3RM4A

Amcase in complex with compound 1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
373
structure length
373
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 373
sequence length 373
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm4A01
4W93A 1J0HA 3WEOA 4ZE5A 2J7DA 5DT5A 5EFFA 3W81A 4J3TA 1UR9A 1DWJM 3A47A 2VVSA 4TX6A 1UWIA 2BXZA 4QAWA 3BSGA 5CPQA 1B9ZA 1WDQA 1UA3A 4ATLA 3WNOA 1SR0A 2BY3A 2VNCA 1CXFA 1WE5A 2VJXA 1KCLA 4DUVA 2ZX5A 2ZX8A 3OGVA 2VC9A 5KEZA 4HZ7A 3A3HA 1MW0A 4AD5A 5A3HA 4JKMA 1W9DM 1GORA 1FFRA 2D23A 1JYXA 1MQPA 1BHGA 1S46A 4BQ5A 3WDPP 4AIOA 1K9TA 3EDKA 3ARQA 2X0HA 4HZ8A 4ACZA 1Q6CA 4AZHA 1BVZA 4P7LA 2WMHA 3I3DA 5E0CA 1J12A 2WLYA 5IHRA 3KWXA 1ZS2A 2Q8XA 1E1EA 3CZJA 4AISA 2DSKA 2PBOA 4WSJA 5A6BD 3D5HA 1GJWA 2WMGA 3THCA 1X6LA 3WF1A 3WBAA 3RO8A 2A3EA 4MNKA 2ZX7A 3RJYA 1CGWA 1VFOA 4M29A 2O9OA 3G6LA 2BVTA 1MYRA 1NP0A 4FLRA 1ZJAA 1V08A 1WZLA 1UD3A 2OWXA 3ZO9A 1PEZA 1CEOA 1WKYA 2Y5EA 3I3EA 1YQ2A 1GQIA 3AROA 4PMXA 3MMWA 3L4XA 4OIFA 3T0AA 5CPSA 3WQ6A 2J4GA 2Z1KA 1ESWA 2ZOXA 4GPNA 4S3JA 4C7DA 3RPMA 1B0IA 4N0RA 1OSEA 4D6JA 6CGTA 2WVTA 1UYQA 4UFKA 3VGEA 4UOJA 4R5EA 3SIMA 3VD3A 3OZOA 1WP6A 3JUGA 1E6XM 4F66A 1LG1A 1D2KA 2NSXA 2UY2A 3L2MA 3POCA 5M5DA 1HT6A 4D6HA 3MSGA 4TXEA 1WZKA 2D3NA 1QI4A 3NYDA 1ISZA 5I23A 1OGGA 2W66A 1MW2A 3AHYA 2DSZA 2XWEA 1V3KA 3SURA 1E4MM 1OIFA 4D6CA 3O6AA 1JD7A 2WB5A 1H5VA 1B3XA 2QPUA 5A6BA 3PZUA 3AS2A 1PZ3A 3APGA 1JDDA 2OYKA 4CN4A 1FOBA 4YPJA 2UWFA 1UKTA 3WDQA 2BXYA 4AZ6A 4LYPA 1ODUA 3K8LA 4IUGA 1JGIA 3VX1A 2J75A 2WHLA 2WMJA 4ZFMA 2CBVA 4JKLA 4PTXA 3ARPA 3IJ8A 2VCBA 1GQKA 2OLHA 3II1A 4M81A 3AIRA 4F9JA 1V6YA 2GJXB 4LYQA 3PZTA 1QW8A 5JUVA 2EPNA 2DT0A 3GDBA 1N82A 1E55A 4CD6A 3BMVA 4JIEA 4W86A 1ITCA 3AFBA 5ABFA 4W7WA 1JZ7A 3WQVA 4HA1A 5BRQA 3WD3A 1B2YA 1LL6A 5CGMA 1AQHA 3WF3A 4W5ZA 5HOSA 1VJSA 3NSXA 1PIGA 2A3HA 4DM1A 1QI3A 3GNOA 3QGVA 2G41A 1WDSA 3PBGA 4GXPA 4M82A 2Y4SA 1CGXA 3VDHA 3LPPA 1VFFA 3K8MA 3W37A 2FHCA 1UH4A 2V3FA 4L4PA 3WSUA 1E40A 1GQLA 3GXFA 1X1NA 1UH2A 1VB9A 1V02E 1OIMA 5A6AA 4JHZA 1C8XA 2BY2A 3ARSA 5FCZA 2A3BA 4XV0A 1VBUA 1ISYA 4Z2KA 4GI9A 2DH2A 4PMNA 4D6GA 4MNLA 2JIWA 1PBGA 2VR4A 4UNIA 1E5NA 2YBTA 1OGBA 1UKOA 5BXPA 4BS0A 3PN8A 2NT1A 3IK2A 5BRPA 3ARZA 2D1ZA 3HU7A 3AICA 2VRQA 3BCDA 1WNOA 1UR2A 3ARWA 4L4OA 3WH8A 2J7FA 1P6WA 1GOOA 4MAZA 2VI0A 2ZXBA 1UD6A 4CGTA 2G3JA 3IANA 1V6WA 4GO9A 5D9MA 4MB1A 3S6TA 4OOZA 3GNRA 2BHZA 4W8AA 3CH9A 2WWCA 1LWJA 1KCKA 4IM4A 3B9EA 1ZBCA 1H0GA 3RIKA 1QI0A 1SYTA 3BAXA 3N18A 2GJPA 3WNKA 1V6VA 2O92A 4PMQA 1UWRA 1NARA 3VM5A 2V3DA 2X8RA 3VUPA 2J7CA 3WMSA 3BLKA 2GDUA 6TAAA 1EXPA 4XZWA 1MFUA 1O6IA 2W91A 5LA2A 1E6NA 5CJ5A 3FHQA 4YHEA 2X09A 2PWEA 3WFLA 3MO4A 3ZJ8A 1D3CA 2CKSA 5ECUA 4QCFA 4EANA 2WNWA 2WCSA 2FGZA 1BFNA 2W62A 3OA5A 1UR0A 2YL8A 1BAGA 5GQBA 1BSIA 3ZSSA 3AHXA 4V27A 2CBIA 4QDMA 3IAQA 2CEQA 3PZ9A 3VO0A 4W84A 3WNLA 1BYDA 3BSHA 1OT1A 5A6JA 4HOZA 2C7FA 3UR7A 4MPKA 4D6DA 2W61A 3BAJA 3TA9A 5M03A 1GUVA 1BF2A 2OYLA 1H1NA 2ZE0A 1GOWA 4WK9A 3GZAA 2FHFA 1H4PA 4IISA 3VIMA 3VINA 3VVGA 2O9PA 5GNXA 5A69A 4C7GA 4P8XA 2E0PA 2J7EA 1QNPA 3OGSA 5FOOA 1B31A 1C8QA 1TVPA 2PF0A 4K68A 2ZXDA 1V0MA 1J0YA 1V3MA 2RGLA 4D6EA 3VIIA 4LXFA 1CXHA 4W87A 1G9HA 3TTSA 1EIBA 3SUWA 1HL9A 1TA3A 2XIBA 1CPUA 2WC3A 1KBKA 4NI3A 3WF2A 3QHMA 1JZ4A 4OUEA 4V28A 1QNSA 1JIBA 3ZR6A 2CESA 4FLSA 5I3DA 4PMZA 3AXIA 1UUQA 2WWDA 1E6QM 3AS0A 3SUVA 3VOCA 3MUY1 7CGTA 1UR8A 1UQZA 3WKZA 1JXKA 3BLPX 4BF7A 4W89A 1JAEA 5HNNA 5ABEA 2EPKX 1E43A 1PX3A 2XPKA 3NDZA 4JKKA 1SMDA 4B3LA 1LL4A 1NP2A 4NZCA 3UG4A 1BYAA 1JI1A 4J3XA 1VF8A 4KGJA 1VJZA 4PUEA 3WY1A 1B90A 4Q22A 1UWSA 3RM9A 1KXVA 1V0KA 4UQBA 5IDIA 3MANA 1JXJA 3CZKA 3IJ7A 4AD4A 2DSWA 3VMPA 3W6MA 3MU7A 4J3WA 1C91A 1QHPA 4CN6A 2XWDA 3BH4A 2J8GA 2UY3A 1OD0A 1EOKA 2W67A 3AS1A 3GBDA 4LGXA 3QHNA 5GPRA 1U33A 1BVNP 2AMGA 4DWSC 3AIVA 3FNDA 4HA3A 4JCLA 4HU0A 3GYCA 3VGGA 2D2OA 2XFRA 3BCFA 1VENA 2GUYA 1HJWA 4GZJA 5AY7A 2YJQA 1C7SA 5TD4A 2YDSA 4HPGA 3TTYA 4QLLA 4UOQA 4MB3A 2V5DA 3QOKA 1MXGA 1H3GA 4PUDA 1SFSA 5ABHA 3OB8A 2DSVA 5CZKA 4D6IA 2A3AA 3OGRA 1XGZA 4TVDA 1LL7A 5DMYA 3WH7A 4PMUA 1HN1A 3WEMA 5IFTA 1JG9A 2A3CA 1GZJA 3SCRA 1QVBA 4AZIA 3UERA 1HNYA 3BAWA 1I1WA 1OINA 1PJ9A 2PWFA 3VX0A 5BROA 4PMRA 5E6ZA 5A8QA 3L4YA 4MNMA 2XIIA 2XGIA 2VOTA 2WVSA 4OJYA 5BCAA 3AHTA 3OG2A 1V02A 3W24A 4LX4A 1HP4A 2WW5A 1XH1A 3SUTA 1OD8A 3HJEA 2PWDA 5D4YA 4NRRA 2NT0A 3WQ8A 4GIAA 3W25A 2VZUA 4HZ6A 1CENA 3UG5A 3K4AA 2WVVB 3ARVA 3DC0A 5CQ1A 2G3IA 4AMCA 4AD2A 1LJYA 3TOPA 3W27A 4PSPA 1HKIA 4MDOA 2WMIB 3PTMA 1HJQA 4W8BA 4MNJA 4KRUA 2X05A 1R85A 1W32A 2G3NA 4CVWA 4UQAA 3AIUA 1ISWA 2WC7A 1DWAM 3SCPA 1UWUA 2CKRA 2BHUA 1G1YA 7TAAA 1BG4A 3AXXA 5I0DA 4H8VA 1W9PA 3W26A 2HVMA 4BCEA 2CPUA 3CZEA 5CG0A 3K4DA 1JDAA 2VCAA 3W53A 4OZOA 5C8BB 3G6MA 2XVPA 3L2LA 1MWOA 4FF5A 4Z2JA 1GVIA 3F4VA 1G01A 3VU2A 5IHSA 1TFVA 5FD0A 2QF8A 3WDRA 4PTMA 2VRKA 3OIHA 3ARRA 4AZCA 3MSDA 4PMDA 1PZ2A 1NM9A 1UKSA 1G0CA 1BLIA 1E9LA 3O9NA 2JFEX 8A3HA 1C93A 1EGZA 1EHNA 3ZT7A 4HMCA 4AY1A 1E56A 4GZEA 2VX7A 1OM0A 2C0HA 1QBBA 3LPGA 5HPOA 3WD2A 5E09A 4P7OA 2VT0A 1DWIM 3N12A 3AYRA 5CLWA 2CBJA 1VFUA 2OYMA 4TVUA 2EO7A 3TP4A 1ZBWA 1XCXA 1XRVA 1ISVA 1OT2A 3AXHA 1H49A 2WVUA 4MB4A 2ZUTA 1CDGA 1GNXA 5A6MA 2XUCA 1K6AA 8CGTA 1K9DA 4CD5A 4CD8A 4CD7A 1UD2A 4DUXA 2YLAA 2DDXA 1W3JA 3U5UA 4DWSB 4U2YA 1J01A 1JZ6A 2XFYA 3ARYA 4PTVA 1XHGA 4MAVA 2DH3A 2G8ZA 3KZSA 1X6NA 1EOMA 2ZICA 5JBFA 1VAHA 3A4WA 4ACYA 1GW1A 3RDKA 2QPSA 2F61A 1GOMA 3VIJA 2W5FA 1KWKA 1E72M 1CECA 4WSKA 5I79A 2Y8VA 4U33A 1YHTA 4W8LA 4ATDA 1FH9A 1GOIA 1J10A 4UCFA 1QW9A 2GJRA 3F5KA 3CZGA 1MQQA 2WBKA 5CSYA 1Z32X 2WMFA 4U31A 2DT3A 1NOUA 5EBAA 2NW0A 4S3KA 5HBFA 2BVYA 2W4XA 2ZUUA 4ACZB 3VGFA 3SCUA 5KZ6A 2J78A 1CXEA 1ZBVA 2XFFA 2J74A 3IJ9A 1CZ1A 3VIOA 5A1AA 3SCQA 1Q6EA 4AD1A 2WCAA 3W6LA 1I1XA 4CCDA 3EDEA 3N04A 1WCGA 1IT0A 4AEFA 5HDRA 5FL0A 3WUEA 1JZ8A 1U2YA 2VMFA 2YA1A 1MQRA 3MUZ1 5LA0A 1CXKA 1V3HA 1KQZA 3M07A 2EXOA 4GI8A 1DWFM 1ZBKA 3VIFA 3CZLA 2HISA 5EB8A 3AJ7A 1H2JA 4GO8A 1BQCA 4HMDA 1DHKA 1CLXA 2AOSA 1JL8A 4OKDA 1C90A 4JHOA 2VX5A 5DF0A 2FH8A 3EMCA 4ZE4A 3WL1A 1QI2A 3K8KA 4D72A 3OZPA 4JFUA 4D1IA 3AZTA 4AZ5A 2EPLX 5DFAA 3VD7A 4CU6A 3VMNA 4UOZA 2VZVA 3PZQA 1E0XA 3DHPA 1LLOA 2YOCA 1FP8A 5I5RA 3NUKA 2CERA 2D0HA 4EE9A 3CHEA 1UG6A 1JNEA 3CMJA 3T09A 1PAMA 1V6UA 3MS8A 3VPLA 3ZT6A 5E70A 3AIBA 3PHAA 3S2CA 1B1YA 4YHGA 2CXGA 2VX6A 4JCMA 4JFVA 3WF4A 4AWEA 5A6SA 2E8ZA 2XVKA 4M1RA 3PTQA 1A47A 3N17A 4V2XA 3VNZA 1WDRA 1MXDA 3ALGA 3WQWA 3WH5A 3MKKA 4WKFA 3SCSA 2OWCA 3AIEA 3GH4A 4U5IA 2ZXAA 4JFWA 1H41A 5CXPA 1NH6A 4UQ9A 1FHDA 1WPCA 1M53A 1EQPA 4W7UA 1QNQA 4HTYA 5I77A 4AZ7A 1WO2A 1E3XA 4TVCA 3K46A 3DYPA 1OBAA 3UCQA 1CGUA 3CHDA 3EDJA 1J0JA 2E40A 2E8YA 2YIHA 1V6XA 5ABFB 3CHFA 4Q7NA 1UH3A 2V38A 3UG3A 4CU7A 4HPHA 1E5JA 7A3HA 1G5AA 5M3WA 1XV8A 5IXEA 1XSIA 3WELA 1HKJA 2E9MA 1HJVA 1V0NA 3SEPA 1E6RA 4M24A 1TG7A 5EMYA 4UFJA 1U30A 3PTKA 2ZX9A 5I24A 1C92A 3CMGA 3WDJA 1CWYA 2PWHA 3ARXA 4LQ1A 1XYZA 1E4IA 3BGAA 1J0ZA 1UR1A 2GFTA 9CGTA 1UR4A 1UD5A 1WB0A 4WKAA 5DT7A 2WM0A 4MDPA 1PPIA 1W2VA 3VIPA 2WLZA 4AXNA 5JIWA 4ZENA 4J7RA 1M01A 5BYWA 2BV9A 3ZJKA 1PX4A 3M6DA 1F4AA 3CPUA 1XYFA 3AMDA 3SUUA 4EAMA 1W1YA 2VCCA 2WKLA 1UHVA 2VRJA 3VIGA 5F7UA 3I3BA 5GNYA 3MV11 1DEDA 1PX8A 3VGBA 4UR9A 2WANA 2WBGA 1CNVA 2D22A 2FH6A 3GBEA 2TAAA 4BQ2A 3WIJA 2GK1B 4MJ2A 1JF6A 3HMCA 4NRSA 4TUFA 2GSJA 1FH8A 2QLYA 1HF6A 3SCWA 3BAIA 1E1FA 3ZIZA 3EDFA 3FAXA 2YL9A 1M03A 3EDDA 5CGTA 3AYSA 1QPKA 4RE3A 1W2PA 1XSJA 3WD1A 3E1F1 1M7XA 4HA4A 3UR8A 5A2BA 1W91A 2ZUNA 5D9PA 4CCCA 5I78A 3GNPA 1CGVA 1EDQA 1TUXA 2Y24A 1H11A 3A6OA 4AD0A 3VGDA 2WVVA 4LYRA 1GHSA 2OSWA 3VILA 2IXVA 4GKLA 3CUIA 3SCTA 3WNNA 3PZOA 3OLIA 2EEXA 2JALA 3BXWA 4H2CA 3T0BA 3U57A 2Y2WA 4GQQA 1UD4A 2VQTA 1W1VA 1W1TA 2DPEA 1NWSA 4MTVA 1K9FA 4PN2A 2YLLA 3D3AA 1BYCA 1NWTA 4WLCA 4EKJA 4B15A 1B3VA 4KWUA 3WF0A 4DM2A 4BQ4A 1WZMA 1B3ZA 4QFUA 5A8OA 2CITA 1US2A 2ZIDA 1J9YA 1Q6DA 1V0LA 3MV01 4GZIA 2YDQA 2WZIA 4X9YA 1EDTA 2V3GA 4A3HA 2VR5A 1R7OA 3GXMA 3T08A 3POHA 1R7AA 1GVYA 3VM7A 3AMGA 1MW1A 3N9KA 2W63A 4M8UA 2BFGA 1DWHM 2CYGA 2D3LA 2UY5A 2JIEA 2DT2A 1KXHA 3PZVA 1D7FA 1JYVA 1KR1A 4GQRA 2DSUA 3CIVA 3L4ZA 2ZXQA 4RE2A 4H04A 1HJSA 1UZ4A 3BC9A 1TA3B 4ZXOA 5FIPA 2QHAA 1LQ0A 4HP5A 4MADA 1E15A 1OWQA 4URIA 4UQDA 1CIUA 3O2LA 3ALFA 4F9DA 2ZUVA 2YL6A 2ZUMA 2YBUA 3VTRA 4CKQA 1JYWA 2OSXA 1ZU8A 2JF7A 3N15A 4XX6A 1QHOA 3N11A 1US3A 4PTWA 4J3UA 3UEQA 1R87A 3AISA 3W28A 3WBEA 1E71M 2XHYA 5DEZA 1L8NA 2XM2A 1AQ0A 3RMEA 4UFMA 1GHRA 3ZMRA 4D1JA 1Q6GA 3RM4A 3RM8A 4HMEA 3ZJ7A 1QHZA 3WH6A 2F8QA 4J27A 3VD9A 1QNOA 1EH9A 1GONA 3T0DA 1UKPA 3AHVA 3QR3A 2O9TA 4PYSA 4UTFA 5A8NA 3VDBA 5A94A 2CETA 3LMYA 2WHJA 1DTUA 3N13A 1BGAA 1L0PA 2CHOA 2DT1A 1E0WA 1V3IA 2J7HA 2PWGA 1H09A 3W0KA 3U7BA 2CHNA 2WPGA 3KE0A 4JL2A 3GH5A 3OLDA 4UFLA 5AC5A 3M7SA 2E9BA 3VGHA 4BZYA 3VKKA 2CBUA 4WIWA 5DO8A 5JBEA 1OGSA 1KXQA 1BGGA 1ZL1A 3WD4A 1HJUA 4H8UA 1JZ2A 2ZUWA 4XB3A 4F8XA 3W29A 1JFHA 3F5JA 3MMUA 1VBRA 4AIUA 3FW6A 3NDYA 1PIFA 1FP9A 2MANA 3KEHA 4P8VA 3OLGA 5BXSA 2GJXA 4Z2LA 3WENA 1G94A 2DGAA 1HJXA 2YKKA 1NQ6A 4UQCA 3T2QA 2JEQA 1E6SM 3CHCA 3VIKA 1HKKA 4ATWA 1KGXA 2JEPA 4NF7A 4U2ZA 3L4VA 1C3FA 1E73M 3L4WA 3MMDA 1KR0A 4TTUA 3RILA 3A4XA 5A6LA 1HIZA 4JFTA 2J8FA 4W85A 4CN1A 1TZ7A 2G3MA 2IUZA 4H8HA 4BQ3A 1MFVA 1VRXA 3N1AA 5GNZA 4W7VA 1RP8A 4TTGA 1E4LA 1J0KA 2D0GA 3BMWA 1GCYA 2VZOA 3DYOA 4QCEA 1I75A 4PCSA 5AC4A 4WJXA 2Y8KA 1RP9A 1XC6A 2YA2A 4Z2IA 2OSYA 1WZAA 3B8SA 2XVNA 5M17A 3U5YA 3WUGA 4ZXLA 2BNJA 2DIEA 2F2HA 4PMYA 1GQJA 2PI6A 2WK2A 3FXYA 1CXIA 3EYPA 2ZUSA 4AD3A 4Y7EA 2WYSA 2ZWYA 2VZTA 3LPFA 4KRTA 2X2YA 4N42A 4U5KA 5EFDA 2D20A 5IFPA 5HXMA 2J7GA 2EPMX 1RPKA 5JBDA 1IZJA 4XUYA 1ITXA 3PZGA 4OOUA 1QBAA 4U3AA 2BS9A 1JD9A 3L4UA 5JH8A 2DIJA 1SMAA 1TCMA 1XD0A 3CUFA 4OBSA 2VURA 2VVNA 4D6FA 1UD8A 4AZBA 4CVUA 4P7QA 2ESCA 1J18A 4B9YA 1UKQA 2JF6A 3BAKA 3EMQA 3SCNA 1HVXA 4JZ5A 1FHLA 1QOXA 4J28A 5A95A 4QLJA 4AZCB 3FY1A 1W9UA 2W92A 2OWWA 2XTKA 3PZIA 1CGYA 4CD4A 3ZOAA 3ZSTA 3MUAA 4GINA 1LF1A 4U3CA 1BPLB 4B3KA 3VIHA 3FHAA 3ZQ9A 4RE4A 5A2AA 1CXLA 1E3ZA 1EO7A 1XCWA 4GI6A 1EDGA 1QI5A 3CGTA 3ECQA 2WZEA 4JL1A 4X0NA 1TVNA 3CZ8A 3AMLA 1RH9A 1Y7VA 5AYBA 1LG2A 1UOKA 2XG9A 3WUBA 2E4TA 1JYNA 3UETA 1QNRA 3B9DA 5LA1A 3GTNA 3L4TA 2YL5A 3SUSA 1W3LA 2PB1A 1EHAA 2CCRA 1XD1A 2J47A 1NWRA 1BYBA 1KB3A 1TMQA 4CUCA 4TOQA 1Q4NX 4NSBA 3DHUA 2CIPA 5ABGA 4JAWA 2UY4A 1KBBA 4F79A 1JNDA 4HOWA 2WMKA 5BXRA 3WMBA 1W3HA 1EO5A 4IPLA 2EQDA 1V03A 4M56A 2J25A 4HU8A 1GOKA 4YN5A 1B3WA 4X0VA 3RCNA 2PC8A 4M80A 3OLEA 1UWQA 3UESA 1UZ1A 4KH2A 1OB0A 4E8CA 4P7NA 3VD4A 1KGUA 2B31A 1UA7A 2WAGA 2WSKA 3QHOA 3VD5A 4FLQA 1MW3A 2XVGA 2J79A 3EBVA 4PMOA 3WEZA 1KQYA 2RGMA 3IAPA 4P7RA 5BXTA 1CBGA 4B9ZA 1H0IA 1KGWA 3CBWA 4PEEA 5CPTA 5CSUA 4JFSA 5E9AA 1B30A 3VDCA 4E8DA 1XSKA 5I2UA 2D0FA 1VIWA 1UQYA 2ZWZA 2GK1A 3PZMA 3AOFA 4ML4A 2BY1A 5C70A 4FLOA 1GPFA 1B3YA 3GXDA 2VZSA 6A3HA 1W3KA 1W9VA 4KGLA 3WN6A 3ARUA 4AW7A 4R27A 4TX8A 1HKMA 1ECEA 4UQEA 1JAKA 2XSBA 2VL4A 3WQ5A 5E0FA 1TR1A 5CLTA 3WUFA 1NOFA 3AZRA 3SCOA 2V5CA 2WSPA 3WDHA 2EJ1A 1JF5A 3NIYA 3SCVA 3GH7A 1E0VA 3AZSA 4RL3A 1IZKA 3AI0A 3KL0A 3B9AA 2XJ7A 3T2OA 3FAWA 4WKHA 3T2PA 2FGLA 1KXTA 4XZBA 3AQUA 2X0YA 1GJUA 5D9OA 1AMYA 4ZEPA 5C71A 1O7AA 3CLWA 1V3JA 3DECA 1RD6A 4P8WA 4E4PA 2EBNA 1JZ5A 1MVYA 2QMJA 2J7BA 3WDIA 4KMQA 2JE8A 3ZJ6A 3KL5A 3FN9A 1JI2A 3THDA 2PBGA 4HOXA 2IXUA 4A4AA 4PBGA 2DEPA 1JZ3A 2FHBA 3WMCA 2WZHA 5A6KA 1NWUA 5A2CA 4AIEA 3AS3A 1AQMA 1EA9C 4PSRA 2D24A 3AMCA 4E2OA 2VUYA 3CTTA 1V3LA 1W9BM 4CCEA 4WF7A 5D8ZA 3VDAA 4UFIA 5FKYA 3F5LA 3PZNA 4OBRA 3TONA 4AYSA 3GXIA 4FK9A 1AVAA 2DQXA 1JFXA 4AZGA 1GOQA 1WDPA 4UFHA 3WD0A 3CO4A 1HX0A 3ZR5A 2E3ZA 3J7HA 5BWFA 1VEPA 4QLKA 2XVLA 1CTNA 2QV4A 2E9LA 1ODZA 3CUHA 1ZB5A 1VEMA 2BVDA 2WCGA 4UZUA 3WQ4A 2CNCA 3CUGA 1FA2A 2VTFA 2WHKA 2J77A 1CGTA 3W4RA 2GDVA 2V3EA 2VX4A 3WH9A 4QP0A 2WC4A 1ISXA 4EK7A 1M04A 5A8PA 3VMOA 5E6YA 4AC1X 5HPCA 3QOMA 4W5UA 3TTQA 4IPNB 1Q6FA 1W9XA 2ZX6A 4D71A 2WMIA 2X1IA 1CYGA 3WNPA 1TE1A 3HN3A 4B16A 1WAWA 3OBAA 4PCTA 1BG9A 3GM8A 3WNMA 2G4FA 1C7TA 3BAYA 1FH7A 3AMKA 3M46A 1IV8A 5FL1A 1EQCA 1R8LA 4FMVA 1CLVA 3AIWA 4PRWA 2C8NA 1FFQA 2WKGA 1LWHA 2FDMA 2QMKA 3NCOA 3KL3A 4DWSD 1HL8A 1VEOA 1DWGM 4A3YA 3NJ3A 1BTCA 1HXJA 2BY0A 3AHZA 1C8YA 4MB5A 4AEEA 3K1DA 1R86A 2YA0A 4PMVA 4J3SA 5I6SA 1E6PA 1HVQA 1J0IA 1XH2A 2O9RA 2EPOA 1XH0A 4BA0A 3DYMA 2VQUA 1A3HA 1KFWA 3ARTA 2VO5A 3NSNA 4J3VA 5A8MA 1F4HA 2Z1SA 4H41A 1UWTA 4MJ4A 1JDCA 4H7VA 5AYIA 4Z2GA 3W38A 3RJXA 3TTOA 5D9NA 1VFMA 4P8UA 1K9EA 2WXDM 1ZJBA 4DUWA 4LPCA 3CUJA 3LPOA 2J62A 1NOWA 3MUIA 2XM1A 3VNYA 2XGBA 1KWGA 4UZSA 4C7FA 1E70M 2XSAA 3U7VA 2GVYA 1E4NA 1OCQA 1E6ZA 5JIPA 4CU8A 3W82A 3A4AA 5D8WA 3ZM8A 1J11A 1HP5A 2BHYA 3WFZA 1W1PA 3NSMA 4W88A 3AIQA 2XYLA 2YDRA 3EMZA 2WHMA 5LYRA 4DWSA 3WL0A 4Z2HA 1DP0A 3ZT5A 2AAAA
chains in the Genus database with same CATH superfamily
4GYJA 3UI6A 1F76A 1MUWA 2P0IA 4ZOEA 2FDSA 3LRMA 1UR9A 2VVSA 3V1PA 2EKCA 4ATLA 1WDQA 4F3HA 4K1GA 3BGJA 1KCLA 3P84A 3NGFA 3OGVA 3LCLA 3K5XA 2IQ0A 2VC9A 4RZ5A 1Q7QA 3QM3A 4AD5A 5A3HA 1WBHA 1JCTA 3O5EA 1GORA 3FS2A 5HK4A 2D23A 3MCNA 4LF2A 2ITKA 5J5DA 3UWZA 1SJDA 3NXFA 4JDBA 4OBTA 3G1RA 2PTWA 4IICA 3N2MA 1BVZA 4BI5A 5LSMA 5XIAA 3CL6A 4NJIA 5E0CA 1KW1A 2FMOA 3SAZA 5AB3A 3N25A 3S2NA 2WLYA 4JQ2A 5GPGA 2YSWA 1EFZA 1S3HA 4Q4SA 4F0RA 4B4FA 3THAA 2DVUA 4FXSA 4Q8WA 3D5HA 1GJWA 4C6JA 5A6BD 1NFBA 2WMGA 2PPGA 3GU9A 3WBAA 1KFLA 2QXWA 4ZFCA 4M29A 3NPVA 2P76A 1AW5A 1ZJAA 1FBAA 5G4WA 1PEZA 4DELA 1CEOA 3LQGA 8TIMA 1YQ2A 1G4PA 4Y9PA 5FEXA 3WQ6A 3LBOA 2ZOXA 3DENA 1EJRC 3LCIA 1W1IE 3GIPA 1B0IA 4N0RA 3WJWA 1OSEA 2YCLB 4D6JA 4UFKA 2AQVA 4R5EA 3OZOA 1E6XM 4F2TA 3H2AA 1FWEC 1D2KA 1N2VA 2UY2A 1T99A 4PFMA 1FCQA 2Q3OA 5DXYA 1QI4A 2PDGA 2ZRVA 1OGGA 3T4WA 3AHYA 1LOLA 4LEFA 4HNNA 4LBUA 4RW5A 4JTUA 4RPPA 1E4MM 1OIFA 3BGGA 4UTLA 3KRZA 3A64A 3S1VA 1B3XA 3H55A 3THUA 3TMLA 3TROA 4LC6A 2R91A 1FOBA 4PR4A 1ELSA 2UWFA 3WDQA 1EC7A 1KTNA 4IIDA 1V4YA 1M9HA 2A3LA 1TWZA 4ITZA 2XP8A 3PNZA 4ZFMA 3W76A 2CBVA 3WQOA 4HNVA 1HXVA 4JKLA 1F61A 2VCBA 2J66A 3AIRA 3H12A 2XFWA 4F9JA 1XUUA 4LAZA 3PZTA 3ISIX 2FJKA 1I6NA 1QJWA 1K8XA 2JZVA 2B4GA 4JIEA 4W86A 5D37A 3EWDA 4XSMA 5BRQA 1OF6A 1H7XA 1AQHA 4W5ZA 2DP3A 4NG3A 3VZXA 5IM51 1XR2A 3JRKA 4Z1DA 3B8WA 4DX3A 1PIGA 2A3HA 4O16A 4DM1A 1QI3A 4GXPA 4HJWA 1CGXA 1VFFA 3JU2A 3UGVA 4XVDA 2V3FA 1RAKA 1E40A 3GXFA 1X1NA 3EWZA 1VB9A 3HQPA 2V5LA 3MTWA 4IQLA 4DT4A 3A9IA 5EYWA 1EPVA 4JIRA 2RJHA 3UXKA 2DH2A 2VFDA 3HFTA 5HATA 3WH0A 3S47A 2IW0A 5KITA 1N7KA 2V6AA 4B3ZA 5C2XA 1YW1A 1OGBA 1JUBA 1X1ZA 4C60A 1Z89A 4L64A 5FA5A 4BWLA 2PDKA 2PC4A 4P61A 3ABXA 1P6WA 3USBA 1GOOA 4RXFA 3G1FA 4GJ1A 4AF0B 2V69A 3W88A 6TIMA 1H51A 4MFEA 1E44A 3VOJA 5DANA 2WWCA 3CLMA 1MUCA 4JTQA 4NILA 3U2CA 1H0GA 1QI0A 2F4EA 3KAHA 1KA9F 4KT2A 4PMQA 1UWRA 1TKKA 2X8RA 4GNJA 1EXPA 4XZWA 3G0XA 4OECA 5IDZA 3W1XA 2R1KA 1O6IA 3DG7A 1E6NA 2DW7A 4UTTC 3FHQA 4YHEA 2X09A 1OFAA 2PWEA 3MO4A 2FTYA 3ZJ8A 2CKSA 2LGOA 1WXYA 4HU4A 5CZSA 2WCSA 2F6KA 3OA5A 4PRTA 3QZ6A 1J93A 1VIZA 1SGJA 1BSIA 4EPEC 3EOLA 4LWWA 1T6MA 1TV2A 3B03A 4GD0A 5I3HA 4L9ZA 3W07A 3S6OA 2RDWA 2CFFA 2HV5A 4OE7A 3BAJA 3LX9A 4WOQA 1GUVA 1J6PA 1W1B1 2ZE0A 3FLUA 3CMFA 4DJFD 2Y5JA 4I7UA 1MNSA 5GNXA 3ANVA 2GYIA 3LHVA 3AXMA 1YDVA 5FOOA 1KNWA 1RUSA 3S3GA 1TVPA 3LBMA 4ODKA 2BDQA 4A3RA 2P10A 4NZ3A 7REQA 4F0KA 1HL2A 4HNCA 1G9HA 4ODMA 3ORWA 1G67A 5D2TA 4JYEA 3KBJA 1TA3A 2NWSA 2XDFA 4K38A 1X6UA 2SFPA 3BW4A 3L0GA 2QDHA 4NI3A 3WF2A 3K30A 2FMNA 1LLZA 4OUEA 2GQ9A 1DBTA 3NZGA 4PTNA 2FB3A 4UXDA 3CC1A 3AXIA 3A5FA 1E6QM 3IHZA 2HCVA 1RCOB 3VA8A 2GOUA 3OZYA 1TR9A 3EOEA 5XIMA 3ZVIA 1G6CA 1PKLA 2QQ6A 3P80A 3B40A 2PTZA 2XPKA 5D38A 2QJMA 3LNMA 1QW7A 3STGA 1Q2RA 2HK0A 1SMDA 4AVFA 2NQ5A 4MY9A 1JCMP 1RLCL 4O13A 1OFOA 1JPDX 1UWSA 1Y65A 2FVLA 1KXVA 5G2WA 3UVAA 1UW9A 4UQBA 4BEQA 3QF0A 3VMPA 4CN6A 5I3JA 1EOKA 3SY1A 1BVNP 2XZ7A 3AIVA 3GTIA 1FWJC 4PC8A 4TMBA 3GYCA 2D2OA 2XFRA 1XDMA 3BVJA 1HJWA 4GZJA 3V16A 1BWKA 2MNTA 3CWHA 3CEUA 4DXVA 1C7SA 3EXRA 3MWAA 4HSNA 1XFCA 4QLLA 1SW3A 5KMYA 1V79A 4ZB2A 1B6CA 2X7VA 3MPGA 1GG0A 2QVNA 3CAKA 4QBXA 3C61A 4JIIX 2YBVA 1OY0A 1H7NA 5JH1A 3WH7A 4B2DA 1W5NA 5J6EA 3O0KA 3PULA 1WXJA 4AZIA 2X41A 2Y6ZA 3BAWA 1I1WA 2PWFA 1PJ9A 2DFAA 4RE0A 3GKFA 3PFMA 5A8QA 2XIIA 2VOTA 1NELA 4RNFA 4OJYA 1FKBA 1ME7A 4FOKA 4W9TA 5DCDA 4WDUA 4IPJA 2NV9A 3LNPA 1XH1A 3SUTA 1OD8A 5D4YA 5EMMA 3TDBA 2NT0A 2VZUA 1CENA 3BV4A 3MT1A 1PV8A 4L72B 5CQ1A 4AMCA 4L1WA 1XIEA 2TPSA 4AD2A 1LJYA 2ZZ7A 2Y1HA 4PSPA 1A0EA 3RU8X 3PTMA 1HJQA 4KRUA 1W32A 3AIUA 3TTEA 1ISWA 3N6JA 2WC7A 4ZQMA 1PUDA 1YXCA 1G1YA 4H19A 3RLVA 5I0DA 4GJJA 5DIVA 1W9PA 3W26A 2CPUA 3WLPA 4DROA 3K4DA 4FF7A 4XKYA 3W53A 3HURA 2OKTA 5ECVA 1QUMA 2XVPA 4XZIA 3WLRA 2BOGX 3ODKA 5IHSA 2F84A 4LUSB 1QPNA 3WDRA 4PTMA 2FZMA 3ARRA 3MI6A 4AZCA 4AWTA 3QMTA 4J4OA 2JFEX 5HWNA 2ACUA 4LALA 3ZT7A 4A21A 1E56A 4QXIA 4GVHA 4M6PA 5CPNA 1XLCA 4HHPA 2FZ9A 4Y9AA 5HPOA 1EP2A 5D05A 3V3WA 1YPIA 2E7FA 2VT0A 1DWIM 3MYPA 2QUNA 3N2OA 1UBPC 4O1BA 3SY8A 2EO7A 1ZBWA 1XDJA 5H8MA 3AXHA 5F2LA 4J4NA 1W26A 4RZ6A 2G96A 1Q1CA 4J2MA 1K6AA 8CGTA 1B3OA 1K9DA 1RD5A 4DO6A 1FD9A 4DUXA 4F0LA 3V36A 2YLAA 4CNPA 3U5UA 3QZEA 1J01A 3W00A 1XHGA 3U9IA 2Q8LA 4CQDA 3KZSA 2ZICA 5D2WA 1FWWA 5I3GA 3W7GA 2NVCA 1QWGA 3PAJA 5LNVA 4EOUA 1IT7A 4PZVA 3BURA 1WX0A 3VK5A 2NXHA 4ACYA 1GW1A 3RR4A 2HVNA 2F61A 1UMYA 1E72M 1CECA 2J24A 4UMAA 5HUPA 3VI2A 3FSUA 4W8LA 3LZ5A 1FH9A 1GOIA 4HA0A 1EJXC 1R9ZA 5F4WA 4DRKA 4N2YA 4S3EA 1PO9A 1PXGA 3OVRA 1LORA 4ACZB 1WV2A 1KFBA 1XBVA 4M3PA 3SQSA 3PBMA 3IJIA 4JQ3A 5G1MA 4N9BA 2PPPA 3VIOA 3GDRA 3W6LA 4A8NA 2BWGA 3TC5A 4ZQPA 1HUVA 1SSGA 4MF4A 4DYJA 1XYLA 2PD9A 1IT0A 7XIMA 4S3CA 3WUEA 1JZ8A 2VMFA 5AYZA 1XDLA 4E4UA 5LA0A 1PYFA 1H7RA 1KFJA 1EEPA 1D3GA 4Q8PA 3NL6A 3SIZA 2CHRA 2HISA 5EB8A 3KS5A 3GU1A 3HQOA 1H2JA 4GO8A 1J4IA 2AOSA 1XXXA 1C90A 1L1PA 3DKLA 3BLLA 3AXKA 1QI2A 5BU9A 4NNBA 2E6YA 1C9HA 1LWIA 1ZJIA 4JFUA 3OZPA 4WX2A 3L12A 3QPZA 4FNUA 2WOQA 3A13A 3L23A 1P0EA 3RPDA 4ODRA 2KAUC 4EE9A 4CEXC 3CHEA 5KTLA 4DJDD 1PAMA 4ONVA 5C9XA 3BG3A 5M2FX 1SU5A 3MS8A 1AZ1A 3ZT6A 1J2BA 3UZWA 3S2CA 3PFRA 2CXGA 3WF4A 5HANA 3VKAA 3W1UA 4DB7A 4UIOA 4QHRA 3WQEA 4J1OA 3RO6A 1WDRA 3ALGA 4NVTA 1K4GA 3MKKA 4WKFA 3NAVA 4NAEB 5J5RA 1VBGA 3IKDA 1EJTC 2O56A 3R0UA 1C9WA 1EJ7L 5CXPA 1NH6A 2DG4A 2E68A 2ZE3A 1WPCA 3QC0A 4JS3A 2A4AA 4HTYA 5DO2A 2DUAA 2ZYFA 1OYAA 1WO2A 3CUZA 4TVCA 2ISSA 2RJGA 1ICPA 4AUBA 4DZAA 4LCRA 2OQLA 3BJTA 3G2GA 5FAGA 5CZTA 2IKGA 3I7SA 2OPJA 2CU0A 3E0VA 5CZ0A 3QV7A 4KPLA 4DZHA 3D0CA 4ODLA 3DFOA 4TW6A 1E6RA 4GMEA 2ZBTA 3RR1A 2G5WA 1DQUA 4A22A 1T8XA 3T07A 4XZLX 3W1QA 3UF9A 4DJFC 1J0ZA 2FAPA 2GFTA 4A8RA 2OQYA 1WB0A 1W5PA 2CZVA 3QEZA 5BOOA 4MDPA 4O0KA 1SO4A 1THFD 1AG1O 1UR3M 2Y85A 3BLFA 2WNQA 2PEVA 3LCXA 1PX4A 1NDZA 1XYFA 1TWWA 2VCCA 2WKLA 1OX4B 4J2PA 1DJHA 1UHVA 2VRJA 3LUTA 3V1HA 3OW1A 4JYFA 1A5OC 2Y61A 1ITQA 3MV11 4NYYA 2ONEA 1DTNA 3ONCA 1PX8A 1XQKA 3S0CA 3N4FA 4A29A 2WANA 1EX1A 5I3KA 4I6KA 1QU4A 1DQXA 1R3TA 2FIQA 4UTTA 1B57A 3BANA 4HYVA 3KLKA 4NRSA 3H23A 4TUFA 1FH8A 4AX6A 1OX6A 4N7QA 4UTIA 2QLYA 1HF6A 4I6VA 3SCWA 3BAIA 2JK2A 1E1FA 4KWOA 4C65A 4JTFA 4AAJA 4HBOA 4IPXA 5BRBA 2GQ8A 3RGCA 3AYSA 1M7XA 1J5SA 5A2BA 3DKJA 3RYSA 4CCCA 4KQNA 2BGSA 3WK3A 3C8FA 3D46A 3FOKA 3N4EA 4C6NA 1P7TA 1RY8A 4ADSA 3A6OA 1SZRA 4Q4QA 3LLFA 4LYRA 3QVQA 4B90A 3VILA 2DVXA 3HGSA 3CUIA 1EGMA 3PZOA 5F2GA 3OLIA 4FOUA 4O1CA 2EGZA 2JALA 3BXWA 1I2NA 2Y2WA 2M2AA 2VEGA 1X96A 1XLFA 1YRRA 4AVNA 1PKMA 3D3AA 3HGOA 1SW0A 4GX9A 4KWUA 4RLIA 4DM2A 1WZMA 1B3ZA 1JULA 2VDIA 5G2IA 3TJXA 4B5UA 2PTYA 2CITA 4PULA 1US2A 5G5IA 1J9YA 4E38A 4GZIA 4ES4A 4X9YA 2QT3A 1MNZA 1P5BA 2V3GA 2P8BA 3T08A 3PANA 1GVYA 1F3EA 3AC0A 4JIHA 3FEQA 3N2XA 5HQMA 5AHFA 1MUMA 2CYGA 2AGTA 3OTRA 4KWVA 2PV3A 2JIEA 3KXQA 5REQB 2DT2A 4W9OA 3IVTA 3S5YA 2MF9A 3GVRA 2ZXQA 1XI3A 1Q8AA 4H04A 1HJSA 4JEQA 2XIOA 5DX7A 4A05A 4MADA 2OFNA 1E15A 3TX9A 1CIUA 1RK5A 3W72A 4N4PA 3QV6A 2ZUVA 4GGQA 2ZUMA 3GAYA 2OSXA 4KESA 2OEKA 1QHOA 1D7KA 1XGEA 1US3A 3FK4A 4GFIA 5CC7A 1R87A 1RQHA 3AISA 2QR6A 3O07A 5LIXX 5DEZA 1L8NA 4XBJA 3RMEA 4UFMA 3BK0A 2IPFA 3HPFA 2F8QA 3VD9A 1EH9A 4JFLA 4Y9OA 2KR7A 1ROTA 2EKGA 4XAFA 3VYLA 5A8NA 1GG1A 3G18A 2WHJA 4QIBA 2PSNA 1BGAA 1A0DA 2CHOA 1FDZA 1V3IA 2J7HA 3TC6A 4IJRA 4HNUA 3KE0A 2OLAA 3C0QA 4UFLA 2Z1VA 3R1ZA 5MKGA 4NNAA 3VKKA 2CBUA 2FJUB 3KBWA 5JBEA 1OGSA 3O6DA 1ADDA 1XJBA 2H8XA 2OOFA 4RDVA 1N8WA 4CNTA 2POZA 1ZUAX 4H8UA 1JFHA 3BZJA 3FYPA 1G7VA 3FW6A 1V7YA 3P14A 1TJ1A 1PIFA 4AHOA 3OLGA 5BXSA 3M0YA 2XPBA 1K7EA 2NX9A 4Z2LA 1G94A 2YKKA 3FV9A 3BJSA 2QGHA 3VIKA 1T0OA 3VFLA 1KGXA 4KRZA 3OYZA 4DRIA 1LP6A 1KR0A 5D33A 4W85A 3WQPA 1V8EA 2V2DA 1XPYA 3MSRA 3NG3A 3JS3A 2EJAA 2IUZA 4H8HA 1TPUA 3STEA 4BQ3A 1VRXA 2DZSA 4C6OA 1TV3A 1YXDA 1X97A 1E4LA 4M1BA 3BMWA 5KINA 2PP1A 3DYOA 1EBHA 4H2HA 1ME8A 4I9MA 1J96A 4PCSA 3F4DA 2C16A 1Q3NA 2DW6A 1Q13A 3IJ6A 2J9XA 1W5QA 5HWMA 4MGGA 4DJED 1XBXA 4HNTA 2DIEA 5LIUX 2WK2A 3O5MA 3TC3A 2F6XA 3GR7A 4N6FA 1RVGA 4QX4A 3GQYA 3LHZA 3FA5A 2ZQUA 3LPFA 2AAMA 4KRTA 2X2YA 2AKZA 4U5KA 2D20A 2J7GA 3HIJA 5FEPA 3PBYA 3T81A 3GG1A 1BSLA 4OOUA 4U3AA 1TCMA 6REQA 1EA0A 3TXVA 1XLEA 2PV2A 4IH3A 2I16A 1RPXA 4ERAA 4Q6XA 1F3WA 1E9ZB 4O14A 4K3ZA 4B9YA 2JF6A 2WPBA 3UQBA 3BAKA 3EMQA 3QJAA 3SCNA 4BF5A 1S5NA 4MYXA 4EXBA 4DAIA 4QLJA 3HG2A 3FY1A 1W9UA 2OWWA 1IXQA 3PZIA 1CGYA 5FJTA 5AVNA 4CD4A 3ZOAA 3ZSTA 4PUNA 4PCNA 2OVLA 3MW7A 4DYEA 5A2AA 3R8GA 1O95A 1UP2A 1EO7A 3CGTA 3TW9A 1YYAA 1BRLB 2E1DA 4DN1A 3CZ8A 1TTPA 1EIXA 4FA3A 1UOKA 2VWSA 1G4EA 3UETA 1QNRA 3GTNA 3V5OA 4AIBA 1QPLA 2YXXA 1EUAA 3CAQA 2CCRA 2Y88A 3IJLA 1NWRA 1BYBA 2NX3A 1FCUA 5IOBA 4G7FA 2BASA 1Q4NX 4NSBA 3T8QA 3W87A 4CCZA 3HG5A 3R94A 4JAWA 1KBBA 4DRNA 2ATMA 3I6TA 4HOWA 1GK8A 3WMBA 2ZZ2A 1EO5A 2V63A 3CB8A 3GKAA 3P5YA 1Q6UA 1KM5A 1Y5WA 2GGIA 4HU8A 2VD8A 4YN5A 1B3WA 4FO4A 4XBKA 4DRJA 2HSAA 2PC8A 3OLEA 1UWQA 4LAOA 3MQTA 1RHCA 1UZ1A 4KH2A 3KADA 4E8CA 3E5BA 1PIIA 2PGFA 1UA7A 5HJYA 2VYOA 3NQAA 3VD5A 3MP3A 2ISFA 4XAKA 3C2EA 4NZJA 4E2VA 1ZZMA 3WEZA 3IAPA 4P7RA 1CBGA 2XH0A 4B9ZA 4UMBA 5HWBA 4JFSA 3TYUA 4ZTYA 1B30A 1FDYA 1UZHA 3KM8A 4PBFA 4E8DA 1XSKA 5CAHA 2BG5A 2D0FA 3PZMA 2XINA 2PRMA 2X42A 3GIQA 3PA7A 1EEXA 3WJYA 5C70A 4FLOA 1GPFA 5LGXA 2VFEA 1W9VA 1FWIC 4FIQA 3BO9A 1AW2A 2P88A 4TX8A 4WOZA 2XSBA 1F6KA 1FWAC 2FZ8A 4MWAD 2QVHA 5E0FA 3LS9A 3WQ5A 3NURA 5CLTA 3O7UA 4I5UA 3SCOA 2V5CA 5LNUA 5CJMA 1LRTA 4XIMA 5I98A 3GH7A 3F2DA 1K3UA 3B9AA 3EX2A 4WKHA 1EC8A 4GC3A 2FGLA 2GDQA 3AQUA 1SZFA 4R88A 1BQGA 3CLWA 1AODA 4P8WA 3WLKX 1WAUA 4ZMGA 2EBNA 1JZ5A 3U8GA 3WDIA 3FN9A 3E2QA 2V5JA 1JZ3A 3OZMA 2HE8A 4JTKA 5T26A 1G69A 3AS3A 1AQMA 2RAGA 1V3LA 1W9BM 3KX6A 4DXKA 4HGXA 4WF7A 1RK6A 3QH2A 3RHGA 1TWDA 4DLFA 3GRIA 2Z25A 2ZDRA 3KZPA 3TONA 3GXIA 2H9AB 4DRMA 4FEZA 1AVAA 1R3VA 2DQXA 1IEXA 3PG8A 4NJGA 4FR1A 4CNOA 3CQ0A 3WD0A 1LBMA 5CSSA 3R0DA 5BWFA 1KRAC 5IBXA 4TMCA 4K7VA 2O7SA 3U2OA 2GJLA 3WQ4A 3BARA 3V5CA 3EA2A 3CUGA 3N6HA 4KFNA 1VFSA 3TA6A 3H2CA 2J77A 4O57A 2V3EA 1OC5A 4DQWA 1SO6A 4QP0A 1FY6A 2WC4A 3OA3A 1ISXA 1M04A 4F48A 2TYSA 2PWUA 5HPCA 4AC1X 3QOMA 4MVAA 4IPNB 4D2JA 2PLCA 2ZX6A 1H7PA 4JNZA 5D32A 2QDDA 2BB0A 3WNPA 1TE1A 3HN3A 4PCTA 3GM8A 4HBEA 3GVWA 3H2EA 1VD6A 1O12A 3AIWA 1FWBC 4PRWA 3PY2A 4ZSTA 1TO3A 2QMKA 4DO4A 3NCOA 4DWSD 4ALDA 1HL8A 4FX6M 1GVSA 3NJ3A 4TYOA 3QQ0A 2GUBA 3NZRA 4C1NB 1C8YA 4C6BA 4CNUA 4GNVA 3GR8A 4AEEA 2ZVIA 4G1KA 2I5IA 1E6PA 5I02A 4XTDA 4IPPA 3W2LA 3SGZA 3PG9A 3PJTA 3C3NA 4QITA 5DN1A 2VO5A 4MG4A 5A8MA 1F4HA 1SZEA 5HR7A 3VFCA 4H41A 3S1UA 1MI3A 2IS7A 3REQA 5AYIA 4P5UA 4EPDC 3TR2A 1OZQA 1UWAA 4O17A 1GEQA 5AC6A 1YDYA 3HF3A 3C86A 1F74A 2VOMA 3SY5A 1P0BA 1NOWA 2ZR6A 1Z7AA 5T9CE 4DIPA 4PL2A 3LRKA 3VOIA 3VOGA 1R2SA 1OCQA 4CU8A 3L66A 4KEZA 3W82A 1XLLA 3FVMA 1HP5A 3QSTA 2BHYA 3U48A 1RCXB 3WFZA 4KETA 3AIQA 2BODX 2G37A 3WL0A 1HO1A 3H22A 3XISA 2DZUA 4H00A 2AAAA 2EPHA 4QROA 4WR3A 3TAOA 2WJZA 3WLHA 1KFEA 5C2CA 4XVEA 2PWVA 2UV8G 1QWKA 4IOTA 3NEHA 3WEOA 3V0SA 2J7DA 4RX0A 1XX1A 3ZR4A 3NO3A 2CLLA 1HKWA 1UWIA 2BXZA 1B9ZA 1SJCA 3RX2A 5FSDC 1WE5A 4DUVA 2ZX8A 3LBCA 8RUCA 1RXOB 5KEZA 4HZ7A 3FGCB 1Q66A 4JKMA 1W9DM 5HUOA 3WLQA 1MQPA 2OQHA 4BQ5A 3WDPP 5BOFA 4AIOA 3GFXA 1QO5A 1OJXA 2X0HA 1FXPA 1Q6CA 2WMHA 3NI6A 3E0WA 2A7NA 4K8EA 5EMKA 3UZ5A 4B91A 6PTDA 4LH8A 3KWXA 3P74A 2Q8XA 4AISA 2PBOA 4U4MA 3UF8A 1X6LA 3WF1A 2A3EA 4MNKA 1P43A 3MI2A 4DUOA 1V93A 2O9OA 3G6LA 2BVTA 4FLRA 1V08A 3N3MA 2CZ5A 2OWXA 1WKYA 2CLMA 3AROA 1I2PA 3G1YA 4PMXA 1PB0A 2W6RA 2QPXA 3E0IA 1MEWA 4DJEC 1FX6A 2NXIA 2G50A 4U10A 3SDOA 1LG1A 2NSXA 3GFZA 4O0QA 2PURA 3AJXA 3RMJA 3UR5A 3MSGA 1WZKA 3Q37A 5I23A 1GW9A 2GQAA 4Q4KA 3SFKA 2W66A 1MW2A 4JIPA 2WQDA 1KM4A 1X8FA 1IYXA 2XWEA 4DZ2A 2ALRA 1ML1A 4ZS6A 1ZAIA 3O6AA 3H4XA 4C6MA 3UG8A 1QRQA 2VELA 3PZUA 1JDDA 4XKYB 4TO8A 2PMQA 1DPMA 2FPTA 4RR4A 4YMZA 2BXYA 4AZ6A 3TJIA 1KV8A 4LYPA 4L4LA 3EX4A 5HKGA 1JGIA 3KVMA 2J75A 2ZC1A 1VPXA 4ZOAA 3U2ZA 4PTXA 3ARPA 2FVMA 1M5WA 1GQKA 2OLHA 4CQBA 2GJXB 2M08A 3V4BA 3GW0A 2EPNA 3GDBA 2Q71A 2V68A 3CH0A 3LCWA 1YPXA 2GQ3A 4ODOA 3BMVA 4I9TA 3ZXWA 2YW3A 5I7GA 4JN6A 1JZ7A 2RDUA 3WQVA 4GXMA 5AVHA 1HTIA 1DORA 1ALDA 5AYYA 4XWUA 1JCNA 2YR1A 1VJSA 3IPWA 4G5DA 1JVNA 3QGVA 2G41A 1WDSA 4XIAA 1JCHB 3K8MA 1K8CA 1PZ0A 2FHCA 1E51A 4LAWA 3W1TA 1GQLA 1XIDA 1V02E 1OFRA 4HB7A 4JHZA 3RXZA 4BFAA 4DO5A 3ARSA 3TDFA 4PMNA 1ISYA 4Y9MA 2QJHA 2OJPA 3BG5A 3GS6A 3KOWA 2VR4A 4GVGA 4HSHA 1RBLA 1WKDA 4OT7A 1FKSA 1UKOA 2HROA 3KBVA 5BRPA 1T41A 3TYBA 3BCDA 5D75A 2PDJA 3JYMA 1TWIA 4O11A 4MAZA 3DI1A 2Y89A 4W9PA 3WLIA 2VI0A 5D03A 1UD6A 1KM6A 4GO9A 2O7QA 2PLJA 1QNVA 5D9MA 3EXTA 4OOZA 3GNRA 2BHZA 4HK6A 5DCBA 3LD5A 3FA3A 1V77A 4IM4A 3UWYA 1ZBCA 1M7PA 2X40A 3RIKA 3STFA 1P1XA 3WNKA 3GTHA 1F40A 2C18A 1NARA 3HV9A 3QV8A 3VM5A 2REQA 2V3DA 3E3HA 3VUPA 3WMSA 3BLKA 3CQJA 1SPQA 2EG8A 4MWAC 3MCOA 4YNGA 1RA5A 1RQEA 3CV2A 4H8NA 3TR9A 2W91A 5LA2A 5A8GA 5CJ5A 2CZFA 1LBFA 1DL3A 5T8GA 3W2JA 1FKJA 1VCGA 4EANA 4N19A 1BFNA 2W62A 3HQ1A 4EP8C 2YL8A 1H62A 4ZCWA 5GQBA 4LF1A 1PE1A 1US0A 4J40A 3ZSSA 1IXOA 4V27A 2CBIA 3IAQA 2CEQA 1S3TC 3JZEA 3VO0A 3CIXA 4IIBA 2UZ5A 3PR9A 3DI0A 2ISVA 4HOZA 3B0UX 2VFIA 3UR7A 4JFMA 5DMMA 4ZL1A 1BF2A 5HMFA 2HE5A 4N9DA 5DQPA 4XD6A 2ATSA 1H1NA 2VGIA 3GHRA 1YE4A 4WK9A 3GZAA 1L6YA 4IISA 3VIMA 2PD5A 3VINA 2O9PA 4XG1A 5A69A 4C7GA 1XCFA 3WO8A 4LANA 4OHQA 3WJSA 4IHCA 1B31A 2X1SA 1C8QA 3B9NA 4K68A 2GSEA 4O4VA 2HEJA 1CXHA 4G7EA 3W1PA 1JUKA 5K2ZA 1EIBA 4ERIA 1HL9A 3MP4A 2WC3A 5K4XA 5C7HA 3QHMA 3PAOA 1JZ4A 2QCDA 4V28A 2HDJA 1QNSA 3UXIA 1U5HA 4S3BA 2Z0IA 3N6QA 4HT3A 4TX0A 4PMZA 4NAFB 5EKYA 1UUQA 1VPYA 1JCJA 3SUVA 1H7OA 4PODA 1JXKA 3GNNA 1JNSA 5FEWA 3PF3A 5HNNA 2EPKX 1E43A 3GG8A 4B2DD 1VH7A 4YTTA 4GE8A 4JKKA 4B3LA 4S38A 3LM3A 1LL4A 3C6CA 1PHWA 4NZCA 3ZVHB 1UROA 4KGJA 1VJZA 1MDLA 4Q22A 3M9YA 4O4WA 1FWCC 3RM9A 4GACA 4QJ3B 3QXBA 1PL9A 1D7HA 2CZDA 2DSWA 3MU7A 2XWDA 2J8GA 4LBSA 1I60A 1GTEA 1OD0A 2OLSA 3AS1A 3GBDA 4W9QA 1IEIA 1H63A 1NEYA 4DWSC 3FNDA 4HA3A 2BVWA 3K1GA 1VENA 5HMEA 2N87A 3NRKA 3EWBX 2YJQA 3GLCA 2V5DA 3QOKA 3B97A 1MXGA 4RXGA 2VN1A 2YGYA 1A3WA 1DXEA 3OB8A 3YPIA 2DSVA 5CZKA 4D6IA 2A3AA 3OGRA 1GZGA 1LQ2A 3L9CA 1U5VA 4S1FA 2PODA 3FJ6A 5KZMA 4LRTA 1ONWA 3WEMA 5IFTA 1JG9A 1GZJA 4C6QA 5AFDA 3SCRA 2ZRWA 1XISA 1QVBA 1CB7B 1R30A 2OEMA 4MZ8A 3VCCA 2YFNA 1TELA 3G22A 3VE7A 3CT7A 1HNYA 2ZRUA 3QN3A 2VR2A 3GNDA 1TUFA 3ZWTA 5BROA 4PMRA 3W1RA 5D2YA 2UZ9A 3N9SA 4UTWA 3LCGA 4Y90A 3CQKA 4WQ6A 5J8LA 4FHAA 1GTHA 1V02A 2G95A 3B8UA 1DJGA 2C1HA 3URAA 3WQ8A 1TJRA 2GL5A 4GIAA 3W25A 3VOFA 4PUKA 4PUUA 3UG5A 2PP3A 1FWGC 2BGNE 4WHBA 1RLDA 3W27A 4MDOA 2WMIB 4NX5A 5D2VA 4W8BA 4MNJA 4G1NA 4DLMA 4H3DA 1YEYA 2X05A 3R10A 2G3NA 5LGZA 4CVWA 1RA0A 3MVIA 4UQAA 1SZNA 3EB4A 2BHUA 1BG4A 3W1AA 2ZKMX 4DIAA 2LJ4A 4RKAA 3B04A 2HVMA 3CZEA 4H6QA 3I4EA 1XLDA 2DZXA 5K3VA 5CG0A 2MPHA 3W2UA 3BJFA 2WJEA 1NF0A 1QFEA 3L2LA 1MWOA 4G50A 4FF5A 4QTGA 1A5MC 1G01A 3VU2A 1EC9A 1UUOA 5FD0A 1KBLA 4LVDA 4L7ZA 1TV7A 3A9BA 3OIHA 1YTKA 4ZB5A 1OFBA 2VENA 1NM9A 4QS6A 1G0CA 1BLIA 3S1GA 4ZQOA 4PL1A 4NNCA 1C93A 1TYGA 1EGZA 1EHNA 1FWSA 4XD4A 4O2TA 1R3YA 4C5YA 1OM0A 3GU2A 3HPZA 3A5VA 4FOJA 5IRPA 4LC8A 4MWAE 3CYJA 2V0TA 4P7OA 1FJDA 2TRSA 3IIPA 1DXIA 1XKJA 4PH6A 3MHFA 5CLWA 2OYMA 4TVUA 3ZYZA 3TP4A 2QIWA 5G4HC 1XRVA 1ISVA 3DFQA 1UPMB 1H49A 4MB4A 1CDGA 4QG8A 5AHEA 3TMQA 3KBMA 1SO3A 4H4IA 4HJFA 4R85A 2E09A 4CD8A 4CD7A 3UJRA 5TIMA 3NWRA 5I06A 4OVXA 7TIMA 3W7EA 1JZ6A 2GUUA 3SJNA 5JU6A 2XFYA 3AALA 2DH3A 4S3DA 3TYCA 1CT5A 4LVAA 1VAHA 1NJJA 4ADUA 4H9TA 3B4UA 3JVAA 4PRRA 3MDYB 4DO7A 1SJBA 4LNCA 4O52A 2NQHA 4NZFA 3VIJA 4IT6A 2CLKA 4PE8A 4D8AA 4I7WA 4W4QA 3BW3A 5FJOA 2A6LA 2Y8VA 1UP3A 4JD4A 4Z0SA 4U33A 5CC5A 2VP8A 1SW7A 1E9IA 1QW9A 3F5KA 3CZGA 4MLJA 1Z32X 1Z6KA 5BMWA 3W7MA 3E0LA 3CU2A 5EBAA 1XINA 2W4XA 4BWLC 3BDKA 1ZSXA 3W7LA 2BMBA 1H1YA 3P6LA 3IIOA 2QCGA 4TV5A 2J78A 2XFFA 2DIKA 1K7FA 1XP3A 4K36A 5E93A 3WQCA 4NJHA 3WJZA 3NL3A 1Q6EA 2WCAA 5AC7A 4NY2A 3H54A 1I1XA 5A5WA 4CCDA 4LNYA 3N04A 1WCGA 1F5ZA 1R9HA 4R34A 1GPWA 4DJEA 2ZQ0A 5HDRA 1LT8A 4LUTB 5FL0A 1AH0A 1WOAA 3VC6A 3ABSA 3TCEA 2QAFA 1DV7A 1KQZA 5HTGA 3M07A 1KFCA 3SO7A 1X7IA 4UNLA 3QQ1A 2KO7A 2I5QA 5K7JA 1IEVA 1ZBKA 3NVTA 3UYIA 3MWCA 3NXLA 2PDYA 3OPSA 1BXBA 3FDKA 3W84A 4UTJA 3TYZA 2FH8A 1TPH1 3EMCA 3VE9A 3WL1A 3SRFA 2PUZA 1DJYA 3K8KA 4D72A 2BX7A 3KAIA 1AL8A 2C14A 5T91A 2EPLX 5DFAA 2A85A 2Z2UA 4UOZA 4CLMA 2V2HA 2VEMA 1LLOA 1H1ZA 4O1DA 1TCDA 3ES8A 2CERA 1OG0A 4ZB0A 1JNEA 4IUOA 2GOKA 4QDWA 2AMXA 3F1QA 5G1YA 1LTDA 3GVQA 4C6EA 5AYXA 1E1CA 4JFVA 5A6SA 1IGSA 2E8ZA 4RPQA 3SR7A 1A47A 3N17A 5AN7A 4JX6A 3WMLA 5HQEA 1EKOA 1XF0A 2J9ZA 3BL3A 3GC4A 2QJGA 3AIEA 3TSMA 2QCLA 3T55A 1VCVA 4U5IA 5HT1A 1H41A 1FHDA 4W7UA 1M53A 1QNQA 1IE7C 1C29A 4B5SA 3PM6A 1J4RA 3DYPA 1OBAA 3W2NA 3PSVA 4AVOA 3EPNA 2ABBA 1J0JA 2RUCA 2E40A 4RK8A 1V6XA 5ABFB 1IEWA 4Q7NA 1UH3A 3AU6A 1TPWA 2Y7DA 3QSRA 4YJ5A 3UG3A 4CU7A 3L0NA 1WKEA 1XV8A 1AJ2A 5IXEA 3S9ZA 2JKEA 3V0TA 2GVJA 4EVZA 1FKIA 1HJVA 2HWGA 4DWDA 4G8TA 4UFJA 4RNIA 2ZX9A 5T9BG 4YYFA 5I24A 1CWYA 1K7XA 4LQ1A 4CNSA 4H9YA 2Q02A 3M4HA 2P8CA 2DZAA 2XH7A 9CGTA 1UR4A 1UD5A 5DT7A 1Z41A 1EPXA 4TX9A 1PPIA 2PDLA 4JY9A 4ZSUA 5JMUA 4JTTA 4X2RA 5JIWA 2BSLA 1VCFA 2E6AA 3KCEA 1OG6A 3N4AA 2QF7A 2BV9A 1FQ0A 1A4MA 3SUUA 3ME3A 3EKGA 1W1YA 3H8AA 2JGYA 3GG7A 4MZYA 1D3HA 3VIGA 1XG3A 4F0MA 5F7UA 5GNYA 4Y9NA 4G56A 1UBSA 2BTMA 4MWAA 3NTPA 2G0WA 2WBGA 1XLMA 4DXXA 1CNVA 1DJQA 2PBCA 2TAAA 4BQ2A 2X7WA 4JNMA 3I68A 2GSJA 5C0QA 3TSDA 5HMDA 4FIRA 3ZIZA 4WRHA 4ZBCA 4X9SA 2W0UA 5HMSA 1GGOA 4FNRA 2Z28A 3EDDA 3APTA 4RE3A 1W2PA 3WD1A 3E1F1 1T8QA 4Y8FA 1W91A 5D9PA 3MYOA 5I78A 3GNPA 4X2PA 4UR7A 1NDVA 1TUXA 2V81A 2Y24A 4FSAA 1FWHC 4PMJA 5FSEC 3O5OA 3EPMA 4R7JA 5I07A 2XP7A 1GHSA 3CS2A 5EU9A 1FKKA 3UXLA 5B80A 4L6HA 1W3TA 3GTFA 2OCZA 3PR2A 4FAPA 3TU9A 3HGRA 2A7RA 3T0BA 3FJ4A 3LZ3A 1UD4A 3OQEA 1YDNA 1W1TA 4UMCA 1QT1A 1NWSA 4GQBA 4PN2A 1B3VA 3I7RA 1Z48A 1LUCB 2PZ0A 3MV01 2WZIA 5E1QA 1I4NA 4A3HA 2RFGA 1R7OA 2VR5A 3GVVA 1XRTA 1WYIA 3WG6A 3N14A 4RNJA 1MRQA 3IGUA 1M6JA 3N9KA 2Z26A 3E12A 2RH9A 2XN1A 1S5VA 2BFGA 1A7XA 4M0XA 3WLTA 4IQDA 4GXWA 4XAGA 4JDYA 3W7RA 1JYVA 2DSUA 4QISA 3TN3A 4HHHA 3C2VA 3UU0A 5FIPA 1BXNA 2QHAA 5BW6A 1LQ0A 4GI4A 1PHQA 2YL6A 3UJEA 2YBUA 4CKQA 3LHWA 4DBUA 3LU2A 1GKRA 1ZU8A 5AHNA 2CXEA 4GYKA 5AHLA 3S1XA 3KRBA 2P4VA 3N11A 1FAPA 1JNTA 4BR1A 1PYMA 3UEQA 3ITCA 3W28A 2YCLA 1ZCCA 1Z8AA 1W1ZA 3OYXA 3H7UA 2ICSA 1Q6GA 3L7RA 3BLDA 4U84A 4LVFA 4WJ8A 5DMNA 4PB4A 1QNOA 2Y7EA 2M1IA 4O50A 5LZLA 3IK8A 3UI5A 1POKA 1V6TA 5A94A 3LMYA 1I2RA 3PC0A 4CQCA 2DT1A 5RUBA 2PWGA 2VD9A 1GZ1A 3B06A 3U7BA 4A35A 2D69A 5AC5A 3LV5A 4WUIA 4AYGA 3E74A 3VGHA 1EUNA 3L0KA 3IIZA 4O12A 4WIWA 4GHRA 2E25A 1OCNA 3HV8A 4JFKA 4O19A 5DO8A 2NUXA 4C6FA 1BGGA 1L6GA 3WD4A 2DQWA 2ZVRA 3W1NA 3RFAA 1LT7A 3W29A 2PDHA 2R1LA 3F5JA 3TW7A 3EPOA 4E3VA 1GEHA 1VBRA 1QTWA 4LUIA 5CPLA 3NDYA 2Y7GA 3G1VA 1FP9A 3NQ2A 4Q8UA 2X1UA 1Y5VA 4NX0A 2DGAA 5CAKA 1NQ6A 4NNRA 3REQB 1XPGA 5J04A 1OCJA 3UPWA 1E6SM 2JEPA 3TFCA 4NF7A 3MHGA 4U2ZA 3F03K 3L4VA 3WBXA 1C3FA 4DI8A 1UZDA 1E73M 3MMDA 2PRHA 4GRSA 5XINA 3RILA 3A4XA 3TZNA 1XLHA 1HIZA 3SI9A 3I6RA 2L2SA 4I9JA 1A80A 2MNRA 4LV4A 3T1GA 2FYMA 1R9YA 1GVFA 4IL0A 4L1GA 3RGTA 5GNZA 4L80A 4QS5A 4TTGA 3EX3A 2D0GA 3Q94A 2IQTA 2NV2A 2VZOA 1I75A 2YDAA 3CB3A 5HW6A 1HQTA 2Y8KA 5AKQA 1MEHA 3DBPA 4TQTA 1ZFJA 1XIGA 5AZ1A 1HG3A 3U5YA 3WUGA 4ZXLA 3HPSA 2G97A 4PMYA 3B9OA 2GZXA 2R1PA 3C2FA 1QMLA 4EF8A 4INFA 2WYSA 2ZWYA 2VZTA 2D73A 4IG2A 4N42A 5IFPA 5HXMA 2AL1A 4Z1YA 1RPKA 4LS1A 1IZJA 3K4WA 4AF0A 3PZGA 2BS9A 5H8PA 2GVEA 1PSCA 2DIJA 1B9BA 2PU0A 5EMJA 4S2BA 2PLMA 2HQAA 2VURA 3RITA 2AKMA 4D6FA 1UD8A 4EPBC 3PRAA 4CVUA 5CBJA 2XIQA 3V0UA 4JZ5A 1OK6A 1QOXA 3TJ4A 3NQEA 1F07A 3GXNA 3LSCA 2W92A 4TNSA 3KLLA 3UJFA 3NQ8A 3MUAA 4OQVA 4PUWA 4C6KA 3W02A 4Q8QA 4K6AA 3QKEA 3ZQ9A 3L5AA 4RE4A 3WJXA 1XFBA 3UY7A 3W7KA 3LN3A 1ONEA 1U22A 1LRNA 1XYCA 3ECQA 4X0NA 2V5KA 4IMEA 3AMLA 5MHBA 1RH9A 1Y7VA 5AYBA 1PWMA 1LG2A 2R1MA 2XG9A 2FTPA 1REQB 3WUBA 2E4TA 2WO5A 4XAZA 4HQVA 3O5JA 2YL5A 3L4TA 3EZ4A 3EOOA 1X8CA 1EHAA 2RUSA 1N8IA 1XD1A 2NQ9A 2VHLA 4J4KA 1DJZA 5ABGA 1JNDA 1EF3A 4ADTA 3SN4A 3UXDA 3LUOA 1V03A 2J25A 1XYBA 4IJCA 4PB5A 2ZTKA 3S2JA 1YE6A 2WV8A 4IZGA 1UC5A 4HCLA 4M80A 4FX8A 3WX7A 1S2VA 2A7PA 3DFSA 3ABZA 3VCRA 1KGUA 1FKDA 2AWGA 3O6CA 1BL4A 3T0TA 5GVJA 2WAGA 3I6CA 4F40A 3THQA 3CK5A 3QY6A 4QEEA 2XVGA 2J79A 5K9CA 2O0TA 1FDJA 5CG7A 1RVKA 2V67A 3WLOA 1RBOB 5BXTA 4PUJA 3H26A 2RUDA 4PEEA 5CPTA 3R11A 2ZZ1A 2EG7A 4XD5A 3TYDA 3WLJA 4PCFA 3Q67A 3AOFA 3LEPA 3W2MA 4FXRA 1B3YA 6A3HA 1K6WA 1LZOA 2FZBA 3SSJA 3ARUA 4O8AA 3E02A 2NQZA 3WLMA 4UQEA 3VXGA 4HHLA 3F2CA 3GY1A 3GDLA 6XIAA 3TIMA 1NOFA 3AZRA 1RV8A 1FRBA 4WSHA 4I5RA 2NV1A 4EACA 2VUNA 1KM3A 3NIYA 3SCVA 4RL3A 1W8SA 1IZKA 3KDNA 2BXVA 3OVQA 3KL0A 1V7AA 4A8IA 4AWSA 2XJ7A 3T2OA 3B05A 3NQDA 2PTXA 4X22A 2X0YA 1GJUA 1AMYA 2LLEA 2QJIA 3IKGA 1MVYA 2B7QA 4HSOA 3ZJ6A 4AY8A 3KCJA 1Z44A 2PBGA 4MY8A 4PBGA 1NDWA 2DUXA 1KBIA 3TLQA 3P81A 5C55A 2Z4GA 3KUMA 3PBWA 5A2CA 4WD0A 2A5HA 4PSRA 2D24A 3NYZA 3CWNA 3CTTA 4IMAA 4AHQA 5F1VA 3S4TA 4CCEA 4O54A 1DVJA 1I45A 2GGJA 3VDAA 1K8ZA 2J6XA 4AYSA 3H9RB 1S39A 3GXTA 3MMTA 4ZTXA 4FK9A 4ODQA 4AZGA 1GOQA 4LOCA 4IGHA 5GJNA 2NQJA 1KT0A 1TJPA 4K39A 3CO4A 1HZYA 1J6YA 2E3ZA 3KRUA 2XVLA 1AJ0A 1FHVA 5HJLA 3CUHA 2YPIA 2REQB 4DAFA 4R53A 1VEMA 2BVDA 4KEUA 2WCGA 4JN8A 4GZ7A 2AL2B 4GUJA 2VTFA 6XIMA 1CGTA 3S5ZA 2GDVA 2VX4A 4UTMA 4X60A 4EK7A 1EQ3A 2BBFA 5CH9A 4PEKA 4W5UA 1Q6FA 3NQ7A 2PTDA 3R4IA 4D71A 3WCZA 2X1IA 1W5MA 1GVOA 2JQXA 4B16A 1XC4A 1XQLA 1F8IA 1VLIA 2G4FA 4FP1A 4HPXA 4J9JA 2Y63A 1T11A 1FH7A 3S8HA 3AMKA 1IV8A 3NNTA 3SW6A 2D2JA 4ORIA 1R8LA 2XPAA 1LDCA 1CLVA 1R2TA 4XTIA 3KOXA 3W7DA 3KRSA 3MBDA 3UWQA 1L2UA 3NOYA 3W7CA 1HKVA 2Z1BA 3VKCA 3BE7A 1XLIA 4M6UA 4AHPA 2NLIA 1YX1A 3QZAA 3C5QA 3D6NA 2C6QA 2YA0A 4LUSA 1XIMA 4M51A 3TJLA 2F21A 4DNMA 1HVQA 1J0IA 1XH2A 1RSCA 5C9ZA 2O9RA 4G7EB 4XO6A 2Z00A 4BA0A 2VQUA 3FX4A 1KFWA 3ARTA 1MZRA 3UI4A 3PVFA 3OHIA 3GUGA 3NSNA 4GUGA 3UJSA 1HGWA 3EA3A 3RJXA 3PP7A 2ETNA 1M7JA 1VFMA 2PDQA 2KFWA 3CV6A 2PGRA 3A3WA 1P0NA 3M0HA 2WXDM 1YBQB 4GQGA 2HXTA 4LPCA 3CUJA 2HPMA 3BOLA 2J62A 3GR4A 3MUIA 5L9FA 2XM1A 4LCSA 2XGBA 4JTRA 4C7FA 1E0TA 3IVUA 3DH7A 1CLKA 3DU0A 3DDMA 3EX1A 3KBNA 3RRXA 3GYEA 2F9RA 5D8WA 1TPC1 1XL9A 9RUBA 4BF9A 1W1PA 3NSMA 2XYLA 2YDRA 3EMZA 2E6DA 5LYRA 1X7FA 2FPYA 2FLIA 3ZT5A 4IQEA 4JTJA 5JXQA 1IWPA 1S1RA 3UP8A 4W93A 5CSRA 2F23A 1KKRA 5GJMA 3G1XA 4M6QA 5DT5A 5EFFA 3UY8A 1A3XA 1DWJM 3UZZA 4TX6A 3QR1A 3BSGA 5CPQA 1SR0A 2BY3A 5U4NA 1OK4A 1EYEA 3WLLA 1NMWA 1EBGA 2PU1A 1W31A 4GIEA 1L6SA 1A5KC 3C52A 4L56A 5AOUA 1MW0A 5HJXA 1FFRA 3DERA 1S46A 3TN6A 1EF2A 3MZ2A 3CQIA 3D3FA 3W3OA 1GKPA 3ARQA 1O94A 4ROQA 5FF4A 3IUHA 3LI0A 5CPMA 4ACZA 4AZHA 3W73A 4P7LA 4WXZA 1RR2A 2VEFA 3S5OA 4IT1A 3ONBA 1E1EA 3CZJA 2QKFA 1TV5A 4LAXA 4Q7BA 4DF1A 3THCA 2QCMA 2P3EA 3Q58A 3RO8A 3RJYA 1VFOA 4PGLA 4OGZA 4AH7A 1D9EA 2NUYA 4IQ2A 3BCJA 1MYRA 3OOBA 3RFWA 1I9CB 3ITGA 1UD3A 4UR8A 3ZO9A 4WDTA 2QW5A 2Y5EA 4XAPA 1R3SA 1IR2A 4C6DA 4AFYA 4Q32A 3L4XA 4EIVA 3T0AA 4GPNA 3E96A 4C7DA 5EY5A 4H9VA 4HBKA 3TW6A 2Z1WA 6CGTA 2WVTA 3H6OA 3DUGA 3VGEA 4POCA 3IK4A 1NMVA 1AD1A 1ADOA 1WP6A 2MUCA 4EXQA 4XZNX 3FKRA 3POCA 3FVDA 1HT6A 3KVJA 1W3NA 2D3NA 1TRIA 2Y70A 4NU7A 1MRAA 1Q6OA 4LAVA 4IWWA 3P0XA 2MLXA 1TV8A 5LKYA 5CBBA 1CCWB 4FB7A 1SJAA 1O68A 1RCQA 1V3KA 4US6A 3BG9A 2WB5A 2R14A 4GVFA 1F9CA 2RKXA 2PS2A 3NQGA 3MY9A 3AS2A 1PZ3A 3KOFA 1I0BA 1K8YA 3KHDA 2WQPA 3LTPA 4RV3A 4O8RA 4MY1A 4JTGA 1XLJA 2ON3A 1EXBA 3DFYA 4IUGA 4NAEA 3VX1A 1ZTVA 3OBKA 2AQOA 5LIWX 2WHLA 2QEZA 2W79A 4RZBA 4UUIA 5DMLA 3JR2A 5DITA 2ADAA 4F4RA 3II1A 3M5ZA 1V6YA 4LYQA 1QW8A 1AMKA 5JUVA 4FNPA 2XP3A 4MUZA 1KM0A 3LA4A 3AFBA 1OVDA 4HA1A 1B2YA 1LL6A 5CGMA 1C8VA 3WF3A 5HOSA 1JJKA 1FKWA 4FS9A 4DF2A 2B0MA 1F7BA 3NSXA 4L1XA 2CLHA 4H83A 2HK1A 4KR0B 3GNOA 3ZLFA 4M82A 3N9RA 3VDHA 3LPPA 4ZPTR 3W37A 3U4FA 1UH4A 4IGMA 1NIUA 2Y8UA 4Y8EA 5AECA 4ERGA 1UH2A 1Y0OA 4LBRA 1OEPA 1OIMA 4G6CA 4GY1A 1C8XA 2BY2A 3PS7A 5FCZA 2A3BA 1VBUA 2OXNA 4Z2KA 4GI9A 4D6GA 3B7XA 1AZ2A 2YX0A 2JIWA 3BMXA 4MMWA 4Q4OA 4D8ZA 3E9AA 1E5NA 3ENLA 2DJLA 2R8WA 2YBTA 5BXPA 3VNMA 1CX9A 4MGVA 1A5AA 1TJ2A 3PRDA 4FALA 3IK2A 3MUXA 1TJ0A 3ARZA 2PN0A 2D2HA 1UR2A 2J27A 3UVIA 4HK7A 2J7FA 4J35A 2H90A 3OHMB 4U28A 2E28A 5C9RA 3PWGA 2I9EA 2XGZA 3HZ3A 4TW8A 4CGTA 2G3JA 3IANA 1V6WA 2JBMA 4Q8MA 1ZQ5A 5HW8A 5FF2A 4W8AA 3R8RA 1SVDA 1LWJA 4Z1CA 4HNLA 1Z69A 4ZR8A 5D09A 1ZP4A 1SYTA 2GJPA 2TSYA 2O92A 3C2OA 3LLXA 4UBPC 2J7CA 2HZGA 2OX4A 3BW2A 4ICNA 2D9FA 2E1WA 2GWNA 1GKQA 4JYSA 4FXJA 3WFAA 5K9XA 1XS2A 3CUXA 2PRLA 5BU6A 3CASA 4DI9A 3C2YA 3QKZA 3RNDA 3O5KA 3M47A 5ECUA 4QCFA 2WNWA 1CI1A 3O1NA 3SN0A 5IBXC 4ZOCA 1DIEA 5GJPA 5BXJA 4NZ4A 7PTDA 1OABA 3AHXA 3PZ9A 4REQA 2XP6A 3TFXA 1QATA 3W74A 3WNLA 1TQXA 3BSHA 2X0SA 2C7FA 4MPKA 4D6DA 3GXPA 5M03A 2OYLA 1A5NC 4C6LA 3G1DA 1P0KA 2HJPA 1GOWA 3W71A 1VC4A 3ATZA 4GIRA 4PA8A 1Y8BA 2OB3A 3U3HA 2E0PA 2J7EA 3FA4A 3EIPA 1DQWA 1QNPA 4LB4A 1P4CA 3FYOA 1VYRA 3M6YA 2PF0A 3KCLA 3LENA 1V3MA 2P50A 3LGEA 2QNEA 3O15A 4MHBA 4I90A 4LXFA 4W87A 3S6DA 4K8HA 1YXYA 4I8DA 3QYSA 3SUWA 3TC7A 1FTXA 1E1CB 4H01A 1CPUA 1KBKA 4BJHA 3OG3A 1YLVA 2Y78A 1KRMA 3SB0A 1BKSA 3KP0A 1JIBA 3ZR6A 1ROUA 4FLSA 5I3DA 3DEQA 3S1WA 3UCDA 4YYCA 3S46A 2WWDA 1QPFA 3MUY1 2C13A 2XP4A 1UQZA 3BLPX 3SECA 4BF7A 4W89A 3AUOA 2FB2A 4PUMA 3SRKA 5C9UA 5ABEA 1M65A 5G2HA 2DJXA 1WBJA 5CZJA 5DRIA 2C15A 3PUEA 3GDTA 3NQVA 1XIHA 1K1DA 3GDMA 3HGJA 3UG4A 3M0MA 1JI1A 3LXCA 5EA9A 4J3XA 1VF8A 2E67A 3HQNA 1FWNA 4FX7A 3STCA 3EOSA 3F2BA 2MLYA 4AD4A 1PDYA 1D6OA 3IJ7A 4A3QA 4FNSA 4I8YA 4OFCA 3M0JA 3VNJA 4A2RA 4J3WA 1QHPA 1UOZA 4L9YA 3BH4A 4DBWA 2UY3A 2W67A 4LGXA 2F2KA 4ZVJA 3IWPA 1U33A 4KS0A 1POJA 4Q3MA 4AWUA 4HU0A 3VGGA 3TN4A 4AMAA 1HFBA 3BCFA 1TRDA 2GUYA 4JTEA 4AG0A 2PDXA 2RHGA 1Q6LA 2YDSA 2E77A 4HPGA 2XZ9A 3TTYA 3S5NA 4MB3A 3R89A 4PUDA 5D30A 4TIMA 3VOHA 9XIAA 4AXKA 4JTAA 3BOFA 1XGZA 3KACA 3KAGA 3VKDA 1LL7A 4IIFA 3FCPA 4PMUA 1HN1A 1MMFA 3SGUA 4MWAB 4LU0A 3KTCA 2IMRA 4O1FA 2PZNA 3UERA 1TTQA 1OINA 3VX0A 3IEBA 3PBUA 5C9WA 2IKHA 4RZ4A 1FKRA 2WVSA 5BCAA 3AHTA 3CNYA 3UD6A 4RDZA 3EWCA 5LHFA 3W24A 4LX4A 3TWBA 1HP4A 1Q65A 3KVLA 2Y62A 3RAOA 2PWDA 1W1A1 2Z2AA 3DFTA 1JQVA 4HZ6A 1FWTA 4HK5A 3K4AA 3L5MA 1VYPX 3ARVA 3DC0A 2G3IA 2VFHA 5H8UA 2J6VA 3TOPA 4GYPA 1HKIA 1A4LA 2Q5AA 2R9RA 4G2DA 4AB4A 3SN1A 4H6RA 1DOSA 3UFYA 4Q8OA 7ODCA 5BWAA 2A0NA 5B8IC 3H21A 1DWAM 3SCPA 4TR9A 1QXLA 4Z42C 4QE1A 3F4WA 4H8VA 1BD0A 2J8TA 2OR2A 1U1JA 2PP0A 5FAJA 1VGAA 2NWRA 1JDAA 2VCAA 3N2TA 1R3QA 4IFKB 1IEQA 4OZOA 4C02B 5C8BB 4WY0B 4MPQA 3G6MA 3PUOA 4A8LA 1SZGA 1UIPA 1KBJA 4GG9A 5LXXA 3UWUA 1FCBA 3OO2A 1TFVA 3WK1A 4S23A 4XZMX 4L9XA 2VRKA 4EAYA 1KKOA 4XD3A 4GJIA 3SFWA 3O5DA 1PZ2A 4M7SA 2FPVA 3JW7A 1E9LA 3O9NA 3ERPA 5FJJA 2G4JA 4HMCA 4AY1A 3A22A 4GZEA 4DNHA 2VX7A 3ZZ1A 3MKCA 3SQLA 2ALDA 3H2FA 1BRLA 3OJGA 5E09A 4DRQA 4KBXA 1W3IA 2QZRA 1JDFA 2CBJA 3PUDA 1GJPA 1VKFA 2ZUTA 1GNXA 2XUCA 3TEVA 3E2SA 2IPGA 4F0HA 1FKXA 2JGQA 1H61A 4CD5A 2C3ZA 1UD2A 5EGRA 1R9XA 1W3JA 3ITVA 4WCJA 1GYLA 1AW1A 1VZWA 1JVWA 4DWSB 3T8LA 3PJUA 5B7ZA 2OT0A 4PTVA 3KOZA 1B54A 2G8ZA 1JPMA 1EOMA 5JBFA 2GJNA 4FPSA 4M7TA 3A4WA 3QW3A 4ILSA 3T9PA 3Q4DA 5ENLA 1TB3A 3W7JA 3RDKA 3F7JA 3GHTA 3HTWA 2PDUA 3HO8A 2W5FA 4JX5A 3DOPA 2J9YA 4GYFA 4WSKA 6ALDA 2XISA 1QOPA 2RUQA 4GISA 3L21A 3M0VA 2GJRA 2QUMA 3BUVA 4AEOA 2DUZA 4GLEA 1MQQA 3QV9A 2DT3A 1NOUA 1IIGA 4S3KA 4ZQNA 4GIVA 1UJPA 3SCUA 3W70A 2INZA 3D47A 1CXEA 2J74A 2Q09A 1OQFA 2BOFX 4CEUC 4ZO8A 5A1AA 3SCQA <