UJNA 1R66A 1VB5A 3CEAA 1OLOA 1SR8A 1WZIA 1X7YA 2ZUDA 3EK2A 3FSEA 3W6UA 4B8WA 4ZPXA 5BNTA 4XUCA 1Q17A 3I12A 1OU0A 3UBTA 1U1FA 2IW3A 5ALFA 1MV8A 5JNRA 2H2FA 5K1ZA 4D4HA 2I03A 2QVYX 2QX7A 1D0VA 2OHOA 3KP1A 4IYRA 4Z7JA 2J0UA 3ZG6A 4QLOA 2XCUA 4AMUA 4D9CA 2G83A 2VDRB 4S1WA 5CLLA 1JFFA 3NANA 5KYVA 1P3JA 3S4YA 4MYTA 3PFKA 3WGKA 1ZYUA 3P0FA 1Y7TA 5I4KA 5KYWB 3U09A 3ISJA 4DSTA 3E4CA 1NPYA 2C4UA 3PC2A 2WJYA 4FR0A 1NLZA 4GWLA 2IZZA 4N8DA 1OFVA 1N9GB 4O2BF 4TLCA 4MV6A 3UW3A 4GL2A 3NFRA 4BV2A 4LXGA 3OX1A 4EJ2A 4XTCS 2Z6VA 3FWHA 3IPRA 4FQ5A 1JLKA 3EVGA 4G9BA 3EIUA 2PXXA 3P94A 1KE1A 2GGSA 4RSHA 1J97A 3A6FA 1G2PA 1RWVA 1HQYE 1UMBB 2BFBA 4XLLA 1Q1NA 2GEJA 1LSUA 3UF0A 2PS1A 2AIRA 1S8AA 3WBFA 2XRZA 4P80A 5BN3B 1EZZA 3U60B 3AVVA 1R37A 3LT2A 1YC5A 3TLBA 1UPAA 1QR2A 1ZH4A 4KSYA 2YWHA 5KKNB 1GRQA 2CW5A 2JJ2A 2P4UA 3K1JA 1QWOA 2HA5A 3CF4G 1UPXA 1D7AA 2BI4A 2H5LA 4X64B 2GZHA 1PHPA 1Z6QA 2R00C 2ZR8A 3AF2A 4IUDS 2YHIA 2CHFA 4J07A 1BHO1 2BMWA 4P3XA 1FSZA 4JUDX 3HBJA 1UFOA 2RHJA 4M1QA 2O8FA 5DHSA 2IXDA 4J75A 1N2XA 3R6GA 2XNSA 4LMAA 2RCNA 3IOEA 1FUKA 4X9XA 3ELUA 4NULA 4PC7A 2FWNA 1N6KA 1F12A 2YY7A 2BBWA 5E9WA 1CVRA 5FADA 5AI9A 3RVRA 4HVLA 2VL7A 1FFSA 3ZU2A 4DCPA 3WHLA 4GKBA 5C51B 4DA7A 1QS0B 5EJ5A 1IQUA 2F4VB 2XDYA 4L9RA 5E7QA 4DLZA 1KVUA 2D00A 2G6TA 2JJ1D 4WY8A 4DVGA 1JPUA 3O7WA 5ES3A 1KGDA 1YJ8A 3A6ZA 3QM1A 2PRKA 5FA5A 1H3EA 4BX0A 1COZA 2F1OA 4D7AA 3K0BA 5LQSA 1T6NA 4A23A 5FPQA 4E0BA 3PPYA 1VDZA 2NTVA 5JPCA 1KFKB 2VHXA 2BJWA 3I1IA 3ZWOA 1HL7A 3AOEC 2G40A 3DDOA 3DFFA 4FILA 2O8BB 2YJZA 3Q41A 1LQTA 4G1VA 5GV8A 4BL5A 2P6UA 4EECA 1L8QA 4RL4A 5K01A 3EVDA 4OLJA 3ZWCA 1N2CB 1TKRA 3LGSA 4QOEA 2FNAA 2AFRA 4WNIA 4ZA2A 3SFVA 3HA2A 4WZBE 3ZEAA 4MQFB 1UKBA 4ZOBA 1U02A 2VT3A 1T5TA 2PZBA 4HQRA 5I5GA 4EUKA 13PKA 1ESNA 4R40A 3SC3A 4WXMA 3FHJA 1TIBA 2NZWA 4FJ0A 3UWKA 2QV0A 3GXOA 1PCXA 3UK6A 4KWHA 1CK4A 3K92A 5HP4A 4KBYA 4M9CA 1IZ8A 2ECOA 1BMDA 3DFMA 3GLSA 2OTCA 2XCOA 2RB4A 1T6YA 2OLEA 3DDNA 1VHJA 5EJIA 5FTJA 4WZBA 5EIXA 3N7TA 5A3JA 1CQJA 3UT5A 4M8LA 1D04A 1V5GA 1SKMA 1KOJA 4B2YA 2R6JA 3KLNA 5JAMA 2A59A 2WJ6A 4OXRA 1MIHA 5HKOA 3NEYA 4LUCA 5GVRA 2WHYA 3FTPA 1M9NA 1XV5A 4Z8XA 3PB3A 3L3BA 4GP7A 3TUZC 1M8GA 4XVRA 4ZICA 4NZ9A 4JMLA 5CFOA 2NT3A 4KUGA 1SCJA 5L3RA 4O25A 3KD3A 2D5AA 2HBZA 3FX2A 1ORDA 3A2KA 1MU0A 2G8LA 2WJ3A 3OEWA 4CCYA 1V9CA 4HG2A 5HKLA 3O47A 1BAPA 2FFRA 2E5LB 1EVKA 1XMXA 3MRVA 2VHWA 1LFDB 3WGMA 1RMTA 2ZIEA 3TO5A 3OSUA 3WS7A 3GU3A 3EQ2A 4KXXA 2YZ2A 2ZJFA 2G0TA 4EDFA 1BN6A 1NV8A 4JFAA 4QAJA 3T7AA 2CVZA 3RHTA 2XF8A 3PEVA 5DULA 3QFFA 4LHZA 3O26A 1KK1A 3QW4B 3SYKA 2BFFB 2YNMD 3SK0A 4AY5A 3KD2A 2ZJOA 4ALLA 1YJ5A 5C3UA 1GAWA 3RTCA 5AT1A 4FP9A 5L3ZA 4DQVA 3LF2A 2XWBF 4GXNA 5EWJB 2VJNA 3E58A 5H3LA 2WQ6A 1XU4A 1ZHOA 4BQEA 4IXMA 2RH8A 3ORYA 5KNDH 4EWLA 1VBFA 4ER5A 4RELA 1L3IA 1RJ9B 3RCBA 1R9JA 2AEEA 1JLHA 3B2QA 1W30A 4YV1A 2JIQA 3BTVA 1JDPA 2H0QA 2WAXA 1C9YA 3L46A 4QDKA 4PM4A 3PVZA 1DEKA 1K8RA 4KRXA 1KDYA 5C7LO 3AUYA 4EHHA 5CFQA 2FMKA 5E9QA 2PKWA 2LP4Y 2C7QA 1T10A 3BH0A 5C7YA 1K1EA 3C39A 5FF9A 4D3DA 3A2LA 1T6ZA 3ZCUA 3BE8A 4P7KA 1RE1A 5JAQA 4LJ8A 2IV7A 1GL9B 4ARZA 4KBGA 1GPDG 1W4AA 1FDSA 1QP8A 1NYTA 1HLGA 3MT0A 3NT5A 4Z49A 5K0BA 5JCPA 4AN1A 1Z39A 5DT9A 3TR5A 3N2YA 3VVCA 5A4KA 1SURA 1ZEJA 2WRZA 1XCPA 1CR6A 3HCRA 3IEKA 3RC8A 1F4VA 1R8YA 2HF8A 2O5VA 2ZYDA 1VA5A 4PFJA 1SELA 2BR4A 1Q92A 2WM9B 2JJ8A 1IHDA 3IT3A 1EFVB 1OBOA 3N2KB 4GZ6A 2I6GA 2O23A 4ZCPA 3RTGA 2IKQA 4Y2YA 5G4KB 4MVJD 1EVEA 2PX6A 4GMGA 5GWXA 1HNZB 1RRFA 2QVZX 1GXSA 1SB9A 3G2MA 1HY3A 1P1FA 2WPDA 5CVDA 5IBQA 1YBVA 4ESHA 2QRJA 4JWKA 1O87A 1CYDA 4IJMA 2B30A 4BHTA 4Z7QB 4U63A 4KITB 5KYTA 3EA4A 4AYTA 1ZJ4A 3EZFA 5DNYB 4ZFNA 1E1KA 3FTNA 4L78A 2BDUA 2CL0X 2V8BA 3WYBA 2V65A 4YRCA 2JLYA 1JG6A 1JZQA 3U7JA 4A0HA 5KWVA 3H19A 2VAVA 4KXMA 4XIIA 2RJOA 2VEDA 4EW1A 1PSZA 2CWDA 4G0QA 1LD3A 2GJ8A 2QX4A 2XGMA 3ET5A 2HBRA 2O4UX 5C8DA 3DOFA 3OA2A 4MWSA 4Z9BA 3E8SA 2VG8A 4ALKA 5HW0A 3QBVA 4IG4A 4RIGA 2ZB8A 1PDOA 3A9SA 1MT0A 3NVDA 2QRUA 3PL1A 3Q7RA 4YJGA 4FVTA 5YASA 1QH9A 1IJEA 4GZLA 4DBZA 3K9NA 1Y7IA 2ZE5A 5F2OA 1CDDA 3FFXA 3IBSA 3R7BA 1G66A 4E88A 2BGWA 4I6JA 4R9RA 4EGQA 4G5XA 3NIDB 1H65A 4MRPA 1SQSA 1GJRA 3LPMA 4MVJM 1EFKA 1LGYA 1DIRA 1N5OX 4DDWA 3UPDA 3JAKA 3BWYA 1Z18A 4DNPA 4FR5A 3G0CA 3BERA 4FONA 4PZ9A 2C5LA 1XXHA 2E2WA 1UDWA 3A26A 4FEGA 5JFOA 1RHJA 1UMCB 4ARAA 4TZ0A 2OA0A 1P9OA 2IYWA 3WNVA 5HKKD 4QIHA 3GD7A 1W9MA 3ILSA 3CZCA 1ECPA 1EJBA 3GJ8A 1ZK1A 4QHSA 1I7QB 4EI2A 2Q9UA 2IPAB 2OPHA 2REBA 1SVOA 1Q12A 2GWRA 4B31A 1AXRA 4WX2B 2A0KA 4GC5A 2R4TA 1TEVA 3F97A 3OOYA 3SC4A 4DJAA 1YAJA 2GLXA 3AYXB 2A5GA 1JVNA 5KQSA 2RAUA 4JC8A 1E1LA 1WDKA 2YZ7A 4RM2A 1KZ6A 4WKOA 5CUQA 4Y1FA 3REQB 4AO8A 1Q7CA 2WQZA 3DVQX 1XPOA 2V54A 3NJ8A 2JAWA 4FFPA 4X20B 3SHVA 2IJGX 2V7XA 1QZ3A 3N07A 1Z5GA 5AICA 5L40A 1S2IA 2JI9A 1A50B 3P9PA 3B36A 3R5XA 4GC9A 1ZS9A 1K6XA 1QF7A 2FLVA 1HG1A 1HTWA 1WLSA 2L2QA 2V6GA 3HKCA 2LTAA 4HSEA 4YI3A 2INGX 1QLHA 3BCRA 5FULA 3NDJA 2BDEA 2V7WA 5LCXA 3SVTA 2A1UB 1L5OA 4IX1A 4KPFC 1RCFA 4I4TF 4L6IA 4BFSA 1KJ9A 3AZOA 3EXHA 4GWGA 5C1OA 1R6VA 4BVEA 3FGOA 4OM7A 1ANKA 4YJFB 5EZ5A 5C3MA 4EY4A 1FY2A 3DWEX 4N12A 2XB6A 1TLLA 1K88A 1WMAA 2WUGA 2F64A 3H6HA 3O03A 3SOPA 3VR6D 3ZCTA 4QM7A 4PZPA 4LRYA 2GN0A 4N4AA 1QPBA 1AQLA 4OJNA 1ODKA 1DXOA 2W2MA 4E31A 4G65A 2JG3A 1YZFA 4LJKA 5BW8A 1FU8A 1MJGM 4OHZA 1ZCJA 2PVCA 2XQJA 4L4UA 4BFTA 4U7WA 2VFAA 2SBTA 2XF2A 4L22A 1TXGA 5AJUA 1MG0A 3DM9B 3FRJA 1WO8A 2IZ0A 1B7GO 2C2BA 3TXXA 2QTTA 3H17A 4A4DA 4JQOA 3LUKA 4O33A 4B17A 4G1FA 4M0PA 4NZMA 5DBOA 4UC0A 3SHOA 4AG3A 4L3WA 2GWHA 2G9QA 3K53A 3R8XA 1O6GA 5JRDS 3AR9A 3P2OA 2GARA 3BXHA 1IM8A 3M6AA 2WTMA 2ZUCA 2YWBA 3ZV4A 2DKOA 4OX9Y 4LHWA 3L0DA 4JITA 2Y1LA 5JI3E 1QH1B 1K5GA 4I1YA 1PNQA 4RK4A 4DYHA 4EQ6A 1M5TA 1XTZA 2CMKA 3TG8A 4QT4A 3HVHA 4KPUA 1X7YB 3V1NA 2OK8A 3GG9A 4RD4A 1HPLA 5LXTA 4GGPA 4HLNA 1Z7GA 3INYA 1WBJB 5KS2A 1U8TA 1TECE 3HNRA 1WM1A 3BUSA 2MYNA 5CA0A 2Z6UA 2CXUA 2QL7A 3WL3A 1GDHA 2J0UB 2ISQA 3DE1X 2HHHB 3M4XA 4N40A 5BPFA 4IHJF 2YJ5A 1XRJA 5CEJA 1AO0A 3NETA 1GNSA 1JFFB 2AZDA 4PYLA 1KOGA 4H1HA 3KX2A 5DTRA 4HXGA 3K0HA 2K7ZA 2GF2A 2Q3EA 3Q7QA 4IJVA 2V97A 1V2HE 1PDWA 2QRZA 3JYNA 2WOOA 1XTBA 3CE9A 1M10A 2O7QA 3KRTA 4HMQA 4LK2A 4LFCB 4DVJA 3RS9A 3OQBA 4ASUD 2DWUA 3FDIA 5JECA 1S8OA 5C34B 1ZP6A 4H3VA 3EUFA 4JD5A 4XDGA 2XY4A 4B45A 1PKXA 2X5JO 1D2EA 1I4DD 3K9LA 1LLFA 1NP6A 2C9OA 2CXXA 3DTVA 1KDZA 1IHUA 1SU6A 1W29A 2VT6A 1XZQA 2E4ZA 3NNDA 4UVDA 1DFHA 1T2NA 1WP9A 2FPOA 2HXGA 4UEWA 5DLYA 2QMYA 4ZARA 2ZSIA 3HR4A 4H0NA 2AFHE 1A95A 3NOQA 3OKAA 4BCBA 1MJNA 5CFNA 4O2AA 1E96A 5G02A 3T0IA 4PGFA 1KPHA 5JAUA 4TTVA 4DZTA 4KODA 3W77A 2PZEA 2Y77A 1BYIA 1YZNA 2W2VA 2YHIB 3COZA 1TO2E 2FUKA 5HE8A 1G42A 2AEJA 3C5VA 4XTRA 1MKYA 1UPFA 1SVKA 2QN9A 2X7HA 3FR7A 2BISA 4DLLA 2O8FB 2BKAA 3HXPA 4LZLA 4BASA 1LBSA 3HJNA 5AW8A 4CGYA 1VHWA 2GDZA 3S28A 2RGCA 3VC7A 4YRZA 4J0DA 4RF5A 4YMUA 1GGFA 4RTOA 2YWXA 1OWNA 3FVVA 4TS3A 5SZIA 3EB9A 3KT8A 3RKRA 4NS4A 2JH8A 1CEYA 2V7UA 4L8GA 2WA1A 5GQSA 3IAM6 1TFRA 3GGGA 2XWSA 1FS4A 4K3UA 4QPCA 2I9KA 3R8CA 1YI1A 4NCBA 1KHTA 2DZDA 2IQ5A 4FIZA 4ZP1A 5GGYA 2X0DA 4A0SA 2JLUA 1N0WA 2GZ3A 2EGHA 5A7HA 2OGZA 1DTSA 3ZJTA 5CVTA 1E0AA 2R7AA 3C4QA 3S8YA 2XQGA 1JI0A 2WV9A 2P78A 4ND7A 1CQWA 3JQRA 3T3NA 4BLUA 5U4QA 1OAOA 1YA6A 3KFXA 5CW1A 2W6JA 3LQFA 1X38A 1EWKA 3MT9A 4LF7B 4TL8A 1D8AA 1Q7BA 2NPFA 1AS0A 3H8SA 5B12A 1YUMA 4OUKX 5KO2A 1TA0A 4QBKA 2C61A 1JXAA 1QIFA 4EI9A 2YMLA 2F3UA 2YFHA 4ZZ0A 3B9QA 1ZVKA 2Q3BA 1C1DA 2P9TA 2YHAA 4LRXA 1DDOA 3T99A 5AW9A 1KH3A 1QGAA 2FR8A 1UP4A 4KR9A 1V41E 1FYDA 2QAJA 3ABQB 2P4HX 3EWIA 3SP1A 3DB2A 1HE2A 2W6OA 2W6CX 3RT7A 3IP1A 4Z54A 1TW3A 3O4FA 2OORA 4V24A 1YB1A 4LJSA 3FUUA 1XR3A 3T54A 4BLPA 2FSIA 4YUXA 1IK6A 2FMFA 1AZTA 4DR2B 1J7KA 2QE7D 4LYFA 4WZBB 4OP2A 1GRCA 1WUHS 3NTOA 1CQJB 1Z74A 4PC2A 4X60A 3UT5B 3HR8A 2JL1A 4LGYA 4EFMA 1CUIA 5DYNA 3SNKA 4IY1A 5BUZA 1FNDA 2YKGA 2DFDA 1NT2A 2E6KA 2HUPA 2I62A 2Q7XA 4M88A 2GUWA 1GSOA 3T4XA 3ZUGA 4AVYA 4BNJA 5LDHA 5CDGA 4OJQA 1KQOA 4YCBA 4C2TA 1T8PA 5AJWA 1CUXA 1S3IA 4XYGA 3BKXA 1Y1TA 1FC0A 3EXHC 1DG3A 4MYRA 4K9MA 1KO1A 3I0MA 4TV9F 1BQ3A 1QF6A 2OD9A 4NRDA 2AJCA 3DLAA 3FPBA 2DHCA 4HAIA 4S1PA 5KNBA 4IXWA 3N8GA 3E7WA 4W7IA 4FFSA 5KYXA 1T8UA 5IVDA 4IV0A 2BVNA 2WSMA 2PRIA 1ZX1A 1A8IA 5C4GB 3NYIA 5BSFA 3IRVA 3AVUA 4PR3A 1QJ4A 1QGUA 1Z7BA 2GVNA 3GCGA 3OZAA 4YVFA 3UEOA 5J1SB 4JIMA 4YPFA 3QY9A 3PHCA 3EAQA 2FGJA 4WOPA 3VR5H 1CV2A 1T4CA 4U2FA 5K9ZA 3E61A 3ERCA 3H1FA 2CFTA 2ZLBA 3QNWA 4N5IX 5IKOA 3GDGA 4ECEA 4B5KA 1IY1A 1J0DA 1BE0A 4KKVA 4ZI7F 3ECSA 4F3CA 5KTSA 4RABA 4EPVA 1ISFA 1NNI1 2GT1A 3V1MA 3SBDA 3VU9B 1RKUA 5BP7A 1LLCA 2VUUA 2JNWA 4Z0NA 1CKEA 4JJIA 2O07A 3DNFA 3FD8A 1PYOA 4DLYA 1X1CA 5J2UF 2IEYA 4P7GA 3VOBA 4NDZA 2O2ZA 2N1MA 2HX1A 1NVMB 4XX0A 5G3YA 1N1MA 3WRYA 1JIQA 3QTLA 5JADA 5GV7A 3A9CA 2ZZNA 4MYSA 2ODQA 3IIIA 1VKJA 2VQDA 4RVOA 1CNEA 1ATIA 1UJ4A 1P4JA 3BIJA 3WP0A 1FRQA 2G63A 2XD9A 4WBNA 1DCMA 1DKQA 3KQMA 3ZE8A 1FE8A 4QPNA 4FFMA 1LJ8A 1H0KA 3DEKA 3PCXA 4RK5A 1ESMA 1RQ7A 2AXNA 1PT8A 1O97C 3RRBA 1AU9A 4ARZB 4D0RA 1UWKA 2XTNA 4Z4QA 1SKQA 1AD2A 3O93A 3TR6A 4CR7A 2P0EA 2VATA 4M0LA 1YOVA 3B9RA 3QFTA 4KMSA 4EPXA 4ZCTA 1NU6A 1IZ7A 4EKGA 4RF3A 1Z6XA 3A1UA 5F3WB 3LSYA 4FSDA 4JKOA 1RBQA 4K9OA 4X7BA 5D3KA 5ENVA 4EATA 2AH5A 1EUQA 4HNHA 4ZT3A 2GBIA 4CLXA 4YV0A 2ZBVA 2O6HA 4IV8A 5A2QA 3EWSA 2QL6A 1SB8A 2V4MA 1GXSB 2R6DA 4G1MB 4RZSA 5ALNA 4D9EA 4UMFA 4K9LA 2DPLA 4J6FA 4KJXA 4C01A 4ARIA 3ZNOA 1Z5UA 4EK9A 3KCQA 4G09A 4UM7A 2OD7A 2IYXA 2VH2A 1GV1A 4CV0A 3D3JA 2QD1A 2A5FA 1ZI8A 3KIPA 5C7OO 5DU2A 3X1XA 5DCUA 4QE3A 5EMNA 5EP2A 2A86A 3GHYA 1MTZA 3OOEA 1HV8A 3C2QA 4PX5A 3WMWA 3CS3A 4D4MA 1FDVA 1SH7A 4M99A 1ZRHA 5KTNA 3KUXA 4BGVA 3P1JA 1VSTA 3DL2A 4JJKA 2QQGA 4TUYA 4HI0E 2OM6A 2J5XA 4R8RA 2F3TA 1JI3A 1X1QA 1ORWA 3PUWA 4WN9A 1U81A 1DKNA 2PWBA 3KVOA 3PVCA 1VL0A 1VCNA 1VYTA 5JTTA 4IRMA 4E5MA 3A2NA 1G38A 5AO9A 1JAZA 1RADA 3RC7A 3JAKB 2P65A 4TKVA 2JFWA 4ZZIA 5IKMA 1AXGA 2C3OA 4RPIA 4BN0A 3NG1A 3UMMA 1C0KA 1JWLA 1CS4C 3NM5A 5MFZA 1XXHB 1XG5A 3BEOA 3AU9A 3LCCA 5CB8A 4B76A 2RCYA 2QUZA 3JASA 3CN9A 3GLRA 3WL4A 1MB4A 3CPSA 1IULA 4G6ZA 1OGJA 6PFKA 5AK6A 2WM8A 4JI6B 4AUNA 2ISSD 3QVVA 3RYFA 5EXXA 4RH1A 2Z4RA 4MUBA 4ZAFA 4V39A 5JOQA 2VTEA 1EUYA 2NU9A 2FGKA 4OQXA 3NIFB 4NP6A 1U3DA 3SSAA 2HMWA 3H5AA 3OTHA 4FQ7A 4YGYA 2APJA 5PNTA 1DRUA 1EUCA 3HDYA 1JR4A 2G9ZA 3L7OA 1EEHA 2RAFA 5I01A 3WQRA 1T6XA 4AROA 1R1DA 2IHZA 1QB7A 2I4NA 3DD1A 2PYZA 1JHRA 3E23A 1W34A 1I6LA 1NW5A 1EVQA 2Q5CA 3H2ZA 5CEEA 2PUBA 3HLYA 4EM6A 3PNLA 4JR1A 3IBFA 4TXLA 3WGIA 1P4SA 4PPNA 5AI8A 4RGBA 4Z7NB 5JWOA 2FR8C 1JLLB 1YBMA 1NPDA 2EG9A 4GLLA 5DN9A 4B6OA 4J1TA 3VPHA 2YJTD 1S96A 1N4AA 3RUDA 4IXTA 4IDDA 2VPZA 3VH1A 3IP5A 4P4SA 2F48A 3HKCB 3TRKA 2AYZA 4FKMA 4MW4A 2OORC 1ZR4A 2Z43A 2NU8A 3ZDEA 1Q15A 3TBHA 3JYHA 4ODIA 3DVAB 1IWPB 3W7VA 3G0HA 1N6NA 1D4AA 3FBGA 3EXHB 5ESXA 5GONF 1KEEA 4MVJH 2DPMA 2IA5A 3NC4A 3GX1A 1YACA 3ODPA 2HMSA 3Q8XB 2V7PA 2V58A 1P60A 2FMHA 3W2IA 1A9QA 3MLBA 1NG1A 4EG7A 3IOBA 4BEWA 3L07A 1SCAA 3D8SA 3HV2A 3GJ7A 2YIMA 3TSWA 4CUJA 3D4PA 2WBLC 1TIKA 3BKWA 5DTMA 4C0BA 2YCBA 2GN1A 3DF9A 3INGA 1KI8A 3HVJA 3C4JA 1E79A 1U2TA 1GL7A 3NTXA 4X8LA 2CCGA 2VUIB 3WYFA 5GIOE 1QHFA 2GVZC 4DM3A 5TNXA 4IDCA 4R1UA 2FW9A 5FR1A 1P33A 5GM1A 1AM4D 1SU7A 4HWOA 5EP1A 4C7KA 3CVUA 1G7CA 1H66A 1NI5A 5HMMA 2FF5A 3G8CA 5BSHA 3D4LA 2FCRA 2FE4A 4MIKA 5H70A 3WKCA 4GIBA 1A1SA 3ABSB 1E7RA 2QTVA 4QKQA 5AW1A 5I7OA 1ZVVA 4E21A 3DO5A 3H42B 4EHAA 3VI3B 4DPLA 5HQTA 2FP4A 2BEVB 3HV0A 1NKTA 1KBZA 1C14A 3QITA 4ZMBA 2FG7C 3URKA 2GJAA 3ADKA 3TD9A 4EQ6B 1Q22A 3WLLA 3IB6A 1YONA 4TXMA 4YRMA 1DAFA 2CDRA 1CEXA 1DIAA 4KPUB 3EOAI 4TS1A 4NSNA 2JFPA 5T3UA 5LXTB 3NWEA 4A03A 5DN6D 1S5PA 1OWPA 4DARA 2QPAA 3ZHXA 2AZ4A 3ZHZA 1ILWA 5DEIA 4KJZA 2XGOA 5IJ9B 4YCMA 1XZDA 5CA0B 4PYIA 4FZJA 3UB4A 1Q91A 2XB9A 3I1FA 3OEHA 5DMXA 3CW9A 5H4GA 3B1KA 5IEJA 1SQ6A 3C87A 3WRYC 3S7ZA 3EISA 3NHAA 1UPTA 1Z8FA 1STOA 4LJ5A 3U40A 4CT0A 2CY0A 3X1WA 2J9ZB 1O89A 1A27A 4QEZA 1AQIA 1E2GA 2YZKA 1Z4PX 1OFUX 1KOLA 3HZHA 3HK2A 2JGKA 3NRBA 3B7PA 3LLSA 5KBYA 3U4QA 4CQMA 3BMOA 1ZIXA 3QBDA 2Q4OA 4OPMA 1YFJA 4WW0A 4C03A 3SSOA 2QSUA 4IIJA 4TMWA 2WWWA 1A7UA 1C9MA 1FJ2A 3AUAA 4Q47A 2P77A 2Q50A 4DS3A 4BUCA 2XMBA 3DTVB 3EZ2A 3GCDA 3MF4A 5IN4A 5CNIA 2ZE6A 2VJCA 4CXMA 3HJTA 3L6DA 2ZG6A 1V8OA 2FHSA 3WIBA 1VMIA 3FMPB 3PWKA 3FM9A 1TM2A 2BTEA 1EFCA 5D1HA 3MINA 1AHHA 2UXCB 1ENOA 4N03A 3WJ2A 1QHEA 3F1LA 4QXQA 5LYJA 2W2OA 2YJGA 3GPIA 2I4OA 1DJNA 1F2VA 3VPBA 3OT4A 5T64A 3AUJB 1N3YA 1TKBA 2GERA 2VQSA 4CFZA 1MRSA 3PCRB 1L3BA 5KUTA 3VNSA 1RLUA 1SOAA 4YAEA 4BFZA 4BGDA 1V8FA 2QL9A 3HWX1 3IIJA 3PRHA 4UUBA 2X1MA 5BYJA 1LI4A 1AS3A 3ZH2A 2PQ2A 5ALDA 2BF7A 1Y9JA 3RFFA 2XLBA 2WD8A 1JQ5A 1RXYA 1FTYA 4CQLA 4BE7B 1E4YA 1T2VA 4OG2A 3T3GA 2X7JA 2Z4TA 2R7LA 3REGA 1HL3A 3RBAA 6ABPA 1U0FA 1SKAA 2RKBA 1L8OA 3HDGA 3SR3A 3W5IA 1JFTA 2ZBDA 1YJBA 4KL8S 4DA4A 1UM8A 3EGDA 4J0HA 5KNLA 1N2SA 3DDZX 1CRQA 4Q1AA 3OTWA 1R0SA 3PPWA 4NMLA 3H5WA 1SXJA 4KW7A 3OA0A 1H1DA 2J59A 2PVPA 2BGGA 4E32A 4TTIA 3TNLA 4MVYA 3PP8A 4CTOA 1X1DA 2PMDA 4ER3A 1JT2A 4LDQA 5BPHA 3IXLA 4BUJA 2BAGA 2ZBUA 3T3OA 4O1HA 2UV8A 4TPKA 4CPDA 4JVMA 1N5JA 4LF5B 2QPLA 4HEA6 1I2CA 2ZYWX 1O54A 1FW8A 3OPYI 4E13A 5JDCA 1PR2A 1RXWA 5TQ2A 3KKLA 1E18A 2SKCA 4R8KA 4E3ZA 1UBCA 3OLYA 3T5GA 1YQEA 3UG6A 5AFSA 7MDHA 3JYQA 1UDBA 1PHRA 4ZO4A 1HOXA 4BECA 1ID8A 3I9NA 2GK7A 2P69A 2VSQA 1JECA 2BM1A 4U1RA 1T0UA 2QRQA 3FPCA 2FX2A 5BN1A 2AN5A 4AT1A 4G2TA 1MORA 5K09A 2IXBA 2MYUA 4CMGA 5C5DA 4LNUB 3V7FA 4J1TC 1NUAA 4P5DA 1KVQA 4QO7A 1SM4A 3U7FB 4G3XA 3IIEA 4BX3A 3O6VA 2J0QA 1AGRA 1IDN1 1WB4A 3ND5A 4EZBA 3I1JA 3KWJA 4DLVA 3JQQA 2I4RA 3ORHA 5DX0A 1QZXA 4BNDA 4JB2A 4RTSA 2PHZA 1ULSA 1P18A 3JWJA 3HXLA 3FTQA 3MM4A 3OOSA 1ZK2A 3QVLA 4Y9DA 3USCS 4WY2A 2ZT5A 4R1OA 1CR0A 4GOLD 2HRRA 3KLOA 1K6EA 3RBZA 2OSVA 3HY4A 2C1EA 4IIFA 3N86A 2WB4A 2REQA 3Q5DA 4IDQA 2VBGA 5EQDA 3ZY4A 3JTMA 3C14C 3O8NA 3VC2A 4B3HA 4MLCA 3WLNA 1UBMS 4YDSA 3PUJA 4RNDB 2OOSA 1QGUB 5LZ9A 1M6YA 1YB4A 5K0CA 3T5PA 4NFYA 3N53A 1KZ9A 5FUBA 2HA3A 4ZJZA 1AQNA 4V0OA 2XV1A 2ODEA 1H4VB 4LY3A 2XQKA 1YFLA 4NLLA 2Q1XA 3TFQA 3CSUA 2XPCA 3V1UA 5HVNA 5K8JB 2CXSA 2IELA 2AKYA 1T4CB 1LQUA 2EF0A 3VZCA 4CIDA 3KJZA 4X7MA 1MMFB 1R0YA 1KORA 4ARSA 1KY2A 1KJNA 2DHQA 2ON6A 4BY9E 3IPLA 4MDYA 2XYGA 1BXZA 1NUUA 3RUHA 4FDMA 1EXDA 3UH0A 4FTWA 4RLSA 5A04A 3ZDBA 1W48A 4E2XA 4MVJG 2YVUA 5I9TA 3C3CA 4Q3DA 2GOYA 1EAMA 4QDJA 1JUDA 4R2WA 5JNLA 5DT2A 4PLVA 2PMBA 2R60A 3JS5A 5DM2A 3HWWA 3V8NA 1QKJA 1ECBA 1U4NA 3FB4A 2PZFA 1LK7A 4JEMA 4XX0B 4BO1A 5LQRA 2JKYA 4JI8B 3TINA 4YCDA 2V59A 1GKKA 2WWFA 3WK4A 3GDFA 3RS0A 1LPOA 4IH4A 3D8HA 1PDVA 1VJ1A 1XAJA 2Q8PA 4HLQB 4NEHB 4BO7A 4WBNB 2ZDQA 3WP1B 3NH9A 1TA9A 4G01B 4ZCMA 2CUTA 4AX4A 2IDKA 3MCAA 1FLNA 3IRUA 3AHEA 1QV9A 4I1IA 5BXQC 5KNCA 4DV4B 5DWVA 2WF8A 3WWEA 1I9CA 1E63A 1W75A 3PNKA 5CLGA 2IU0A 4OSEA 2XUDA 1XF1A 1WPXA 1YOVB 1R0BA 3LWBA 1A88A 1UK6A 2HXYA 2VJOA 3GJZA 4WASA 3RKUA 1K8YB 1OF1A 1IWBB 4E5VA 3VVLA 1TB4A 5TGZA 1WVIA 5TS3A 4NX2A 4Z4FA 4N39A 2HU8A 2ZR9A 2ZSEA 2BFDA 3K0SA 5EJAA 5I7VA 4CG2A 4B84A 2HA6A 2GJ4A 4HN9A 4HDMA 1ISHA 5HJ2A 2XE4A 1KC1A 2H5EA 4P4LA 2HGSA 2BELA 3O0TA 2P5YA 3DZIA 5H0IA 1AHPA 4LE1A 2JLVA 1X19A 4LHEA 2XDQA 1EJ2A 5IXJA 1QTQA 1DKPA 3CW2A 4E94A 2PFSA 2WM2A 1D7OA 3L4KA 3NWJA 4TM7A 5CHEA 2X6RA 4AY3A 1Q84A 2YWEA 1T13A 3AOGA 4QNRA 2UYOA 4G4IA 2G4CA 5LUAA 1LK5A 5GADl 3VU0A 1H4QA 4A26A 1FSSA 3T5TA 2IF0A 1JKMA 2WIJA 1RM5A 1T9GS 4ZHSA 4H7DA 1KZ1A 1XNHA 1S3FA 4O4JA 4DLSA 5L51A 1NBEA 4TUYB 1JBEA 2JH9A 1D1PA 4CT4B 4LJ9A 5JRJA 1WKCA 3A6LA 3PR1A 4WN9B 1P0IA 2B4RO 2E4UA 2Z3ZA 1LXCA 2WJZB 4P92A 4PG6A 3L77A 1WY5A 1BDJA 4QICA 1C30B 1KEWA 5DH9A 3ZK8A 3OJXA 1ZGBA 3ABOB 1NP3A 2R85A 2IH2A 1I2AA 3WLPA 4TKVB 4XCQA 5KINB 4AJHA 4DLAA 4KV7A 4RESA 2JIDA 3PZRA 1C7FA 4M8KA 4CCSA 1MVNA 3NNNA 2CFCA 2DT8A 4O4HF 1PJ8A 3OLCX 3QGMA 1JH8A 3JWEA 2O2XA 4CNBA 5C5CA 1CVLA 4BX9A 5DM70 1MX3A 1DDGA 3TGWA 3VKFA 4L5AA 5LYYA 1CUVA 3HMQA 1AN9A 3RYFB 1RVV1 4TN5A 1GU0A 1WW8A 3P9SA 3A4LA 1BQEA 4BKRA 1SXJC 2EL7A 5EUBA 2NU9B 2XYRA 1Y37A 2C0QA 2HI0A 2ONYA 1TU0A 3UMVA 5CJPA 5T8KA 2NYVA 1GTZA 3OLWA 2BZ1A 1EUCB 1GNVA 1USGA 4UVIA 4FHZA 1LLQA 4NYJR 3EJ6A 3E9RA 3EVEA 2PY6A 4J0JA 2O59A 4I1PA 3UMJA 2QR3A 3LPAA 2G1JA 3HCAA 4MKIA 1HE8B 1ZK4A 5DP1A 4N76A 1RQ2A 2FVYA 3WDKA 1ZUNA 1SUEA 2A33A 3OO1A 2C4TA 2GYUA 3HJGA 2QTNA 1LDMA 2ANCA 2RDMA 2XYPA 4F2HA 1VKZA 4IDOA 4Q3BA 5AP9A 3SDBA 1L7BA 1NLFA 1THTA 1OBVA 2Z0MA 3EFEA 1G7SA 1BG6A 2HSJA 3BN3A 5BNIA 5CDTA 3QYPA 1PVDA 3FVRA 3TSZA 5FX2A 4EG0A 2R6ZA 5C52B 4BNYA 1B4DA 1FDTA 1RM3A 2Y2UA 2HWKA 2Z2ZA 2NU8B 3AO0B 2BGRA 3EIXA 5FUWA 3TZHA 1F48A 4BO4A 2ZSFA 3KJQA 4GSKA 3PJEA 3B6ZA 3EOBI 1OBFO 1V2GA 1KEEB 3FZEA 3TRIA 1NF2A 3JD3A 4JP8A 3NHYA 1XTIA 1MF7A 2QN6A 4A15A 1L1EA 3SR4A 3FSGD 1RT9A 2HEGA 4JJ6A 1UP7A 1DQSA 4KSCA 4Y2GA 2RHMA 3U26A 2AOWA 3EF1A 3ZUPA 2PNJA 4P58A 2WD7B 3VPCA 2ACWA 4FOPA 5IVIA 4MUIA 1U4SA 2IOHA 1P17A 2Y1CA 3DHYA 4DSOA 1ZD9A 4L95C 1VLJA 5IC4A 3I32A 1NXSA 4JQZA 2C95A 2XR1A 2YN2A 1PE0A 5DIZA 2Y66A 3LZ6A 3N58A 5HMLA 3S2ZA 4ZXPA 3WGTA 3LWDA 2AF4C 3KDSE 3NTQA 5A4MS 1PJ3A 1XDBA 1UADA 2Y4NA 4ITVA 3OFKA 1I9GA 3P9QA 4FCTA 3Q11A 1ELOA 4KDRA 4C30A 4AD8A 1QHIA 3TI7A 4O3MA 1UJCA 4G5YA 2FW1A 2QTVB 4CTMA 3DR5A 2YOFA 1BS1A 3N2NA 1JWBB 1K5PA 1VLQA 4RSRA 4W4TA 4XVHA 3UAWA 3UCEA 3UW1A 1FOEB 1X9GA 5TMBA 2FP4B 5HGXA 4I55B 2FVXA 2ZAIA 1E5LA 1YU9A 2OHGA 1AK2A 4R7ZA 2C2HA 2VHQA 3ITDA 4EKYA 3FTFA 4J16A 4S35A 2XUQA 3GD5A 1I0LA 2XUAA 4M1ZA 1K63A 1PFQA 4HPXB 1BFKA 2HF2A 4PV7A 3TECE 3CVWA 4B3GA 1AK1A 1NP7A 4IIVA 3RSZA 2JW5A 3CLKA 4GOXA 3D5EA 4P4NA 4DEVA 2FWIA 3IA7A 2YYSA 4IZHA 3ER9A 1K7SN 2PWYA 4FYWA 3CLUC 1EX1A 1S6YA 4V03A 1P1CA 1YSCA 5KQMA 1XQVA 4XYBA 4BLOA 4YPOA 2I8LA 1ZGJA 3IVRA 2IOFA 3W78A 2YYAA 3MK31 1SOMA 4YUVA 3QEOA 1LRJA 2W70A 3GDHA 4PXSA 5KTRA 4QATA 3MQFA 1ZXXA 1H5UA 4KIUA 3CB4A 3C43A 3BA6A 5ALOA 3L7AA 4B9EA 2HYDA 1RWMA 4N0DA 3UY4A 5HBGA 2BKXA 4NXNB 1EVIA 1UKYA 1JR6A 3DYIA 3FYUC 3U4QB 2D5IA 4CQMB 1BHSA 3BMOB 1NN5A 1E0JA 4WTOA 2QRHA 3VSDA 5LNK6 3VPFA 2UUCB 5EI5A 3RVDA 4IIJB 3IP3A 3R1IA 4AZTA 3H1BA 1E6EA 4QJ5A 1CF9A 2C9ZA 1LH0A 4MQ4A 2BBOA 3U16A 3B5JA 4ZANA 4JGGA 1LZLA 3N0VA 3FGZA 1THMA 4OFZA 4PCUA 2VWGA 3H6GA 2A57A 4R2HA 1FDOA 3FBTA 1DBRA 4F2PA 1L5QA 1A76A 3Q98A 4PVCA 1TAUA 1WX1A 3A6GA 1Y3BE 3KZXA 1DV2A 3ZGLA 2Z1NA 3LIPA 2BHNA 4U3JA 4PZ0A 4MYDA 2HRBA 4XH9B 3EVTA 4P4GA 5EC8A 1FQWA 2W00A 3TIVA 1NUSA 4I50F 4MIYA 3SQXA 1Y34E 1WMEA 4YMWA 1ENYA 1K27A 1FRVA 1YCDA 2EJTA 3BZUA 4P3PA 3UWPA 3PFNA 3WLEA 3K9CA 3UGKA 1YL6A 1NXVA 2FZLA 3DKRA 4IIUA 5EJ2A 4Y30A 5HA5A 3PXEA 1PX2A 1JHXA 4UULA 1CCWA 1FQKA 3WNDA 1P8JA 1LC0A 2EWMA 2R96A 1ZU4A 3UOGA 2BYTA 5JD5A 4CQLB 1N7GA 2EJUA 1ONPA 3LQ2A 2OZLA 1B2LA 5LSAA 1PX0A 1HT1E 1LW7A 4GICA 2HLPA 3LPNA 3TEJA 3DUFA 3WJ7A 3C15C 3L1JA 2WIGA 1YDGA 1IPFA 1H9BA 1I0ZA 1ZN2A 2I34A 3PFCA 5DWQA 1KQNA 5JQWA 2ZAYA 5CJJA 3EXFA 4ETWA 3FHOA 2N3ZA 3LXMA 3M1IA 1CF2O 4JEUA 4KLCA 4XJVA 2EFEB 2RAPA 4M1KA 3LCJA 1F3LA 1SXJB 1U2DA 2Q5FA 3AKYA 2O7RA 3LNTA 2VYCA 3UT0A 1MH1A 4ENTA 1UZNA 2MSWA 3GP8A 2DQKA 5BR8B 4R3NA 2PBRA 1SXQA 5F4BA 3ILYA 1KYWA 1NW3A 2WLSA 4ZOAA 1Z3IX 1DAPA 1ML4A 3IQGX 3RU9A 3EY4A 4LJYA 4N7BA 4MS3A 3HRKA 3TIXB 1GPMA 3D6NB 4L50A 4AG5A 2HYIC 1MDBA 1A4XA 2H4HA 3KXLA 3NNSA 1NR1A 1Y4AE 4D4KA 2VZ8A 5IBRA 4B7AA 1WABA 5TQ2B 2F9MA 3D4OA 2XTJA 4L4ZA 1RAIA 1EH5A 2OFOA 3LC7O 3WB1A 1HMYA 2AOXA 1G1AA 4HAUA 4NV1A 4JI1B 4ZIRA 2FWRA 4CM9A 4F92B 5LP6A 3M1YA 1V9LA 1DX6A 1JIJA 1OAKA 4QYXA 3ADOA 4K86A 1TQDA 5EMJA 2B92A 4N7RA 4PSUA 5NLLA 5A0VA 4L4XA 2VQEB 1NE7A 3M33A 4DWVA 1XLWA 4MRVA 3WLMA 2Y05A 1YAHA 1UKAA 1B0UA 4B32A 3QVWA 4PBRA 5HWSA 2M6RA 4UJ5A 2RJNA 3BDVA 4MYHA 4YQEA 1ZRNA 1J1IA 3CE6A 3MCUA 4HMPA 4LMPA 1O95D 3ZI0A 1PQWA 1VLZA 2VWHA 3NKVA 4M54A 4WWHA 4XR4A 3MTEA 5FUXA 3HP1A 4BNDB 5FOQA 2F55A 2C84A 1H8HA 1MAHA 4A8TA 1XKXA 1Y1PA 1ZOPA 3DBLA 1BJTA 3ICOA 3RSLA 1NJFA 3DOJA 1UC4B 3B3QA 3IPXA 4AMYA 1YB7A 4JASB 4LC9A 2GYYA 4L76A 2HNKA 1YO6A 2WHQA 2REQB 3D4NA 1FUEA 1TT7A 4E2WA 3W9UA 4MQ5A 3LVQE 1KR5A 1Z16A 3Q12A 2BV3A 4B40A 5ALIA 3V8MA 1RQPA 2VI5A 4BNZA 3VDQA 2DFNA 1G9TA 3CX8A 3WJAA 2QENA 4L5BA 1FFCA 4CEHA 3WKAA 3ZN2A 1LV8A 4C3ZA 4UBNA 1X1EA 2VYND 1DQPA 3IBTA 3G8AA 1I24A 5G53C 3INTA 4HDKA 2OHVA 3DZ8A 3T1QA 3SN6A 4CG1A 3JQFA 1WD5A 4DCOA 5TB5A 5AVVA 5INTA 1MVOA 1MX9A 1Z0KA 3PNBA 2KI5A 3UMCA 3ZWYA 2E18A 4YGXB 1YJQA 3F3MA 4E15A 1SC4A 2Z83A 4NJMA 3TJZA 3QA9A 3VHRA 4WBXC 1PP4A 3I2IA 2I2WA 1UEXC 5C5IA 2W4IA 3I2HA 1N8NA 4CF4A 1WF3A 2HMUA 3DL0A 2OY0A 3DOUA 2DLNA 2HNAA 1K8QA 1NT4A 2YS6A 2QUKA 2VJPA 3KUUA 1MVLA 3BHJA 3V1TC 4B3FX 5AVTA 1KYVA 1BRTA 3V9AA 3ANTA 4OJYA 3FXAA 1QVAA 2J3LA 1BC5A 1VE5A 2JDIA 1BD3A 4MV9A 1EA7A 2HWUA 1P8AA 2OB2A 3R0XA 1PJ2A 1SXIA 1U8ZA 1HYHA 2SKEA 4X62B 4L5YA 3L8DA 3DWFA 1FX0A 3FYTA 3MMPA 4XWAA 2AFIE 1W87A 1HGXA 3LZDA 3ZVRA 3FYUB 2AWOA 1SZJG 1NXTA 3GUUA 3FCUB 4P22A 3EGXA 4BCCA 5LU8A 5ADUS 1HEYA 3R9KA 4XYLA 4UM8B 2ZYHA 1QGYA 5KSYA 1IJKA 1I1HA 2X2EA 3ADPA 4HOYA 5A6SA 3KAPA 5JBQA 3H18A 3KQSA 4P5EA 1UJ6A 4KYTA 1JPJA 1WPGA 4Q7EA 4TWBA 4C4OA 2BTOA 4NEGA 3FLAA 3IALA 1F4LA 4IFTA 3F71A 3G8DA 2VP2A 4JEIA 2AI1A 3KSMA 2P2ZA 1VFPA 2P67A 1RHQA 4B2LA 2MT9A 1W4RA 3DE4X 4K7JA 2BFDB 2VDOB 4NNJA 4RA9B 1W93A 4WBSA 4HDMB 1X6VA 4QUDA 4AI6A 4XPIA 4PRKA 1CG6A 1RU3A 1M1XB 2ZZKA 4MVJP 4Y2QA 2XDQB 2ZJ7A 3NT4A 5K0NA 2AW3A 4XCXA 3ZCRA 3GRZA 1DXHA 5A71A 2C3MA 3OG9A 5ECGC 1MAWA 4NJEA 1RS0A 4H1TA 4KCGA 1BMQA 3ELWA 2VCYA 1EG7A 1QX3A 3LMKA 3GJTA 4JBHA 5A2GA 3ORFA 3U7GA 2PMFA 1MO6A 2AUMA 2AJTA 4GRIA 4IJQA 4J2OA 3G9QA 1TL7C 5IJZA 1VL1A 1Z0DA 1LCIA 1RPJA 1EI9A 3TQHA 4IIGA 3P2YA 2FPGA 1XQYA 3CHYA 3KYIB 3DC7A 1Z6ZA 1YZKA 3S0JA 4BPBA 4I5GA 3M6LA 3GI1A 6LDHA 5C80A 3WYNA 1RHRA 4AG6A 3GA0A 4YNBA 1VPVA 1VL8A 2HF7A 4RE5A 5JCZA 3CNQS 4E12A 2VA8A 4PANA 1U8FO 2I6XA 2OK7A 3ORSA 3ANSA 5AQEA 3SIXA 4AXXA 2IPNA 2RGGA 4JR2A 3U62A 3ZW9A 1DKRA 2XH8A 3ZLUA 2EIHA 4K28A 4UMVA 5CYOA 4HNUA 4GF5A 3QUQA 1A5ZA 2D2VA 3QG1A 3QVSA 5TGTA 1I1OA 1E7SA 1JIVA 4M98A 2LGJA 2VRNA 1U2DC 3DC2A 3BRWA 4UM5A 4Y1RB 1KBQA 3U37A 3FOCA 4GQIA 1ULAA 2CLDX 4FJ2A 1MO4A 3P9NA 4KACA 3LQYA 5ECDA 2ZRMA 3F2VA 3QBTA 1TKCA 4DMMA 4H18A 2ZETA 1V6SA 2IQIA 4QWWA 3CXRA 3ESQA 5CDSA 4QZVA 1R64A 1DTEA 3QA3E 2B8EA 4RTNA 1T8SA 1YK1A 1L5HA 3RIYA 721PA 2IHTA 5ICFA 4O0LA 3OQIB 4BJ6A 1QG6A 4BFLA 4ISCA 2CXNA 3I5XA 2NN3C 5FTWA 5I7EA 2A5DA 4EX7A 2WICA 3OQVA 2P6OA 4RY0A 5LP6C 5L7TA 3Q7SA 2XCSB 2P90A 4IDPA 4C22A 4GLBA 4PBTA 5AESA 1DTWA 4NU5A 1O6ZA 1E89A 5B37A 3VMFA 4EY6A 1E99A 4BNGA 5JPIA 5CCEA 1DKLA 2MYTA 3LT4A 1F06A 5K0SA 2YXLA 1XKQA 2FW0A 3LWZA 1EP1B 1YCFA 3OCVA 4KE7A 5DTEA 3LA8A 3HHPA 4LZWA 3LM8A 5FYQA 4AKEA 2NXCA 3EGEA 2QLBA 4CETA 2D1YA 4RV4A 4N3BA 3R5KA 5A4AA 1NBHA 5ICGA 1A77A 1N2ZA 5J4HA 1I94B 3S55A 1IUKA 1VZ3A 2HSGA 2JCYA 4DREA 4JJGA 3OBBA 5IH7A 3TM4A 4FFVA 3ZD9A 2Y1FA 1PJRA 1CJCA 1V7ZA 3GN2A 5FFNA 1IN6A 2IP2A 4IZIA 5JARA 4OFWA 1KJYA 4MV0A 1PV1A 5CB0A 3Q88A 3SU8A 2IYTA 1Y9AA 1UBHS 3J81k 4W7HA 3EGCA 4XJTA 3GFOA 4X65B 1GSIA 1O6BA 2JEYA 2QX8A 2J85A 2ZS7A 4LOLA 1IBCA 2PZKA 4WUVA 5KREA 4QM6A 4OMUA 2FEWB 2GPSA 1W581 4XJXA 3PTAA 4GP9A 4PZZA 1T8YA 3V5NA 3WJ1A 3G49A 3WWYA 4BNIA 5AM2A 2GDJA 1YV9A 1ZD2P 2FUG1 1J8QA 2VVTA 5JROA 3R7WA 3U3OA 2IYQA 1Y7PA 1TQ8A 5JASA 4G0ZA 1VGRA 2P6PA 2QI9C 5CH5A 3GT3A 1RIFA 4JLUA 1U2RA 4QU9A 2G72A 2ZPTX 2WAOA 4GYJA 5A7GA 1NRJB 5TVKA 4MCIA 2YNMA 3DYBA 3RK4A 4A5OA 4RQUA 1ZNQO 5DI3A 1JAIA 3U3MA 3EZNA 3FTEA 3UNXA 1HYGA 2XDAA 4TOIA 4F4CA 4JJ7A 5BQFA 3I4CA 5EEGA 2VDKB 2D5CA 4HAVA 2ZVJA 2WUDA 2FSVC 4ZEOA 4YIKA 4JN6B 2VSOA 2F1RA 1CZKA 1PJ4A 2IYNA 3BZWA 3K6KA 4XOUA 1M0SA 3MWDA 4H7EA 4P4UA 1JJAA 2D7JA 1RPAA 4EG1A 1QF9A 1H2EA 3S8MA 2TMGA 5ERYA 1DUVG 1GPWB 2A9OA 3BOSA 3KQVA 3PQFA 1OX5A 4G4GA 5H80A 3WGGA 4KC0A 4FZ5A 3V1YA 1B16A 3OTGA 4MVJE 2YW9A 2QTAA 4D9BA 4D25A 2BEUA 3VI4B 4JJEA 5K51A 2VHZA 2DFKB 4J49A 3WSTA 2C31A 3JU3A 3KOUA 4R5HA 4XOIA 2VR1A 4R1MA 4BLTA 5CA1F 4JI7B 5THKA 1U7OA 1U63A 1XC7A 3N87A 4GI2A 3JQ8A 4R3UC 1QJCA 3NBYC 3GLUA 4IFBA 3BCHA 2R25B 1JIKA 3V9PA 4U3JB 3H04A 4PHTA 1AH2A 4X54A 2WF6A 5KZMB 1K97A 4X6LA 3ZDAA 4EBBA 3DONA 2C2WA 5LZ2A 3JAMA 1OSNA 3FDFA 4HFJA 2XOXA 1ZN9A 3CWCA 4WK0B 3LQRA 3SIPA 1H6AA 1Q0RA 4XJSA 2EBHX 4A8PA 5T6BA 4HDAA 1YR7A 2OO5A 5TDHA 3PF9A 1Q0QA 3LAWA 4G89A 3MCWA 3QEMA 4UU7A 1P6UA 1IY8A 1TYDE 4ILKA 5H5JA 3TVTA 4B47A 4Z9YA 2YQZA 4KOEC 5KOIA 4O5OA 2IEBA 3KJIA 1WXHA 2YUTA 1W96A 4E2FA 2H92A 3GLIE 4HGNA 2SHKA 3TLAA 1N8TA 2FDXA 2MINA 3AETA 4V0ME 1G60A 1JG1A 2OZLB 3B82A 3PHIA 4Q15A 4YP1A 4DT1A 4LZOA 2GTHA 4CMBA 1WV1A 3D6VA 1KMMA 1CRLA 2Y1DA 2O50A 4G0OA 5AKYA 4V3BA 4IIDA 5T4BA 2IWRA 4IKEA 3SKVA 4B4KA 5IHXA 5ED4A 4NZPA 3EH1A 3EXFB 1PUIA 1N6IA 4YP5A 1TUEA 2Z04A 2I80A 1GQFA 3K9BA 5E4TA 3SZOA 1OIWA 1OHHA 3VSBA 4YLYA 2W2TA 4BIMA 1H4TA 4HTAA 3RLIA 1GAJA 4DCCA 1UCFA 1Z13A 2FPIA 1KQ3A 4MWDA 2E6UX 4BTVA 3GQBA 3UG7A 1R9NA 2B8NA 2Q28A 3FFTA 4MS3B 4OIMA 4ZT6A 1QGED 4XM1A 4XI9A 5LBTA 4V0MA 2EDAA 5K3DA 4BVBA 3BWDD 1PIWA 1A3CA 2PCLA 2XB8A 3AUKA 4D8VA 3TXAA 1IHXA 2I1QA 2ZQZA 4IQ4A 4KHZA 1P29A 1G8YA 5T4HA 4Y2UA 3OZRA 4HB3A 4M9ZA 1CPYA 5EJMA 3ZCPA 1Z4JA 3DA8A 4U8GA 2VNIA 1G3UA 3C3JA 2P62A 3B1YA 3D7NA 3VKHA 3OO0A 4L1KA 4ZIRB 3P52A 1ZLXA 4GUDA 3MEQA 1NONA 2J30A 5G1PA 2VP6A 1FFEA 4KV9A 5LP6B 4KK4A 3MWYW 3KB1A 3BAZA 4HSGA 1SN7A 3K8YA 1OKKD 3IDFA 4ND1A 2H2GA 5DBEX 4PSAA 4B6QA 4C4SA 1G291 1E6CA 3JR7A 4P33A 5CTAA 1I4WA 4DV1B 1TCBA 1LA2A 3PEEA 4EHNA 1TEXA 3FOBA 2IV3A 4Q9DA 2OG2A 1ZOLA 2GILA 3KLMX 4DNQA 1JXMA 1XMIA 4EQZA 4JL5A 3A3KA 1XK6A 5KDDA 3CF0A 4B7ZA 1YZQA 3GG2A 2JVIA 4HRXA 5FBHA 1NKVA 3JZAA 4YO7A 3RJ9A 3JVEA 2H18A 4Y0NA 5LMZA 1C3XA 1XUOA 2C4NA 2Z8XA 3CNLA 1YJXA 2L42A 5AH0A 3AB3A 2J3JA 1TOAA 3SR0A 3EDQA 2BM8A 2CNBA 2HC9A 2K6GA 1SIBE 3E0QA 3TZKA 5EJ7A 1AZSC 4NZZA 4D41A 3WTCA 1SKYE 3QQ5A 3ZXIA 2O3UA 3WRWA 1AO3A 4MEAA 2Z9CA 1YMVA 1GRNA 5D85A 2XUJA 3ZI7A 3U7QB 3RHSA 7ABPA 2Q45A 1FTNA 1JDJA 1PWEA 4ENQA 1J8MF 5KWIA 5LKAA 2QW8A 3UJ3X 3HCCA 4N1AA 3VR6A 2CK3A 3VYWA 4CKCA 5AW6A 3PGMA 5GJWC 1YQ9A 4HLDA 2E82A 3TLZA 1YIAA 2IYZA 4J91A 4URXR 3ZJ4A 3C6YA 1P2VA 3JWHA 5E6SA 2YWRA 3S1SA 2RGBA 2Q1TA 5JTUA 4BLQA 1GQRA 1P72A 3IQHX 4U2GA 4OHXA 4WIAA 1VXRA 4OHBA 2EARA 2ZBQA 4OK3A 5FJIA 3MHTA 4NBUA 2GPWA 3SQDA 1C4KA 4YT4A 1GAQA 2PKXA 4EKIA 3A4TA 4IUBS 4NJMB 3MHPA 2E9SA 1NKSA 1PYDA 2R8ZA 2C57A 2CYCA 3I9V1 4DFDA 3K5IA 5TC4A 3DL4A 3AKEA 4PZDA 3ZV7A 3MLAA 4S1TA 4QYMA 2G17A 1UXJA 2IGTA 521PA 4RHEA 1O9HA 3GLQA 3FUTA 3L18A 4DUGD 5CDHA 1PRYA 1S01A 3A6JA 4IZOA 3NCHA 3R6TA 1NPTO 2FZWA 1FX1A 3CUTA 1X77A 2YOHA 3FLBA 2YNMC 4PWZA 3C45A 3FJYA 4N18A 1P3Y1 2CBGA 2MSEB 1B1AA 3TE7A 1KMNA 1FX0B 4HFMA 4PO3X 1L5LA 3VVBA 2BGLA 1P7YA 3L06A 2I1WA 4HN4B 5EHNA 3QLVA 4Q9NA 4MP3A 2W9XA 3EGXB 4NG5A 1NRXA 3ZQJA 1R0RE 2Y1KA 3GFSA 2BJVA 1FVFA 3COPA 1L7XA 4N9QA 3UN1A 2JLXA 2EW2A 2QN8A 1KO4A 2QM8A 2H59A 1B93A 1MC1A 3HMKA 5ITVA 5JR3A 4AU1A 2YINC 4L75A 1KQGA 2P9JA 4OU4A 5B1IA 4JROA 5HHTA 5JJBA 2YICA 4WERA 4WN3A 3KJHA 3WDMA 4XPIB 3QWBA 3SBXA 1NUQA 2DCUA 2HDWA 2MMCA 2VKTA 1EWVA 1TYAE 2JCSA 5AW2A 5IDQA 2HSDA 4FI3F 4ASUA 4LS3A 2NTNA 3FCYA 4PY2A 3GMDA 4KMMA 1L7AA 2AEMA 5CFZA 2QD4A 2B1QA 4U39A 4FYIA 1CUGA 2CE7A 3WZMA 1JZTA 4X92A 1CBUA 4NJEB 1QHSA 2IYLD 2LIPA 3A6KA 4R1PA 1NQOA 2Y4OA 3A9VA 4TS9A 2W37A 1ND6A 4Z2YA 4C14A 4DANA 1QLWA 2DAPA 3B48A 4QDUA 4QSMA 1LDBA 1PN3A 2GEBA 2ZIUB 1XP8A 1K4MA 4CMEA 1V4NA 3IKMB 4C4PA 3CU5A 4ARBA 4FZVA 2PSHA 3NATA 4OCZA 3A14A 3AUFA 4ZD6A 2YBEA 4CN9A 2FPGB 1GVNB 2OO5C 1Z2CA 1FFHA 3IELA 4OIFA 3OIUA 3T5DA 4B3JA 2W6ID 4UBKA 2PUDA 5AJZA 3VSEA 4IIXA 4PZYA 4B3IA 3R7DA 2B0CA 2I6SA 2FEAA 2O3TA 1SO8A 4QUGA 5K3SA 3ROFA 3JD2A 4YRIA 1AGYA 2G9VA 4J3FA 3OCZA 2A92A 1JN0A 2AMVA 1T3TA 1JL3A 2AQHA 3PR3A 4TLMB 5T5QA 1Z4MA 4BNTA 5B6JA 5A9SB 2BIFA 2AVNA 1Z56C 4A2CA 1QE5A 1D5WA 2CL5A 2HKIA 3DHEA 4JCCA 4BAGA 5A03A 2WU4A 3O75A 3N5CA 4MMYB 3QELA 4RFSA 1QMPA 4CV2A 3LRXA 2EWVA 2O0KA 3PFGA 4MDEA 4JP2A 3LQ4A 4XW2A 1NATA 5EHXA 3W5CA 1CC1S 2I54A 3EF0A 2PLWA 1BMFD 1ZCBA 4W5NA 1DC7A 1KWKA 1SIUA 3V7UA 4BB9A 4ZQCB 1J8YF 4Z51A 4M3NA 4BNVA 3EGOA 4KXFB 3W2HA 1U9IC 2HUNA 2ZRCA 3AFNA 4E7OA 1G4UR 3W4IA 4N3CA 3K8OE 1RBZA 2XMGA 4OQYA 1KTIA 1L5HB 3KNZA 3F98A 2IY7A 2FDCA 4BFUA 1BJRE 2FEXA 1E2LA 1UFQA 1NQWA 1FS6A 2JIMA 2XXJA 1T3GA 2GAJA 3SOZA 3L4JA 4XIYA 2ZU0C 4QUBA 5KQPA 1HKUA 3TBKA 1OMOA 1GEGA 3RW9A 1NLYA 1UPCA 1L7VC 1W2HA 4S1NA