3RM4A

Amcase in complex with compound 1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
373
structure length
373
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm4A01
1AQHA 3SCRA 3ZMRA 1HT6A 3L4ZA 1RPKA 3WN6A 5M17A 4AY1A 1AQMA 1R85A 5A8QA 3L4WA 4K68A 3VGBA 3AS3A 1BSIA 1OD8A 5A6JA 3UCQA 3OGRA 2VX6A 2YDQA 2J8GA 5GNYA 3WUGA 3VIGA 3AIWA 3OGVA 2J7DA 1CTNA 4CKQA 2WVVB 3CZEA 2CBIA 1E55A 1RH9A 3UERA 3UG5A 4HP5A 1B30A 5HPOA 2CBUA 4TOQA 4HA1A 1UR4A 3L4YA 4CN1A 4RE2A 3W24A 4B9YA 1X1NA 4HMDA 3PHAA 1R86A 5LYRA 4W8BA 3AMCA 2PB1A 4AZHA 3VIJA 2YLAA 3ZIZA 3VIIA 4JHOA 1CDGA 3NIYA 3ZQ9A 3VMNA 1B2YA 2J7FA 3CHFA 4GZJA 4ZXOA 3CIVA 3QHNA 3AHVA 1PIFA 3EBVA 5TD4A 1BTCA 1EDGA 1TG7A 1BVZA 1US3A 5EFDA 1CIUA 4UZUA 1J0JA 2RGLA 4W86A 2Y2WA 1FP9A 3M46A 4J3VA 4MJ2A 4MTVA 1VEOA 1XH2A 1G1YA 4D71A 2YBUA 1JFXA 2XVNA 1XYFA 2O9PA 3ZJKA 3CPUA 1QW9A 2JIEA 1EDTA 3TTQA 1W91A 3WKZA 3GM8A 1QI2A 1M53A 2DH3A 4Z2IA 2F61A 5ABEA 1G0CA 1C92A 2WMHA 4PYSA 4D6EA 4GIAA 1ODUA 1V0KA 3PZTA 1DEDA 2CITA 3OGSA 3AIEA 1B90A 4J7RA 1C3FA 3K1DA 3MSDA 2AAAA 4RL3A 1HVXA 2VZVA 4CD5A 1AMYA 1HJVA 2B31A 3UG4A 2ZWZA 3ZJ6A 3BCDA 1W1VA 2D1ZA 3ZR5A 4C7GA 2WHMA 4H2CA 1E4MM 3N13A 1JI2A 5ABFB 1JFHA 2QMKA 1W9VA 1UD5A 3PZOA 1Z32X 1GOKA 2BVYA 4ZE4A 1LG2A 1MVYA 5DT7A 1GQLA 3APGA 3RDKA 3RJYA 2WMFA 1JYVA 3K4AA 1UWIA 3VDAA 2V5DA 4C7FA 1EOKA 1K9EA 5D9MA 3HU7A 3WH5A 4PMNA 4GQRA 3EDDA 1HNYA 5CZKA 4BCEA 2RGMA 1J0ZA 1UWUA 3FHQA 1XSKA 1UR1A 2QPUA 3WDHA 1WDSA 3MMWA 1U30A 3GH7A 1UKQA 3QOKA 4CVWA 2CKSA 2A3EA 4ZFMA 1PZ2A 4ZEPA 4X0VA 3MMDA 5ABGA 1KR1A 1GOWA 3PZ9A 3WQVA 5IHSA 1KCKA 2VR5A 2W62A 3RPMA 5IHRA 1W3HA 1XD0A 2W61A 2BV9A 3CHCA 2WCAA 3BAYA 1WAWA 1MFVA 3EDKA 4ZENA 2O9OA 2FHCA 4GZEA 4LPCA 4U31A 4UFMA 1XGZA 4IPNB 3RM9A 3AFBA 3NJ3A 1HL8A 1HX0A 2BHZA 3DHPA 2FHBA 4DWSA 3RILA 1SYTA 2X0YA 2O92A 4OBSA 3NDYA 3VM5A 2A3CA 1AQ0A 4ZXLA 2V3FA 2C0HA 3O6AA 2VJXA 5AY7A 4FF5A 2XWDA 3MKKA 1KXHA 3ALGA 1G5AA 3T2PA 4W5UA 4JCLA 4Z2KA 1UWQA 3OB8A 1JXKA 1G01A 2J7BA 2E9LA 3DYPA 4HU0A 2J79A 3WNOA 3HJEA 3ZSSA 1UD8A 5I2UA 3MUY1 1KWKA 4D72A 2XJ7A 1Q6GA 2OWCA 4DUXA 1B3YA 3GXFA 1HJXA 4Z2GA 1DWIM 2FH8A 1IV8A 1NOFA 1E15A 1MW2A 1VENA 2WAGA 1HJWA 2VX7A 4P8XA 1GOMA 5BCAA 2WVTA 1C93A 5BRQA 4AZGA 3M07A 1EH9A 3F4VA 1FFRA 2GVYA 1OGSA 2JALA 3IK2A 3LPFA 4D6DA 3RMEA 3WD1A 1V02A 3DYMA 2YBTA 3M7SA 4MB1A 2UY4A 2ZUWA 1PX4A 3QR3A 3SCOA 3WL1A 2WSKA 3CTTA 4GO8A 5A2BA 1CGTA 2DDXA 3W26A 1OIMA 3N18A 1J0YA 5JIWA 1KR0A 1X6LA 5FCZA 4EE9A 5LA0A 4W88A 1E4NA 2VOTA 1MQQA 2WXDM 1QBBA 2W66A 2W4XA 2Y8VA 3OA5A 3WEZA 3WUEA 3ZT6A 1EO7A 2O9TA 1V3MA 5BXPA 4ACYA 3GDBA 4DWSB 3ZT5A 2D0GA 5A6BD 5CG0A 3POCA 3GYCA 2CXGA 4B9ZA 4XZWA 4L4PA 1VJSA 1MXGA 4AISA 4UQCA 1FH9A 2DSWA 1S46A 1B3WA 4TTGA 1H4PA 2ZXAA 2W5FA 1W9DM 1V6WA 4NI3A 5C8BB 2GSJA 3HN3A 4EK7A 1NWSA 3UETA 1OINA 3CMGA 1ZBKA 1MXDA 3AXXA 3W6MA 4HA3A 1N82A 2WB5A 1IZJA 4PMOA 3GXDA 3SUTA 4WK9A 2ZUTA 1TA3B 1HL9A 3AI0A 3VDHA 2J7CA 3DYOA 2QMJA 1M01A 1V6UA 1XRVA 1W2PA 1QI3A 1O6IA 1UOKA 1I75A 3LPOA 5F7UA 1R87A 3IANA 3U5UA 5FKYA 2ZUSA 3CUFA 4AWEA 3ZR6A 2ZX7A 1GVYA 3AS1A 5CGMA 2ZX9A 3GNOA 3WDRA 1E0WA 5I24A 2D0HA 1UZ1A 5D8WA 3VKKA 1DHKA 2D22A 3AISA 4C7DA 1OB0A 2GJRA 3SIMA 4J27A 3PTKA 5A6LA 1WZAA 2QV4A 2G3NA 5DEZA 1DWGM 1TMQA 4D6JA 4JFSA 5CPTA 3T0DA 4PUDA 1V08A 4H8HA 1WO2A 4TX8A 5AYBA 3BGAA 1QI5A 3BAXA 1CXHA 4S3KA 3W25A 4A4AA 1JIBA 2XFYA 1ZB5A 3FN9A 4XZBA 4H04A 4LQ1A 1ZJAA 3BMVA 2EBNA 4V2XA 4DM1A 2CHOA 1LL4A 1TVPA 1UZ4A 3A4AA 3AIRA 2XYLA 3N9KA 2J7HA 4WKHA 2WW5A 3RCNA 4IM4A 3PZMA 1TR1A 3MV11 3CUGA 3B9EA 3OBAA 4BQ5A 3EDFA 4UQBA 2VCCA 4GKLA 5CGTA 1VJZA 2PF0A 3ZM8A 4AW7A 4UFIA 3FY1A 3FNDA 4WKFA 1KGWA 2GK1A 4OOUA 4QLJA 2VRJA 4AIOA 3ARZA 1GUVA 1PZ3A 1E40A 4TX6A 1J9YA 2ZXDA 2E40A 5EBAA 4PUEA 4N0RA 3VD5A 3GBEA 1C7TA 1E6QM 3T09A 4W85A 3OIHA 5JBEA 4OKDA 1UR2A 2G3JA 1JAEA 5I6SA 4AIEA 5GNXA 3BXWA 5CLTA 1PPIA 4MAVA 1AVAA 3THCA 5I5RA 1VFFA 1MFUA 1U33A 2WANA 3WSUA 2OLHA 4PMRA 4GINA 2WMJA 3FXYA 1K6AA 2AMGA 1E56A 4W87A 3WNLA 3UESA 2CHNA 1DWAM 1BLIA 4ACZA 1H5VA 3T2OA 3ARYA 5AYIA 1QI4A 2XVGA 1BYDA 1V3JA 2XM1A 2XWEA 1R7OA 1J0HA 2EPOA 3AIVA 3SUUA 5D8ZA 4MNLA 2VURA 9CGTA 1CXEA 1E70M 5EFFA 5A2AA 1LWHA 2QF8A 3PZQA 2UY2A 1QNSA 3WY1A 1UA3A 2WMKA 3AHYA 3SCNA 1Q6FA 5FL0A 4TXEA 3VIPA 1H11A 3WDJA 4AMCA 1RP9A 4DUWA 1U2YA 4MB5A 3ZJ8A 1P6WA 2XGIA 5BYWA 1EOMA 3WUBA 1HJUA 2BY1A 4W7UA 1UR8A 2W91A 4J3UA 2XVKA 2FHFA 3UR7A 4AEEA 4W5ZA 3AMDA 3WMSA 4LYPA 3BAJA 3UR8A 3AXHA 4M56A 4PTXA 3II1A 3MANA 2YA2A 2GJPA 3E1F1 5DT5A 1ISZA 4D6GA 2BS9A 4A3YA 3SUSA 4UOJA 3GBDA 4LGXA 1BYBA 4HZ7A 4WKAA 4TTUA 3F5LA 1F4AA 3TP4A 3ZOAA 1JZ5A 1HKJA 4UCFA 1JAKA 2V3DA 1EO5A 1B1YA 1BG4A 3CHDA 3ARPA 2IUZA 2BFGA 5FD0A 1GVIA 2GDVA 3ARUA 3CUIA 1J01A 2DGAA 3WD2A 4RE3A 4QDMA 1PEZA 3WQ6A 1OCQA 3A47A 1QNRA 4HZ8A 4UQEA 1W1TA 4HA4A 1GQKA 3A6OA 4OIFA 5DMYA 4MB3A 3AHZA 3GH5A 1W2VA 1UKSA 4OBRA 4CCCA 1E1FA 1J11A 3SCPA 2VT0A 2YL6A 3CZJA 1KGUA 5DO8A 4V28A 3WDIA 3M6DA 3ARTA 2WVUA 4GI6A 4NF7A 2PBOA 5BROA 3AQUA 2WC7A 5D4YA 7A3HA 3TA9A 3VU2A 1HXJA 2D3NA 4MNMA 5CQ1A 3VIOA 3AZRA 3W37A 3VX0A 5IFTA 3ARRA 4BF7A 1WZMA 4P7LA 3ARSA 5E0CA 1VBRA 3IJ7A 2YKKA 1HKMA 1W1PA 5M3WA 1EHAA 2OSYA 5I23A 1GJUA 1GOOA 4URIA 3CLWA 2EO7A 1LQ0A 1CYGA 4HMEA 8CGTA 3CH9A 1YHTA 4JCMA 2JF6A 1W9BM 1JNEA 4UFJA 1E4IA 1V3IA 3ARQA 1ECEA 2DH2A 1WE5A 3CUHA 3NDZA 3LMYA 1B3XA 3FW6A 4GO9A 2G3MA 4DM2A 3UG3A 3SCVA 3L4XA 2G41A 1MW1A 3MUAA 1D3CA 4QP0A 1UQYA 1JF5A 1NM9A 4J3TA 4U3CA 2CBJA 2QHAA 2D23A 4KGJA 1GCYA 1BGAA 4FLQA 3SCUA 4PTWA 4CD7A 4PMXA 1BHGA 2YDRA 4F9DA 3KEHA 1QPKA 2EXOA 1CLXA 4OZOA 2J47A 2Z1SA 1OIFA 4CCEA 2HVMA 3AMKA 1QNPA 4M29A 5CLWA 3WNKA 4MJ4A 4PRWA 3QHMA 2BXZA 1QW8A 2WZHA 5A69A 4QAWA 4U2ZA 2XG9A 4B3KA 4U33A 4Z2LA 3K8LA 2XIIA 5D9NA 4X0NA 1UR9A 4XUYA 4PN2A 1QHPA 1V3KA 2CBVA 1H09A 1SFSA 2WCGA 4HPHA 3VIMA 5C71A 3EYPA 1NWUA 2UY5A 1MW3A 2ESCA 2G8ZA 2D24A 2VUYA 4CD8A 1UKPA 3WD3A 2YL9A 1BGGA 3O2LA 1H1NA 2YLLA 1CGXA 3QOMA 1BQCA 3AIUA 2WWCA 2YOCA 3CZ8A 1UG6A 3WQ8A 2G3IA 1NWTA 3L4UA 3HMCA 1KXVA 4CUCA 3AHTA 1UKOA 4MDPA 1E71M 1ODZA 3RO8A 5DFAA 4E8DA 4MNJA 1B0IA 3BLKA 1E5NA 2E0PA 1WDPA 2XGBA 3WMBA 3PZGA 2WVSA 1V6VA 2WC3A 1C7SA 4PSRA 3CUJA 2MANA 1ZBVA 1H2JA 3CMJA 5JUVA 3NSNA 4ML4A 1MWOA 1UD4A 5AC4A 1PBGA 1UUQA 3L4VA 2OSWA 2VI0A 4BZYA 4W84A 2D20A 5HOSA 2PC8A 3FHAA 2DSUA 4CN4A 4S3JA 1Y7VA 5A2CA 1XD1A 4J3SA 4UFHA 1JL8A 4AD0A 2WZIA 5LA1A 4F66A 4UQDA 1E73M 4U3AA 1NWRA 5A6SA 2D2OA 1NQ6A 3PZIA 1E0XA 4NZCA 3RIKA 1VFOA 4UQAA 1UWTA 2X05A 1TVNA 5A6AA 5A3HA 1LG1A 2JF7A 1GJWA 4UOZA 5CSYA 2ZOXA 3ARVA 1KBKA 4QFUA 4FLOA 1HKKA 4EKJA 3NCOA 1UD2A 2NW0A 1E72M 3VM7A 2VX5A 2W67A 1G94A 1QHZA 2ZX5A 1KWGA 1XSJA 2JEQA 2F8QA 3OZPA 1V3HA 4R27A 5A95A 3W82A 2WMIA 4W93A 1ZJBA 3VGGA 4TVUA 3ARXA 5A94A 3ZO9A 1JYXA 1H41A 2JFEX 1OWQA 5E6ZA 2WYSA 1VBUA 2F2HA 3WH9A 2CCRA 1LF1A 1JYWA 5A8PA 1V6YA 2PI6A 2XFFA 3POHA 2OSXA 2EPKX 4U5IA 1GPFA 4E8CA 1V02E 3RJXA 2YL8A 1MQRA 4HOZA 5IDIA 3B9AA 1EHNA 1QVBA 4J3XA 1QI0A 2CKRA 3WBEA 1CGUA 1UQZA 1US2A 3CHEA 3S6TA 3L2MA 3TTYA 3IAQA 1JG9A 4E4PA 1CGYA 2OYMA 1OM0A 4Y7EA 3F5KA 4UFLA 3FAXA 2D3LA 6A3HA 4M24A 4X9YA 2OYLA 1M7XA 5I79A 4PTMA 1JD9A 2OYKA 5GPRA 6TAAA 1PX8A 1EQPA 4H8UA 4JIEA 3AROA 3LPGA 1E5JA 1OT1A 4P7RA 5A1AA 3VMPA 1M03A 4CVUA 1EGZA 3L4TA 4XX6A 1NP0A 3EMCA 5A8NA 1W1YA 4PEEA 2WSPA 4NRRA 1NP2A 1A47A 4UTFA 4F79A 2BY0A 3WNPA 2CNCA 3W29A 2WLYA 1CBGA 1LWJA 2ZIDA 1H3GA 1BPLB 1UH2A 1OBAA 2J7GA 3U5YA 1IZKA 5A6MA 1J12A 2J7EA 1UWRA 1KXQA 2E9BA 3EMZA 3WH6A 4PTVA 3CBWA 1V0MA 2XPKA 2CYGA 2NT0A 1D2KA 6CGTA 4CU7A 4D6CA 2G4FA 3U57A 2PWFA 4PBGA 4PCTA 4JFTA 2Z1KA 3CGTA 4MAZA 4W89A 5HXMA 4J3WA 1H0GA 5BXTA 3AHXA 1HIZA 4AZ5A 2DT3A 2WHKA 2XM2A 2XHYA 1V0LA 4M80A 3LPPA 1K9DA 3OLGA 1W9UA 1UKTA 4LXFA 2YDSA 3WMCA 1GONA 1WNOA 1BYAA 2BHYA 3GH4A 3W28A 3W4RA 1XCXA 2X2YA 1Q6DA 3SURA 1B3ZA 4H41A 1C8QA 1KXTA 4HPGA 2WVVA 4W7VA 3T0BA 3TONA 1KBBA 2WM0A 4JKKA 2Y8KA 1I1WA 4AZ7A 3GNRA 4AC1X 5HNNA 3N17A 1ITCA 1FFQA 1EIBA 4AZCA 3WF4A 2ZUVA 4JL2A 3T0AA 4JL1A 3TTOA 4UNIA 2Q8XA 3GXMA 1WPCA 1PJ9A 3PZUA 1E6NA 2X8RA 1TCMA 3RM4A 4JFUA 1GZJA 1NH6A 3VGHA 3WFZA 1W3JA 4HU8A 2BVTA 1CZ1A 3U7BA 2VR4A 3WBAA 2Y24A 3OLDA 4KRUA 2UY3A 3JUGA 2ZUMA 2DQXA 1X6NA 2X09A 5D9OA 3AYRA 3K4DA 1XC6A 3A3HA 3VOCA 5A6BA 2ZUNA 4AD5A 2HISA 1QOXA 3VIHA 1LJYA 2GK1B 2WZEA 3RM8A 1B3VA 1XHGA 1WDRA 4PMZA 1PX3A 2V3GA 5ECUA 5CPQA 2Y4SA 1GOQA 4AD1A 1Q6EA 1VFMA 3N04A 5DF0A 3VD9A 1O7AA 3A4XA 2X0HA 1OGGA 4ATDA 5HBFA 3N1AA 1E9LA 3QHOA 1VIWA 1CPUA 2VO5A 1VAHA 2ZX6A 2GJXA 2OWWA 1QBAA 4DWSD 1CLVA 2VL4A 4AZBA 1J18A 3VUPA 1BFNA 1ISYA 1LLOA 2IXUA 4NSBA 4YN5A 1VFUA 1KCLA 3U7VA 3MV01 4GI9A 4MNKA 2BXYA 3AICA 5BRPA 3BCFA 1MYRA 3D5HA 3K8KA 3VD4A 3VO0A 3SCWA 4F9JA 3OLEA 3WF1A 5I78A 1ISWA 3ZSTA 4ACZB 2CPUA 3WELA 1UH4A 1WZKA 2BHUA 1KFWA 1W9XA 4QCEA 5ABFA 3BAKA 4ATLA 4AZCB 2V3EA 1CNVA 3OLIA 1A3HA 3VGEA 1DTUA 1JNDA 1EDQA 2EPNA 3WENA 2ZX8A 4KWUA 3ARWA 3UEQA 2GUYA 3EDJA 2VRQA 3WF3A 1JDDA 5I77A 1DWFM 1UYQA 3GTNA 3IAPA 7CGTA 3BLPX 1W32A 2CEQA 3F5JA 2J62A 1UD3A 1UWSA 3PZVA 5KZ6A 4B3LA 3VINA 3PBGA 4U5KA 4OJYA 1XV8A 3BH4A 3L2LA 2XSAA 3VIKA 4BA0A 1V0NA 1WZLA 1YQ2A 3W53A 4A3HA 4WSJA 3B8SA 4LYQA 4Q22A 7TAAA 3WEMA 3MS8A 5JBFA 1CXFA 8A3HA 4AZ6A 4B16A 1BAGA 5GQBA 4PMQA 2PWHA 2WMGA 1E3XA 3NUKA 5KEZA 3VDBA 4AEFA 1ESWA 4L4OA 1W3LA 1ISXA 2DIEA 1BVNP 3GNPA 4JHZA 4N42A 5A6KA 4DWSC 5A8OA 1GHRA 2W92A 2DEPA 1QHOA 1B31A 2CETA 4KMQA 2C8NA 4UQ9A 2WNWA 1L8NA 1NOWA 4UZSA 5E6YA 2E3ZA 4MADA 1I1XA 5CJ5A 1ZS2A 2GJXB 1FH7A 1H49A 2DIJA 3VX1A 4IISA 3CZLA 1E0VA 4TVDA 3BAWA 4P7NA 2CERA 2ZICA 3VIFA 3WH8A 1MQPA 1OSEA 2BY2A 2VC9A 2FGZA 1ITXA 2BY3A 1HVQA 2DSKA 4CD6A 2ZWYA 1JZ3A 2UWFA 3WNMA 4PMDA 3W81A 3WH7A 2ZE0A 4W7WA 2YA0A 1FHLA 4M82A 1DWHM 3AJ7A 4ATWA 3WD0A 2XFRA 1XYZA 1JF6A 5BWFA 4R5EA 1CENA 5BXSA 1NOUA 1TE1A 4WLCA 4KGLA 4FK9A 4JFWA 2DT2A 2WWDA 1E4LA 5GNZA 1HF6A 1OGBA 3SCSA 2PWEA 5JIPA 4UOQA 3AIBA 1HJQA 2TAAA 4QLLA 3I3EA 1MW0A 4UFKA 4GI8A 1ISVA 3BMWA 1JI1A 4PMVA 2FGLA 3AYSA 5CPSA 4Z2JA 3I3BA 4B15A 4P8VA 4AYSA 3B9DA 3PZNA 4HMCA 1HP4A 2WK2A 2W63A 1CXIA 4DUVA 4QCFA 3WEOA 1JZ2A 2VCBA 2J8FA 5CSUA 2WBKA 3WQ4A 5AC5A 3KL5A 4PMYA 3MO4A 4MB4A 1CWYA 1FA2A 3MU7A 1UA7A 3VVGA 1XCWA 4XB3A 2WC4A 3MUIA 1JDAA 5E70A 4YPJA 3N11A 1J10A 4BQ2A 1V6XA 2NSXA 2WHJA 2V5CA 3VMOA 1GQJA 5EB8A 2J75A 1JD7A 5EMYA 1BG9A 2E8YA 4ZE5A 5ABHA 1JZ8A 4AXNA 3TOPA 5I3DA 2VZTA 4M81A 2VZOA 3AZTA 3DC0A 2NT1A 3WL0A 1C91A 4W8AA 1EA9C 2GDUA 4JFVA 3WD4A 2J25A 2O9RA 1L0PA 2XUCA 3WIJA 2CESA 5FOOA 4TVCA 3MUZ1 1G9HA 1WCGA 1VEMA 2FH6A 2BNJA 3W38A 4EAMA 1CECA 4AD3A 2J4GA 2IXVA 4CN6A 2D0FA 4P8WA 5E9AA 1KQYA 1TA3A 1GQIA 1GNXA 3SUVA 3CO4A 2WHLA 5HDRA 1V3LA 1V03A 2WPGA 3ECQA 5E09A 4AIUA 3IJ8A 4J28A 1FP8A 1F4HA 3OG2A 4OOZA 2ZXBA 1TUXA 1WDQA 1FOBA 1K9TA 3BC9A 1UHVA 1E6SM 2CIPA 4PMUA 3T2QA 1PIGA 2XVPA 3KZSA 1EXPA 1PAMA 1TZ7A 1UR0A 1FHDA 3WDPP 3WDQA 3VILA 2OWXA 2XTKA 2XIBA 3NYDA 3CZKA 4GQQA 1R8LA 3VGDA 1CGVA 1H0IA 1ZL1A 1E6PA 1WB0A 4CU8A 1DP0A 4UR9A 2XVLA 5D9PA 2VCAA 2AOSA 2Y5EA 3WFLA 1TFVA 3WF0A 3IJ9A 2FDMA 4GXPA 4YHGA 4PCSA 4U2YA 1JZ6A 1NARA 5M03A 1SMDA 5I0DA 2E8ZA 1LL6A 4FLRA 1ZBCA 3MMUA 1ZBWA 3BSGA 1Q4NX 1JYNA 1WP6A 4AZIA 2VVSA 2J74A 2DSZA 4TUFA 1JZ4A 4H7VA 1VB9A 1UH3A 4HZ6A 4JKMA 1HKIA 3KWXA 3PTMA 4AD2A 4Z2HA 1CXKA 3VD7A 4HTYA 3VNYA 3AIQA 2QLYA 1SR0A 2JE8A 5A8MA 2WBGA 3QGVA 3MSGA 2DT0A 3WF2A 3FAWA 4CD4A 1VRXA 3SCTA 1OD0A 2VVNA 2DSVA 2DT1A 1BF2A 3BSHA 4MPKA 3OZOA 3W0KA 2PWGA 4BQ4A 2PBGA 1JXJA 2WLZA 3EDEA 1DWJM 1E3ZA 2EJ1A 3VGFA 4WF7A 2ZXQA 3SCQA 1EQCA 3VDCA 4E2OA 1KGXA 5C70A 3DECA 1KB3A 3D3AA 5IFPA 2ZUUA 2E4TA 3VTRA 2A3AA 1C8YA 3GXIA 4CU6A 3SEPA 3K46A 4WIWA 1HJSA 4F8XA 1CXLA 1GW1A 4D6HA 1C8XA 1UD6A 2YA1A 1E6RA 4CGTA 3AZSA 4JZ5A 4M1RA 4HOXA 1D7FA 2WMIB 2YJQA 1J0IA 3N12A 4JKLA 2JEPA 1HP5A 3KE0A 4QLKA 1M04A 2J78A 4D6IA 1QNQA 1E43A 4YHEA 5E0FA 1GORA 2XSBA 1FH8A 2VRKA 1QNOA 4H8VA 4V27A 5M5DA 3ALFA 3AXIA 2JIWA 3O9NA 2VQTA 3W27A 1XH1A 4WSKA 1B9ZA 4IUGA 4PSPA 1XSIA 3KL0A 1R7AA 1GOIA 3NSMA 1K9FA 1LL7A 2A3BA 1Q6CA 2EPMX 4GPNA 1VEPA 2X1IA 4P8UA 4FLSA 3I3DA 4LX4A 3EMQA 4KH2A 4P7OA 4LYRA 2WCSA 1WKYA 1C90A 5BXRA 3K8MA 4P7QA 2VTFA 4KRTA 3SUWA 2E9MA 3BAIA 2GFTA 1ZU8A 3GZAA 4BQ3A 1CGWA 2VZUA 1IT0A 1HN1A 4D1JA 3PTQA 3AS0A 3AMLA 4XV0A 3N15A 3ZJ7A 5JH8A 4EANA 5HPCA 1XH0A 2VMFA 4IPLA 4WJXA 1OT2A 4MDOA 3KL3A 4D1IA 4NRSA 1W3KA 2PWDA 3WQWA 1SMAA 3VNZA 4CCDA 4D6FA 3AS2A 3THDA 1VF8A 5CXPA 3CZGA 3WNNA 1GHSA 3VPLA 2A3HA 2EEXA 2YIHA 5LA2A 2BVDA 3J7HA 1JZ7A 2VX4A 1JGIA 5JBDA 3VD3A 4GZIA 4RE4A 1E6ZA 4JAWA 3DHUA 3ZT7A 5FL1A 3T08A 1CEOA 2VZSA 1RP8A 3G6LA 3W6LA 3A4WA 4M8UA 1RD6A 1KQZA 2C7FA 1E6XM 2EQDA 2QPSA 5FIPA 3WUFA 1JDCA 3TTSA 3NSXA 4BS0A 2WKGA 3WQ5A 4AD4A 2J77A 2VNCA 4FMVA 2DPEA 3AOFA 3PN8A 1BYCA 2EPLX 3G6MA 2YL5A 4HOWA 2V38A 5IXEA 4OUEA 2WKLA 2VQUA 1J0KA 1W9PA 3S2CA 3AMGA 1E1EA 4W8LA 4Q7NA
chains in the Genus database with same CATH superfamily
4OECA 1QMLA 2Q8LA 3ZMRA 1AQHA 1XFCA 5FAGA 1MI3A 3L4ZA 3LTSA 4P5UA 1I2PA 3B0PA 2G96A 1RALA 1RPXA 5AVNA 4LNCA 1R85A 3WQDA 3BCJA 4JTSA 3VGBA 3AS3A 1BSIA 3UCQA 3U4FA 4Q6JA 4Q7BA 3P82A 2ONEA 1PE1A 4GC3A 4XZLX 2CBIA 1RH9A 4OT7A 1V93A 3F4WA 5LNWA 2R24A 4KWWA 1FWTA 4F0RA 4J35A 3L4YA 3AXMA 2IQDA 1R86A 4AZHA 4DJFC 3ZIZA 4JN6A 1CDGA 3O7UA 4TV5A 3BOLA 3TR9A 1XLKA 1B2YA 3O5DA 3GHUA 4FX8A 3XINA 3E2SA 4ZXOA 4HD5A 1OCJA 4DRSA 1M5YA 5ENLA 3SSJA 3QY8A 1EDGA 1TG7A 5H91A 4Z0SA 1BVZA 1US3A 4UZUA 3R8HA 1J0JA 2RJHA 3ZVIA 1NDVA 4MJ2A 1VEOA 2F9RA 3ANVA 4HHHA 4RV3A 1RXOB 1N7KA 4HNCA 4D71A 2HE8A 4IT6A 1A0DA 2O9PA 2BOGX 2JIEA 1DORA 4YXGA 3TTQA 1T11A 2VC5A 3WKZA 1ZY9A 1YPXA 2F4EA 1M53A 4H6QA 1B57A 4EP8C 1VLWA 3PZTA 4S1FA 3K13A 2CITA 2GPTA 4NT0A 3AIEA 3K1DA 2Y5JA 4RL3A 1W54A 3VAWA 3E0FA 2AL1A 3UG4A 3WQCA 4GXMA 3BCDA 4A3RA 2CZDA 1OX5A 2D1ZA 3ZR5A 1UPMB 2WHMA 4H2CA 3UWUA 4ITZA 3GSMA 3ZLGA 3N13A 5ABFB 4IP5A 4IG2A 2DUZA 2BVYA 1LG2A 3EA2A 4EPKA 4X2RA 1GQLA 3APGA 3RDKA 5LIKX 2WMFA 2V2CA 3D46A 4IMAA 1K9EA 1TPUA 5D9MA 2A7RA 3AJXA 3FGCB 3WH5A 1DJYA 3EDDA 3RPDA 4BCEA 4C6IA 1W5QA 3FHQA 2I16A 1UR1A 2BOFX 1IYXA 1EWDA 2HBVA 3GH7A 1UKQA 4G8TA 2CKSA 3NOEA 4V15A 1FWGC 2V5LA 4NNCA 4PRTA 1A7XA 3MMDA 5ABGA 1KR1A 1SSDA 4R7WA 1F3TA 4C6KA 4QT2A 1I0BA 1FWRA 3Q67A 2BV9A 4GYPA 4K36A 4NZ3A 2M1IA 4M1BA 1XLLA 2AQWA 1WAWA 4ICCX 4ZENA 2PMQA 3OYZA 3LS9A 4AWUA 2C6QA 1OFOA 1EUAA 1XGZA 4IPNB 3ZWSA 4MWAC 3P62A 4EX4A 3QLLA 5C9RA 1M7JA 3UWEA 3FYOA 3BMXA 4JOMA 2B7OA 2Q3OA 4DWSA 1SYTA 3AUOA 1GVEA 2X0YA 3UY7A 4XTDA 3NDYA 3C0LA 3CL6A 4GUIA 2A1YA 4DT4A 3N9SA 5BZAA 3HIJA 1G5AA 3CU2A 3ITVA 4JX4A 3G5EA 2C15A 4Z1DA 3OB8A 5FACA 2G37A 3LRLA 4B5XA 2E9LA 1TQXA 2ZQ0A 2J79A 4IJCA 3HJEA 3SDOA 3NR0A 4N02A 4BK9A 1UD8A 3ID7A 1J4HA 3A3XA 4D72A 1Q6GA 4DUXA 1DJQA 4HK7A 4UTMA 4C91A 3MSYA 4R0XA 1AW2A 3WQEA 2WNQA 1E15A 1MW2A 1TPWA 1GOMA 5T9CE 2ZA2A 1XLJA 5BCAA 5F1VA 4HNNA 2HK0A 3NQEA 1PCKA 3F4VA 1UWAA 3TEVA 1OGSA 3IK2A 3LPFA 3PWIA 3NZ1A 1AMKA 3U2OA 5H1WA 1T96A 4CNOA 4K1GA 3MBFA 4PR4A 4HPXA 4GWEA 4Q8NA 1PKMA 3TC5A 3FDGA 4PC8A 3G0SA 5G2HA 1KR0A 4PMJA 2LJ4A 3P84A 2Z25A 5FCZA 4EPEC 4WGXA 1Z6KA 2VOTA 1QBBA 1EO7A 3KOXA 5BXPA 3KTXA 5CG0A 4KWVA 3V16A 2P10A 4N7QA 4XZWA 2P0IA 1F9CA 1FH9A 1S46A 3FIGA 4Z0JA 3I4KA 2VUNA 2WZMA 3HN3A 5CEWA 5I3FA 4C6FA 3UETA 3VK5A 1ITUA 1OINA 3CMGA 4NP7A 1VRDA 2ETNA 4F0SA 1IZJA 3HBLA 3QN3A 1HL9A 2QMJA 1TZZA 3IVUA 2QCCA 4JDYA 4QEHA 3REQA 4RPPA 2XP4A 3CQHA 1Z9AA 1MRQA 4GVHA 1UOKA 4XD5A 4XKYB 2V0TA 1DYSA 1R87A 2QCMA 5FKYA 2J6XA 2ZX7A 3VZZA 2ZX9A 3VNJA 3WDRA 5I24A 1T6MA 3KWSA 1I4NA 2D22A 2J8TA 1OB0A 4F3HA 2GJRA 2ZRXA 3NA8A 3PTKA 3H2AA 3LGEA 3T78A 2G3NA 2GWNA 2FIQA 1PKLA 3DG3A 3ORWA 3TLLA 1ZFJA 4NL1A 4H8HA 3GK0A 4O19A 5AYBA 1CXHA 2XP5A 2P3ZA 1P0KA 2XFYA 2ISSA 3GE7A 4XZBA 1WOBA 4R9XA 1LL4A 1UZ4A 3N9KA 3THAA 2Y7FA 3GXTA 2YFNA 3JRKA 3CUGA 3T42A 3G1VA 1NDZA 5CPMA 1XPYA 3EDFA 1UROA 2VCCA 1VJZA 5D04C 2BWGA 5A8GA 4M0XA 3FNDA 1KGWA 4JFJA 4OOUA 1FWAC 1RA5A 4AIOA 5DY2A 7ENLA 4H7ZA 2E40A 1IXNA 4LS0A 3GBEA 1E6QM 1IGSA 2Q5AA 3T09A 2G3JA 5HWMA 4MKSA 3C0QA 3PC0A 1IEVA 1J6YA 1TWZA 1BSLA 5CLTA 1PPIA 4JTFA 2PDMA 3ZYZA 1MUWA 3N4EA 1R3WA 5HW7A 3ES7A 3A64A 3ENLA 2Y7DA 3FXYA 3DDMA 3WNLA 2Z2BA 2TYSA 3FXGA 3IWPA 3L67A 4I9JA 2I57A 1DWAM 3LYEA 4ACZA 4L9ZA 3ARYA 3TYAA 4FAMA 1QI4A 1BYDA 2E5DA 5FJTA 3TQVA 4FP1A 1TX2A 1NFBA 4N2YA 3EPMA 3W7HA 1S1RA 2VURA 1P6CA 3LBMA 4L61A 5A2AA 2NQZA 4Z42C 4XD3A 4HSHA 4OHQA 2PDGA 4L1XA 3SCNA 3HM7A 1XR2A 3UT0A 3GIQA 4TXEA 4G1NA 3WDJA 4AMCA 3KS6A 3MCMA 4N9CA 3NQGA 1L9WA 1W5MA 4S2BA 4DO7A 4MB5A 2UZ5A 5LXXA 2XGIA 5BRBA 1EOMA 4YU1A 1HJUA 2A6NA 2QT3A 1XFBA 1P5QA 3LCGA 3MI6A 3UR7A 5C2GA 3WMSA 1RJPA 3UR8A 3A9BA 3AXHA 4M56A 1NMWA 1KFKA 5HMEA 4FNSA 3E1F1 1DE5A 2HVNA 4D6GA 1CCWB 2BS9A 3SUSA 4S2CA 4HZ7A 3HURA 2X40A 4TTUA 3F5LA 1OFEA 3ZOAA 2V68A 1JZ5A 4UC5A 1HKVA 4YTTA 2PPPA 3G0UA 4ODPA 3UZZA 4RW3A 3ARPA 1EBHA 1M3UA 5FD0A 3C6CA 3WK1A 4KCVA 1GVIA 2GDVA 3I6TA 5JMUA 4GYKA 4YVPA 1Q85A 4IFOA 1FKGA 3CV2A 4ODLA 1JCXA 3CO8A 1W1TA 2VCDA 4HA4A 1GQKA 3TK7A 3OVPA 3QV6A 1XC4A 3UWQA 3L0GA 2RDUA 1IIHA 4CCCA 4WGHA 2YBVA 1FVPA 2I7GA 4WQ6A 1TWIA 1KGUA 4C6CA 1PS9A 3C4UA 4F2UA 3NEHA 2DUXA 4NF7A 2WC7A 5EMLA 1KV8A 1VCVA 4MNMA 3VIOA 1VS1A 2GGHA 3WBXA 3GTXA 3H4XA 4HKPA 1UOZA 4P7LA 5CJNA 3ARSA 1B5TA 1R9XA 4JTJA 4LY8A 1H61A 3CV7A 5M3WA 1VH7A 1Y5VA 4GY7A 3WJXA 2E6AA 3LXAA 2EO7A 3OIXA 8CGTA 3CH9A 3ISIX 1Q7ZA 1W9BM 1JNEA 1I8JA 5LIUX 1V3IA 2JKAA 3IHZA 5LIWX 4CNPA 2DH2A 4WDUA 4QIUA 3KBSA 4S3BA 1UJPA 5BU6A 3IS4A 4RNHA 3UWWA 3CMFA 3BGJA 3TUUA 3MY9A 1YDVA 2XH0A 4DBUA 1B3XA 3FW6A 4M6QA 1LROA 2PDBA 5DBTA 5EMKA 1DJHA 3M1ZA 3W9ZA 2D23A 4FLQA 2MNRA 1DJGA 1JPMA 4B5TA 4PMXA 3EZ4A 4ZVJA 1IEWA 4Z17A 3FAPA 1QASA 4Y9NA 1QPKA 4H2HA 1ZZMA 2PDJA 2TMDA 3S6DA 1IIGA 3HG5A 2HVMA 3GG0A 1QNPA 4KIEA 3EKZA 4HK6A 2TRSA 1ROTA 4YYFA 5HMSA 3QHMA 4QAWA 1U1UA 3TX9A 1UC5A 1QATA 2XIIA 5D9NA 4PN2A 1IXOA 2KO7A 3N6QA 1XXXA 4ZL1A 2WCGA 3VIMA 4I9TA 5C71A 2HK1A 3KVLA 1MW3A 1PCWA 1UW9A 1EC7A 2D24A 3CASA 4A05A 4CD8A 1T7LA 4LFYA 5DCDA 4A35A 4POCA 2YL9A 4JY9A 4IIHA 3SQSA 4DZ2A 1O95A 1BQCA 1FCUA 2YOCA 3CZ8A 1Y5WA 4FR1A 3L4UA 4NHVA 1F6YA 2R6OA 3AHTA 3SW6A 3RO8A 5DFAA 5MF5A 1M7OA 2PCEA 1PBKA 5BMWA 4NYUA 1WDPA 2XGBA 1DJWA 1U1JA 1AJ2A 2FKPA 1XW8A 2ON3A 2WC3A 1C7SA 4MZ1A 1JVNA 2OX1A 3VKDA 1QO2A 2EAWA 4IGSA 4IICA 4JN8A 4Y6GA 1UD4A 3S1UA 1LRTA 3RK8A 4W84A 2D20A 5HOSA 1VD6A 7ODCA 3RCMA 4AB4A 1K8YA 2DY3A 3PUDA 3O06A 4QDPA 1JL8A 2WZIA 3W1XA 4DLFA 2C18A 4UQDA 2YCKX 1E73M 1NQ6A 1W1IE 1E0XA 4NG3A 3RIKA 3W2LA 1VFOA 4UQAA 4NJKA 2XP8A 2IW0A 1MZHA 2JF7A 3FKKA 1BKFA 5CSYA 1JCHB 3R4IA 1QDSA 1KBKA 4FLOA 1HKKA 1YXDA 3ITXA 3NCOA 2VEGA 1KV5A 3IGSA 2PLCA 2BLEA 4R34A 2OCZA 2F21A 2WV8A 3HTWA 1V3HA 1U1HA 2PDXA 5A95A 5AVHA 1YDYA 3VGGA 3LBCA 4UTTA 2PGFA 4WOQA 3PSVA 5FJRA 1RQBA 2JFEX 2YDAA 4IPPA 3L5MA 4NZFA 3NO1A 4GFSA 1VBUA 1VYPX 2F2HA 3WH9A 2QDEA 1DJNA 3POHA 2OSXA 4DF2A 3KTCA 1MQRA 2KE0A 2PP3A 1XM3A 2D69A 1WUEA 5AN7A 3UQAA 3WBEA 3S2NA 1UQZA 3CHEA 2Y78A 4ADTA 3TTYA 4DXKA 1UMLA 1SO3A 1CGYA 3UP8A 3F5KA 2F6UA 2D3LA 1X97A 2X16A 4PTMA 2OYKA 4MM1A 4JN7A 5C9ZA 4H8UA 3K1GA 3H55A 1OT1A 1M03A 1F74A 2ZRVA 3FDKA 1W6TA 4PEEA 4DPQA 1JCYA 3DN5A 2WOQA 3P2VA 4JX6A 4YMZA 1A47A 3NQVA 1M7PA 1S1PA 2Z27A 3PM6A 4UTFA 1RCXB 2E28A 2BY0A 1POJA 1UJQA 5EMUA 3APTA 1BPLB 4RDZA 3HGSA 1CB7B 1SW7A 1LQ2A 2VEKA 3C2VA 1UH2A 4HBOA 3KOYA 1WBJA 4TU1A 2H6RA 1S5NA 2J7GA 1Z42A 4GG9A 3U5YA 2ZC8A 4TIMA 4IZGA 2H90A 3E96A 1F8MA 4LBSA 4PTVA 4BI5A 3MC5A 4NJJA 3E49A 2E7FA 2C71A 1D2KA 1L6GA 4PRRA 4D6CA 2DG3A 2BOEX 4PCTA 5HWJA 4JFTA 4O4VA 4RDYA 3MP5A 1WUFA 2FJKA 3QEZA 2B81A 1L6WA 5LNVA 4ZO9A 5BXTA 1HQTA 4ZO6A 2OJPA 1MNZA 3TFXA 1V0LA 4M80A 4Q8MA 3GTHA 1AQFA 1KCXA 3EWYA 1X7IA 4LEQA 4UTIA 3W2MA 5E1QA 3W28A 3W4RA 1GGOA 2HXTA 3URNA 2X2YA 4QE4A 3A4JA 2QCFA 1RLCL 2ABBA 1B3ZA 2F2DA 3IIOA 1KXTA 3T0BA 3TONA 1X6UA 1PB0A 1YXYA 3TFCA 3KX6A 5HNNA 1ITCA 4AZCA 2O55A 3TTOA 2MLZA 4UNIA 4EWJA 2Q8XA 3DAQA 3FJLA 1EJUC 3RNDA 5BW6A 3OA3A 3GXMA 3GU1A 4N6FA 2X8RA 3BLFA 2ZDRA 4JHMA 1Q45A 2AKZA 2J66A 5HWBA 2BVTA 1XPGA 4KERA 3U7BA 3LRMA 3KAIA 4KFNA 2UY3A 4JQ3A 1UMYA 3F4CA 3O6YX 4XAZA 3H23A 2TSYA 3V35A 2GVLA 1GW9A 4GQGA 3CS2A 2R1LA 4PUNA 1F2JA 4EF8A 3RM8A 4ZCWA 3BMBA 1PX3A 2PLJA 3NWRA 1EX1A 5ECUA 5AHNA 1NFGA 4YVXA 1VFMA 1HXVA 2Y7GA 3TH6A 1EP2A 2X0HA 1OGGA 4TW8A 4I90A 1O60A 4DRNA 4DBWA 1KM4A 1VIWA 2MPHA 1OG6A 2PDPA 1VFHA 1F8AB 2RDXA 2VL4A 3H2CA 3UA4A 1J18A 1ISYA 1EPVA 3NL5A 2QDHA 2BSLA 2IXUA 4NSBA 4ODKA 4GBUA 1P6BA 1TV2A 2PSNA 3SRDA 3MV01 4GI9A 4MNKA 5D30A 1TX0A 2A21A 3ITGA 2GDQA 3TYBA 1YYAA 3DG7A 3WF1A 1E9IA 2YX0A 3HFYA 3WELA 3NO5A 1WZKA 2ZZ1A 1KFWA 5ABFA 3CYJA 4L6OA 3VABA 4ATLA 3SI9A 4QNWA 3KAHA 1CNVA 3INPA 3VGEA 1DTUA 3QR1A 1E9ZB 1JNDA 3AXKA 3USBA 1UZDA 3PPHA 3R13A 4DRQA 5CJMA 2VRQA 3WF3A 3O3RA 4AWTA 1H50A 1YKWA 3FGCA 3BLPX 4LH8A 3PA7A 4O52A 1UD3A 4TW6A 4QR6A 2FTPA 1XV8A 2I17A 3WO8A 3W87A 1V0NA 4U85A 1YQ2A 4ADUA 5I02A 4LYQA 1BXCA 7TAAA 3WEMA 5I03A 5C2XA 2HPIA 1CXFA 8A3HA 1U79A 3KOWA 1XBYA 5GQBA 4PMQA 3R89A 1E3XA 3M5VA 1YATA 1ESWA 2E5BA 1GRJA 4JHZA 4IFRA 5G1MA 3CL8A 4QBXA 1FKBA 1DJXA 2W92A 1XICA 1IHIA 2QJMA 4IIGA 4UZSA 2E3ZA 4MADA 1I1XA 1HFBA 5XINA 1ZS2A 4DI9A 1L1PA 1IWAA 3W70A 3UWZA 4ZGYA 1E0VA 4TVDA 1DIKA 2OZ0A 1IXQA 2CERA 1UIPA 2L5HA 2FPVA 4IL0A 3BUVA 1MQPA 4NXSA 3WH8A 4DRIA 3NQ7A 4HARA 3LY0A 4C6LA 2VGBA 1EYMA 1HVQA 4CD6A 1F73A 2ZE0A 4W7WA 2YA0A 3TMLA 1FHLA 4ZB0A 2CWXA 5CAKA 3MJMA 4IXXA 3RF9A 1K1DA 1XYAA 2DUAA 3ELFA 3M0VA 1UBSA 2X42A 4YL2A 1AD1A 3U2EA 3PB0A 4J2PA 4JFWA 1TQJA 5FAJA 4B4HA 1EXBA 1E4LA 3GR7A 2XSXA 2J88A 3W07A 5C7HA 4WDTA 1HJQA 1KM6A 3P0WA 4R88A 4UFKA 1FWHC 2UV8G 1EBGA 3E0LA 1YTKA 4EAYA 3BMWA 4Y8FA 2DZPA 2FGLA 5HNTA 1JDEA 4AX7A 3I3BA 3RX2A 1ONEA 4GYJA 3MZNA 3PZNA 4O10A 2FMNA 3ZLHA 3OU8A 3NPWA 2V5BA 4C6BA 3GG1A 4DH0A 3TYEA 1WKDA 2PE4A 1SW3A 5C2CA 3I6CA 5K9XA 2GZXA 1JQXA 4FHAA 3LEPA 2VD9A 3CC1A 4J3ZA 1CWYA 3H24A 1FA2A 1UA7A 1QCWA 1XCWA 2VFDA 4MPQA 5JQ9A 3PK7A 1F3EA 3MUIA 3PPGA 4YS1A 3N11A 1B3OA 1GQJA 3SECA 4DZIA 5EB8A 3M6YA 4DBSA 1TTJA 3W1LA 1PWMA 2E8YA 1TPEA 3LDVA 5ABHA 1JZ8A 4MLJA 2E25A 2FLIA 3TOPA 2VZTA 1TCDA 4FXSA 2VZOA 3AZTA 2NT1A 1ZCCA 1C91A 4RX0A 2ICSA 1R46A 2XUCA 2VFHA 3IIVA 5FOOA 1G9HA 4GZ7A 3AC0A 3W38A 4B2DD 4EAMA 4QT3A 4W4QA 3W23A 2JGYA 3WK3A 1D7IA 1FDJA 1GQIA 1GNXA 3CO4A 1VGAA 4ZZ9A 1V3LA 3F4NA 1OZQA 3SO7A 3K4WA 1VC4A 1A5BA 4Q4KA 4XKYA 3COTA 3LU2A 4GH3A 3S5ZA 2VC6A 3E6EA 1UHVA 3W01A 3O0FA 4PMUA 3S6OA 3KZSA 1EXPA 2QUMA 2W27A 2CC0A 3UNTA 3O5RA 3DKJA 3WDQA 4GIRA 3IV3A 1RY8A 1CGVA 5KITA 1XIJA 1TPC1 1XISA 3CL7A 1ZPTA 1YDOA 3WLRA 2AOSA 1OABA 3BE7A 3IVSA 4GLEA 1XLFA 2F38A 2FDMA 4U2YA 4W9TA 3QR0A 2KI3A 5FEZA 1NARA 5B80A 2Y88A 3VNDA 3N4AA 3KCEA 1ZBWA 3BSGA 4WY0B 4XD4A 3KBMA 1G7UA 4R7OA 4ZS6A 3OG3A 4TUFA 4H7VA 2YXOA 1RJQA 2R8WA 1OYBA 3FX4A 3PTMA 4DF0A 4Z2HA 3SZ8A 2XIMA 1F8IA 4RZBA 3AIQA 3EEGA 4O53A 1MEHA 2JE8A 3FCPA 3TN6A 3GDLA 1VRXA 3HZ3A 4IPJA 2XH2A 1JPDX 2VVNA 1QR7A 4BQ4A 3TWBA 2PBGA 1JXJA 4WJ8A 2WJFA 1H7XA 2WLZA 4OTKA 3SCQA 4E2OA 3THQA 2J9YA 4JTHA 5C70A 3DECA 2VDIA 3TYDA 2A5HA 4F48A 3H6OA 3N19B 3O07A 1KKRA 4EXBA 4EACA 4R9OA 4H83A 3LI0A 1R2TA 1EL3A 1KT1A 3K46A 1NFPA 2CW6A 1GW1A 3UZWA 3BZJA 4D6HA 3IGUA 1UD6A 2YA1A 4LT9A 3TZFA 2GGEA 5B7ZA 3CAKA 3W1RA 4DF1A 2GJNA 2XINA 4HOXA 3P74A 5HMFA 2WMIB 1J0IA 1HP5A 5HW8A 4QLKA 3VZYA 4NASA 1M04A 2J78A 4D6IA 4DY1A 1QNQA 4F0MA 3IVTA 5HAOA 2H8ZA 4UR7A 2XSBA 1MNSA 4TV6A 4B5VA 1QNOA 4H8VA 1ONXA 3ZZ1A 3D6NA 2WNZA 4WD0A 1TWSA 4MWAB 3LUOA 3HQOA 3W27A 4M19A 3UJSA 4ZTYA 3UD6A 1R7AA 1GOIA 4E2VA 2W3ZA 3S83A 4HVXA 2EPMX 1SJDA 1VEPA 2X1IA 3I3DA 2HNEA 1XS2A 3GKAA 4LYRA 2WCSA 1WKYA 3UF9A 2PTDA 4KRTA 3BV7A 1XDMA 1TUFA 1CGWA 4L72B 3O1NA 1FKWA 3R11A 3G1SA 1HN1A 3TNBA 5K4XA 3AS0A 4XV0A 3M7WA 4EANA 4TMCA 1YNPA 4LUSB 2EGZA 4AFYA 4IPLA 1OT2A 2GOUA 5D2XA 4I9MA 3WLMA 1SMAA 3FYYA 1D7JA 1MDRA 5AZ0A 4C6PA 4GABA 1X39A 2A3HA 2EEXA 2YIHA 5LA2A 4JGDA 2JGQA 1JZ7A 5DRCA 4EF9A 1C9WA 4JS3A 5HUAA 4GZIA 1ADSA 5LIXX 3QLDA 1YPFA 4KCUA 1ZRQA 3E2RA 4DJFD 3G6LA 1IXPA 3W6LA 4XZHA 4C6JA 4YIWA 4FOJA 4NI8A 4TNSA 1KQZA 1W1ZA 3V0UA 2C7FA 2QPSA 1LWIA 4IGMA 2QULA 3TTSA 4BS0A 2XH4A 3PFRA 1M1BA 3MO7A 1T0OA 5IBXA 4JDBA 3PN8A 1BYCA 2EPLX 2YL5A 2QVNA 4ZODA 3V4BA 5I3HA 3T1GA 3N3TA 1I9CB 3BZGA 2VQUA 1J0KA 1W9PA 9XIAA 4PB4A 1E1EA 3I7RA 4PEKA 5LNSA 1JRBA 4LBRA 4AY1A 3B9NA 3VDGA 3LMZA 3O5JA 3KBWA 1K4GA 5A8QA 3L4WA 5ECVA 3OGRA 2YDQA 4NU7A 3IUHA 2C91A 4HNLA 2J7DA 2OMAA 3LQGA 4QJ4B 2ATMA 1MUCA 1E55A 3UERA 3UG5A 2VGFA 3NVDA 4TO8A 2P4VA 3WBYA 2EG7A 2CBUA 2DJLA 4MOZA 3G1FA 4CN1A 4HMDA 1NQKA 4EVZA 2PB1A 3GIYA 4H6RA 2WQPA 2YCLB 4JHOA 4JNYA 2QQ6A 3ZQ9A 2NLYA 3CM4A 1Z3NA 3CHFA 3C5QA 4GZJA 3OHIA 3CIVA 1D7KA 3RPTA 1PIFA 3EBVA 5TD4A 3KTSA 1XIBA 2GYIA 3DXIA 5EFDA 1CIUA 2FZDA 3BANA 4GYPC 5GPGA 4W86A 3S9IA 1FP9A 2KFWA 5CPOA 1XRTA 4LALA 3MSRA 2GVJA 3IJQA 1G1YA 2NV9A 3GTIA 3O6CA 3A24A 4HA0A 1JCMP 1GTHA 2XVNA 3ZJKA 1QW9A 3W2UA 3LZ5A 3GVGA 4H8NA 1W91A 4MKNA 1FX6A 1QI2A 2HXUA 4G6CA 1X38A 3Q65A 4Z2IA 3RGTA 1C92A 2O4MA 2WMHA 3HG4A 3WYZA 4D6EA 3CIXA 1ODUA 2Z29A 1V0KA 3UBPC 1A5AA 1B90A 3VE9A 2VZVA 1AW1A 1LYXA 3PBYA 2PCQA 3S0CA 1HJVA 2GWGA 1S2AA 2PTZA 3W7IA 4FXFA 4MWAD 1R9YA 1E4MM 3UI4A 4JQ1A 2QMKA 4PCNA 4O16A 3PZOA 5D2YA 4ZE4A 4ML9A 5EPDA 4W9OA 3KLKA 1JYVA 4DROA 4F0LA 3NM1A 2V5DA 4UMCA 3CWNA 1V7AA 3H9RB 4AVNA 4GQRA 1HKWA 2RGMA 1AL7A 1UWUA 1KO0A 3QKZA 4Y9OA 3WDHA 1U30A 3B8TA 3HFTA 4ZEPA 2DZTA 3IKDA 2P88A 1H62A 1VFSA 4I3GA 4RDWA 3HGRA 3BW2A 2NVAA 4YTQA 1KCKA 3RPMA 3E2VA 3UZ5A 2OEKA 2ISVA 3B7XA 2WCAA 3GVRA 2FHCA 4RE0A 4DRHA 2CFFA 4GZEA 2B0MA 4LPCA 1E51A 1WQ5A 1G67A 4QSHA 1N8IA 5DXYA 1SGJA 1PKNA 4ZTXA 3RM9A 4ORMA 5KTLA 4FS9A 3DHPA 3RILA 3P14A 4ASTA 1FKXA 5TQLA 4ZXLA 4KW2A 3NQ6A 1Q8AA 5JXQA 1BKSA 2XWDA 3V75A 2YW3A 4W5UA 1HO4A 1O12A 2DW6A 2OQHA 4JTEA 2J7BA 2QUNA 3TCZA 5H8PA 3GDTA 4HU0A 3M0XA 3QXBA 3SY5A 4LS1A 3RLHA 2PA6A 2QUVA 2OWCA 3EWXA 1B3YA 2VGIA 4N4PA 2MUCA 2YCEA 1XYBA 4Z2GA 3QTGA 1DWIM 3ATYA 4UNKA 2FH8A 3PP7A 2QYGA 3ITYA 1H7OA 4P8XA 2WM1A 1J6PA 1T8XA 4AH7A 3T55A 3WLHA 3GFZA 5AHIA 2OXNA 2GVYA 3HPSA 3T4CA 4GJIA 3TSBA 4K8HA 3RMEA 4JIQA 3A23A 3DYMA 2YBTA 3M7SA 3OOQA 3TMQA 2UY4A 1PX4A 4ODNA 2JZVA 1KTCA 3H2MA 4YLWA 2HE5A 2PDQA 3RYSA 2CHRA 4DXVA 3A5FA 3I65A 2YB1A 4UCGA 3A9IA 1SM9A 3N3MA 1CW2A 1OIMA 1YEYA 1DXIA 5JIWA 2FQIA 4XQ6A 1X6LA 4GUHA 5LA0A 4PUUA 4UBPC 1W5PA 1AH3A 1ZP4A 2WXDM 2O9TA 1V3MA 4DWSB 3ZT5A 1GQNA 4BI7A 3POCA 1EP1A 2DW7A 3GYCA 2CXGA 1QAPA 1X8CA 1DJIA 1VJSA 3GU9A 4FNTA 1O1ZA 2ZXAA 4L80A 3KACA 3G1YA 1SFTA 1OG0A 1XBZA 4X63A 1OZMA 2PODA 1NWSA 3GWQA 1ZBKA 2PRHA 3AXXA 5HKGA 1GKQA 1N82A 4WK9A 4O4WA 2ZUTA 4MJZA 3GC4A 3AI0A 5HR6A 3VDHA 3DYOA 4GBDA 1EGVA 1J2BA 3ABXA 3SN0A 2PLMA 1QI3A 1ZENA 1O6IA 3T8QA 1FCQA 1I75A 3U5UA 3CH0A 1AZ2A 3DENA 3AS1A 3OQ8A 4IIDA 3GNOA 2RSEA 2D0HA 4DB7A 1P1MA 5D8WA 3AISA 4IMCA 3GR4A 4G50A 4AAJA 5A6LA 1RHCA 3LNMA 4LC6A 1UIOA 1V08A 5J04A 1WO2A 4TX8A 3OP2A 3BGAA 3BAXA 5CC5A 4IUOA 3CWHA 1KT0A 1W3IA 3FN9A 4PFMA 1CB2A 4X9SA 3PTDA 4LQ1A 1QJWA 2CHOA 3MQTA 3WQFA 4ZSUA 3AIRA 2XYLA 3DERA 3TNOA 2XISA 2J7HA 5EGRA 4WKHA 2WW5A 3RCNA 2QGYA 4BJHA 5HQLA 3B9EA 3W1MA 1CI1A 4UQBA 3TJ4A 2ABAA 4GKLA 3ZM8A 4AW7A 2J9ZA 1XLHA 3GNNA 4WKFA 3O5PA 4R7JA 4QLJA 2VRJA 4EPBC 1GUVA 1E40A 1DV7A 2J9XA 3MI3A 2NXIA 4IPIA 4PUEA 1XLBA 1C7TA 4DAFA 1VPQA 1UR2A 2G97A 3UY8A 1A5NC 2F2KA 4B2DA 1SVDA 1RSCA 4H9MA 3L2IA 3REQB 4IIEA 4HCHA 3UZYA 3STEA 5I5RA 1VFFA 5KSWA 1U33A 2NX1A 4G7EB 5DMNA 3PJWA 3WSUA 2OLHA 4PMRA 1D8WA 1OVDA 1K6AA 1E56A 1WXJA 3VOFA 2FVKA 5RUBA 1KBJA 2D73A 3T2OA 1V3JA 1R7OA 1J0HA 2EPOA 3ATZA 2Y8UA 5HQEA 2I14A 3AIVA 3Q94A 3SUUA 5JH1A 2AGKA 5D8ZA 4J4KA 4MNLA 9CGTA 3WLLA 3M64A 1LWHA 3BWWA 3UJEA 4NQ1A 3ES8A 1FUYA 1QNSA 3R79A 1BQGA 2WMKA 2OR2A 3AHYA 3DU0A 5FL0A 3UVAA 2YFOA 5HWCA 1RP9A 1OFBA 4US5D 4DJDA 1QU4A 3W1PA 1OF6A 3JZEA 3ZJ8A 1TV5A 1LORA 2PN0A 5BYWA 4PGLA 4FI4A 3N25A 3JZUA 4MY1A 4IF2A 2Z24A 3KRBA 3TW6A 4V33A 3B0YA 3AMDA 4I5XA 4PB5A 3CV6A 2ADAA 3II1A 3MANA 3NDOA 1KLZA 5DT5A 3TC7A 4G9PA 3EOOA 2ASHA 3JS3A 4WKAA 3DZ1A 5HR7A 1WV2A 3W7NA 1F4AA 1WKEA 1RVGA 1B1YA 1BG4A 4DPPA 3G1HA 2FVMA 2FZNA 2BGNE 2Z2UA 1EUNA 4HYRA 3ARUA 2DIKA 3E0VA 4ROQA 2PWVA 2DGAA 1TWWA 4QDMA 1PEZA 4LU0A 8TIMA 4GXWA 3N73A 7REQB 2QCEA 1EP3A 2DFAA 4OUIA 3D3FA 4U84A 4OIFA 5DMYA 3GH5A 4C5YA 1K3UA 3NNTA 1E1FA 3L21A 3V0TA 3WK2A 3BG5A 2F23A 4D8LA 3CZJA 1RUSA 4V28A 4N9EA 1I6NA 3M6DA 3NTYA 4MHBA 3TC6A 3M43A 3GVWA 3TKFA 1GZGA 3AQUA 5D4YA 3QYSA 4NXKA 3QGKC 6REQA 3VU2A 4P61A 3KRUA 3MP4A 2NUXA 5CQ1A 3LX9A 1K77A 3W37A 3VX0A 5IFTA 3HMJG 4BF7A 1JVWA 2NVCA 1VBRA 1HKMA 1W1PA 2OSYA 1GJUA 2I5IA 2GUBA 4H19A 4BI6A 2AQVA 1LQ0A 4HMEA 3HGJA 1UP2A 3V5FA 4GVIA 1TO3A 2QAFA 4MG4A 2NLIA 3SRHA 1NU5A 1AH4A 1A80A 5K4ZA 1DBTA 3O5EA 3DBPA 3ABZA 3UG3A 3L7RA 3SCVA 2OZ8A 3E38A 3FA4A 1MW1A 3VOJA 2CBJA 3W22A 5LHEA 1B6CA 1GCYA 1BGAA 3NXLA 3KZ7A 3SJ3A 4X61A 1VCGA 2YDRA 2IPGA 1I2NA 1TV7A 4E6MA 2PPOA 1CLXA 4OZOA 3KOFA 5C9WA 3L12A 1OIFA 4CCEA 3UPWA 2FZBA 3FS2A 5EL1A 3QMSA 4I7UA 1W31A 3GU2A 4MJ4A 5H6HA 4PRWA 4ONVA 3E02A 1QW8A 3DX5A 2WZHA 4U2ZA 3S2JA 4B3KA 4CQCA 2HCVA 4Z2LA 3W7CA 5I3GA 3K8LA 3B0VC 3CT7A 1R9HA 1UR9A 4XUYA 1QHPA 1V3KA 3I68A 1H09A 1XBVA 4WEVX 3W00A 3EYPA 2HJPA 1NTHA 2G8ZA 1FAPA 1PVNA 4A2RA 1UKPA 3KLLA 3NFUA 1NF7A 3TDBA 1H1NA 1CGXA 2OODA 2OLAA 4WX2A 3WQ8A 2G3IA 4WY0A 3MKVA 4GGHA 4ROPA 2AL2B 2MLXA 5DRIA 1ODZA 6XIMA 4IQDA 4IMFA 3WMBA 3EXRA 1XUZA 1V8EA 2CLHA 1TWDA 4C1LA 1ZBVA 1H2JA 5MHBA 1MWOA 4A8LA 5AC4A 1XIMA 3RAOA 1UUQA 1RLDA 2BTMA 2DSUA 1TJPA 1R30A 1Y7VA 4AD0A 4YWIA 1PINA 4S3AA 3DI0A 1SZGA 1VBHA 3PZIA 5A6SA 4WY0F 1EFZA 3SADA 2FZ9A 4LVBA 1K7XA 1UWTA 2OELA 5A6AA 1EC8A 4DRJA 1GJWA 3GHTA 2ZOXA 4QFUA 1ALDA 4K7VA 2DORA 4Y9PA 3MB9A 4OQVA 1E72M 4O2TA 3VM7A 4DYJA 4C90A 1D3GA 3W7KA 4S3GA 1L2UA 4R27A 3G3MA 2WMIA 3RU6A 1X98A 2C0AA 2E6FA 4TVUA 4WRHA 5A94A 3A22A 4Y2WA 4MIMA 4F40A 1JYXA 5FF0A 3UNDA 4DYEA 5E6ZA 4MZYA 3WX7A 4MWAA 4RNIA 2PGEA 3UVIA 2A7PA 3G0XA 1EJWC 3NTPA 2HWGA 1KKOA 5A8PA 1V6YA 2XFWA 2PI6A 2DV0A 2XFFA 4DWDA 1GPFA 4E8CA 2YL8A 1NMVA 3A5VA 5IDIA 4J3XA 3I6EA 2BMBA 3S6TA 3FSTA 3L2MA 4UTJA 4X22A 3IAQA 1H7PA 1BL4A 1JNSA 1JG9A 3NL3A 4Y7EA 3GKFA 3VNMA 2F6KA 6A3HA 3WFAA 1HG3A 1JD9A 4EPDC 5GPRA 2KGJA 4O8RA 4IMGA 4LUSA 1EQPA 1KBIA 2FB3A 1U83A 2WPBA 4IT4A 1JUEA 5A1AA 3VMPA 3VC6A 3BO9A 5DCEA 3S8HA 2PPGA 1NP0A 4XX6A 4HBKA 4A8IA 4CQ9A 1PDZA 1NP2A 4EWND 1IEQA 2O56A 4F79A 2CNCA 2WLYA 1LWJA 1GKRA 4L65A 2PLKA 2IPFA 1OHLA 1MZRA 4L56A 1ZCNA 3AUJA 3VA8A 4A29A 1OBAA 1ZK6A 4I5RA 3PB2A 5EMMA 4Z1AA 4ADSA 1YNYA 3URQA 5A6MA 1I2QA 2R1NA 3BOFA 3WH6A 1TJ0A 3CBWA 3KDNA 2R1KA 1A49A 2UBPC 6CGTA 2PV1A 1EQ3A 2ATSA 4GC4A 4PUWA 3H22A 4O14A 2Z1KA 3CGTA 3EOLA 3SY8A 4JFKA 4J3WA 3LLXA 5J6EA 4QE5A 1FHVA 3AHXA 3NAVA 4HU3A 2DT3A 3UI6A 2WHKA 3CQJA 2Q02A 3LPPA 4MVAA 3LCFA 3OLGA 5IM51 1UKTA 4LXFA 2YDSA 3WMCA 1GONA 3U9IA 1YLVA 2V69A 3O05A 2IPJA 1BYAA 2BHYA 4Y90A 2PZNA 4LRTA 4Q8WA 2IF4A 4QRNA 2Y0FA 3SB0A 2EG8A 1OEPA 4H41A 1A5MC 3EKLA 2QKFA 2WM0A 4JKKA 2INZA 1R3YA 4TYOA 4AZ7A 4PE8A 4AC1X 4JBRA 1FFQA 3WF4A 4QITA 5BMXA 4ZOBA 4PFHA 2RAGA 3PZUA 1PJ9A 5HJLA 3S5YA 5DN1A 2Q01A 2YCLA 3IUIA 3MZ2A 4LY4A 5DITA 1NSJA 2WJDA 1SFLA 1AA1B 2JK2A 3M0ZA 2Y24A 4K8GA 3GY1A 3JUGA 2X1UA 1JQVA 4M3PA 2ZRUA 3SAZA 1JPIA 2DQXA 2ZUMA 1TPDA 3MHFA 1W3NA 4QROA 2X09A 3AYRA 1P0BA 3HG2A 3MDWA 4AD5A 4LUTB 1QOXA 2GK1B 2WZEA 3TYUA 1PUDA 1FKSA 1H1YA 3XISA 1ONRA 1GPWA 1S2UA 3VD9A 3M0MA 1O7AA 2BDQA 4S38A 2OQLA 3WLJA 5HBFA 2FDSA 2VO5A 1VAHA 5DMLA 2GJXA 1G4TA 4NX5A 1CLVA 3P8IA 3AO0A 2F7FA 4YN5A 3U7VA 3DOPA 1H7RA 3LB0A 2JKPA 1KM5A 3D5HA 4N9DA 3AYVA 5HATA 4ZQPA 6TIMA 4AYGA 4LAZA 5CC6A 1AJ0A 5HJYA 1QO5A 4M6PA 1W9XA 4QCEA 1J5TA 4AZCB 2NWSA 1L8PA 2V3EA 3NPUA 4O57A 1P43A 3IIPA 3OLIA 1O68A 4RNJA 3HPFA 1OFDA 1UZHA 2EPNA 3WENA 2F84A 2ZX8A 3W7OA 3DC8A 3O5QA 3EDJA 1YX1A 1Z8AA 4GQBA 3IAPA 4JEQA 1N8FA 2CEQA 3F5JA 1P0EA 2J62A 2LPVA 4JIRA 3PZVA 2ZYFA 4B3LA 3PBGA 4OJYA 2LKNA 3B40A 2XSAA 5T91A 4BA0A 1WZLA 2F6XA 4A3HA 4LS2A 1PL9A 2RUSA 1KLYA 1IT7A 2OGYA 4B16A 3VDBA 2PWHA 2WMGA 5FJIA 2QCLA 4AEFA 1WOAA 1RCQA 1W3LA 2DIEA 1GHRA 4UTLA 5XIMA 1B31A 1H5YA 2CETA 4KMQA 3SN4A 4UQ9A 3LBOA 2AGTA 5E6YA 2PDUA 3FEMA 1FH7A 1EX5A 1H49A 3OBEA 1XYCA 3VX1A 1ZSXA 5GJNA 4ODMA 3C61A 3QV8A 3UZXA 2YGYA 3CZLA 2ZICA 5FJOA 2VC9A 1ITXA 1M65A 2OQYA 1FKTA 1EKOA 2VENA 1L6SA 1K70A 4PMDA 3LN3A 4GIYA 4M82A 2XIJA 2ZR6A 2PDCA 2XFRA 3CT2A 1Q7MA 1XYZA 3N9RA 2IQTA 1CENA 4IOTA 4JYEA 3IGXA 2X7WA 1SO5A 1C9DA 2DT2A 3GHSA 3EIPA 3LTPA 1WA3A 1HF6A 4I6VA 3VZXA 2PWEA 5JIPA 4UOQA 5U4NA 3PUGA 3BGGA 4QQUA 3O6DA 3I3EA 1TV3A 1ADOA 3R0KA 1ISVA 1F6KA 3BQ5A 1O4UA 3S2LA 1ZGDA 5CKSA 3V3WA 4PMVA 4TR9A 1BXBA 2NVDA 3AYSA 4Z2JA 1H1ZA 4US5A 2RFGA 4JYSA 1WYIA 3P0XA 4H9VA 2W63A 1CXIA 4ZPWR 3GFYA 1E1CB 4Q32A 4GX9A 3P5ZA 2VCBA 1LP6A 3O8AA 1E0TA 5JH2A 3TOYA 1CT5A 2E1DA 4GUGA 4PMYA 3MO4A 3MU7A 4LUIA 3VVGA 5CSSA 2ZR4A 2WC4A 4JIHA 4FXRA 1RCOB 4NUWA 2FTYA 1PIIA 1V6XA 2WHJA 3PJTA 2NSXA 1A5CA 1KM1A 3GUGA 3BG9A 3BLDA 1IX5A 4XBSA 3VMOA 2J75A 5LNRA 4E5TA 2NUWA 5CGQA 4HNVA 4NZJA 4ZE5A 5I3DA 4HBEA 3QGAC 4ZPVR 5G1YA 4D8ZA 5C54A 4JFVA 3TZNA 4XSLA 3GXNA 1MSSA 2PFHA 4XAKA 4QS5A 5CZTA 4TVCA 5K9DA 1Q2RA 1VEMA 2BNJA 1SW0A 1CECA 2J4GA 3H21A 2XP9A 3M41A 4LUJA 1PZ0A 3TXZA 3SUVA 2E09A 2VYOA 1SJCA 2WHLA 5HDRA 3UXKA 5IDZA 1V03A 3T05A 2WPGA 3B3DA 3ECQA 4AIUA 4LCSA 1FP8A 2EPHA 3M16A 4QEEA 2OVLA 2POTA 3OG2A 1I2RA 1XLEA 2BZNA 3H12A 1WDQA 5BOEA 4H9YA 4LVFA 1K9TA 6XIAA 1KRAC 2HTMA 1PV8A 2OOFA 2A6LA 1JCNA 1T40A 4A3QA 4LAUA 1TZ7A 2VEFA 3UG8A 3NYZA 3EGJA 4ERAA 1T5AA 3VGDA 4C6MA 4B3ZA 1H0IA 1ZL1A 5REQB 1WB0A 1ZLPA 1SO4A 1EYEA 2RKXA 2VEMA 3PJUA 4CU8A 3G22A 1VYSX 1DP0A 5HNRA 4O17A 2XVLA 4H6EA 5D9PA 1LBMA 3CEUA 3B8IA 1XGDA 1KFBA 1EZ2A 3O15A 5HA7A 3WF0A 3IJ9A 4GGBA 4PCSA 4ZR8A 3OOBA 2UZ9A 5IOBA 5M03A 1QXLA 1LL6A 1YXCA 4FLRA 4Q4QA 3NQAA 1A0EA 1WP6A 2P5NA 2VVSA 1BXNA 2DSZA 4MMWA 3LHTA 4A8RA 1JZ4A 3UPMA 1DTNA 1UH3A 1EGMA 3ODKA 3BVJA 4JKMA 1FQ0A 1PO9A 3KWXA 4LYKA 5EY5A 1Q5MA 1CXKA 2VELA 4LANA 3VD7A 4HTYA 4UTKA 2I5GA 1Q63A 4INFA 4LVAA 3AAMA 2E68A 5A8MA 3P6LA 2WBGA 3QGVA 3MSGA 2DT0A 1E9YB 3N2CA 4REQB 5LZLA 3UXIA 2FGBA 1XRSA 1XKJA 1ZTVA 7XIMA 1GG1A 3BG3A 2DSVA 3WJSA 3STCA 3NG3A 3LHZA 4NNRA 4GH1A 3G24A 1P5BA 4G7EA 4F4RA 1KGXA 2ISWA 4KIRA 3TCEA 3PBUA 4L7ZA 4E2DA 2AMXA 5IFPA 2QJHA 3KCOA 5KZMA 4MWAE 1C8YA 3GXIA 4TX0A 4CU6A 4BR1A 4O1BA 5I3KA 2N87A 3B8UA 4JR5A 5CPNA 3S46A 3L66A 2L2SA 1E6RA 4XZMX 4DXXA 5AHFA 3LA4A 2QDDA 4M1RA 4ICMA 5AFDA 4JKLA 3H2FA 3WJWA 1E43A 1GORA 1PKYA 5M1TA 1P7TB 1FH8A 5F2LA 1K8ZA 5CBIA 4V27A 3Q45A 3ALFA 3DKLA 3EX6A 1B9ZA 3MWAA 3TJIA 4PSPA 2OFNA 1K9FA 1LL7A 1ME7A 1Q6CA 5HINA 3W7DA 4QZVB 3QW3A 3HV8A 4FN2A 4P8UA 2QJIA 3M0LA 3DIPA 3IJDA 3EMQA 1GEHA 3LSCA 4Q4OA 3NZPA 5D02A 3SUWA 1M9HA 2GFTA 3NXFA 3H26A 5DANA 3IPWA 4KKXA 1IT0A 1TPFA 1VCFA 2H3BA 1S5TA 3PTQA 2V5JA 4GCXA 3N15A 4E3TA 4RJEA 3OW1A 2FMOA 1SSGA 3A3WA 4J4OA 3A13A 4JY8A 4JX5A 2QCNA 4WJXA 1SJBA 4EIVA 3M0KA 3U48A 4C1NB 4Z1YA 1W3KA 4LCQA 3VNZA 4US6A 5FSDC 3S1WA 4LV4A 1ZALA 4FR6A 3NQMA 3HB9A 5CXPA 4RDVA 2PF8A 4HHPA 1RBOB 1GHSA 3VPLA 2VX4A 1JGIA 4GGQA 3UZJA 7REQA 4JAWA 3LTYA 3QY7A 1A50A 1G4EA 1LBFA 3GD6A 4Y8EA 1JUBA 4M8UA 2QVHA 2FPTA 3NGFA 1KFLA 1E6XM 1RV8A 1W3TA 2EQDA 3N29A 3N2OA 1WDDA 3OQEA 3B05A 1A5UA 5D2VA 5LNUA 1FD9A 2ZZ3A 4XD6A 4LJ3A 4XVDA 1PYFA 2D2HA 4FMVA 1KRCC 3AOFA 5AYXA 1ICQA 2W6RA 1OFRA 3G6MA 1IGWA 3ITTA 5IXEA 2PV2A 3PY2A 1XBXA 4ZPTR 4LF2A 3S2CA 3AMGA 5KZEA 3QMRA 3SCRA 3BV4A 2V81A 5BNKA 3WN6A 5M17A 3QQ1A 1AQMA 3EOSA 3UU0A 4PCFA 1SJAA 2WSQA 4NX0A 2PUZA 2POZA 2VX6A 3TIMA 3GAYA 2REQB 4GHRA 4JYDA 1GYMA 3AIWA 1R0MA 1CTNA 4CKQA 2WVVB 1QW7A 3DEQA 4PTDA 3CZEA 4AG0A 2FFCA 1B30A 1NJJA 2ZA1A 4QTGA 5HPOA 5HTGA 2QAPA 2P8BA 1UR4A 2EG6A 3W24A 4B9YA 3EPOA 3MDYB 1X1NA 3HJZA 4QM1A 4DZHA 3PHAA 5LYRA 5D09A 3L23A 2YLAA 4IXHA 3QTPA 3VMNA 3ITOA 1S5MA 3MUCA 3OPSA 3B9OA 3OVGA 3NO3A 3STGA 1UUOA 3KRSA 1AFSA 3QHNA 1S5WA 2E67A 4U4MA 4R33A 4UNLA 3ONCA 3HQPA 1XUUA 5KZDA 3R2GA 1LRQA 2Y2WA 3QV7A 2CZVA 3I7SA 1EC9A 3CEPA 4YTSA 1KD0A 3SIZA 1XH2A 3BDKA 3H4WA 1QRQA 2E6DA 1VP5A 3MYPA 2P8CA 1JFXA 1VFLA 2VWTA 3D47A 1XYFA 3TN5A 1Y0EA 4S39A 5HWNA 4G7FA 2W9MA 3IARA 1X96A 3GM8A 3MUXA 2F61A 3DG6A 1G0CA 4LC8A 4GIAA 3R12A 5AKQA 2VEPA 3OGSA 1XGEA 3W7QA 3RXZA 2PTXA 3PBWA 4F2TA 3WLOA 1AMYA 2B31A 2VM8A 4DJEC 4FIRA 3ZJ6A 1W1VA 3DH7A 3BW4A 3O5OA 1JUKA 3CK5A 3R8RA 4C7GA 3CUXA 3W2JA 3GVQA 1JI2A 2GGGA 1MUMA 1JFHA 1KTNA 1UD5A 5HNUA 3R43A 2A79A 2AL2A 4LWWA 5DT7A 1NSGA 3RJYA 4DLMA 2NSOA 2VC7A 3WLSA 1J8VA 3TN4A 4C7FA 5H8MA 1EOKA 3ZVHB 3N2TA 3FSUA 2PDLA 3C52A 4PH6A 1VQTA 1SO6A 4IJRA 5CZKA 3GW3A 3GXPA 1XSKA 2VDHA 4C6QA 3H8AA 2QPUA 3PVFA 2VFEA 2Y5SA 3MMWA 1LQAA 4AQLA 4ERIA 4CVWA 3ABRA 4LNYA 2A3EA 4QG6A 4ZFMA 4X0VA 3VC5A 1Q4WA 1GOWA 2GSEA 2QIWA 1FWNA 3WQVA 4PUMA 3RFWA 2VR5A 2W62A 3UW6A 2DZUA 1W3HA 5AYZA 4EOUA 1P0NA 1XD0A 4QG8A 4DYKA 3CHCA 3OBKA 2RDTA 3BAYA 1FWIC 5ABTA 4QJ5B 2O9OA 1OCBA 3ZFHA 3LUTA 4K8EA 2HPMA 4UFMA 4IIBA 1YMYA 5CBBA 3EX2A 3PPCA 2C1GA 3BURA 3AFBA 3EWBX 3NJ3A 1HL8A 2BHZA 5E5CA 3VOHA 4N4QA 3PNUA 2XGZA 2O92A 3O16A 3PRBA 4OBSA 1PXGA 3AALA 5F1UA 2V3FA 4ZO8A 2VJXA 5AY7A 4FF5A 3RX4A 4JFIA 5G4EA 2FYMA 3T2PA 1GYLA 3FYPA 2ZVIA 4ECLA 2WO5A 1JXKA 3PJXA 1G01A 4JTIA 4N6EA 1OY0A 4A6GA 1QWGA 2RURA 3DYPA 3S4TA 4XAYA 3E3HA 2BVWA 4GVFA 1LBLA 2P1FA 5I2UA 1KWKA 1U5HA 3W1NA 4BY3A 2XPBA 4KWOA 4H6KA 3ABQA 1RBAA 4FNPA 1P1XA 1IWPA 4DIAA 3TWAA 5CCZA 3MPGA 1C93A 3ZS4A 4AZGA 3LCIA 3M07A 1EH9A 1FWWA 3QRHA 3T0CA 3DUGA 1Q2SA 1NIUA 1UB3A 3JR2A 1FKRA 4D6DA 1V02A 4MJMA 4MB1A 1B9BA 1DPMA 2ZUWA 5BU9A 4KESA 2GQ9A 2PS2A 3CHVA 3CTTA 1QOQA 5KINA 2BB0A 3C3UA 1CGTA 2AKMA 3W26A 3VYLA 4L1WA 1A3XA 5JU6A 3N18A 4LSBA 1S2VA 4JTUA 5C0QA 2IPWA 3GG7A 4EE9A 2PGRA 2Z4GA 1JPHA 4W88A 1E4NA 4GUJA 2Y8VA 3WEZA 3WUEA 3PBMA 4ACYA 2D0GA 1SZFA 2RJGA 1EPXA 3OJGA 3PR9A 3HV9A 3QFEA 3W3OA 3DFYA 3KVMA 3U8GA 3KBJA 3LQLA 1KM3A 2NWRA 2ZQVA 3NL6A 2PBCA 1W5NA 3RLVA 2HV5A 1B3WA 1H4PA 7TIMA 3RR4A 1W9DM 3EPNA 4NI3A 5C8BB 3W7JA 1GYNA 2GSJA 4GI4A 3UCDA 4EK7A 1O1HA 1M5WA 1IF2A 1MXDA 2QS8A 1DHPA 3W6MA 4HA3A 4IQLA 3N2BA 3BJTA 2G5WA 1TA3B 4OWGA 2HEJA 1OQFA 2OX4A 2RUQA 1RVKA 1OCNA 5TAOA 2Z1BA 1M01A 3OZYA 1XRVA 1RD5A 5F7UA 4JFMA 4AWEA 3ZR6A 2GJLA 5CGMA 3NI6A 1YW1A 3CB3A 2GQAA 5E9XA 3VKKA 1DHKA 1RK5A 4PODA 3I10A 3KS5A 2XH7A 3UQNA 2ZQUA 4BF5A 1X7FA 5DEZA 1DWGM 4HCLA 3MW7A 1CX9A 4JTGA 4JFSA 5CPTA 4HSOA 4PUDA 4JD4A 1G69A 3SJNA 2E1WA 4GA8A 4FPSA 3ICJA 4DJDC 4S3KA 1RK6A 4A4AA 2H9AB 1XLDA 1XP3A 5G4HC 1HL2A 4P2VA 3ITLA 2Y7EA 2SFPA 4H04A 3ANUA 2EBNA 1UR3M 1V77A 4DM1A 1TVPA 3EY6A 4B92A 3LV5A 1POKA 2Y89A 1TR1A 4TMBA 4LW7A 2PRLA 3OBAA 5CGTA 1BWVA 2PF0A 4NZ4A 4ILSA 3V0SA 3SQLA 4X2PA 3FY1A 1GVOA 4LUTA 5U7SA 3A21A 4JFLA 2GK1A 2QDGA 3W7MA 2ZZ2A 3ARZA 1PZ3A 3C86A 2JQXA 1UUMA 1FKIA 1R9ZA 3DI1A 3LHVA 2XZ9A 4XUGA 5F2MA 4JTQA 3QZ6A 3QBUA 4QE1A 3BXWA 1XCFA 3L68A 3F7JA 3THCA 3VNIA 5B7YA 4MYAA 4QXIA 1MFUA 4XK2A 3OVQA 4XKMA 2WANA 3LGDA 3EWUA 3L5LA 3LGGA 1H60A 2WMJA 3UESA 3EEZA 1FWJC 3GIPA 2YXXA 1TMHA 2CHNA 1BLIA 1W0MA 1H5VA 2V67A 1BD0A 5AYIA 2XM1A 2XWEA 1PTDA 2B4GA 4HPNA 3IJLA 1SZRA 2CZEA 3S1VA 4FALA 3RR1A 3BJFA 3M0JA 1CXEA 4IHCA 5HMDA 4K6AA 3L0KA 4IMEA 3LD5A 3U6WA 3PZQA 2XPAA 3NGJA 3WY1A 1UA3A 1Q6FA 3LM3A 3FEQA 1OK6A 3VIPA 1H11A 2A2IA 2K8IA 4E3VA 2Q3RA 4EXAA 1SQ7A 5T8GA 3CWOX 2P76A 1U2YA 5G5IA 4C6NA 4WR3A 3WUBA 2W91A 1UCWA 2B7NA 1P48A 4E4UA 2IS7A 4DI8A 1TPVA 1J4EA 1LCOA 2X7VA 4AEEA 2I1OA 4BWLA 4LYPA 3BAJA 5BWAA 4PTXA 3QC0A 1GG0A 3WMLA 5I07A 4NIRA 2GJPA 1R38A 5E93A 1G4PA 1GWJA 3CPGA 4N19A 1ISZA 1S5VA 3AWOA 2CLKA 1P4CA 2ZC1A 3TCSA 4A3YA 4ZQOA 2O4QA 3GBDA 2NXGA 3PULA 1GEQA 3TP4A 4AY8A 2V3DA 1EO5A 4OBTA 3W02A 1O94A 5LHFA 3CHDA 1SFJA 2BFGA 1U5VA 5E0KA 4DVOA 3G1XA 1XL9A 3H54A 1J01A 3UJ2A 2V30A 4RE3A 5CC3A 2BG5A 1OCQA 3A47A 1XIEA 1WKFA 1VR6A 3GO2A 3M0HA 4UQEA 1W37A 4LVGA 1ICSA 5D37A 2XIQA 3A6OA 2HQAA 4MB3A 3AHZA 4RXGA 4CNSA 1UKSA 5C55A 4OBRA 4NILA 4IX0A 1AZ1A 2DP3A 4NVTA 1J11A 4FEZA 3SCPA 4QHRA 2YL6A 1LRNA 2QUTA 2OFJA 5LIYX 3FV9A 4DRMA 1GZ1A 3O5KA 1X1ZA 3KFTA 3ARTA 5H2ZA 5FSEC 2WVUA 2XZ7A 4GI6A 2PBOA 4GOAA 7A3HA 3VOIA 1XLCA 2CZFA 4IQ2A 1BRLA 3FJ6A 4KCWA 3GU0A 1GKPA 1DIDA 2D3NA 4YJ5A 2EKCA 2XN0A 4HYVA 3ARRA 1WZMA 1E1CA 3BTNA 5E0CA 4YNGA 1AD4A 1FXQA 4QDWA 4DELA 1EHAA 2INEA 2NZLA 4G1KA 1NAL1 4URIA 3CLWA 2WJEA 4PTNA 1E4IA 4OVXA 3ARQA 5FESA 3S2MA 2DJXA 5CC7A 5C6MA 2JKEA 5L6UA 3KADA 3V1PA 3EB4A 3WCZA 4GO9A 2G3MA 2IKIA 3W7GA 2VEIA 1FKJA 4CQBA 4DM2A 3VI2A 4M51A 4FNRA 3L4XA 2I5QA 3QYQA 3LNPA 3MUAA 4UTWC 4QP0A 3RLGA 4J3TA 3SCUA 5D32A 3DESA 2M08A 4L9XA 1BHGA 3B4YA 3LM7A 4F9DA 3URBA 3B97A 4GX8A 2Z1VA 1F6PA 2EXOA 1TB3A 3L5AA 4FA3A 1MEIA