3RM4A

Amcase in complex with compound 1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
373
structure length
373
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 131
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm4A01
4MAVA 4DWSD 2W5FA 1FH7A 1WDRA 1VB9A 3ARUA 2VZVA 1Q6CA 3FAXA 2DQXA 4BZYA 2O9OA 4MJ2A 2VX7A 3VIJA 1GOOA 2EEXA 3VIHA 3AHZA 1UR2A 2BVDA 2E0PA 2WVTA 3B8SA 1HF6A 3KL0A 2OYKA 4V27A 5BRPA 5IHSA 3G6LA 4KWUA 3BAIA 4HU0A 3N04A 4P7QA 3FXYA 1GQIA 2PBOA 3O2LA 1GOQA 1NWTA 2YIHA 4AD4A 3AMCA 3N15A 5A3HA 1E73M 2VCCA 3RCNA 4HZ7A 3L4TA 2JFEX 3WD4A 3OG2A 1JXKA 4RE3A 3U57A 5A6LA 2EO7A 1DWGM 3AMDA 5D4YA 4HPHA 4MNLA 1KQYA 2ZUMA 3ZSSA 3VD4A 1W1PA 3CPUA 1CGVA 1MW0A 4B15A 3GNRA 4M24A 1E0VA 2W4XA 4D6HA 4FLQA 3SCQA 1V3MA 5A2AA 4MB3A 5JIPA 3POCA 1WKYA 1N82A 3VD3A 1C8XA 2J8FA 1GHRA 4J3WA 1X6LA 4PUDA 4C7GA 3AIBA 2XIBA 5ABFA 3PTQA 3A4AA 5CPQA 5LA1A 4CVUA 4QCEA 2BY0A 3RDKA 4M82A 2G3MA 2VC9A 1FP8A 1V6WA 3VD5A 1XCXA 1J18A 1X6NA 4Z2LA 2Y24A 3SUUA 1UD6A 4WJXA 4TVCA 3HU7A 5BXPA 1BYBA 1MW3A 3L2MA 1OBAA 3AIRA 1DHKA 4OBRA 2CKRA 5FL1A 1V6YA 3ARQA 1NOUA 3OGRA 2VCAA 5I2UA 3W82A 1H3GA 2ZUVA 3GNPA 1Q6FA 3BAJA 5LYRA 4W8AA 3VOCA 1WP6A 1GNXA 3G6MA 4LGXA 2CPUA 3IAQA 4CN1A 1AVAA 2EBNA 5CGTA 1KXTA 2JIWA 3TA9A 4D6EA 1UZ1A 2VQUA 1HJQA 1G1YA 2GUYA 3FHQA 1SR0A 4DWSA 3N13A 2WCSA 8CGTA 1UD8A 6CGTA 4AEEA 2ZX7A 1KWGA 1NWRA 1M7XA 2X8RA 4HZ6A 1XSIA 1EIBA 4J27A 4UQCA 2YKKA 1JI1A 3PTMA 3GYCA 2J7DA 1PX8A 1E6ZA 1W9BM 3FNDA 5EMYA 2CHNA 1E72M 2FH6A 4BA0A 3RJXA 4DM2A 1ODUA 1DTUA 3UESA 5C8BB 1MXDA 3VNYA 2OWWA 1E70M 2WCGA 3GXMA 3OZOA 1JYVA 3CIVA 3AIVA 2XVNA 1G0CA 1H41A 4C7FA 1HX0A 2WLYA 3OLGA 3ZT7A 4CGTA 5AYBA 1WE5A 1PIFA 2WM0A 2DSWA 2DEPA 2J25A 4XZBA 1QHPA 1YQ2A 1XCWA 3SIMA 2J74A 3WDQA 1E4LA 2WBGA 3MV01 1LWHA 1L0PA 2CEQA 1FH8A 1V0KA 1MYRA 4MTVA 1GOIA 4HU8A 4FF5A 2D20A 2V5CA 3VDBA 1E3XA 4FLRA 2UY2A 5E6YA 4PMZA 3VO0A 3EBVA 4F9DA 3NYDA 1EGZA 4CN4A 3POHA 4J7RA 4U3AA 1HKIA 5HNNA 1CGUA 4ACYA 3ZIZA 1BSIA 4M56A 4QCFA 3RPMA 3CZLA 3M46A 3MMWA 1J9YA 1TFVA 1WB0A 1PIGA 3UG3A 2G3JA 4PUEA 2ZUNA 3SCNA 1QBAA 1C92A 1LG2A 4WF7A 1DWAM 1PAMA 1H11A 5TD4A 1I75A 4JAWA 1BVZA 2ZXQA 1DWFM 4ACZA 4PMOA 4PCSA 2Y8VA 2GFTA 1J0IA 2GJPA 2EPOA 2A3HA 1ZBVA 1RH9A 3L2LA 3ZSTA 3AHTA 3WF4A 4AD0A 2O9RA 4H7VA 3SUTA 3L4WA 3DC0A 2J75A 1QVBA 2Z1KA 3OLIA 4GI6A 3VM7A 5F7UA 4P8WA 3W4RA 1J0YA 1CECA 1HVXA 1V0LA 5EB8A 3EMQA 5A8OA 1JDCA 3EMCA 2VTFA 1Q6GA 1TVPA 1XSKA 1CGXA 3SCOA 2VI0A 4URIA 2CESA 2J7BA 3N9KA 1UR9A 2VX4A 4UR9A 4PSRA 3APGA 3BSGA 3ARZA 1X1NA 3KWXA 1ISWA 1F4HA 3ARTA 1OD0A 1BTCA 1G5AA 2DSKA 5E09A 5D8WA 4XZWA 4KMQA 3QOMA 2J78A 2HVMA 2VNCA 4U5IA 5GNYA 4PTXA 5HXMA 1UWRA 1XRVA 1H0GA 5BROA 4GKLA 2XPKA 1J12A 3WQ8A 2WYSA 4LYPA 1KB3A 2XVPA 5CG0A 3WF2A 1QNQA 2W62A 1K9EA 1E0XA 4HOZA 1D3CA 3N1AA 4JHOA 2BHYA 4N42A 1JFHA 1FHDA 2Y8KA 1V03A 1NM9A 1BAGA 3AZRA 2VJXA 1E1FA 2WMJA 3GH7A 4OZOA 1DWIM 3RIKA 3SUSA 4AMCA 3WNLA 4NRRA 2G3IA 3FAWA 4HMEA 2GVYA 2YL6A 2DGAA 2PB1A 1KXQA 2VX5A 1AQMA 1BGAA 3DECA 3WD1A 2CHOA 3PTKA 1JD9A 2YA2A 1BPLB 3K4AA 4XV0A 5BRQA 2WC7A 1IZJA 2E4TA 2X05A 1Q6DA 1GOMA 1W1TA 3VIGA 4HMDA 4W87A 4MB1A 2PF0A 3T2OA 1C90A 2D2OA 2HISA 1NWSA 2CBUA 3BLKA 5M3WA 4UCFA 4KRUA 1U30A 3AYSA 4MB5A 1B3ZA 2CYGA 2VR4A 4M29A 2XYLA 1JZ8A 3WQVA 1E6XM 4AZIA 3VDCA 2E9LA 4H41A 3VVGA 1B3WA 4U3CA 4FK9A 4W5ZA 4JHZA 5KEZA 1NOFA 1IT0A 3K46A 1XD1A 4JCLA 4U5KA 3WBEA 3AQUA 1HNYA 1TCMA 2YA0A 1HJVA 4D72A 3S2CA 4IPLA 3AXXA 4M1RA 3MUIA 3GXFA 1NP2A 5A1AA 2VCBA 3FW6A 1EOKA 1E4IA 4CU6A 1CXFA 3ZJ7A 1UH4A 4ATLA 5I5RA 2XSAA 1GOKA 4XUYA 3AFBA 4WKFA 3WH9A 1VFOA 1UWSA 1E5JA 4CCEA 1NP0A 2J47A 1TUXA 3VGDA 1GQJA 5LA0A 2AMGA 5FKYA 3WD3A 3AIWA 2WKGA 3KZSA 3PZIA 4GZIA 2NW0A 3W25A 2D3NA 2EXOA 1ZBKA 1O7AA 3WFLA 3ZJKA 3B9EA 4AD1A 1BQCA 1H1NA 1ITCA 3GM8A 2IXUA 1W3HA 3ZJ8A 5A6BD 1HKKA 2CXGA 4P8XA 3VPLA 4B9YA 2JEPA 1LG1A 3K8KA 3WUGA 2W91A 1GVIA 4TX6A 3PZUA 2PWDA 1W9XA 4AZGA 1YHTA 1UD3A 1R85A 1UH2A 1E4MM 5ABFB 1C7TA 1EO5A 3EDKA 4MNMA 2RGLA 3O6AA 5D9MA 4GINA 2OYLA 3B9AA 3WH5A 1E6QM 2NT1A 2F8QA 2GK1A 3OLDA 2A3CA 1E55A 1QHZA 1JZ3A 3WY1A 3BAKA 2XUCA 1B2YA 4E2OA 1J10A 5A2CA 2WMIB 1CLXA 2XFRA 3MO4A 2BS9A 4U2YA 3VX1A 1CXHA 3VDAA 5CGMA 2X0YA 1B3VA 1W3KA 5I3DA 1E40A 2YLLA 2W67A 1W3LA 4LPCA 4ZFMA 2EPMX 5C70A 1A47A 3AYRA 3UEQA 1KXHA 2ZX8A 3RO8A 4AZCB 1I1WA 3MMUA 3W53A 4P8VA 3ZOAA 5ECUA 2EPNA 3UERA 1MW1A 2XM2A 1WDPA 4QLKA 3WD2A 1W1VA 4P8UA 1HN1A 2GSJA 1OIFA 1SMDA 1UWTA 4UFMA 1ZBWA 3RJYA 3VMNA 1K6AA 4RL3A 2D1ZA 3IAPA 1GORA 4ZENA 4QLLA 1NQ6A 6A3HA 2YDSA 4WK9A 5FIPA 5IFPA 1LL4A 3M7SA 3VUPA 1JYNA 5EFFA 9CGTA 4NRSA 3EYPA 3OZPA 1HJSA 3VGFA 3BSHA 3WUFA 1ODZA 3WKZA 3AISA 3EDEA 1UH3A 4QFUA 1QW8A 1ESWA 4YPJA 1D2KA 5AC5A 3VDHA 3WNPA 2VRJA 1GQKA 4NSBA 5CSUA 1B90A 1JNEA 1H5VA 4QDMA 1US2A 2WWDA 5E70A 2VZTA 3UG4A 2VURA 4PTVA 5A8MA 1C3FA 4M81A 4LYRA 1VIWA 2WMGA 3WL1A 1G01A 1W32A 3A47A 3FY1A 2BVTA 3AICA 3K8LA 2DSVA 3BAWA 2DIJA 2WMKA 3M6DA 1BGGA 4XX6A 1OGSA 4F66A 3K4DA 4DWSC 4L4OA 4AZCA 1M53A 2PWGA 3DHUA 1KWKA 2XVLA 4R27A 2W63A 2E3ZA 1JIBA 1ZJAA 2ZX9A 1B9ZA 4U2ZA 1Q4NX 2V3GA 3TTOA 1HVQA 4P7NA 3WF0A 4JFTA 4PMXA 2C7FA 4OIFA 1CXLA 5C71A 3WSUA 3OLEA 1MQRA 2ZWZA 4YHEA 3BAXA 1FFQA 1EA9C 1WCGA 1QBBA 3SURA 3CUGA 1BYAA 2YA1A 5GQBA 2CERA 4BQ5A 2OSYA 5KZ6A 2J7GA 3K8MA 1CENA 2UY5A 1TMQA 1DP0A 3SCPA 1CYGA 4FLSA 2FGZA 2XGBA 2WHLA 4TTGA 3WL0A 1GJWA 1JZ7A 4P7LA 1B0IA 1JF6A 2XM1A 1MXGA 1LJYA 1LLOA 2YL8A 3HMCA 3ZT5A 3QR3A 4CU8A 3QHMA 1PX3A 5DEZA 4UFHA 4H2CA 1NWUA 1M03A 4B9ZA 4JL1A 5BYWA 4Z2GA 4PMRA 4MNJA 3GXIA 2BY1A 3WFZA 1QNOA 2JF6A 2WPGA 4OJYA 1QI5A 2E9MA 5I78A 3MUY1 4UZUA 4PCTA 5AYIA 4D1IA 1GJUA 1W3JA 4UFKA 4ZEPA 1MQPA 1CNVA 1GONA 5CPSA 4AZ5A 3MU7A 5FL0A 1PX4A 3ZM8A 1FFRA 4CU7A 4F9JA 5I79A 1G94A 4GQQA 5I6SA 3SCWA 3AMGA 2YL5A 1KGXA 5D8ZA 1UR8A 2ZE0A 1ZS2A 2Q8XA 3GH5A 2WSPA 1SYTA 3T08A 4AYSA 4WSJA 5D9NA 3U5YA 4LYQA 3NSNA 3AS2A 1UA3A 3WQWA 2QMJA 4BS0A 3N17A 3LPOA 3RMEA 3SCUA 1MWOA 3IJ9A 1R7OA 4JKMA 2X1IA 1RP9A 3J7HA 2VRQA 3WENA 3UETA 4GQRA 4OOUA 2VVSA 5DMYA 2EQDA 1EXPA 4MAZA 4R5EA 2UY4A 3WIJA 4MB4A 2W92A 3AS3A 1MVYA 2XWDA 3BH4A 4HZ8A 3L4VA 1B3XA 1C7SA 3TTYA 3NSXA 2E8ZA 4M8UA 2DPEA 2G41A 3PZGA 4AZBA 1V0MA 1JAKA 4H8HA 1UG6A 4OBSA 4HA1A 1V3KA 2QF8A 3W26A 3RILA 4GO8A 1JZ2A 1VF8A 2DSZA 4YN5A 2VUYA 5M5DA 3VIKA 4K68A 4IPNB 4UTFA 3UG5A 4CD5A 2ZOXA 2WMFA 1BVNP 4CCDA 4FMVA 4M80A 3BAYA 4AIEA 4MJ4A 1TZ7A 2XFFA 3T2PA 1QPKA 1GCYA 4PMNA 1R87A 1XYFA 4DUXA 2FHBA 2ZX5A 1HIZA 1O6IA 4AEFA 1UKTA 1G9HA 3OGSA 1K9FA 3GH4A 2XHYA 4JL2A 3TP4A 5A8PA 1HT6A 2JEQA 1R86A 4J3XA 1XHGA 4EK7A 3WDRA 1OSEA 3I3DA 3VKKA 2XG9A 3CLWA 5E0CA 3ECQA 1V02E 1TR1A 4X0NA 3VIOA 5GNXA 5HOSA 1V6UA 4TUFA 1LL7A 5CPTA 3WDJA 3ZT6A 1UA7A 5E0FA 3OBAA 4CKQA 3WEMA 1C8YA 3VGHA 4HA3A 1WDSA 2C8NA 1HL9A 2OSXA 4BQ4A 2PWEA 3CMGA 4PMUA 3KL3A 1E43A 4AD2A 4MNKA 3CHDA 4UQDA 1QNPA 4JZ5A 4ZXLA 3KEHA 1EOMA 3WNMA 3MMDA 2OYMA 1UOKA 5CJ5A 5JBEA 1MW2A 2YDQA 2F61A 1GW1A 2ZIDA 4PMVA 3F5JA 4JKLA 2WXDM 2VQTA 1TA3B 4HOWA 1JG9A 3GNOA 4IM4A 3WN6A 2VT0A 3LPPA 1PZ2A 2CITA 1CPUA 3OIHA 2XVKA 3UR8A 4QAWA 4LX4A 3MSDA 4HA4A 4UFIA 1HL8A 1QOXA 4QLJA 4J28A 3D3AA 5IHRA 2XTKA 1U33A 2GJXA 3AIQA 3I3EA 3WDHA 1J11A 3WH7A 1VBUA 3CO4A 2XSBA 3PZTA 3WMCA 1GZJA 2ZXAA 1NH6A 1Y7VA 2DT1A 3GZAA 4ATDA 1QW9A 2PBGA 1TA3A 4GPNA 3WUBA 5JBFA 1W9PA 3EDJA 1C91A 1E1EA 3AOFA 3QHOA 5CLWA 1ZU8A 4AY1A 1JI2A 3F5KA 3WQ5A 4TTUA 1VFMA 4D1JA 3AS0A 1WZAA 1VENA 5HDRA 4JCMA 5FCZA 1OIMA 1UKOA 4FLOA 1K9DA 5IFTA 1EQCA 4KGJA 2QMKA 1XH2A 3BMVA 1C8QA 3MUAA 3NDZA 1JD7A 3SCVA 1US3A 1UR1A 2BHUA 4W7WA 1ITXA 1KCLA 1B31A 1PJ9A 1OWQA 4DWSB 1GHSA 1XH0A 3W29A 1EQPA 2OLHA 2DT0A 3PZ9A 1QI0A 2W61A 4X9YA 2NSXA 4E8DA 3W24A 1KR1A 4XB3A 3CZJA 3U7BA 1P6WA 5JBDA 2BNJA 1BYDA 1R8LA 3N11A 1ISZA 2XFYA 3WDIA 4HOXA 4HPGA 5I0DA 3L4UA 3CUJA 2BXZA 3L4XA 1V6VA 4JFSA 3I3BA 4D6FA 2OSWA 1HJUA 4AZHA 2X0HA 3DYMA 3AJ7A 3GXDA 4W85A 2J7FA 2WVVA 5FOOA 1IZKA 5A8QA 3N12A 2XWEA 4CD8A 5ABGA 2YL9A 2NT0A 1J0HA 3TTQA 4U31A 4WIWA 5DFAA 3VIFA 3NJ3A 5I23A 1JZ4A 3TONA 1W1YA 4JKKA 2YOCA 4D6IA 4MADA 3WBAA 4S3KA 1JNDA 1XH1A 3QGVA 1NOWA 2VOTA 2AAAA 3VIPA 1CXEA 1PBGA 4CN6A 2E8YA 1W9DM 3U5UA 3ZO9A 3THDA 1E0WA 3VD9A 4P7RA 1UWIA 1M04A 2IUZA 5M03A 1XC6A 2YJQA 4GO9A 3A3HA 2A3BA 4EE9A 1E4NA 4Q22A 1JZ6A 4MDPA 1EDQA 2BFGA 4OOZA 1UD5A 1ZJBA 1OB0A 2WBKA 4PN2A 2D0GA 3AIEA 3VGBA 2WMIA 2WK2A 3TTSA 5DO8A 2OWCA 3OGVA 3AHVA 1K9TA 3LPFA 4HMCA 1CGWA 3CH9A 1CLVA 3MKKA 1EDTA 2J7EA 2D22A 2IXVA 2GJRA 1E6NA 4W8LA 4BQ2A 3WMBA 2D3LA 4JFVA 4TX8A 1PPIA 1V3JA 1XYZA 4UQEA 2ZUTA 1HKMA 3PZVA 3CHCA 3HJEA 1D7FA 1UQZA 2ZICA 1WDQA 3EDFA 2UWFA 1JDDA 1WO2A 2V3EA 3BCFA 3WEOA 3WNKA 4S3JA 3SEPA 7A3HA 1WAWA 2ZWYA 3MSGA 3SUVA 2ZUWA 4IUGA 1BF2A 5AY7A 5D9OA 3WQ4A 1TE1A 5A6KA 3AMKA 3FN9A 3SCTA 4N0RA 1L8NA 2VL4A 4GI9A 5I24A 3IK2A 2E40A 3VMOA 2D24A 1UD4A 2A3AA 2ZUUA 3W37A 1VAHA 3CZKA 1C93A 3WMSA 4PMYA 4DUVA 4B3LA 2AOSA 4HTYA 1GPFA 1E6RA 3AMLA 2G3NA 3MUZ1 2WLZA 3T0DA 2BY3A 1HJWA 2QV4A 3WQ6A 3AXHA 5AC4A 4A4AA 1WZKA 4UOJA 2WVUA 4LQ1A 1JYWA 5HPOA 1E71M 2BXYA 4MDOA 3CHEA 3ARRA 1E5NA 2CBIA 1HJXA 3PN8A 3TOPA 4UOQA 4DM1A 1UKQA 1JGIA 2WC4A 1ISVA 3CUIA 5A6MA 5A6JA 3ZR5A 3GDBA 1AQHA 5JUVA 1OINA 4D6GA 2G8ZA 1JAEA 2V3DA 1CXKA 5BXTA 2DT3A 3RM4A 4CCCA 3CHFA 3A4WA 4J3VA 1ISXA 2QLYA 3SUWA 3VGEA 3CZ8A 2DT2A 1BG4A 3WD0A 1ZBCA 3LPGA 1OM0A 2DH2A 1CTNA 1ZB5A 1CBGA 2EPLX 4PEEA 1GVYA 3NCOA 4KH2A 1B1YA 3W6MA 4BF7A 2YDRA 3WH8A 1V0NA 4W84A 2JE8A 3THCA 1JDAA 5A69A 3VD7A 2GK1B 1UR0A 3MV11 1WPCA 1W91A 1BHGA 4RE4A 2G4FA 4W7VA 4AIUA 4W86A 2CBVA 3ARVA 3NSMA 1JF5A 1LWJA 4UNIA 3W28A 3GBDA 4PTWA 1QNRA 2WW5A 1FH9A 2X09A 2XIIA 4F8XA 4W8BA 1CXIA 1EHNA 4BQ3A 1QI4A 4KRTA 3IANA 4AWEA 1WZMA 5ABEA 3F4VA 3HN3A 3RM8A 4GZJA 4UQAA 2WNWA 5BWFA 2VMFA 7TAAA 2O9TA 1PZ3A 1KCKA 1KGUA 2TAAA 1FP9A 4H04A 3BLPX 4D6CA 2GDVA 3PZOA 4X0VA 4W7UA 5EFDA 4IISA 4JFUA 4TXEA 4LXFA 4EAMA 1UKSA 3LMYA 4ZXOA 1UKPA 1W2VA 2Y2WA 5IXEA 4AW7A 3ZR6A 3W0KA 2WZHA 3BGAA 2VR5A 2QPUA 1KXVA 2DSUA 2YBTA 4PYSA 4E8CA 4HP5A 2FH8A 3AROA 5BCAA 3T0BA 2WHMA 1OCQA 1VBRA 3O9NA 1H4PA 2ZX6A 3WDPP 4AD3A 4H8UA 1DWHM 1UD2A 5I77A 4ATWA 4TVDA 1VEOA 3DHPA 1UUQA 4WKHA 1ZL1A 1VFUA 1ISYA 3VINA 3WF3A 3WF1A 3CBWA 3T09A 4V2XA 1ECEA 3ALFA 4AZ7A 4EKJA 1GOWA 2EPKX 1V02A 2WHJA 1JYXA 1A3HA 2FGLA 7CGTA 2D0HA 3KE0A 3MS8A 3BMWA 5A6BA 5DT7A 1KFWA 3CGTA 1JXJA 4TVUA 2Y5EA 1V3LA 1QNSA 4C7DA 1JFXA 4GIAA 1FHLA 1I1XA 3ZMRA 4JIEA 5A94A 4CD6A 5A6AA 1V6XA 1QI2A 1KR0A 2WHKA 5HPCA 4AD5A 1VEPA 1LL6A 2WMHA 2X2YA 4J3SA 1WZLA 1OT1A 4PTMA 1VRXA 2ZXDA 2WAGA 3AIUA 2WB5A 2W66A 1F4AA 2GJXB 2WSKA 4ZE4A 1RD6A 5A95A 3ARPA 3VMPA 1HKJA 2DH3A 1OGGA 2J8GA 3AZTA 4W5UA 4UZSA 3II1A 4MPKA 3OB8A 1CZ1A 4GZEA 4Y7EA 2FDMA 2WVSA 1GUVA 1DWJM 3VU2A 2BV9A 1V08A 3A4XA 2JALA 1B3YA 2VZSA 1CGYA 2BHZA 1JL8A 1BG9A 1QI3A 3NUKA 4U33A 3BXWA 3EMZA 3GTNA 1J01A 2O92A 3FHAA 2JIEA 2PI6A 2GDUA 3DYOA 2PWFA 3VTRA 2V3FA 1IV8A 4ML4A 2PC8A 1V3HA 1XGZA 1H2JA 4UFJA 4A3HA 5JIWA 3ARXA 4DUWA 1LQ0A 3KL5A 2CBJA 2YLAA 2JF7A 5CZKA 1VFFA 3NDYA 1VJSA 4A3YA 1SMAA 1XV8A 1XD0A 2C0HA 2E9BA 1BFNA 2ZXBA 3F5LA 1HP4A 1WNOA 4CD4A 4Z2IA 3VILA 2V5DA 1TG7A 5GNZA 1VJZA 3DYPA 4P7OA 3CUHA 2Z1SA 4J3TA 3IJ7A 3VX0A 3UCQA 2J77A 1M01A 3WUEA 2A3EA 3ARWA 4Q7NA 1UZ4A 1AMYA 4AIOA 1EO7A 2ZUSA 3PZMA 1HP5A 3CMJA 3IJ8A 2B31A 5A6SA 1W9UA 3L4YA 1MFUA 5GPRA 1LF1A 3WEZA 4OKDA 1BYCA 2J7CA 4Z2HA 4UFLA 4GXPA 4JFWA 2Y4SA 2CIPA 2D23A 2V38A 1E9LA 3B9DA 2WZIA 1HXJA 3WH6A 2FHFA 4D6JA 1H09A 4V28A 3K1DA 3ARSA 1E6SM 2OWXA 1PEZA 4TOQA 8A3HA 4J3UA 4W88A 2O9PA 4B3KA 5DT5A 5E9AA 5LA2A 2VZUA 2J62A 1MFVA 3CUFA 3BC9A 1KQZA 5D9PA 2D0FA 1V3IA 1E15A 3AI0A 3MANA 1BLIA 1RP8A 2WANA 1MQQA 4PBGA 1S46A 3W6LA 4OUEA 2WC3A 1OD8A 1VEMA 5CLTA 5IDIA 1UWUA 1W9VA 1J0JA 4B16A 1EDGA 3S6TA 2WKLA 2XGIA 2J79A 3ARYA 1FA2A 4AISA 1CEOA 4H8VA 1UWQA 5CSYA 3L4ZA 4L4PA 3CTTA 3W38A 2VX6A 2BVYA 1H0IA 3EDDA 2PWHA 1E6PA 5DF0A 1CIUA 5CXPA 3SCRA 4PMDA 3WNOA 3WELA 4NF7A 5ABHA 4CVWA 4UQBA 2FHCA 1J0ZA 1SFSA 3E1F1 3UR7A 3VM5A 6TAAA 4F79A 2DDXA 2VVNA 4NI3A 1CWYA 3CZEA 2XVGA 5BXRA 1KBKA 3W27A 1NARA 3VIMA 2WWCA 2F2HA 2XJ7A 1FOBA 2BY2A 4UQ9A 4ACZB 3ZQ9A 1TVNA 3BCDA 2CETA 1XSJA 3RM9A 1EH9A 1E3ZA 4W89A 2VRKA 4UOZA 1RPKA 1OGBA 5HBFA 3WNNA 3GBEA 1OT2A 3SCSA 3AHYA 3T2QA 2WZEA 3PBGA 2J7HA 4CUCA 1UR4A 4NZCA 4PSPA 4Z2KA 1R7AA 3PZNA 4D6DA 1AQ0A 3AZSA 2VO5A 1UYQA 1KGWA 3OA5A 3D5HA 2WVVB 1U2YA 3VIIA 5A2BA 2WCAA 3VNZA 2UY3A 4PMQA 1CGTA 1DEDA 1GQLA 1KBBA 5FD0A 1EHAA 5E6ZA 1H49A 4KGLA 2MANA 4EANA 1JZ5A 4Z2JA 4CD7A 4WSKA 1QHOA 5EBAA 3M07A 3VGGA 3A6OA 1UHVA 4WKAA 4AC1X 3PHAA 3AHXA 4YHGA 2QHAA 1B30A 3U7VA 2EJ1A 2CNCA 2RGMA 4AXNA 1E56A 5A8NA 2J4GA 1Z32X 1J0KA 3AXIA 4WLCA 3T0AA 4W93A 5JH8A 4RE2A 5CQ1A 3NIYA 5BXSA 3N18A 2QPSA 2CCRA 3W81A 1UQYA 1W2PA 4ZE5A 4QP0A 2ESCA 3ALGA 2YBUA 1CDGA 4BCEA 4PRWA 3JUGA 2VZOA 2CKSA 3CZGA 3PZQA 3AS1A 3ZJ6A 3QOKA 4E4PA 4GI8A 3QHNA 5M17A 1Q6EA 2DIEA 4AZ6A 4D71A
chains in the Genus database with same CATH superfamily
4MAVA 1EJTC 3L0NA 1KRBC 1FH7A 4EVZA 4ZSTA 3AUJA 4FP1A 3RLVA 1R0MA 1MRAA 2VFHA 3REQA 3WK2A 2XH2A 3UWEA 1F7BA 3O5FA 3MSYA 2BVDA 3HG4A 1HF6A 1FY6A 4O19A 1Q7QA 2JKEA 1FKDA 3G6LA 2Y5JA 3GFXA 2PBOA 1GOQA 3EY6A 2FFCA 3CQHA 1QATA 4JYDA 1E73M 3RCNA 3BJFA 5FAGA 3BLFA 3MB9A 3U57A 2EO7A 3R11A 4MWAA 2BG5A 1NDVA 3E0WA 3M0JA 3KP0A 2Y85A 1W1PA 1YATA 3KCEA 4TMBA 1RJRA 2ATSA 3GNRA 5EYWA 4K3ZA 2W4XA 3NRKA 3SCQA 1J4HA 1V3MA 4YCOA 4MB3A 3H2EA 1N82A 1W37A 1C8XA 1A5LC 4JS3A 1GHRA 1OC7A 2XFWA 4E2BA 1UJPA 1P0DA 4PUDA 5AYXA 3LZ3A 4H9MA 5JXQA 1Z9AA 3EIPA 3KRZA 3Q94A 3EWDA 2BWGA 5LA1A 3BK0A 1WDWA 4L61A 3KS6A 2G3MA 5CG7A 2M2AA 3LD5A 1DXEA 1UD6A 3CC1A 4BF8A 2PWVA 1MW3A 1OBAA 3SGUA 3MA8A 4NXSA 1TTQA 2QULA 3P2VA 1V6YA 3OGRA 4WGXA 2VCAA 2ALDA 2M1IA 3W82A 1KFKA 2GUBA 5DXYA 1M5YA 1GNXA 3NZQA 3NQMA 1MMFA 4E5TA 2EBNA 5TBOA 2JIWA 1S5WA 3PR2A 4D6EA 4ZO8A 3ODKA 3BE7A 4FAMA 3M1ZA 2NQLA 1HJQA 5LNSA 3QKZA 1Q1CA 5KITA 3UG8A 5C9RA 1LUCA 2G37A 4XAPA 1UD8A 4WSHA 3GR8A 1F5ZA 3W9ZA 3JVAA 1TYGA 2DW6A 3IK4A 4YTSA 1NWRA 5EL1A 4LTSA 4JTGA 3LCWA 4DIAA 3W7IA 2QJMA 3U2CA 4KEUA 4C1KA 2FH6A 3I7SA 3DUGA 4DT4A 4BA0A 2OFNA 3PWGA 3VNYA 1T11A 3GXMA 4Q4KA 1ZP4A 4BEQA 2WSYA 2Q5AA 2WLYA 3OLGA 3ZT7A 3UQIA 4CGTA 3N73A 3G5EA 1WE5A 1PIFA 2BGQA 3UT0A 3ABZA 3LSCA 4XZBA 3UZZA 1QHPA 3ME3A 4D2JA 3BARA 5L6UA 3SIMA 1H7XA 3MV01 3CLMA 1PDYA 1RLDA 2CEQA 1TUFA 4C6NA 3PAOA 3LRKA 3K30A 3O15A 3BG9A 2DUZA 3WG6A 3S1WA 4PMZA 3BG5A 4L9YA 2PDNA 2VFDA 2WJZA 4FHAA 3TZFA 3NYDA 1EGZA 1A0DA 4CN4A 2FLIA 3M6YA 1OHLA 2V5JA 4Z0JA 1BSIA 4I9AA 1XIJA 4TQTA 1OEPA 1Q6HA 4LH8A 2C71A 4P2VA 5E0KA 1J9YA 1GZ1A 3QV7A 3TUUA 1PIGA 1J79A 1FCQA 2G3JA 3MY9A 1FWAC 3SCNA 2X7VA 3Q2DA 1LG2A 1DWAM 5T9BG 4UNLA 1XUZA 2VEKA 4O18A 1W5PA 4OVXA 3O16A 3RUBL 1DWFM 3UYCA 1VCFA 3A3XA 1AG1O 1J0IA 1RH9A 4MY1A 3G1AA 3WF4A 4AD0A 1J4EA 3L4WA 1CLKA 3K13A 4PL1A 3VM7A 1Z8AA 2F2KA 2VXNA 1CECA 3L7RA 5EB8A 3FIGA 5A8OA 4ZPWR 3C2FA 3UWWA 3WLTA 1TVPA 3SCOA 3SO7A 4LF1A 2CESA 1PSCA 4O4VA 4LVFA 2QR6A 5DANA 4IXHA 3M0ZA 4I7WA 3BSGA 5DLCA 1YEYA 5CSRA 3GXNA 2PV1A 1W8GA 3KWXA 1ISWA 4I90A 5D8WA 3L9CA 1FAPA 4IFKA 3GC5A 3WYZA 4LY4A 3T44A 1NAL1 2VNCA 4U5IA 4US5D 1UWRA 2PZ0A 1FWWA 1NFPA 4PUUA 4PTDA 2EPHA 4E8GA 3WFAA 5EMMA 1TPFA 2V69A 5HW8A 1P0NA 2XVPA 4XKYB 1KA9F 2O7QA 1A5OC 1E0XA 4QIBA 1DJYA 2OCZA 2BHYA 2Y8KA 1V03A 1NM9A 2HROA 4NX5A 1E1FA 1TTIA 3GH7A 3UXKA 3CAKA 4GCXA 4NYYA 1DWIM 3STPA 4M19A 2QCNA 4HMEA 1OFDA 2GVYA 2YL6A 1FCUA 2DGAA 3EOLA 4XZMX 5DO2A 3HQOA 3WD1A 1SO3A 1R3RA 3GG8A 2QW5A 3W1QA 2CHOA 4ZZ9A 1L1PA 2G5WA 4AX6A 4C1NA 2PPGA 4C6QA 2WC7A 1IZJA 3R8HA 5HNRA 1Q6DA 9XIMA 2ZA2A 3VIGA 4HMDA 4MB1A 2X1TA 3GDKA 3W7GA 3T2OA 2HISA 3XIMA 1U30A 3QW3A 3IV8A 3UU0A 3E6EA 4M7TA 3ABSA 2I9EA 3HBLA 1E6XM 1SR9A 1UUMA 4H41A 3VVGA 1NDZA 2V5LA 1VRDA 1KLYA 5MKGA 3S9YA 4W5ZA 2IKIA 4JHZA 4XK2A 2OMAA 1ZNNA 3UNTA 3KLKA 5HMEA 1Z41A 3MO7A 4O1FA 2ZQ0A 1HJVA 4B3ZA 1XQLA 2GPTA 3GB6A 4HHPA 3S2CA 3IPWA 3KAHA 1I2RA 4HBKA 2GL5A 4MZ1A 4WQ6A 4R85A 3C3NA 1E4IA 4CU6A 1TWZA 3CB3A 1GOKA 2B81A 5FEZA 2QCDB 3WQGA 2E25A 6REQA 3VGDA 3WLOA 1IT7A 2AMGA 5T8GA 5D2XA 3W25A 2D3NA 1VBHA 1H5YA 2QPXA 3ZJKA 5CC7A 3LCLA 3B9EA 2ZTJA 3B97A 2UBPC 4MVAA 3OHIA 3GM8A 1ITCA 5CPLA 3QR0A 4HCDA 3N2CA 1FKJA 3WBYA 2FVLA 2CXGA 2JEPA 2Q09A 3W75A 1KRMA 3K8KA 3IIZA 2ETNA 2PWDA 3KCJA 4CNTA 1BWVA 1YHTA 3LUOA 1R85A 1UH2A 1DE5A 5AOUA 5ABFB 5I3GA 4JTKA 1PZ0A 3TIMA 3SRDA 1DORA 4JTJA 4KCUA 4LCSA 4NY2A 3LHVA 1WKEA 1TMLA 3BAKA 3CV6A 3WY1A 5LHEA 2XUCA 1B2YA 1SM9A 1F6KA 3GHSA 2XFRA 3UPMA 3G3DA 2XIMA 2YGYA 3MO4A 1PV8A 3H2MA 5RUBA 1G7UA 3GVRA 5AC8A 2X1SA 4DYKA 2IPWA 1FHVA 2PPOA 1B3VA 3S47A 3H4WA 5IOBA 1LBMA 5I3DA 1E40A 1IXOA 2AMXA 3W7NA 2EPMX 3EOEA 4DRQA 4HB7A 3N2BA 5BW6A 2ZX8A 1U22A 4C65A 3PB2A 4F0LA 1RV8A 1IT8A 3W53A 4P8VA 4UUIA 3LLXA 4QLKA 1H1ZA 4P8UA 3CIXA 3IV3A 3GK0A 3W3OA 1D7IA 4UFMA 4LBSA 1GORA 4ZENA 4QLLA 1BXNA 3E0FA 3TXVA 1POJA 1YNYA 2YDSA 4N19A 3A21A 2PA6A 4RNFA 2CLLA 2W3ZA 3ZZ1A 5EFFA 4NRSA 1KM2A 3EYPA 2ACRA 3OZPA 3VGFA 3BSHA 1S5TA 1ODZA 1UH3A 1QW8A 1ESWA 3NL2A 3VDHA 2W27A 4LY8A 4MWAB 3L23A 4UIOA 3TTEA 5CSUA 1XJBA 2D2GA 1JNEA 4XZNX 1H5VA 1US2A 5ENLA 4PTVA 5CZSA 4HNNA 1DKWA 1EYWA 2WMGA 1VFSA 1FHUA 1W32A 3H26A 3FY1A 1XLAA 2DIJA 2I1OA 1OGSA 3OZMA 3GS6A 3IJQA 1FWHC 1M53A 4EIVA 3NXLA 2W63A 3SJNA 4DF0A 3IJDA 3PFRA 5B80A 1QOQA 5FJPA 1TV4A 4PMXA 1DBTA 1MNZA 1OG6A 1CXLA 4QZVB 3MZ2A 3VOJA 5C71A 1UMLA 4XD6A 1EA9C 1V7AA 3KOYA 3HMJG 1BYAA 2YA1A 5GQBA 4AQLA 3IUDA 5KZ6A 4M1BA 4L7ZA 2NXGA 5MF5A 3R8RA 4JFKA 2C1GA 1E9IA 7REQA 2QCLA 5HR6A 3JW7A 2XGBA 4TTGA 3WL0A 1Q6RA 3VNLA 1CB7B 1C29A 1QK2A 1JZ7A 4RDZA 4MYAA 2CLPA 1JF6A 1ICSA 2Z6JA 3P7YA 1YW5A 4AB4A 5HJYA 1F07A 1LLOA 1ZY9A 3E02A 3W2MA 4CU8A 4OUIA 2YBVA 4RNJA 2ACQA 4X3ZA 2ABBA 1XDMA 2GOKA 3PB0A 1UIPA 4UFHA 1NWUA 1BWKA 3LGEA 4JL1A 2ZRVA 5LNVA 4PMRA 5CSSA 3WFZA 4PR4A 2E5CA 4OJYA 4N7QA 3URQA 4EWND 4JTQA 1XYCA 3MP3A 1O12A 1W3JA 1A0CA 4RKAA 3ES7A 1CNVA 1GONA 5CPSA 3SFWA 3MU7A 5FL0A 1PX4A 1FFRA 2OZ0A 3H6OA 1YNPA 1DJNA 4POCA 3AMGA 4HYRA 3P5YA 1XXXA 1ZS2A 3HPFA 4UR7A 2PDCA 2RFGA 4IPPA 3ZR4A 3GIQA 2YFOA 1Z48A 2QMJA 4RZ5A 3N17A 5FA5A 3OVGA 1G4TA 3KBMA 2X1IA 2ZVRA 3EA1A 3A23A 1EZWA 4OOUA 3RITA 2WM1A 1ONEA 2EQDA 3RK8A 4RZBA 4R5EA 2UY4A 2DZVA 2V82A 2WZTA 3QFEA 4QDWA 4F0SA 5CCZA 3L4VA 4WGHA 1C7SA 3V0UA 3RR1A 2O4QA 5FF0A 3KM8A 8XIAA 1F8MA 4H8HA 3B7XA 2QF8A 1DJIA 3PJUA 3UFYA 3SI9A 2DZBA 3DGBA 1WKFA 3RPTA 3RCMA 4PMJA 4K68A 2OQHA 4UTFA 3UG5A 1XLDA 4CD5A 4GQ0A 3Q4DA 4S1FA 2YZ5A 3LEPA 4M80A 4G7EA 2WQDA 4MJ4A 3T2PA 1QPKA 3R89A 1NTHA 4XZIA 2R1PA 1GCYA 4K8HA 4AVFA 1R87A 1XYFA 1U5VA 4O14A 2ZX5A 3R79A 1P5BA 2BOGX 3UXLA 3R0DA 2ZR5A 3PUEA 4WOZA 1HT6A 1RBLA 5DCDA 4U4MA 2J6VA 4J3XA 3LTPA 1OSEA 3FA5A 3I3DA 4RCXA 3KAIA 3EKLA 3VKKA 2JKAA 1S38A 4H00A 3GXTA 4TIMA 1XBVA 1V6UA 1LL7A 3ZT6A 2H3DA 4NAEA 5E0FA 3R43A 3FCPA 2BGNE 4AYGA 2V6AA 4JTIA 1ZALA 9XIAA 1FBAA 1HL2A 3WEMA 4HA3A 3FKRA 2OEJA 3T0CA 4BQ4A 2PWEA 4XVDA 1E43A 4AD2A 4MNKA 2PDGA 1A5KC 2ISVA 3M0MA 4NZJA 1L2UA 5JBEA 3QYSA 1MW2A 4H4IA 2F61A 3HPXA 1EGMA 3I6TA 2P0IA 5LZLA 4HOWA 1F3EA 2DUXA 5G2IA 3UPWA 4IM4A 4FOUA 3Q67A 1VS1A 2VT0A 2YCLA 2I57A 3LPPA 4H8NA 2VFFA 1EC9A 1AZ2A 4D9PA 2QEZA 1SZRA 4J35A 2LKNA 4QLJA 3TQPA 4J28A 5B7ZA 1U33A 3P8JA 2E6YA 1ZCCA 3AIQA 2ISWA 5C9WA 3ES8A 1TJ0A 3NWRA 3GY1A 2PDKA 4UTKA 1SO6A 1JQVA 3WMCA 2ZXAA 5FJJA 1QW9A 4GPNA 4MYXA 2R1MA 1W9PA 3EDJA 3EX1A 3LDVA 3QHOA 1LRTA 3F5KA 4ODRA 4K8GA 4NZFA 4LAKA 1YDOA 2H9AA 1R46A 5C2GA 5PTDA 1VENA 3LCHA 5FCZA 4FLOA 1Q4WA 5IFTA 2PRLA 1VYSX 1YTDA 1GEHA 1C8QA 3NDZA 1SO4A 3SCVA 1UR1A 3MJMA 3KVJA 3H23A 1XIIA 1R5YA 1PJ9A 1XH0A 3VKDA 5AN7A 4H3DA 2DG4A 3P81A 3M0LA 2OLHA 3RAOA 3KADA 4EXBA 4ZOEA 2FJUB 4X9YA 5EMJA 4E8DA 2AL2A 3ITOA 3CQKA 4DWDA 3CZJA 1P6WA 2FKPA 2BNJA 1RR2A 3NZ1A 1HUVA 3N11A 2CZVA 4OTKA 4ZO9A 4HPGA 5I3HA 1XG4A 2Q02A 4K2SA 2BXZA 3SY8A 3AWNA 1FWNA 1KTCA 3H7RA 4US5A 3I3BA 5CZJA 2V9DA 2NXHA 2NX9A 2L2SA 3GHTA 1IGWA 1J4RA 5IRPA 3AJ7A 3GXDA 5F2IA 3N4EA 1WDDA 1AW5A 3QGKC 2DU2A 5A8QA 2XWEA 4CQBA 3BJSA 4WDUA 4IL0A 3VIFA 4A2RA 3NJ3A 3TONA 5B7YA 2C1HA 5DITA 1W1YA 4JKKA 3V0TA 4D6IA 4DNMA 4MADA 2OLSA 1Q13A 4XSMA 1TCOC 3BDKA 1NOWA 2VOTA 1SFJA 4CN6A 1FWSA 3D46A 1W9DM 3THDA 4G7FA 1XC6A 2OOFA 1XYLA 1E4NA 3MKCA 4Q22A 2PP0A 1JZ6A 1YXYA 4S3BA 5FEXA 3U6WA 2A2IA 4QT3A 5FESA 3ONCA 2RAGA 2WBKA 4FI4A 4JTCA 5CEWA 1SU5A 4F0KA 1WUEA 1VQTA 2WMIA 4TX9A 2WK2A 1S2WA 3DKJA 3V5OA 3Q37A 3UF9A 4I5RA 3VCNA 1XPGA 2X42A 5J6EA 1GG1A 5DMLA 3GG1A 4ADUA 4GI4A 4ADSA 4PB5A 4MIMA 4YVXA 1XYZA 4UQEA 3KABA 1YW1A 3LS9A 1HKMA 2RUCA 4Q8UA 3HJEA 5DN1A 1J6OA 2GGGA 3EDFA 4NJKA 4EOUA 2UWFA 2FZDA 2GVJA 4FEZA 4JIQA 3DEQA 1R30A 4IUGA 1NVMA 1M1BA 1BF2A 1SFLA 4JQ2A 2R1NA 5A6KA 4MY8A 2CFFA 4RXFA 4N0RA 1PTGA 3SQLA 2VL4A 1G4PA 4QG9A 2Z25A 2XN1A 4E3TA 2E40A 3URNA 5AC7A 3E0VA 4X63A 2A3AA 3W7MA 3BPWA 1VAHA 1C93A 4PMYA 3NOYA 4B3LA 4E6MA 2QCMA 3NQ2A 4ILSA 3ID7A 4IX2A 2WPBA 2QDEA 3T0DA 1NQKA 1ZAJA 1XRFA 4S3CA 4LQ1A 3CTLA 5HPOA 1KBLA 2PE4A 5AVHA 2BXYA 3TQKA 2PTXA 3CHEA 3ARRA 1MEIA 4PA8A 5FACA 1HJXA 3WLLA 2WC4A 3ZR5A 3GDBA 1XG3A 1FX6A 4O0KA 1DIDA 2V2DA 4KCTA 1JAEA 4B90A 3KVKA 5BXTA 4HNCA 4Y9AA 3CHFA 2HJPA 3A4WA 4GIRA 3SUWA 3CZ8A 4L4LA 3TH6A 1EC8A 4NG3A 1TCDA 1F40A 3T42A 2D2HA 4L56A 1SZEA 1N8FA 3NCOA 3UPBA 1B1YA 4LBUA 4W84A 3B8IA 4ZQRA 4JBRA 4PODA 1JUBA 3MCNA 1LT8A 4M7SA 4HPNA 1WPCA 1UOZA 1W91A 5AC6A 4RE4A 2G3FA 1E0UA 1PINA 4W86A 3GBDA 2O7SA 3L2IA 4EPEC 1KCZA 4IT1A 3WQFA 3CGMA 1Y65A 2X09A 3H54A 1CXIA 1EB3A 4HHMA 4BQ3A 1QI4A 1GZGA 1Q85A 3OVRA 3BSMA 3VFLA 1SGJA 3EAUA 2WZMA 3C56A 4N4QA 2V0TA 3LGDA 4ODLA 2A1YA 1AFSA 2VMFA 3NQEA 5EBUA 4XZ9A 1KCKA 1F73A 2F84A 3PZOA 3PSVA 3UJFA 3QV8A 3R4IA 3N6JA 1GVSA 4XTIA 1EKOA 4H6RA 3ZR6A 1J6PA 3QLLA 2VR5A 3AUOA 1VKFA 1ROUA 2DSUA 4I8YA 4PYSA 2C3ZA 2FTYA 4HK7A 4LUSB 4ZO7A 4DJDD 1GTEA 2G97A 4ATWA 1S5MA 3W1AA 4NI8A 1I6NA 2WV8A 3VNJA 1UUQA 5K4ZA 3W2JA 1VFUA 3LHTA 4JXCA 3VINA 4TO8A 3WF1A 3TV8A 1JCJA 4RPQA 1AD1A 2Z0IA 1RY0A 4B2DD 4FXSA 4ICNA 1GOWA 1V02A 2BP1A 4NJGA 3NO5A 1JYXA 2WJFA 1O5RA 5D2YA 3W71A 3TSMA 3VE7A 3UXDA 4QM1A 4DJEC 4HVXA 4GY7A 4IXXA 1ZENA 3W74A 4L4MA 1JXJA 1XBXA 3I4KA 4O1CA 1SVDA 2YXXA 3QN3A 4GIAA 1PCKA 3QVQA 1SSDA 1JCXA 3QV9A 5A6AA 2YCLB 1KR0A 3L68A 2WMHA 2X2YA 1I2QA 1WZLA 4BHYA 4PTMA 2FZNA 2VC5A 3H22A 2ZXDA 1YBQA 4YJ5A 3AIUA 4TYOA 1F4AA 4RR4A 3ARPA 4ZTXA 1KD0A 3W87A 2PTZA 2CLMA 3EWWA 1OGGA 2OKTA 3DX5A 1S3HA 3IGXA 4DBEA 3S9IA 4UZSA 5K7JA 3II1A 4MPKA 3B4UA 4GZEA 2FDMA 2BV9A 1V08A 2JALA 4BFAA 2Q8ZA 2HMCA 1CGYA 2BHZA 1JL8A 1BG9A 1S3TC 2DZWA 2FFIA 1J01A 1GVFA 3F2DA 1EL3A 3V18A 3UW6A 1YADA 2PWFA 2V3FA 2PC8A 1TPEA 4UFJA 2PRHA 4G50A 1KBJA 5JIWA 3ARXA 4GH1A 4NKCA 2VGFA 2YLAA 4K36A 3DKLA 3LXAA 1PUDA 3UGRA 2CLFA 4ZB5A 1O66A 1VJSA 5G4EA 3VKJA 3T8LA 3SSJA 4PH6A 2R1KA 3A64A 1XD0A 2C0HA 2AWGA 2ZR6A 3VILA 4IIHA 5DMNA 5AFDA 1TG7A 4C5ZA 5GNZA 4NAEB 1VJZA 4AVNA 3CUHA 2Z1SA 1DOSA 3QY6A 4YS1A 3VX0A 4B5TA 1UZ4A 1A5MC 4B5XA 2ZC8A 3MDWA 3CMJA 3QM3A 3IJ8A 3L4YA 3MC5A 5GPRA 3ITVA 3WEZA 1O60A 3WH6A 1HXJA 1NEYA 5FJOA 3ITXA 1E6SM 4FXRA 3VKBA 2O9PA 5E9AA 3CUFA 3TJXA 1V3IA 3UZYA 4Q8TA 5BRBA 3IACA 4BI6A 1BLIA 4HIBA 3EB3A 4EF9A 1K7EA 4PBGA 3OTRA 3ABOA 4OUEA 1TZZA 5CLTA 1OD8A 1TV8A 1DTNA 2OJPA 3DENA 3HG5A 3CPRA 3TLQA 1EDGA 2FZMA 4DPQA 4GVHA 2HQAA 4DXVA 1F76A 2J79A 2HWGA 1FA2A 4S2CA 3NPVA 2PAJA 4H8VA 3IGUA 1FXPA 3IWPA 1CT5A 2C14A 3O5DA 3A12A 4PFMA 1KC7A 3T4WA 7TIMA 1QDSA 1TRDA 2KAUC 4ITZA 1DIOA 3CYVA 2XPAA 4UQBA 2FHCA 3PNZA 3ABRA 1N7KA 3E1F1 2CC0A 3SM0A 3UR7A 3VM5A 6TAAA 3CV2A 1VJIA 4NI3A 3CZEA 4KEMA 2XVGA 1W5QA 3W27A 1BRLB 1NARA 3QSRA 2TPSA 4A3QA 2F2HA 1PIIA 3NO3A 2E09A 1TVNA 3BCDA 3T8QA 1IXNA 1SJBA 2ODOA 3RM9A 1IYXA 1E3ZA 4W89A 2VRKA 4UOZA 5GJMA 1FWFC 1FKLA 3WNNA 2VEMA 1OT2A 4GVIA 3SCSA 3T2QA 4MSPA 1UR4A 2ZYFA 1AQ0A 3GXPA 1POKA 5I3IA 1UYQA 2E68A 3BTNA 2OOGA 4FXFA 1QXLA 4O17A 2MLZA 3KRSA 5BMXA 2WVVB 5A2BA 1AQFA 2WCAA 4PMQA 3L0GA 4B5VA 1JZ5A 3QMSA 4YIWA 4UTTC 5EBAA 3VGGA 1HKVA 5CAHA 1WOAA 4WKAA 2IKHA 3PHAA 3CL7A 4KFNA 3AHXA 2D73A 4D8ZA 1B30A 3TN6A 3U7VA 2EJ1A 3GC2A 3LCIA 3S0CA 3V16A 3DOPA 5A8NA 3LLDA 5HW6A 1XCFA 4GUIA 2J4GA 4O8RA 2AL2B 3WCZA 3AXIA 3LMZA 5LXXA 2QV5A 4AAJA 3GC4A 4LCRA 5F2LA 3QKEA 1TJPA 1UQYA 3WK3A 1PTDA 2L5HA 2ESCA 4QNWA 4TV6A 2YBUA 3LHZA 1EEPA 4MKNA 4MG4A 3B0YA 3O6CA 1NJJA 4NAFA 4LRTA 3ZJ6A 3QOKA 1YDYA 1R3QA 2ZADA 4GI8A 2VN1A 3EXTA 1FWEC 2G0WA 4AZ6A 4D71A 4DWSD 1LLWA 1KM1A 4H9UA 1L2QA 1TWWA 4Q4QA 1QNVA 1R3SA 2DQXA 4EPKA 3VIHA 3AHZA 4DX3A 3B8SA 1DQXA 4LC6A 4MLRA 3C3UA 1K7FA 2OYKA 3RRAA 5IHSA 3B8UA 2A5HA 2NWSA 4HU0A 3FXYA 1GQIA 4ENLA 3H2FA 5A3HA 3HPAA 3MHGA 4WEVX 3EB4A 3MP4A 4C6IA 3QPZA 3L4TA 3OG2A 3GU2A 1JXKA 4RE3A 3CM4A 1TJRA 5D4YA 3NGJA 1YMYA 2XH0A 2QAPA 4A05A 1B57A 5AHLA 3TCSA 3BOFA 4IGNA 3QF0A 4A8IA 1MW0A 3CUZA 3KCOA 3R58A 4M24A 1E0VA 2RUSA 4A8NA 2R9RA 2Y88A 5I7GA 4UMBA 2B7OA 2YCEA 1XGDA 1ZK6A 1SW0A 1AZ1A 2HE8A 5JIPA 1ML1A 3POCA 1Z6KA 3IHZA 2HV5A 2PLCA 4LV9A 3AIBA 2XIBA 1W0MA 3IGHX 5CPQA 4AC7C 5EA9A 4QCEA 2DJXA 3N3MA 4L1XA 4Z1AA 4DELA 2E6FA 4UTMA 1FP8A 1V6WA 4FOKA 3NPWA 1XCXA 3GR4A 4Z2LA 3SUUA 4WJXA 3LM7A 3HU7A 2I9UA 3AIRA 4GUHA 3TQ0A 1R3VA 5FL1A 2H8XA 1FWDC 1AL8A 2EG7A 3E5BA 4MUPA 4GBUA 4S3GA 2WKJA 4LCQA 5LYRA 1SPQA 4Z17A 3IAQA 1W3NA 4CN1A 2QIWA 1AVAA 1BRLA 1QPLA 5CGTA 3N4FA 3TA9A 3C0JA 1OQFA 4IMGA 2VQUA 5AZ1A 3MHUA 3MZNA 2ZDRA 2HBXA 3MDYB 5I3FA 1XLJA 1LROA 4Y9OA 1JRCA 3NPUA 6CGTA 4AEEA 4XQ6A 1RJQA 1SZGA 1O1HA 4HNUA 1M7XA 2X8RA 3MT1A 2VYOA 3SBFA 5CGQA 1UWAA 2YKKA 3LOTA 1QAPA 2VDIA 4PUWA 3PBUA 2J7DA 1FQ0A 3QH2A 3SGGA 1XC4A 3RU6A 1BKSA 1E72M 4XO6A 5E9XA 4DM2A 1DTUA 2NVDA 1MXDA 3TAOA 2WCGA 3OZOA 4GC4A 1GYMA 2W0UA 3QPYA 3CV1A 2VCDA 2WM0A 1YPIA 3R10A 4RXGA 1ZRQA 2OO6A 3M5ZA 1YQ2A 3NDOA 2PP3A 1LWHA 1L0PA 1MYRA 3HIJA 3URAA 4MTVA 5HWBA 5HT1A 4AWTA 4LUYA 3VDBA 1MSSA 4YVVA 5E6YA 1G4EA 3VO0A 1YRRA 1JPMA 3G1DA 1UZDA 4EP8C 3S83A 1YYAA 3VUSA 2H3BA 4J7RA 4U3AA 2PDWA 4WDXA 4R7WA 5BMWA 3AC0A 4PUJA 4QROA 3VXGA 2NQ9A 3VC5A 1TV3A 3ITGA 4QCFA 3RPMA 1BKHA 4KRZA 3CZLA 3W7HA 3M46A 1EGVA 1E9YB 2QS8A 1F6YA 4WF7A 3FVMA 1H11A 5TD4A 1I75A 1OCNA 1RZMA 4DZ2A 2XDFA 4RZ4A 1Y0EA 1P0BA 2VELA 4PMOA 4ACZA 4PCSA 2Y8VA 1GJPA 5IBXA 2GFTA 3DXIA 1FWIC 3TYUA 3ZSTA 4NNCA 3ATYA 2J75A 3MDUA 1XBZA 1XLLA 1V0LA 4GISA 2PLMA 2FZ9A 4IQLA 2VTFA 5C55A 4K37A 2VI0A 1V77A 2J7BA 2CZDA 3N9KA 2PGEA 1TPUA 2VX4A 5TF0A 3APGA 2X1RA 4TV5A 4GWEA 3ARZA 5T9CE 1X1NA 5H8UA 1F4HA 3ARTA 2VFGA 2DSKA 3FJLA 3T6CA 4XZWA 2E77A 1UROA 3QOMA 4JGDA 4Q8MA 3E38A 4G7EB 1C9DA 2P88A 4UCGA 5TQLA 1RY8A 5D02A 3T55A 3QFWA 3PPGA 1KV8A 2XPKA 4OV4A 3DESA 4ZBCA 1OK4A 1G4SA 4LYPA 4Z08A 3USBA 2GQ3A 3O5QA 4GFSA 4JFLA 2W62A 2NX1A 3G3MA 2ZBTA 3LHYA 1D3CA 4JHOA 2I56A 2H9AB 1D7JA 2GVGA 4O52A 4CNUA 3D6NA 3OO2A 2BZNA 4KWWA 1FKXA 2VJXA 2ZDSA 2WMJA 4OZOA 1E0TA 3RIKA 3O07A 2NQHA 3CEPA 3IGSA 2G3IA 3FAWA 2HVOA 4PL2A 1KTBA 2NUWA 2PB1A 1KXQA 1AQMA 1BGAA 1TJ2A 4A3RA 3H2OA 1BWLA 4GOAA 4XZLX 1XS2A 4MHBA 3CEUA 1KNWA 2X05A 2XZ9A 3HTWA 3QZEA 3PA7A 1O1ZA 3NFUA 1ZJIA 4W87A 2PC4A 2PF0A 1C90A 2C18A 2D2OA 3SN0A 4TW7A 1UP3A 5M3WA 3AYSA 4I7VA 5CKSA 2LPVA 2CYGA 2VR4A 3H2NA 3ITCA 4C91A 4Z1DA 4M29A 4BI5A 3MMTA 1AL7A 1W31A 1JZ8A 3FA4A 4HA0A 4MM1A 2E9LA 3L5LA 2NV1A 4U3CA 1TIMA 4FK9A 3WLJA 4O13A 3WQPA 4G2PA 1W6TA 1NOFA 2D2JA 4JCLA 4U5KA 1XINA 3AQUA 5C2CA 4HQVA 4M0XA 1AW1A 5HATA 4IPLA 3AXXA 4M1RA 3ZVHA 4QEEA 3GXFA 1OFRA 2PURA 2VCBA 3HJZA 4KKXA 5AECA 2OQYA 3HZ3A 4WOQA 3VZZA 2WSQA 3AFBA 2LJ4A 1VHCA 1VFOA 2ZFAA 1UWSA 2XGZA 3WLQA 3MVIA 1K77A 5LA0A 3U48A 3XINA 4X9SA 3WD3A 3AIWA 2WKGA 3PZIA 4GJIA 2NW0A 2PTDA 2Z1VA 2QJIA 3O5OA 3M5XA 1OX4A 2IXUA 3ZJ8A 3TK7A 3G1RA 1HKKA 4P8XA 3VPLA 1AA1B 1K3UA 4QEHA 3W84A 1XI3A 3GDTA 3WUGA 1A5SA 1GVIA 2ZTKA 2P50A 2XIOA 4TX6A 4LAYA 4ZL1A 3OOBA 1TZ9A 2JGQA 1UD3A 4N02A 2OB3A 1OFOA 1VZWA 4L64A 3EDKA 2KX9A 4JX6A 1KFJA 4MNMA 2RGLA 3G1VA 3KUMA 1GVQA 4GINA 2OYLA 3VOGA 4HN4A 2O56A 5BOEA 1OY0A 1E6QM 4XAGA 2XH4A 1P4CA 5DIUA 3STGA 4LW7A 4Q32A 4HU3A 5G1MA 3O5MA 4K8EA 2FYMA 3VC6A 1QRQA 3LCFA 4F48A 5H8PA 1P1MA 2QJNA 2AAMA 3VX1A 2VWTA 2E6DA 5A6TC 1W1A1 1L6WA 2ANUA 2X0YA 1VFHA 4O53A 2V2CA 4QS5A 3W88A 1I9CB 1W3LA 4N2YA 4RV3A 4DO4A 1A47A 1DE6A 4TMCA 3AYRA 4UB9A 3RO8A 1TRIA 3MI6A 2PRMA 1JNSA 3TLLA 4DLMA 3ZOAA 3UERA 1MW1A 3U2ZA 4RJEA 1WDPA 1A5CA 4QJ4B 1HN1A 4AWSA 1ZBWA 1NFGA 2OT1A 3SQMA 1K6AA 4QIUA 4RL3A 2D1ZA 3U4FA 1WKDA 3G24A 1NQ6A 6A3HA 3AU2A 3PC0A 3UNDA 3VUPA 4K7VA 2FAPA 1JYNA 4EACA 4JQAA 1FWCC 4W9QA 3AISA 2QT3A 3S6DA 1CCWB 3WLSA 5AC5A 1N8WA 1FKKA 1A7XA 4IUOA 3I7QA 4JTTA 1D8CA 1WOBA 4ASTA 3BURA 3VCRA 1HG3A 2DVXA 4B5SA 3OA3A 1B90A 4E2VA 4QDMA 2WWDA 5E70A 5EU9A 1OC6A 4CQ8A 4M81A 4LYRA 4DI8A 2YFNA 1G01A 2HK1A 2BVTA 2DSVA 1NF7A 3M6DA 3FX4A 3TAKA 3M5YA 2PTYA 4XIAA 1E1CB 4F66A 2QQ6A 4DWSC 4L4OA 2PWGA 3B0XA 3QQ1A 4IP5A 1DQUA 3CNYA 3H21A 1Y5XA 1Q4NX 2V3GA 3TTOA 4U84A 1V79A 5DMMA 3C8FA 3O5RA 4N9DA 5DXXA 3PUOA 1MQRA 3BAXA 1FFQA 4I9JA 3SURA 3GU0A 5I00A 5CBJA 3ITLA 5FF3A 3RX3A 4BQ5A 3TW9A 1XLCA 2DY3A 4CQDA 1X97A 3B8VA 2QCHA 3K8MA 1JCMP 3KFTA 2UY5A 1OYAA 3HGRA 3B40A 4IIGA 3TSDA 1DP0A 3SCPA 4WY0B 1FXQA 4LFYA 3G1YA 3ZVHB 1OZMA 4P7LA 4REQA 1B0IA 2DZXA 1D6OA 1MXGA 4HN8A 4LVGA 5KINA 2YL8A 3ZT5A 1XW8A 4JYFA 4HCHA 1RBAA 1M03A 4B9ZA 4ONVA 2YCJA 3S2MA 3IVUA 1VBJA 2BY1A 5KZDA 3KBJA 1QI5A 4QQUA 3HM7A 5I06A 4UZUA 4PCTA 4D1IA 4ZEPA 1A4LA 3OYZA 2Z1WA 1HFBA 2Z1BA 4AZ5A 1U5HA 4CU7A 3OP2A 3KCLA 4F9JA 3SCWA 1KGXA 3HQ1A 2ZE0A 3GH5A 3HO8A 3T08A 1BD0A 1HZYA 3G1HA 2BOEX 5D9NA 1A53A 5AYZA 3U5YA 2V63A 1A5UA 5D2TA 3AS2A 1UA3A 3P82A 3AO0A 4N9BA 4BS0A 3LPOA 3T40A 3SCUA 3FK4A 2OG9A 2F6XA 3UY7A 3BGGA 2VRQA 3UETA 4G5DA 4BY3A 4PB4A 3LV5A 5DMYA 4XZHA 1EXPA 4MAZA 4EXQA 4LV4A 2GQ9A 4MB4A 3AS3A 3S42A 1B3XA 3ANVA 6PTDA 2DPEA 5LIWX 3KOWA 2G41A 1UG6A 4JY9A 4HA1A 3RILA 1VF8A 4UNKA 3DFNA 4KQZA 3OBEA 2VUYA 3P84A 3R94A 4PUMA 3TA6A 4WXZA 3VIKA 1V4YA 4DBDA 4CCDA 1QO2A 3TZNA 4WR3A 3AXKA 1TX0A 1TZ7A 3AU6A 2XFFA 4KFOA 1XISA 2DUAA 4B4HA 4CNOA 4QE5A 4HD5A 4HNTA 4WDTA 2FVKA 3O5JA 1KV5A 4JL2A 4IIFA 5A8PA 4C6CA 3H55A 1M7JA 1Q2RA 3KAFA 2J9YA 2H90A 3DHFA 4FNPA 4IICA 3UGVA 1V02E 2I14A 4X0NA 4E4UA 4FR6A 4TUFA 1PKYA 4QE4A 3DIPA 1MZRA 3AYVA 1U1UA 1XYMA 1ZZMA 1GPWA 1GGOA 2D69A 3MCMA 4Q8NA 5HNTA 2ZZ5A 1IZCA 1R47A 1RCQA 4MFEA 4PMUA 3KL3A 2CLKA 1ZJHA 2QGHA 4FIQA 4NXKA 3NQAA 3KEHA 5G4HC 3WNMA 3R25A 5CJ5A 3NVTA 4FX7A 5C6MA 1TKKA 4GXMA 1GW1A 3JYJA 4NJJA 4Q4MA 2VGGA 4LJ3A 2VD9A 4FOJA 2VQTA 1TA3B 3T81A 3WN6A 3CL6A 2X41A 4M6QA 2CITA 4QAWA 4G1KA 3I6RA 4LX4A 3FV9A 2I5QA 4UFIA 1HL8A 4UTIA 4LUTB 1QOXA 5J04A 2SFPA 4M51A 1US0A 1SW7A 4DNHA 4DZHA 3LCGA 3BLDA 5KZEA 3IVSA 2FIQA 1PYFA 3WH7A 4O1AA 1VC4A 4FSAA 4IOTA 3EWZA 2PD5A 5EGRA 2XSBA 3HB9A 4HYWA 1QW7A 1Y7VA 2DT1A 3GZAA 4ATDA 5HWMA 2PBGA 3REQB 3WUBA 3ZS4A 5DY3A 1XBYA 2WNQA 1L6FA 1YNQA 3OBKA 1XLIA 1SW3A 1TPH1 5CLWA 3EA2A 4AY1A 3WQ5A 4ODQA 1UBSA 1WZAA 2QDGA 4JCMA 1K9DA 4KGJA 1A4MA 2GJLA 3C61A 5JH2A 1XH2A 1M68A 1UPMB 4KWVA 3CK5A 3WLKX 3W2KA 3GTIA 4W7WA 1ITXA 3SECA 4RDVA 3UYIA 1LT7A 1OWQA 3M44A 4DY1A 3PBWA 3I65A 4DWSB 3W29A 4L80A 2CXEA 2DT0A 3PZ9A 4JNYA 4CNPA 2GGJA 4DHGA 1KR1A 3KVLA 4FS9A 1VYRA 2F6KA 3GD6A 1X39A 2XFYA 2Y8UA 4JTUA 1J96A 2OX4A 3W70A 5I0DA 3L4UA 1K8ZA 2PDLA 5KTLA 3CUJA 3LGGA 3L4XA 1QPQA 1KTNA 4LEQA 2PDFA 4QHRA 1F3XA 2A0NA 1MI3A 5LNRA 1XPYA 2VC7A 1V93A 2X0HA 3LSBA 2Y7EA 3N2TA 4HCLA 4X2PA 4E3VA 1M3UA 1A0EA 2J7FA 5T91A 5FOOA 4X61A 1IZKA 2OGJA 4UDMA 2HNHA 2QXWA 3CQJA 4LUSA 3KLLA 8RUCA 4IMEA 1KM5A 4LVBA 5D37A 3BCJA 5DFAA 3LK6A 3TJLA 3CU2A 2VC6A 2ZQVA 1JZ4A 4GGQA 3H70A 3QGVA 3E2RA 5JH1A 2NQZA 1TQJA 1CXEA 1PBGA 4Z0SA 1TPWA 3UWVA 3PM6A 4FNQA 3M0HA 1UWIA 1M04A 7PTDA 4LBRA 4BF5A 5M03A 5A8GA 3OVPA 2YJQA 1Q8JA 4MDPA 1BF6A 4ZCWA 1EDQA 4KPLA 1ZJBA 2ZZ4A 1OB0A 1TJ1A 2E5DA 4LAOA 4V33A 3W6YA 3RF9A 2FPVA 3OGVA 3XISA 3M9YA 1Y5WA 3LPFA 4MLJA 3CH9A 3UZ5A 1CLVA 3MKKA 1EDTA 3CHVA 2IXVA 1EJSC 1P7TA 1ZP3A 3WMBA 3TJIA 4TX8A 3SY5A 4IQCA 3WMLA 4DLFA 3PZVA 2GWGA 4AMAA 3ELFA 3GTYX 3F03K 2ZICA 4IFOA 1JDDA 1WO2A 1J5TA 3G1XA 3WEOA 5C9UA 1KM3A 7A3HA 2ZWYA 4RX0A 1WBJA 3STFA 5FF2A 1Q6UA 3KAOA 3WQ4A 4HNVA 1TE1A 3FN9A 3GQYA 3SCTA 5AKQA 4HU4A 1R2SA 3VMOA 1UD4A 3LHWA 4MZ8A 5L9FA 4GNKB 3DFPA 3CASA 1UPPA 2V30A 3LBCA 3W37A 3WMSA 2NVAA 4F3HA 2LGOA 2AOSA 4HTYA 3HV8A 1LM1A 4I3GA 3O0KA 3QW4B 3RG6A 5C2XA 2BASA 3AMLA 1R9HA 2WLZA 2ZE3A 2BY3A 3WQ6A 3WJSA 3U9IA 4YMZA 5HJLA 5AC4A 4A4AA 2WVUA 3UJSA 1X8FA 2QYGA 3HGOA 2OZ8A 4MDOA 3P74A 3T9PA 4DBWA 3C52A 3TOPA 2YB1A 1UKQA 1JGIA 3NEHA 7ENLA 1OABA 2A6LA 5A6JA 4IGHA 3NQBA 1AQHA 2BLEA 4D6GA 3CMFA 4LVDA 2G8ZA 2YB4A 4GCAA 1M65A 1CXKA 3RM4A 2Q01A 3FGCB 1YE4A 4FNTA 3H9RB 4J3VA 3VGEA 4C6MA 4I6KA 2FKEA 3LPGA 2Q8LA 1I45A 1ZB5A 1CBGA 1X1ZA 2EPLX 1TWDA 2Y1HA 5CZTA 3M7WA 3M0YA 2V68A 3GKAA 5DCEA 3S1UA 3MWAA 2RQSA 1IXQA 3ERPA 4W9OA 1UR0A 4GVFA 3MV11 4AWUA 2G4FA 4J5NA 3GAYA 3HG2A 4JTAA 4A8LA 4PEKA 1JF5A 1LWJA 4UNIA 4I9MA 1UB3A 4L9XA 2WW5A 4UTTA 2XIIA 3W76A 3ENLA 1QPOA 3V35A 2XINA 5DRIA 1YLVA 2F7FA 3LI1A 5BWFA 2JK2A 3MJYA 4CNSA 4UBPC 1IIGA 4RDWA 3CGNA 1KGUA 4IF2A 4H04A 2Y61A 1YIXA 4D6CA 2GDVA 2CWNA 4W7UA 3BW2A 1C8VA 5EFDA 4LNYA 4WY0F 3FYOA 4EAMA 1UKSA 2OO0A 3D3FA 4ZXOA 1EXBA 3TXZA 4JIPA 4AW7A 4I5UA 2I16A 2QPUA 1XLHA 3W1LA 3PF3A 3APYA 4AF0A 2YBTA 3W83A 4JFIA 1KM6A 5BCAA 4DRHA 3MUXA 3C0LA 4DRIA 3WDPP 4AD3A 1UD2A 3FSUA 1AW2A 2HPIA 2A7NA 2PV2A 2W6RA 4WKHA 3B03A 4H9XA 1ISYA 3PRAA 3T0TA 3B0VC 4V2XA 1ECEA 1ZPTA 3E5PA 1Q65A 4AZ7A 4EKJA 7CGTA 3KBVA 2QAFA 4O50A 2HBVA 3BMWA 5A6BA 3CGTA 3NVDA 4PRTA 1ZAIA 4RNHA 1FTXA 5C0QA 2E67A 2J9ZA 2NQJA 1V3LA 4C7DA 1FHLA 1I1XA 1DIKA 4JIEA 4GYKA 1WXZA 4R53A 4NT0A 3LQLA 1JEZA 3Q58A 3NZRA 1W17A 4X2RA 1O95A 3DC8A 1UASA 3W1MA 1VRXA 2WB5A 5IM51 2W66A 4HKPA 2WSKA 4QITA 5A95A 4ZFCA 3PBMA 3EEGA 3VMPA 4H6EA 2CWXA 2ZRXA 3BGJA 3MKVA 4K1WA 4Z42C 4K1GA 1XUUA 5F4XA 2VDGA 3IIPA 3WQDA 1MDRA 2VZSA 3QPEA 3GNDA 1Q6IA 4DQWA 1QI3A 3EMZA 3GTNA 4BI7A 2O92A 4YTTA 3O5IA 1FKGA 3DYOA 3NQGA 6TIMA 4IPXA 1XGZA 1EJXC 2E7FA 3C2EA 1LQ0A 3KL5A 5I98A 2OVLA 3B3DA 4KFPA 1VFFA 3NDYA 1U5JA 1BSLA 3EX2A 3H2AA 3F5LA 1WNOA 3BW4A 1LDCA 4CD4A 4M6PA 3QYQA 2QCEA 2GGHA 4LNCA 4P7OA 4AY7A 1RPXA 3IJ7A 3UCQA 4Q7NA 1ZSXA 4QT2A 3U2EA 1K8YA 2I5IA 4C6FA 5A6SA 3TFCA 1BYCA 2J7CA 4UTUA 3HGJA 2AQOA 4JFWA 4QSHA 2Y4SA 1FKRA 1EQ3A 1XIFA 1VIZA 1E9LA 3UVAA 1YE6A 2FHFA 4D6JA 2XSXA 3L5AA 2ATMA 4HYVA 3ARSA 2OWXA 3LQGA 1XLGA 4YVPA 3BLOA 8A3HA 4J3UA 2EULA 4W88A 4PE8A 1C9WA 4B3KA 2VZUA 5DBTA 4NQ1A 4YNGA 3JR2A 4CQ9A 1KQZA 3PVFA 1E15A 1PBKA 3O7UA 1MQQA 3W6LA 1OFQA 3N34A 4DPPA 1VH7A 3NZGA 3GO2A 4B16A 3BQ5A 1FKHA 2XGIA 3L12A 2YCKX 4AISA 4L3NA 2FB3A 1CEOA 1UWQA 2OEMA 5CSYA 4L4PA 3BQ6A 4PCNA 2VGBA 5KETA 2PWHA 5DF0A 1CIUA 1ELSA 5CXPA 3SCRA 3OPSA 4NF7A 4CVWA 3C6CA 5AYYA 1YKWA 2C91A 3N14A 3S5YA 4F79A 5HINA 1CWYA 4AF0B 1Q66A 1KBKA 5DY2A 2FQIA 2MNRA 3I7RA 3VIMA 3EPMA 1VYPX 3E0IA 3GTHA 4XBSA 4BF9A 2BY2A 3KBWA 1QMLA 1NDYA 4UQ9A 1VFLA 4CLMA 4UC5A 1P6CA 1EH9A 1Q45A 2A3LA 1FKTA 3UY8A 2INZA 1LTDA 3ISIX 3AWOA 1OGBA 2VFIA 3GBEA 4UMCA 3AHYA 4AUBA 3PBGA 2INFA 1PB0A 1LCOA 5DBUA 1R7AA 4X60A 3EWYA 3JRKA 2DORA 4KS0A 1KGWA 5HK4A 4H2HA 2AGTA 3RXZA 2Z7GA 4OQVA 3VNZA 2UY3A 1R2RA 3PJTA 1JDEA 4DEFA 4B5UA 3ICJA 4IIEA 1BTMA 2MANA 2INEA 4QG6A 3E0LA 3IIXA 3NQ6A 4DUOA 1QHOA 5AHIA 2ONEA 2E1WA 3ANYA 4YHGA 4S38A 3NL6A 3TYAA 4IMDA 3JZUA 1ITUA 1TQXA 3SY1A 2RGMA 3M0VA 2QVNA 2VEGA 1T8XA 1E56A 3BOXA 1RD5A 2A85A 4L65A 1OYBA 2ADAA 4NX0A 5F1VA 3O05A 2PDUA 1KFEA 4RE2A 5CQ1A 1KRAC 3QC3A 4OECA 3N18A 3THAA 1RQBA 4WJEA 1DYSA 1WYIA 7ODCA 2AL1A 4EXAA 1R3TA 3C0QA 4GFIA 3BWWA 4I7UA 1ZQ5A 1CDGA 4BCEA 5D03A 1K8CA 4MOZA 1XLKA 2F6UA 3GUWA 2C15A 3DG7A 4WCJA 1EX1A 1SUXA 3E9AA 3AS1A 4NJIA 4JFJA 4FO4A 1PKNA 4LYKA 3QHNA 1Q6EA 2DIEA 4EWJA 3SQSA 2W5FA 1GT8A 3LZ5A 1VB9A 3ARUA 4FX8A 2VZVA 1Q6CA 2BTMA 1F9CA 2IW0A 3FEQA 4KWSA 4MJ2A 2VX7A 3VIJA 1UR2A 2WVTA 2Y7FA 3N3TA 4QAIA 4H1ZA 2O0TA 2AKMA 3W2LA 4D8LA 2TYSA 4KWUA 3G1FA 3BAIA 4P7QA 3O2LA 1NWTA 2YIHA 4AD4A 4QISA 1Q3NA 2FMNA 4QRNA 2VCCA 3BV7A 4ZVJA 4HZ7A 2C79A 3WD4A 3T7VA 1V8EA 2R24A 1EWEA 3LRMA 1FKWA 2GOUA 3O3RA 3LX9A 4BWLA 1M7PA 4C6JA 1LOLA 4MNLA 2QJHA 3CPUA 1DHPA 4B15A 3CJPA 4TNSA 4D6HA 2XP6A 1UP0A 4FLQA 3M41A 5A2AA 5C9XA 2OXNA 4YYCA 1WKYA 3VD3A 3DFOA 3CQIA 1ONWA 1QU4A 5HUOA 1KFCA 4B4FA 5XIAA 3T05A 5ABFA 4IG2B 3PTQA 1IEQA 5LKYA 3A4AA 4FZIA 1OCBA 1O5KA 1ALDA 2VC9A 2EJAA 1X6NA 1J18A 3EOUA 2Y24A 3RNDA 4EAYA 5BXPA 3U0HA 3KBNA 3Q45A 1K4GA 4DRKA 2G96A 1DHKA 4LAUA 3ARQA 1MUWA 1NOUA 4Q4PA 5I2UA 4ALDA 4ROPA 1H3GA 3GNPA 1WP6A 4O16A 3G6MA 5LIYX 2CPUA 2WNZA 4XWUA 3TDBA 1KXTA 3P80A 3P3BA 3P0XA 1UZ1A 1H61A 1H7PA 4GH3A 2GUYA 3R5EA 3FHQA 4KIEA 1J2BA 3N13A 2HPMA 8CGTA 3MSRA 2ZX7A 1IEVA 1KWGA 1CX9A 2PDQA 3KVMA 4HZ6A 2F2DA 3O6YX 4DJDC 4H6KA 1Y5VA 3R13A 1JI1A 3PTMA 3GYCA 2NVCA 2XU2A 3FJ6A 4JD4A 3PFMA 1PX8A 3GHRA 3FNDA 2CHNA 3OIXA 2CLHA 4LB4A 1ODUA 3UESA 1EEXA 1RUSA 3K4WA 1KFLA 3AIVA 1I4NA 2XVNA 1G0CA 2UZ9A 3UCDA 1OJXA 2PN0A 2BOFX 5J5RA 2DSWA 2DEPA 3MPGA 3CXOA 3B9OA 4PFHA 1M9HA 2J74A 2B5UB 3WDQA 1E4LA 1X8CA 2WBGA 3N2MA 1L6GA 3G18A 3EXSA 3GIYA 1V0KA 2PDMA 4ES4A 3GVQA 1GOIA 3VKCA 3R2GA 2V5CA 1X98A 2UY2A 3NA8A 3S8HA 4KWOA 3EBVA 3VNMA 3O5PA 4F9DA 1FCVA 3IEBA 4ZQMA 1HKIA 3KX6A 4U28A 2VEFA 3EOOA 1DL3A 3PPFA 4ERGA 3KZPA 3CPGA 1X7IA 4GABA 3VOIA 1R38A 4JDYA 4NNRA 1K8XA 2NWRA 1JDFA 1TFVA 1WB0A 3UG3A 1YTKA 4IJBA 1I8JA 4YWIA 1C92A 2O4MA 1YPXA 1PAMA 2GQ8A 4AY8A 4JIIX 4DROA 4C02B 4HSOA 4L5ZA 4JAWA 1BVZA 2RKXA 2ZXQA 4M5PA 2YPIA 5U7SA 4ZQPA 1P48A 3KRBA 1B4KA 4LT9A 2A3HA 1ZBVA 4INFA 3NNTA 2ZVIA 2O9RA 4H7VA 4S3DA 1QVBA 3EWBX 1JJKA 1RVKA 3EWUA 3G22A 1T5AA 4P8WA 1HVXA 4YWSA 1JDCA 1Q7MA 3EMCA 4O54A 1Q6GA 1XSKA 4URIA 1EBGA 4UTJA 3NG3A 4ERAA 3S46A 5G5IA 1FCBA 4FX6M 2FPYA 3NGFA 1KBIA 4GLEA 5HWNA 2PZNA 2XZ7A 3TU9A 1WV2A 4MZYA 1GK8A 3RO6A 1OD0A 1G5AA 4Y6GA 5E09A 4KMQA 1GRJA 1N1AA 1A5NC 3P5ZA 4JQ1A 2J78A 3N4AA 3E49A 3R1ZA 2NSOA 2OR2A 5GNYA 4PTXA 5HXMA 1SZNA 4AH7A 1XRVA 3GR7A 3TC3A 1H0GA 1FWBC 1TV7A 5BROA 4GKLA 1BXBA 3MI3A 1KB3A 2QIIA 2P3ZA 1PDZA 2NLIA 3I68A 3WF2A 1K9EA 4H83A 3OHMB 3N29A 4HOZA 3N1AA 4N42A 2IQ0A 3BMBA 4R7JA 2YSWA 4AMCA 3PK7A 1RJPA 1K02A 3UWQA 3WNLA 4Q4OA 4NRRA 1RXOB 4IT6A 1WUFA 1GYLA 4IX0A 4D8AA 3DECA 1N55A 5K9XA 1A80A 4O12A 3PTKA 1PS9A 1BPLB 3K4AA 4XV0A 1XRTA 3EGJA 4GVGA 1M7OA 2CZFA 3W86A 2Y62A 2XH7A 4M6VA 1GOMA 1H63A 1W1TA 3OU8A 3GHUA 3DU0A 4LRSA 3C2OA 4DZ3A 1NWSA 3BLKA 4UCFA 1Z44A 4KRUA 4GYPC 4UTLA 2R82A 2E1DA 2V81A 1REQA 2Q71A 2XYLA 2FZ8A 4NUWA 5HA7A 3WQVA 4AZIA 3VDCA 5HANA 1B3WA 4J3ZA 2I5GA 4LANA 2V8ZA 4WZHA 4PCPA 5KEZA 1XD1A 3QV6A 2IKGA 5KZMA 5CAKA 3WBEA 3JS3A 1HNYA 1RA0A 3HF3A 2YA0A 4A22A 4GYPA 4QBXA 4D72A 2YW3A 3MUIA 2MNTA 1NP2A 1QOPA 1QO5A 3CIWA 3GAKA 1S2CA 5A1AA 1YDNA 4B92A 1Q2SA 1FDZA 4RLIA 4EPDC 2A4AA 1D3HA 3ZJ7A 1UH4A 5I5RA 2Z2UA 2OZ3A 2XSAA 1N8IA 3WH9A 3MVTA 5H8MA 1NP0A 3OQEA 4OWGA 1GQJA 1OCJA 1NELA 1DIEA 4GZIA 1K7XA 1T8QA 2GUUA 2Z24A 2EXOA 4H9YA 4ZSUA 1ZBKA 1O7AA 3WFLA 1IIHA 1Q6OA 1BQCA 1H1NA 1DJGA 3NO1A 5FJUA 5A6BD 1OFPA 1JPDX 4B9YA 2MF9A 3IKGA 4HBOA 1JUEA 1PWMA 1LG1A 2W91A 4C60A 6REQB 3EOSA 5K4XA 1W9XA 4AZGA 3QLDA 2VM8A 3LNPA 4HBEA 3QQ0A 2P3EA 3O6AA 5D9MA 3ZLHA 3B9AA 4PCFA 4B5WA 2NT1A 4S2BA 1WX0A 2F8QA 2GK1A 2Z4GA 2A3CA 1E55A 3O8AA 3K1GA 1TWIA 3CO8A 1B54A 1J10A 1SZFA 4DBSA 2BS9A 3AYTA 4U2YA 1DPMA 1K70A 3TSBA 3V1HA 2ON3A 4GUFA 5CGMA 1XDLA 1RVGA 1W3KA 4CNNA 4ZFMA 5C70A 1FWJC 1NU5A 4G9PA 4MFDA 4E2DA 4KESA 3UEQA 3QGAC 4BR1A 5AB3A 1I1WA 2VEIA 5ECUA 2EPNA 3MHFA 1I0DA 3WD2A 1W1VA 3RCYA 3BV4A 4Y9MA 1OIFA 4IT4A 3NI6A 3VMNA 3IAPA 1Q5MA 2QUNA 3PY2A 2B7NA 1D9EA 4WK9A 5FIPA 6XIAA 5BZAA 3M7SA 2IQDA 1XICA 4YL2A 1A3XA 2Z2BA 3P93A 1C9HA 1HJSA 1QTWA 1F2JA 2P1FA 3WUFA 5LSMA 3WKZA 2DG9A 4GACA 1IF2A 3DFYA 2Z28A 3WNPA 2VRJA 3LXCA 4ICMA 1GQKA 3TR9A 4NSBA 3NQFA 5CC3A 3VE9A 4JTSA 2VZTA 4DAIA 4W4QA 5A8MA 4KCVA 4S3EA 1VIWA 1TV2A 3W23A 3WL1A 3KOZA 3B04A 2KO7A 1ME9A 3P67A 3A47A 3AICA 4DJFD 1FWTA 2R6OA 1BGGA 1VCGA 3GDRA 3N6HA 4JIHA 3SB0A 4RNIA 4XX6A 2RUDA 1BXCA 3K4DA 5AHEA 4H6QA 1F8IA 4H7ZA 4AZCA 4XAFA 1JIBA 4YTRA 2W9MA 4P7NA 4JFTA 2Y6ZA 2C7FA 3A3WA 4OIFA 1TV5A 2Y78A 3IRSA 3U3HA 3WSUA 2H8ZA 1WCGA 1QBBA 1GG0A 4ZR8A 3CUGA 1NMWA 2CERA 1FKFA 2OSYA 3K5XA 1ZTVA 1CENA 1RK6A 4H7CA 2EGZA 5C7HA 1LP6A 1TMQA 2R91A 1WXJA 1WQ5A 4UTWA 4DJED 5T26A 2GVLA 1TSIA 5BOFA 2FGZA 2PPPA 2WHLA 4ZQNA 1GVEA 2CLOA 3A9IA 1TPVA 2C1IA 1S1PA 3OEXA 4HSNA 3LRLA 4FF7A 1LJYA 5CBBA 3HMCA 1NSGA 4YCPA 1GEQA 3QR3A 4PZVA 2KGJA 3RLHA 5DEZA 1O5XA 1NFBA 3R12A 3MUCA 4Z2GA 2Y70A 3GXIA 2BX7A 1B3OA 1QNOA 1UW9A 2JF6A 2WPGA 2E9MA 3MUY1 5CC6A 3IARA 1GVOA 4QJ3B 1MQPA 5CPMA 2OFJA 3DFHA 3ZM8A 2JQXA 3QZAA 4DF2A 3W1XA 2X30A 4O0QA 3HFYA 1SYTA 1YTEA 2CHRA 3LERA 5E1QA 4F0MA 2ACUA 2OGYA 3YPIA 2EG6A 3LM3A 5DELA 1A5AA 3TQVA 1LRNA 5LXEA 2PWUA