3RLMC

Structure of the w199f maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 30
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rlmC00
2HKRD 2AGYD 2AH1D 1MG2B 3RMZC 2AGXD 2H47B 2IAAB 3RLMC 4FA1C 4FANC 2AH0D 2J56L 3SLEC 2MTAL 4FA4C 3SWSC 2AGWD 3L4MC 3RN1C 3C75L 4FA9C 2IUPD 2J55L 2Q7QD 3SXTC 4K3IC 4FAVC 3SVWC 3PXSC 1MAFL 3PXWC 3SJLC 2GC7B 2IUQD 3PXTC 1MAEL 3RN0C 2HKMD 2IUVD 2HJ4D 2J57K 4L3HC 2I0TD 2I0SD 2OJYD 4L3GC 4FB1C 1MDAL 2IURD 4L1QC 2OIZD 1MG3B 2HJBD 2H3XB 4Y5RC 4FA5C 2GC4B 2OK4D 4O1QC 2AGLD 2I0RD 2MADL 2OK6D 2HXCD 3L4OC 3ORVC 2BBKL 2AGZD
chains in the Genus database with same CATH superfamily
2HKRD 2AGYD 2AH1D 1MG2B 3RMZC 2AGXD 2H47B 2IAAB 3RLMC 4FA1C 4FANC 2AH0D 2J56L 3SLEC 2MTAL 4FA4C 3SWSC 2AGWD 3L4MC 3RN1C 3C75L 4FA9C 2IUPD 2J55L 2Q7QD 3SXTC 4K3IC 4FAVC 3SVWC 3PXSC 1MAFL 3PXWC 3SJLC 2GC7B 2IUQD 3PXTC 1MAEL 3RN0C 2HKMD 2IUVD 2HJ4D 2J57K 4L3HC 2I0TD 2I0SD 2OJYD 4L3GC 4FB1C 1MDAL 2IURD 4L1QC 2OIZD 1MG3B 2HJBD 2H3XB 4Y5RC 4FA5C 2GC4B 2OK4D 4O1QC 2AGLD 2I0RD 2MADL 2OK6D 2HXCD 3L4OC 3ORVC 2BBKL 2AGZD
chains in the Genus database with same CATH topology
2HKRD 2AGYD 2AH1D 1MG2B 3RMZC 2AGXD 2H47B 2IAAB 3RLMC 4FA1C 4FANC 2AH0D 2J56L 3SLEC 2MTAL 4FA4C 3SWSC 2AGWD 3L4MC 3RN1C 3C75L 4FA9C 2IUPD 2J55L 2Q7QD 3SXTC 4K3IC 4FAVC 3SVWC 3PXSC 1MAFL 3PXWC 3SJLC 2GC7B 2IUQD 3PXTC 1MAEL 3RN0C 2HKMD 2IUVD 2HJ4D 2J57K 4L3HC 2I0TD 2I0SD 2OJYD 4L3GC 4FB1C 1MDAL 2IURD 4L1QC 2OIZD 1MG3B 2HJBD 2H3XB 4Y5RC 4FA5C 2GC4B 2OK4D 4O1QC 2AGLD 2I0RD 2MADL 2OK6D 2HXCD 3L4OC 3ORVC 2BBKL 2AGZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKR D;  2AGY D;  2AH1 D;  1MG2 B;  3RMZ C;  2AGX D;  2H47 B;  2IAA B;  3RLM C;  4FA1 C;  4FAN C;  2AH0 D;  2J56 L;  3SLE C;  2MTA L;  4FA4 C;  3SWS C;  2AGW D;  3L4M C;  3RN1 C;  3C75 L;  4FA9 C;  2IUP D;  2J55 L;  2Q7Q D;  3SXT C;  4K3I C;  4FAV C;  3SVW C;  3PXS C;  1MAF L;  3PXW C;  3SJL C;  2GC7 B;  2IUQ D;  3PXT C;  1MAE L;  3RN0 C;  2HKM D;  2IUV D;  2HJ4 D;  2J57 K;  4L3H C;  2I0T D;  2I0S D;  2OJY D;  4L3G C;  4FB1 C;  1MDA L;  2IUR D;  4L1Q C;  2OIZ D;  1MG3 B;  2HJB D;  2H3X B;  4Y5R C;  4FA5 C;  2GC4 B;  2OK4 D;  4O1Q C;  2AGL D;  2I0R D;  2MAD L;  2OK6 D;  2HXC D;  3L4O C;  3ORV C;  2BBK L;  2AGZ D; 
#chains in the Genus database with same CATH topology
 2HKR D;  2AGY D;  2AH1 D;  1MG2 B;  3RMZ C;  2AGX D;  2H47 B;  2IAA B;  3RLM C;  4FA1 C;  4FAN C;  2AH0 D;  2J56 L;  3SLE C;  2MTA L;  4FA4 C;  3SWS C;  2AGW D;  3L4M C;  3RN1 C;  3C75 L;  4FA9 C;  2IUP D;  2J55 L;  2Q7Q D;  3SXT C;  4K3I C;  4FAV C;  3SVW C;  3PXS C;  1MAF L;  3PXW C;  3SJL C;  2GC7 B;  2IUQ D;  3PXT C;  1MAE L;  3RN0 C;  2HKM D;  2IUV D;  2HJ4 D;  2J57 K;  4L3H C;  2I0T D;  2I0S D;  2OJY D;  4L3G C;  4FB1 C;  1MDA L;  2IUR D;  4L1Q C;  2OIZ D;  1MG3 B;  2HJB D;  2H3X B;  4Y5R C;  4FA5 C;  2GC4 B;  2OK4 D;  4O1Q C;  2AGL D;  2I0R D;  2MAD L;  2OK6 D;  2HXC D;  3L4O C;  3ORV C;  2BBK L;  2AGZ D; 
#chains in the Genus database with same CATH homology
 2HKR D;  2AGY D;  2AH1 D;  1MG2 B;  3RMZ C;  2AGX D;  2H47 B;  2IAA B;  3RLM C;  4FA1 C;  4FAN C;  2AH0 D;  2J56 L;  3SLE C;  2MTA L;  4FA4 C;  3SWS C;  2AGW D;  3L4M C;  3RN1 C;  3C75 L;  4FA9 C;  2IUP D;  2J55 L;  2Q7Q D;  3SXT C;  4K3I C;  4FAV C;  3SVW C;  3PXS C;  1MAF L;  3PXW C;  3SJL C;  2GC7 B;  2IUQ D;  3PXT C;  1MAE L;  3RN0 C;  2HKM D;  2IUV D;  2HJ4 D;  2J57 K;  4L3H C;  2I0T D;  2I0S D;  2OJY D;  4L3G C;  4FB1 C;  1MDA L;  2IUR D;  4L1Q C;  2OIZ D;  1MG3 B;  2HJB D;  2H3X B;  4Y5R C;  4FA5 C;  2GC4 B;  2OK4 D;  4O1Q C;  2AGL D;  2I0R D;  2MAD L;  2OK6 D;  2HXC D;  3L4O C;  3ORV C;  2BBK L;  2AGZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...