3RM9A

Amcase in complex with compound 3
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
377
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 129
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm9A01
1E6ZA 5LA0A 3PZTA 3WDJA 1E6NA 3WF4A 3PZQA 3AIBA 4QCEA 1TMQA 4GIAA 2DH2A 3EDKA 1NWRA 2J62A 2XVPA 2V3FA 4Q7NA 3VM7A 5I6SA 1PX8A 2VZTA 1RPKA 2YKKA 2ZX7A 4OKDA 5FD0A 3L4TA 3VGBA 3VMPA 3WMSA 1HKMA 3WL0A 4MADA 3ZIZA 1EIBA 1PJ9A 5I79A 2VX7A 4B3KA 2ZUNA 3ZT7A 1CBGA 1HJVA 4GZIA 1XH2A 3A4AA 4JAWA 1CGYA 1V3LA 3FAXA 1FFQA 3A47A 1YQ2A 3VPLA 1HL8A 2J7HA 3BC9A 2ZUVA 1R87A 2XFYA 1WB0A 2CHNA 4UQDA 2VQUA 3SUWA 2UWFA 4UOQA 1DWAM 4W89A 1QW9A 3VX1A 1I1WA 1Q6DA 4J28A 1JDCA 2D2OA 3L4XA 1J0KA 5A8OA 1BYCA 1FHDA 1FHLA 4B15A 5A2AA 1PAMA 4LX4A 3ARTA 3WD4A 2XIBA 1JZ3A 1V0MA 3WD3A 3VILA 3WNKA 3GXFA 4S3KA 2J77A 4AZBA 2YIHA 4AWEA 5HDRA 1CGUA 3ALFA 2J7GA 2YBUA 1BGGA 3SUSA 4JFTA 3VVGA 4GQQA 3L4YA 2Y24A 2BY1A 4FMVA 3UG3A 3VGHA 1GHRA 2D3NA 4BQ4A 1QNSA 9CGTA 2VT0A 5DMYA 1UD5A 1UH3A 1A47A 3TTOA 3AXIA 3M6DA 4ACZB 3ZT6A 2XVGA 2GJXA 4PMNA 5LYRA 2BXZA 3AZRA 2J7CA 3ZJ6A 5D8ZA 2YA1A 4TUFA 2VTFA 2J25A 1CWYA 2NT0A 1EOMA 1GOQA 5E09A 1GJWA 2XFFA 1UKTA 4TTGA 4ML4A 4PMVA 3AS0A 1GCYA 3EDFA 3BAXA 3BAJA 2VMFA 1B30A 1F4HA 1HKJA 5BXPA 3HJEA 1PEZA 1DWIM 2VJXA 3LPGA 3WFLA 1G1YA 1US2A 3ZQ9A 5LA2A 1QI2A 4HOZA 3OGRA 4AMCA 4E8DA 2G3MA 2FHCA 1LLOA 1XD0A 2EPKX 3RCNA 1KR1A 4PSPA 1E6SM 3A4XA 3GYCA 2DT2A 2FH6A 2BHZA 4QCFA 4XB3A 2B31A 1BSIA 3WH8A 1EXPA 1GVIA 5FIPA 3IANA 1MW0A 4H04A 1B9ZA 1U30A 1WDSA 3CLWA 1ZL1A 2YLAA 2W61A 4Z2HA 1PX4A 4OUEA 4U2ZA 1BHGA 3WBAA 4MB5A 1CGTA 4LQ1A 1MYRA 4WKAA 2WANA 2UY2A 1ISVA 2IUZA 3OLIA 4GO8A 5M17A 1GUVA 1MQRA 4DUXA 1GOMA 5ECUA 3VIHA 2WMHA 3F4VA 3L4WA 1OSEA 1XGZA 3WDHA 4ATLA 2E40A 2DT0A 2E8ZA 3VX0A 4BQ2A 1J18A 1QOXA 1JYNA 3O6AA 1MXDA 3RJXA 3AS2A 4MTVA 2WWDA 4GKLA 1ODUA 4PTVA 1E0VA 2VOTA 1L8NA 2WB5A 3WKZA 2PBOA 3VMOA 2VRKA 1EDTA 3OLEA 1W3LA 4UZUA 2CKSA 3GXMA 2WMKA 2VZSA 3ARQA 1V6XA 2E4TA 3EMZA 3AMKA 3UR7A 4D6CA 4PTXA 4MDOA 1KXTA 4M8UA 3II1A 1J10A 4W87A 1Z32X 5EFDA 1UKSA 3BMWA 3UG5A 3O9NA 4P7LA 5F7UA 4DUWA 2HVMA 2NT1A 2C8NA 1NOWA 4U5KA 2BV9A 4UTFA 3RM8A 1XCWA 3K1DA 4DWSB 4U5IA 4WK9A 5FKYA 2X0YA 1TCMA 1DTUA 1LG2A 1B3VA 1A3HA 1E4LA 1JZ5A 5HBFA 3WDQA 5DEZA 4TTUA 1LL7A 4CD8A 1J0IA 1C8QA 5A8MA 1Q4NX 3PBGA 3OZPA 5DFAA 2VX5A 3N9KA 5ABHA 1KWGA 5HXMA 4CD5A 4H8HA 4GXPA 1CZ1A 1GW1A 4OIFA 1ZBWA 5E0CA 1QW8A 3SCUA 4AEFA 3TTSA 2DPEA 2FGZA 4AZHA 2CESA 5EBAA 4PCSA 1QHPA 2DEPA 4TOQA 1FH9A 5HOSA 1OIFA 2VVNA 3IJ8A 3W37A 4JKLA 5I23A 4AIEA 5C8BB 1E4NA 3QOKA 3D5HA 2OSXA 4CU6A 4MB4A 1PBGA 3VNZA 1VAHA 2GK1A 1KCKA 2TAAA 4P7RA 1V3MA 1X6LA 4C7GA 1TZ7A 2CXGA 5HPOA 4MDPA 4P7NA 2D20A 2Q8XA 4AD0A 1V03A 4LYRA 3LPFA 2CBIA 4Y7EA 4X9YA 5ABFA 1HNYA 2BS9A 4AD2A 3SUVA 2E9LA 3PZUA 2CBJA 2FHBA 3AS1A 3VD9A 3ZM8A 4W5ZA 1K9FA 5CSUA 1W3KA 3MANA 5JBDA 4OBRA 5CPSA 3VMNA 5AC4A 1W1PA 2G3NA 1LL4A 3A6OA 1E4IA 4J27A 4KGLA 2GFTA 4JL1A 2OSWA 3WELA 1UWTA 5I5RA 5BRQA 2WM0A 2NW0A 3GBEA 3W6MA 1XSIA 8CGTA 1ECEA 5JBEA 4D71A 1KWKA 4D6EA 2QLYA 4HMCA 1Q6CA 3SCSA 3WEOA 8A3HA 3HU7A 3DHUA 1Y7VA 2CNCA 6CGTA 4X0VA 1GJUA 5E9AA 1ITCA 2V3GA 4F8XA 3WQVA 1ZJBA 2GVYA 2V5CA 2VNCA 2EPOA 3GNOA 1JFHA 5CG0A 4AISA 2EPNA 1UKPA 1OGBA 1B3YA 3GZAA 1W32A 3TTYA 3W53A 5A1AA 3RPMA 1TG7A 3RO8A 1AVAA 1UA3A 1UD2A 3L2LA 1V08A 1W9DM 2J8FA 1WPCA 4OOUA 1UR0A 1NARA 4DM2A 5M03A 2YL9A 2VR5A 2WVVA 2WBGA 1E0XA 3WNOA 3ARWA 4H8VA 1DHKA 1SMAA 3GH5A 2ZX9A 1XCXA 1OB0A 2W4XA 3VGDA 1EDQA 2V3DA 3WH5A 2O9PA 1WAWA 2FGLA 1J0YA 4J3VA 1X6NA 4W86A 4MNJA 1G0CA 2J7DA 1LG1A 3OZOA 1DEDA 1G94A 3W81A 2BHYA 5A8PA 1OD0A 4W8LA 2IXVA 1U2YA 1CTNA 2BY0A 3WH6A 1EGZA 1C8YA 1KXQA 1J0ZA 4KGJA 2CBUA 4EANA 4WLCA 4M29A 3AS3A 1K9TA 1QVBA 1XD1A 3DECA 2GJRA 1GQJA 4WF7A 3K8KA 1VJZA 2G41A 1V02E 1NWTA 1VIWA 1HJSA 3FXYA 1B90A 1JF6A 5FCZA 3KL5A 1NWSA 3WMCA 1WZKA 5GNZA 3T08A 1UD8A 3THDA 1V3HA 4U31A 3N1AA 1JYWA 2A3AA 4XUYA 1BTCA 3POHA 3EMQA 5CSYA 4UQ9A 3ZOAA 4XX6A 1TUXA 3N04A 1GONA 5A69A 1JYVA 4J3SA 1JGIA 5ABEA 1RH9A 2V38A 3NSXA 3L4ZA 1JDDA 5A6BA 2AAAA 5BWFA 4P8UA 4JL2A 3RM4A 3VU2A 5JBFA 1E0WA 3VIGA 1QNRA 2E9MA 5IFPA 2CKRA 1WP6A 1EHNA 1W9PA 4P8WA 2WC7A 2CITA 1E5NA 1QHOA 4AZGA 4Z2JA 1CXFA 4AZCA 2O9OA 5BXRA 3UETA 4E2OA 3U5YA 2G3IA 2X05A 5KEZA 2D0HA 3KWXA 3RIKA 2G8ZA 1IZKA 2ZUWA 5ABGA 3M46A 2PB1A 1BVNP 2CHOA 4W93A 3BSGA 1XYFA 2X09A 3W27A 1AQ0A 3IK2A 4PEEA 1BLIA 1KQZA 1G5AA 2Y4SA 5D4YA 1JI1A 4HZ7A 4ZE4A 4QAWA 2GK1B 3WSUA 3SUUA 1TFVA 3U7VA 2YOCA 3ARSA 1H3GA 5D9MA 1JNDA 5BROA 1CXLA 4CKQA 5ABFB 3BSHA 1MFVA 1KBKA 3PHAA 1QNOA 4F9DA 4HA3A 1BYBA 3VM5A 3CHDA 1VFMA 1YHTA 2YDRA 2A3HA 3S6TA 4Z2GA 1DWFM 1FA2A 3TP4A 1WZAA 5CPQA 4M24A 1E6XM 4NF7A 2WPGA 1WDRA 3J7HA 2JIWA 2ESCA 2YA2A 3K46A 1V3IA 3PZOA 1ZU8A 2VRQA 3UERA 4N42A 3CZKA 2EPLX 1UD4A 4X0NA 3WH9A 1QNPA 4CUCA 4JZ5A 1XV8A 1C90A 4C7FA 4BF7A 3B9EA 1UYQA 4UZSA 2UY4A 2WXDM 1KGWA 2C0HA 5HNNA 1E6QM 6TAAA 2YLLA 2WHLA 4HA4A 2UY5A 4HOXA 2ZIDA 2ZXAA 3AMDA 3VTRA 4GINA 5GNXA 3PZNA 1MQPA 3O2LA 1EQCA 2WVVB 2DT3A 3ZO9A 1KCLA 1LF1A 3HN3A 4P8XA 5A6AA 1R8LA 2QPUA 4LPCA 1G01A 2VO5A 4FLQA 2VCAA 3T2PA 3N12A 4B9ZA 1GQIA 2DGAA 5TD4A 1WZLA 5A2BA 1B1YA 3EDEA 1DWJM 1OM0A 2JFEX 3VGFA 1FP8A 1H0IA 3PZGA 5AYIA 1E56A 2J47A 3WF2A 2ZWZA 2O9RA 5JUVA 4QLLA 4Z2KA 1NP2A 2YJQA 2XHYA 1VFUA 5CGTA 3ARVA 1NH6A 4JIEA 3W4RA 3BAWA 2XJ7A 4ZXOA 3LPOA 4GI8A 3SEPA 4KH2A 1SFSA 2GDUA 3UCQA 5IDIA 3AXHA 3W0KA 3FY1A 2J74A 4PN2A 4AIOA 5D9OA 2AMGA 4AEEA 3ZJKA 6A3HA 5A8NA 1LQ0A 1AQMA 3CZLA 4UNIA 3W24A 3CUFA 1E3ZA 1VF8A 1GOIA 1W3HA 1JG9A 1VJSA 2O9TA 5IHSA 1I75A 4RL3A 4JCLA 1IT0A 3OGSA 3QR3A 2VURA 4R5EA 4CD4A 1G9HA 3WL1A 1CIUA 4C7DA 3SCNA 3NYDA 1NM9A 1EO7A 2HISA 4NRSA 4HPHA 3U7BA 1IV8A 1WNOA 4D6JA 4B3LA 1JZ4A 1JZ7A 2XG9A 5A6LA 3SCRA 1CGWA 5E70A 2VRJA 2XTKA 1WZMA 4MNKA 3N15A 2XSAA 1R86A 4M56A 3SCVA 3NCOA 1V6VA 3DC0A 3MU7A 2CEQA 5AYBA 3L4UA 2WHMA 3AIEA 2OYKA 5D9PA 2YDQA 1PPIA 5DT7A 1F4AA 1ZBVA 4DWSC 3VO0A 1C3FA 2QV4A 4FF5A 2DQXA 1LL6A 1SYTA 3PTKA 1OWQA 5FL0A 4ZFMA 3GTNA 4H2CA 3WNNA 2E3ZA 3AIWA 4EE9A 1W9VA 4MB3A 2VR4A 1RD6A 3CIVA 1CDGA 1QBAA 1V0NA 3BGAA 2RGLA 3AIVA 1TVPA 1E5JA 4AZ5A 4W8AA 3WD0A 1V3KA 5GQBA 1C91A 1MXGA 1SMDA 2W92A 3CZEA 1CPUA 2X8RA 3OA5A 3W6LA 1B3XA 1Q6GA 1JZ8A 4PTMA 1CYGA 1QPKA 4TX8A 1UA7A 3PTQA 2E8YA 5DO8A 2CYGA 3OGVA 3U5UA 3AMCA 1QI5A 2D24A 3TONA 4YHGA 3NSNA 1WDQA 1BVZA 4ZENA 3PZ9A 1RP9A 3FW6A 2YL8A 3VNYA 1GQKA 3OBAA 1E6PA 1CXIA 1J12A 1K6AA 1JXKA 3MMWA 2D3LA 2XVKA 4L4OA 2BVYA 3F5LA 4W85A 4P7QA 1KXHA 1OINA 3QOMA 4V27A 2WHJA 3PTMA 1UWQA 5E0FA 4EKJA 1EHAA 3JUGA 1US3A 5DT5A 4GPNA 3WN6A 3MSDA 4D1IA 1ZB5A 3OIHA 2OWWA 3QGVA 1OIMA 1E43A 1GNXA 3VIFA 4CD6A 5D9NA 2QHAA 1D3CA 3ZT5A 4PMDA 3HMCA 3WF0A 4KRTA 4Z2IA 3DHPA 4CD7A 1C8XA 5GPRA 1C7SA 4RE2A 4MAVA 2WC3A 1UD3A 4UOZA 3AYRA 3SCPA 3AIQA 4V28A 5M5DA 2Y8KA 1PIGA 4L4PA 7A3HA 4LGXA 3WMBA 2PWGA 2WMFA 3QHNA 2WSPA 3CTTA 1WE5A 4W7VA 5JIPA 3CUJA 1CGXA 4HP5A 3IJ7A 1NOUA 3CHFA 1XHGA 3CO4A 3CMGA 2GJXB 2V5DA 4PMQA 4HMDA 2D0FA 4N0RA 1IZJA 3SCWA 2Y5EA 1WKYA 3MMDA 3TOPA 2WYSA 4UFKA 5EMYA 3DYMA 3VIJA 3ARPA 3T2OA 1UZ1A 5HPCA 3VIMA 1JAEA 2X0HA 3UEQA 3I3EA 4W5UA 1FH7A 1VEOA 1HKKA 1GVYA 2VQTA 2CIPA 1CXEA 5C70A 5I0DA 1ZBKA 4AZ7A 4XZWA 3FHQA 3SURA 4QDMA 3BAKA 2ZUUA 1N82A 3WNMA 4CVWA 1CGVA 2OWCA 3U57A 2OYLA 3CZJA 4D6DA 4P8VA 3VIPA 3AICA 3B9DA 1XC6A 2F2HA 1V02A 1E1EA 1ESWA 2J7FA 3GNPA 1H0GA 1K9DA 4AY1A 2OYMA 1H1NA 4UFLA 1KR0A 4AZIA 1H5VA 1V3JA 1UZ4A 2X2YA 2EO7A 3K8LA 1TVNA 1GOKA 1K9EA 4CN4A 2WVTA 2CBVA 4UFMA 1VBUA 3MUIA 4HU0A 2D23A 2XFRA 3PZMA 1GZJA 4UFJA 1UR1A 1TE1A 3VUPA 2WZHA 4WIWA 2E9BA 1JD7A 1I1XA 3G6MA 2WMIA 2ZXDA 3VIKA 1UOKA 4BCEA 3EDJA 3CBWA 1XSJA 2JEQA 3CUIA 4W7UA 1EO5A 3UG4A 1W9XA 4UFHA 1CECA 3VINA 3ZSTA 4BZYA 4OOZA 3CHEA 1W91A 2ZUMA 3AYSA 2VZVA 1AMYA 1JAKA 3ZR5A 4D6IA 3WUGA 3AIRA 1UWUA 1E40A 2ZUSA 3AFBA 4QP0A 4WJXA 3NUKA 2A3EA 2W63A 3BMVA 1OCQA 3ZMRA 3BH4A 3ARZA 4YPJA 4NZCA 2FHFA 2O92A 4ACZA 2OWXA 2WBKA 4M81A 4D6HA 4MNLA 1PX3A 3ARUA 1JI2A 3N13A 5A6BD 2PWHA 1Q6FA 1CXHA 4CN6A 2DT1A 3CZGA 4V2XA 1M7XA 2GJPA 3ECQA 1JYXA 3VOCA 4GZJA 4BS0A 4WSJA 2JF6A 2YDSA 1R7AA 4ACYA 4PSRA 4ATWA 1OT1A 3WQ4A 3GXDA 3F5KA 3WNPA 4FLRA 3WF1A 3B8SA 3RMEA 4MAZA 3N18A 4JHZA 4F79A 3BLKA 4TX6A 2WVSA 5CGMA 4M82A 4WSKA 3GXIA 4F9JA 2BHUA 4F66A 1MWOA 4JFSA 1BPLB 5A3HA 1HP5A 5BCAA 1UR2A 1LJYA 1HJUA 3A4WA 3S2CA 5BXSA 3CUHA 1VFFA 1FFRA 4CCDA 1OGGA 1JD9A 1W2VA 3I3DA 2PWFA 2XWDA 4TVCA 4PBGA 2VCCA 3W82A 4A3YA 1TA3A 3WUEA 3BCDA 2ZXQA 2C7FA 1H2JA 3T0BA 5CQ1A 4HPGA 4PUDA 2WAGA 2BFGA 1VRXA 1XYZA 5AY7A 1ZBCA 2WZIA 1JFXA 3OG2A 3QHOA 1XSKA 1PZ2A 4JCMA 2GSJA 3WF3A 1HVXA 4OJYA 1MVYA 2CPUA 3WDIA 2DSKA 1HP4A 3VIOA 1GORA 4H41A 3W38A 1WDPA 2OSYA 4IM4A 3AJ7A 2J7BA 1KBBA 1BG9A 1BAGA 2XPKA 4DWSD 2IXUA 3CGTA 3MV01 2XM1A 1H11A 1L0PA 4E4PA 1OT2A 3FN9A 4OZOA 4XZBA 3WY1A 2F61A 3IAQA 3WQ8A 1UWRA 1GPFA 4AD1A 4KMQA 1JF5A 2EQDA 3RM9A 2W67A 2VX4A 1QI4A 2ZE0A 3NDZA 4D6FA 1CENA 4U3CA 4DWSA 2VC9A 2WMGA 5A6MA 5I2UA 5E6YA 3VGGA 1FOBA 4HU8A 2EXOA 1SR0A 2BVDA 3AHTA 2MANA 4LYQA 3WDRA 1O6IA 2NSXA 2ZX8A 4ZEPA 2WVUA 1D2KA 3DYPA 3LMYA 4AD3A 3CH9A 4UQEA 5E6ZA 1LWHA 1R7OA 3GBDA 3WNLA 1UD6A 2D1ZA 2WW5A 1C93A 1E70M 3CMJA 1M53A 4B9YA 1B0IA 1XH0A 2WMIB 1JZ2A 4JFVA 2PWDA 4IPLA 3IAPA 3T0DA 1DWHM 1PZ3A 3T09A 2Z1SA 4B16A 1S46A 4PTWA 4J3UA 3MUY1 2WHKA 1BF2A 5CJ5A 2W5FA 3AMGA 4A4AA 5AC5A 1VEMA 1HT6A 1CEOA 3WENA 5CZKA 3WD2A 1UG6A 2WCGA 3MMUA 1HIZA 3M7SA 4R27A 4RE4A 1B3ZA 2J79A 3AROA 3EMCA 2EPMX 2WCAA 4ZXLA 4PMXA 3ZJ7A 1UQZA 3EBVA 2JIEA 5FL1A 1ODZA 5EB8A 2YL6A 4PMRA 3OLDA 2ZUTA 4D1JA 2DSZA 2WKLA 3NJ3A 2PI6A 4W8BA 2G3JA 2YA0A 4UQCA 3CHCA 5I77A 2RGMA 3WUFA 4AD5A 1MW2A 4H8UA 1NP0A 4GI6A 2WNWA 3GH4A 1C92A 1HF6A 2XGBA 3WEZA 3N11A 4PRWA 1B31A 2PBGA 2WK2A 3PN8A 1W2PA 5M3WA 1BYDA 4PCTA 1UH2A 2BY3A 3CPUA 1OBAA 2XM2A 4JKMA 4AZCB 1HXJA 1E15A 5CLTA 4MPKA 2JEPA 1GHSA 2WC4A 4KWUA 1DWGM 1H41A 2WLYA 3ALGA 4J3XA 3ARRA 2W91A 3D3AA 3POCA 3NDYA 1V6WA 1TA3B 1ZJAA 2WKGA 4MJ4A 5BXTA 4OBSA 2CERA 3VD3A 4URIA 1EH9A 1B3WA 1NQ6A 4D72A 1E4MM 5BYWA 3T2QA 2DSVA 3AZSA 4J3WA 1KFWA 1WCGA 4WKFA 3VIIA 1EDGA 1UKOA 1AQHA 3BXWA 2VCBA 1JL8A 3CUGA 4W88A 5A2CA 1W3JA 4IUGA 1NWUA 2JALA 2CETA 4K68A 3I3BA 2W62A 7TAAA 4ATDA 1ZS2A 3ARXA 1MQQA 4KRUA 2J78A 2WLZA 3OLGA 1UWIA 4PMOA 2DIJA 3UESA 2DSWA 1W1YA 3MUZ1 1HJWA 3RDKA 1UR9A 4S3JA 3KE0A 4QLJA 4BQ5A 1XH1A 3SIMA 3VD4A 1HL9A 1CXKA 2G4FA 4J3TA 4CCEA 2DSUA 4Q22A 4UOJA 2WSKA 3AI0A 1MW3A 1VB9A 5BRPA 3WQ5A 3SCTA 4CU7A 5KZ6A 3OB8A 3AZTA 1HJQA 2F8QA 3L2MA 1KQYA 4YHEA 2XYLA 2Y2WA 3QHMA 4PMUA 4AZ6A 1J9YA 3VKKA 5DF0A 1E6RA 1FH8A 3TTQA 3THCA 1PIFA 2VX6A 4AIUA 1CLXA 2DDXA 3AHVA 3MV11 4CVUA 1EOKA 3BCFA 3NIYA 4IPNB 4TXEA 1W9BM 3APGA 4TVUA 3ZJ8A 4NI3A 1MW1A 5C71A 4GQRA 1QI0A 1TR1A 3WIJA 4P7OA 3B9AA 2BY2A 1BQCA 3E1F1 3RILA 3EDDA 3EYPA 2VL4A 3K4AA 3WUBA 1UH4A 4HOWA 2OLHA 4BQ3A 4MB1A 5A6SA 1UHVA 1RP8A 3NSMA 1HJXA 3WBEA 4PMZA 2PF0A 2A3BA 4DUVA 3T0AA 1OD8A 1OGSA 1DP0A 3IJ9A 2PC8A 2Z1KA 2FDMA 3KL3A 3AISA 1CLVA 3AHYA 2YBTA 4PMYA 4FLOA 3SUTA 1JXJA 1BG4A 2EJ1A 2V3EA 2WWCA 1M03A 1UUQA 1CNVA 1UQYA 3GDBA 3LPPA 3VGEA 4HZ6A 5LA1A 4HMEA 4YN5A 4BA0A 4JFUA 3WEMA 1VENA 4AC1X 3VDCA 2DIEA 3WH7A 5A6JA 4ZE5A 2EBNA 4M1RA 1JIBA 1BGAA 1KGXA 1BYAA 1VBRA 2AOSA 4PYSA 1HX0A 1WO2A 3AQUA 5A8QA 1HKIA 4EK7A 1VFOA 4MNMA 2WZEA 1E3XA 4M80A 1J0HA 4JFWA 1O7AA 4WKHA 1Q6EA 4UQBA 1BFNA 1MFUA 4HTYA 5FOOA 3M07A 3VD5A 2Y8VA 2D22A 4GZEA 4E8CA 4AYSA 3GM8A 4RE3A 4JHOA 3WD1A 3VDAA 4NRRA 2WMJA 2BXYA 2XGIA 4JKKA 2EEXA 1E71M 3MSGA 4CCCA 5A94A 2JE8A 2GUYA 2J7EA 4GO9A 4FLSA 2XWEA 2E0PA 2J75A 2D0GA 2VVSA 3PZVA 2YL5A 3F5JA 2XUCA 2QF8A 2VZUA 4W84A 2X1IA 2W66A 5I78A 4DM1A 2ZX5A 2J4GA 2XSBA 3WDPP 1B2YA 2QPSA 4IISA 2ZWYA 2JF7A 1HVQA 1J11A 3MO4A 4Z2LA 4A3HA 1H49A 3TA9A 1C7TA 1GOOA 3WFZA 2ZXBA 5GNYA 1GQLA 1GOWA 3UR8A 4LXFA 3WQ6A 4UQAA 1V6YA 3FHAA 3W28A 2VZOA 1EA9C 5IXEA 2ZOXA 5JH8A 1KGUA 4LYPA 1M04A 2FH8A 2XVNA 1QBBA 3VDHA 1D7FA 1W1VA 1XRVA 1P6WA 3SCOA 2QMKA 4EAMA 4D6GA 2VI0A 1ISWA 3WQWA 1E72M 1ISXA 1UKQA 2CCRA 5EFFA 2PWEA 1X1NA 1QHZA 4PUEA 1KXVA 5CLWA 3AMLA 4AW7A 2XVLA 1LWJA 3GH7A 3AHXA 1KB3A 4UR9A 5D8WA 3MKKA 4J7RA 2ZX6A 1W1TA 2VUYA 1U33A 4GI9A 3RJYA 1JZ6A 5A95A 1E1FA 3PZIA 1J01A 5I3DA 1HN1A 3VD7A 4HA1A 1UWSA 5A6KA 4U2YA 3CZ8A 2DH3A 3ZSSA 4AXNA 1V0KA 1UR4A 2BNJA 1J0JA 4QFUA 1NOFA 1ITXA 1H09A 3W29A 3A3HA 3DYOA 3ZR6A 4AD4A 1R85A 5IFTA 4U33A 1JDAA 3MS8A 5IHRA 3BLPX 3K8MA 4NSBA 1V0LA 4CU8A 5I24A 1QNQA 5CPTA 1H4PA 1EQPA 4UCFA 4XV0A 1QI3A 3KZSA 2BVTA 3AHZA 4QLKA 3GNRA 3MUAA 3KL0A 2ZICA 3VDBA 3KEHA 2GDVA 3AOFA 3BAIA 3L4VA 7CGTA 2XIIA 4H7VA 3G6LA 4MJ2A 2UY3A 5CXPA 4UFIA 1W9UA 5JIWA 1M01A 3FNDA 1ISYA 4W7WA 4CGTA 3AXXA 2WCSA 1FP9A 3N17A 3AIUA 4FK9A 1E9LA 4HZ8A 3W26A 4CN1A 1ISZA 3W25A 2QMJA 4TVDA 3BAYA 1E73M 1E55A 4U3AA 1JNEA 2A3CA 1VEPA 3K4DA 3FAWA 1V6UA 3ARYA 2J8GA 3SCQA 1UR8A
chains in the Genus database with same CATH superfamily
5LA0A 1QMLA 3G0UA 3STEA 4H6EA 3W1PA 1PYFA 4QCEA 2DVXA 2VC6A 4LUJA 4IPJA 4NP7A 5JQ9A 2V3FA 3WBXA 4NJGA 3BGGA 3L4TA 3LCXA 3P0WA 3WL0A 2WV8A 1EIBA 2RDTA 2VX7A 1CBGA 3TXVA 3ANYA 1LT7A 4UTMA 4QE5A 4JAWA 2INZA 1EZWA 3IIVA 5ECVA 1ZTVA 1XF0A 3N2XA 1R87A 1SU5A 3DGBA 5T91A 4N4QA 4UOQA 1F76A 1DWAM 4XO7A 1QW9A 3RRAA 3BLLA 1Q6DA 3LLDA 3IJIA 4HQVA 1VHNA 3BWWA 1ZHAA 4S3CA 3REQA 1BYCA 3S83A 1TIWA 2QIWA 1FHDA 1GKRA 5A2AA 4TV6A 2LGOA 1H63A 2VC7A 4LX4A 5C6MA 4EPEC 1AD4A 4I8YA 3GTHA 1LZOA 4JFIA 3L5AA 4LALA 1JZ3A 3GX9A 1V0MA 2HVOA 5LIXX 1N55A 4K3ZA 1OC5A 5C5YA 1XRTA 4QS6A 3W07A 4QJ3B 5JMUA 3UZXA 2J77A 1ONEA 2YIHA 3P8JA 5HDRA 3E2RA 2J7GA 2OQHA 1BGGA 2LJ4A 1KTCA 3SUSA 4JFTA 1ITQA 4OFCA 2NLIA 1VRDA 2Y24A 3GDLA 4FMVA 1LRNA 1KT1A 1AFSA 3NGJA 4BQ4A 1FQ0A 1Z6KA 4INFA 4LEQA 5AC6A 4JTRA 3RLHA 1AL7A 2I9UA 4HHMA 2JQXA 4EXQA 1P4CA 3IGSA 3NEVA 2GJXA 4A3UA 3EWBX 4O14A 3IACA 5LYRA 3WLRA 2PWUA 3AZRA 3EXRA 1X97A 3UJ2A 2XFFA 1UKTA 1WKEA 1F61A 1GCYA 2QJHA 4JOMA 1B30A 1F4HA 5BXPA 3HJEA 3QJAA 5CBJA 3EEGA 4ZQCA 1L2UA 1SUXA 1US2A 1R5YA 2X41A 5LA2A 5LSMA 1QI2A 4AMCA 2P3EA 4HN4A 2VWTA 4A21A 2EPKX 3HPAA 1QO5A 3GTXA 3A4XA 3GYCA 1ZNNA 2BHZA 4QCFA 4XB3A 1BSIA 2A7RA 1VBHA 3IANA 3L2IA 3B8UA 3JVAA 4H04A 1B9ZA 1ZL1A 2QEZA 1PX4A 3WBAA 1Q7ZA 3S9IA 1LOSA 4X3ZA 1CGTA 5BXJA 3NL2A 3VOFA 4LQ1A 3OLIA 5D2XA 1GUVA 1MQRA 2DZBA 2DVUA 1KA9F 3G1FA 3HMJG 4DUXA 3WQFA 2GSHA 3VIHA 4DAFA 4IGMA 3F4NA 1E1CA 5LIUX 5CPNA 1S3TC 1JYNA 3NZ1A 3O1NA 3RJXA 1TV7A 2B7NA 5FESA 3IUIA 1F5ZA 4XIAA 3M5XA 1RCXB 1JRCA 1FWCC 1D8WA 1L8NA 2PBOA 3ZWSA 1EDTA 1XIJA 3OLEA 2XH4A 3TSDA 4J35A 1V6XA 2PDIA 3EMZA 4FR6A 5AZ1A 3BANA 2AQOA 1WXZA 2UBPC 4MDOA 1KXTA 3DBPA 2BG5A 3II1A 3FYYA 1XLHA 2DZVA 4LBSA 3ITTA 1R0MA 3RXZA 5M2FX 1C9HA 1L6SA 3NQMA 2BGSA 4Q8VA 4JBRA 1OABA 2PDGA 1ELSA 4HNUA 5F7UA 4AWUA 4JN8A 2Z1XA 2NT1A 2FB3A 4LUTA 3K1DA 3E5BA 1KRBC 4DWSB 5LIYX 1JCYA 2F4EA 4PGLA 3TYCA 2NXIA 1O4UA 1RLCL 2DG4A 1DTUA 1B3VA 4MKVA 4DJDD 1GYLA 1J0IA 3VKDA 3OZPA 3A13A 2B4GA 2F6XA 2VX5A 2OZTA 4C1LA 1JCMP 4XZIA 4DF2A 3VKAA 5KSWA 1EBHA 1QOPA 3M0YA 3NO5A 1DXIA 2I7GA 3E2VA 4UC5A 4IQDA 4DJDA 1M7JA 1ZBWA 1VH7A 4NAEA 2XFWA 1KTBA 5DITA 3W2UA 4JTQA 1JCTA 3SCUA 4AEFA 2JKEA 3PBUA 1G7VA 2ONEA 4R3UA 5EBAA 1QHPA 3ANVA 4TOQA 2CZFA 2HS8A 4F2TA 1FH9A 4GCAA 2VVNA 3W37A 3UFYA 3PF3A 1JCLA 3B4UA 4ZQOA 1NFGA 1OFPA 2YZRA 1F9CA 1X39A 1E4NA 1EJSC 4MB4A 3VNZA 4Z0SA 1XG4A 2TAAA 3BLEA 4N7QA 5D02A 1X6LA 1AW2A 1TZ7A 4ODPA 2C71A 1SM9A 3FJ4A 3LPFA 1RSCA 4LB4A 3GVWA 3QV7A 1OFEA 3B4YA 1ADDA 4W5ZA 1W3KA 3RITA 4IHCA 2E77A 3VMNA 3VXGA 2G3NA 4J27A 1LOQA 4WD0A 4G9PA 3GTYX 4AH7A 4JL1A 2OSWA 3CB3A 1FKGA 6REQA 3KM8A 4D71A 3ZWTA 1E51A 4GUFA 3M0IA 4D6EA 3TJIA 4JNMA 1Q6CA 3BLOA 4U10A 8A3HA 1RZMA 3N6HA 2QS8A 1GJUA 3IPWA 2V3GA 1GG1A 1ZJBA 2GVYA 2V5CA 1OFAA 2VNCA 1ZAHA 4AISA 3H4XA 1TV3A 2NV2A 2ZCGA 3ITCA 1AJ0A 3SN0A 1B3YA 4XISA 2G3FA 2QUTA 3TTYA 3W53A 4UTTC 3WJWA 5LIWX 3OBEA 1DPMA 2IPWA 4KCWA 1NARA 4DM2A 5M03A 4FNTA 1E1CB 1O5KA 1SSGA 2VR5A 2PDUA 4DRQA 5AOUA 3GH5A 2F2KA 2OKOA 1E0TA 1AH4A 3LTYA 1K6WA 3U0HA 1QOQA 4TX0A 3O5OA 1J0YA 1PKYA 1X6NA 2PCQA 2NSOA 2J7DA 1LG1A 3OZOA 3UNTA 1DEDA 1JQXA 1T8QA 3AXKA 2BHYA 5A8PA 4DBWA 1DJQA 2ON3A 4IH3A 1J0ZA 4M29A 2XIOA 2ZQSA 2AAMA 4DN1A 3STGA 3HM7A 1EP1A 3KVJA 2VYOA 1B3OA 3T78A 1NWTA 1VIWA 1S2WA 3RAOA 3O5JA 1OFOA 3CT7A 3FLUA 3EKLA 4LUTB 4CCZA 1JUEA 4JTKA 3U6WA 4XD5A 5KZDA 4LAVA 3CV6A 2ZZ7A 4PFHA 3EMQA 1YKWA 4ADSA 1JYVA 2C16A 4PBFA 1OHLA 3DIPA 4ICCX 4DBUA 3PG9A 4EP8C 5A6BA 1G4SA 2FZNA 4JL2A 1OC6A 1DHPA 1TIMA 1WBJA 5BMWA 3RM4A 3VU2A 1E0WA 4AWTA 4JIRA 3I4KA 2CKRA 2AL2A 4P8WA 3NL5A 3RCYA 1EUNA 1QU4A 1YRRA 1E5NA 4MKNA 4BWLC 2FZ8A 2UZ9A 3UETA 2X05A 5KEZA 2D0HA 3GUGA 1DJXA 4S3BA 2ZUWA 5ABGA 3H6OA 4HJWA 3P7YA 2CHOA 3UXLA 3W23A 2X09A 3UXKA 2PAJA 3W27A 1J2BA 1AQ0A 4PEEA 3W85A 3WLMA 2R1KA 4L7ZA 3GWQA 1XDMA 5D4YA 1JI1A 4HZ7A 4QAWA 2E6DA 2OX1A 2YDAA 1H3GA 3CQIA 3M0JA 3TYUA 4NYYA 3G0SA 3KACA 1KBKA 3PHAA 1QPQA 4DJFD 4OV9A 4H2HA 3LCGA 2YDRA 3M5YA 3H7UA 2V2DA 1WZAA 2ZTJA 4KFNA 4YCPA 4ASTA 3NQ2A 3PB0A 1BKFA 1DQUA 4CNPA 1XJBA 1V3IA 3HV9A 3HPFA 3PZOA 4DJFA 3UERA 1RD5A 3UY8A 3CZKA 4X0NA 3D47A 3WH9A 3SRDA 1C29A 4LBUA 5AHLA 1T41A 4RZ5A 3GTFA 3KCOA 4Q6JA 5I3JA 4HYVA 3H53A 2ZZ6A 3WQEA 2HJPA 2UY4A 3NQBA 3GK0A 3EZ4A 2PPOA 1KGWA 2VOMA 1Q8AA 3CAWA 3LXBA 4LY4A 6TAAA 2WHLA 4A35A 2Q8LA 4LVBA 2ZXAA 1MQPA 3I7QA 4P2VA 5AHEA 1KCLA 4O12A 5J6EA 1EJUC 3OVPA 4JTCA 3KX6A 4AF0A 4ECLA 3T2PA 1WZLA 5F2IA 3UZWA 2WO5A 3EDEA 3JZEA 1VYSX 3B0XA 3KVLA 4GKTA 2WM1A 3QQ0A 3IIPA 3GG7A 2JFEX 3VGFA 2OG9A 3PZGA 2QT3A 4N2YA 3RLGA 2ZWZA 3SSZA 1XW8A 1W6TA 3T7VA 1O5XA 2PPGA 2XJ7A 2HS6A 4PCNA 2PV2A 1V7YA 1GK8A 5D2WA 3UXAA 1FWHC 3M0XA 3W70A 3KOYA 4KH2A 1SFSA 3AXHA 3HPXA 4ERGA 1NVMA 2OELA 4AIOA 2PDXA 2ZQTA 2AMGA 1FX6A 2XZ7A 2QCEA 3ZJKA 6A3HA 4UNKA 2WQPA 3HQNA 3NFUA 1AQMA 3CZLA 3LGEA 1E3ZA 4GOAA 5IHSA 4YTUA 2J8TA 4JNZA 4R5EA 4CD4A 4GGQA 2VFIA 3BG5A 3NYDA 4ORIA 5KMYA 2HPMA 3GHRA 3U2ZA 1WDWA 4NZ4A 2G97A 3VI2A 2HISA 3MJYA 1FCBA 4KEMA 3H12A 4NZJA 4JXCA 3W7RA 1WNOA 3A64A 4Y8EA 3GDMA 2AL2B 2XG9A 4N9EA 1JZ7A 9XIMA 4LVAA 3H2AA 1T99A 1YDYA 2DZAA 2PDFA 2CEQA 4FNSA 4YNGA 3JXVA 3TKFA 4ZVJA 1Z7AA 2OYKA 1NF0A 3FGCB 5A5WA 3BV4A 1MUMA 1F4AA 4R33A 1F40A 5D75A 1SO5A 3TYBA 1LL6A 1SYTA 3GTNA 4H2CA 5CJMA 1EWDA 1RD6A 2VR4A 5F4XA 2OO6A 3DI0A 2J24A 1OF6A 1TREA 2ACQA 3AIVA 4RDWA 1TVPA 1BTMA 4XD3A 2YR1A 4GQGA 4REQA 3OA5A 1FKWA 3W6LA 1Q6GA 2Z28A 1O1HA 4GD0A 4RW3A 1VD6A 3B40A 4S39A 1EF3A 2EHHA 2GGEA 2XP5A 2FJKA 4LY8A 5HINA 3PTQA 2HQAA 3U5UA 3AMCA 3UWZA 2GGHA 3MYPA 1LWIA 3TONA 8TIMA 1BVZA 4ZENA 4WJEA 2FDSA 1X98A 1G4TA 3KRBA 2ZQVA 1OZMA 1IQ8A 1CLKA 1K6AA 4IQEA 1JXKA 3MMWA 3FSUA 2D3LA 3TJXA 4NJJA 4L4OA 4UNLA 3TC3A 3NVTA 1ADOA 1UMYA 2WHJA 1UWQA 1EC7A 4LCQA 3QYSA 3JUGA 1EJRC 2QDDA 4GPNA 3WN6A 3MSDA 4J4OA 3L66A 2CLFA 4ODOA 1E43A 4FA3A 3B8WA 4JTGA 2I5GA 4CD7A 4US5D 4RE2A 2CLEA 3HGSA 3SCPA 4JQ4A 4FX6M 4YLWA 5M5DA 1YLVA 1PIGA 1I4NA 4GX9A 4L4PA 4LGXA 3H2CA 3FV9A 5XINA 3UZ5A 3ISIX 1WE5A 4HP5A 4A29A 3NAVA 3IJ7A 3KOZA 1NOUA 3HA1A 1OK6A 3PRDA 3TN5A 4MGVA 5G4EA 5AYYA 4N0RA 4HSNA 3VK5A 3SCWA 1FKHA 1S1RA 3RX4A 3LHTA 5C2XA 3TOPA 3GR8A 3PS7A 2WYSA 3DG3A 3KHDA 4UFKA 3VIJA 5C9XA 5HPCA 5T8GA 1M7OA 2X0HA 1NFPA 1ZJHA 4IG2A 3G0XA 2ZA1A 1GVYA 1CXEA 4IF2A 4FIQA 3SURA 1H7XA 3ITVA 1U22A 3M44A 4QDMA 2C18A 2ZUUA 3QN3A 1K8YA 1QDSA 2DV0A 2RAGA 1ZRQA 3D0CA 1LQ2A 5G4WA 2OZ0A 3KW3A 1AG1O 3VNJA 3TW9A 3B9DA 1XC6A 2NX3A 1MRQA 2GQ3A 3B8VA 3CS2A 2FGBA 3THQA 1H61A 4ZOCA 1UZ4A 3BPWA 3WLJA 2ZTKA 3LUOA 5L9FA 5MF5A 1K9EA 4CN4A 3CPRA 2P88A 2R14A 2CBVA 4O50A 1QWKA 2HMCA 2D23A 3PZMA 4UFJA 3JYJA 3KBMA 3DESA 2ZVIA 4K39A 3IJDA 1JD7A 1F74A 3JZUA 2R94A 1B4KA 1KCXA 2E28A 3KP0A 4RR4A 4L6HA 4BCEA 2QW5A 1IEXA 2E67A 2F6KA 2P5NA 3E74A 1BSLA 3CUIA 5HMDA 5CH9A 4BZYA 4IP5A 3CHEA 3DX5A 2FB2A 3WJZA 6XIMA 3AYSA 1AMYA 1QRQA 1JAKA 1XCFA 2ATSA 1J6PA 2VGBA 3QGAC 1E40A 2O56A 3Q67A 1OJXA 3IGXA 4FHAA 3BMVA 2QUNA 4M19A 1P0DA 2O92A 4IICA 2H3BA 1DXEA 2V0TA 4M81A 1TWWA 1EX5A 5LNWA 2YXGA 3GE7A 3N13A 1QUMA 2V5JA 2FPTA 1Q6FA 4CN6A 2DT1A 2OGJA 3M16A 2GJPA 5FI8A 2VFGA 4HN8A 4WY0A 3VOCA 3QGKC 4WSJA 2DUZA 1S5WA 3ABZA 2Q01A 4NNAA 3ZYZA 1KTNA 1Q6LA 4ZA0A 4QXIA 1R38A 3OHMB 3MI3A 4MAZA 3N18A 2KGJA 3EXTA 4F79A 3S1VA 3B3DA 4HB7A 4TX6A 3LZ5A 4CLMA 5CGMA 3GXIA 2BHUA 2ACUA 4WDXA 1HP5A 4GYJA 3H7RA 3GHTA 5BXSA 1VS1A 2F6UA 1PZ0A 1VFFA 3NPUA 1DJZA 3TE9A 3EOOA 1XLGA 5CAKA 3QV8A 2PWFA 5EA9A 2XWDA 4O4WA 3RCMA 3FEQA 3MDWA 2IPJA 4OTKA 3N9SA 4NASA 3NGFA 5H6HA 3DENA 3CC1A 2IQ0A 5CQ1A 3GHSA 3MT1A 1DVJA 2O55A 4DO4A 3RPTA 1XYZA 1PXGA 2F21A 4R9XA 3QHOA 1EZ2A 4H9UA 4WZHA 3WLTA 2OPJA 3URBA 2ICSA 3WF3A 3H9RB 1HVXA 4OJYA 4KWWA 1SZNA 2QVNA 2YCLA 1HP4A 3HQPA 3NM3A 3F2CA 4H41A 1PKLA 4QDWA 3G2GA 2OSYA 4IM4A 3LM7A 3KZ7A 4Q4SA 1A0CA 4HMNA 1BAGA 4WUIA 4MYXA 1H11A 1L0PA 1P7TB 4DB7A 3WQ8A 2QCHA 3C0JA 1SQ7A 2QDEA 1GPFA 2E68A 4DZHA 3OU8A 3UWEA 2ZE0A 3NDZA 3PBVA 3FJNA 2Y7FA 3KTCA 1FOBA 3W1RA 4HU8A 2EXOA 2OO0A 2BVDA 2O0TA 2MANA 2NSXA 4I90A 3GU2A 1QT1A 4OUIA 3OJGA 3HPSA 2C14A 4UQEA 3CWOX 1XIHA 1R7OA 3GBDA 1K77A 4O15A 2D1ZA 4C6NA 3U9IA 3HV8A 1E70M 4B9YA 1FKJA 1B0IA 4ODQA 5BNKA 2F7FA 4IPLA 3T0DA 2Z1SA 4ODLA 4B16A 3E38A 2OQLA 4J3UA 1SVDA 3E96A 3S6DA 3LI1A 3H70A 3LK6A 2QCGA 3CPGA 3EX6A 2C91A 5CZKA 3CAKA 4IJCA 3WQGA 3MMUA 1G6CA 3TQPA 4ZPTR 5M1TA 4RE4A 4NZ3A 2OCZA 4L3NA 2XH2A 1H7WA 4ZXLA 3SQSA 3ZJ7A 4LS2A 4Y9OA 2QPXA 4GK8A 1WQ5A 4W9OA 1KCZA 1WOAA 1ODZA 3OLDA 4D1JA 2WKLA 2G3JA 3VNMA 1H62A 5FEXA 2RGMA 1F7BA 4GGHA 4GI6A 2RQSA 2KX9A 1KM2A 2XGBA 4OBTA 3WEZA 5LGXA 2V5LA 2WK2A 1HW6A 2ZZ3A 3R6IA 1UJPA 5D33A 3ONBA 1KM5A 4KWSA 4QGCA 1Y65A 4AZCB 4DO6A 4O1FA 4E0CA 3ZLFA 4HVXA 3CASA 3SRKA 3QYQA 1P0EA 1DWGM 3T8LA 4J3XA 4O19A 3UR5A 3D3AA 4EVZA 1V6WA 1P0KA 4IL0A 1Z48A 4GJ1A 1XICA 1GVRA 3VC5A 2WKGA 4LUSA 4OBSA 2CERA 1EIXA 3P80A 3TDFA 5LXXA 3L5LA 3HB9A 1EH9A 3SDOA 1J2WA 4IIFA 4DZAA 3BK0A 4J3WA 1P0NA 1KFWA 3GDRA 1VHCA 4GABA 2GPTA 1AQHA 3O15A 2VCBA 4KCVA 3S5SA 3UNDA 1W3JA 3KBVA 4IUGA 4XBJA 4FNRA 3EB3A 5G2WA 3VNKA 4LNYA 3PJXA 7TAAA 5H1WA 3ARXA 1MQQA 2ZRZA 2J78A 1Q6OA 2EAWA 3OLGA 3HGOA 5EMKA 2DIJA 3VOIA 1W1YA 3E9AA 3PSWA 5FJUA 4S3JA 3KE0A 2C19A 1J6OA 4QLJA 4HA0A 5MHBA 4YTRA 3HIJA 2HK0A 3O05A 1HL9A 6ALDA 1EJWC 4AUBA 4QT3A 1O12A 5BRPA 4OECA 1LBFA 2Y88A 3ELFA 2E1WA 3PPCA 1KQYA 4GVHA 3W88A 4PMUA 3R7MA 4MYAA 1UP3A 2E25A 1FH8A 1X38A 1U5JA 3NEHA 1G69A 4TR9A 2DDXA 3IIXA 1YDVA 1EOKA 4F0LA 5PTDA 1N8WA 1W9BM 3APGA 1UP2A 4G2PA 4GJJA 3GO2A 5C71A 1QI0A 3W7QA 3BUVA 5C9UA 3GC5A 1FWDC 3JS3A 1GRJA 3SGZA 1SFTA 1UC5A 3QC0A 3PR9A 1EFZA 3EDDA 3EYPA 4N02A 5CC7A 5CGQA 3K4AA 4FI4A 4EAYA 4HOWA 4Q8OA 2OLHA 3ZVIA 3UZZA 5A6SA 4BF8A 1T8XA 5HUOA 4U85A 1HJXA 3WBEA 2XP3A 4IIEA 1OGSA 3IJ9A 1SO6A 2MLYA 2YBTA 1M5YA 4GVIA 4JDBA 1E9YB 2V3EA 1UUOA 3GDBA 3VGEA 4HZ6A 4D8ZA 4DT4A 2OFJA 1RBOB 1M5WA 2R9RA 4JFUA 3T0TA 2PDYA 3BO9A 4AC1X 2FVKA 5GJNA 3EOUA 1SZFA 4U86A 4DRKA 5H8PA 4LAKA 4O0KA 1WKDA 4AWSA 1VBRA 5HJXA 4PYSA 3U2EA 3Q2DA 4BWLA 3AQUA 1HKIA 4MNMA 1E3XA 2ZZ2A 1O7AA 3EX2A 4WKHA 4C60A 1Q6EA 4EWND 1CCWB 4HTYA 2A7NA 4FOKA 3VD5A 3R0DA 4JS3A 1L6WA 1EJ7L 4RE3A 3VDAA 1ZAIA 2LPVA 2BXYA 3MCOA 1I2OA 5A94A 2JE8A 2RJHA 5EMLA 3K1GA 3IJ6A 4QJ4B 2E0PA 3TK7A 3HGRA 4TO8A 4C6PA 2YL5A 2XUCA 1EUAA 1QPOA 2AQWA 2VZUA 4GISA 3O5EA 2W66A 3KAHA 4DY1A 2J4GA 4GHRA 3T8QA 3WDPP 1YBQA 4LUSB 1NMVA 4LYKA 5L6UA 4A05A 1HVQA 4K37A 3A24A 3SM0A 4V1YA 1H49A 3PR2A 3WFZA 4HHPA 1GQLA 1GOWA 3NZRA 3UR8A 1HTIA 1A53A 1XLFA 4I5UA 1V6YA 4UQAA 1I2QA 2NUXA 2RDWA 4GZ7A 3O0FA 1TV4A 1VZWA 3A22A 2FH8A 3VDHA 5HANA 3IGUA 3PTDA 1EX1A 1MMFA 2BSLA 1XRVA 1Q8JA 3EKZA 1FDJA 4LSBA 4WGXA 4EAMA 4GQ0A 4D6GA 2VI0A 4UTLA 1PSCA 4C6IA 1ISWA 3WQWA 1SZGA 4NZ5A 1ISXA 3LQGA 2CLPA 3TFXA 1X1NA 4GYKA 5CLWA 3AMLA 4HNVA 5D8WA 3EPMA 3MKKA 4J7RA 2ZX6A 3FDKA 3RJYA 2NX1A 3UP8A 1E1FA 3W9ZA 5EU9A 4KIEA 5D38A 3UQNA 4ZZ9A 1SJCA 1UWSA 3CZ8A 3R25A 4JTFA 3ZSSA 4RV8A 1W1ZA 3FA5A 2M08A 4FOUA 4QFUA 1XQKA 1ITXA 3A3HA 2IF4A 5CZ0A 3ZR6A 3DFTA 1MZHA 2HWGA 1ME9A 1JDAA 3MS8A 4L1GA 5IHRA 2HCVA 4TMCA 3W7MA 1VFLA 1NSJA 4XV0A 2PBCA 2BVTA 4QLKA 4IUOA 3MUAA 2RSEA 2ZICA 3BAIA 5CJNA 2RKXA 1ZALA 3UQAA 2GQ9A 4TIMA 3ABOA 4DF0A 4GBUA 5K9CA 1I9CB 2MUCA 4KQZA 5AN7A 4H9MA 3E12A 5DBUA 4MY9A 2GVEA 4UFIA 3GTIA 3TC6A 5JIWA 1ZENA 3PP7A 3L0KA 5E93A 3AXXA 1IZCA 2Z29A 3TMQA 2WCSA 3AIUA 4HSHA 3W26A 1ISZA 1A0EA 2HE5A 1ONWA 4TVDA 4GVGA 3I6CA 5CAHA 3EEZA 3WLLA 1R3YA 3V16A 1YMYA 1DJWA 3ARYA 2J8GA 1E6ZA 3DBNA 3DERA 4RXFA 3WDJA 1E6NA 1H1ZA 3QKZA 3AIBA 4QX4A 3LNMA 4GIAA 2Y1HA 3EDKA 2XVPA 3B8DA 5I6SA 2JGYA 4FOJA 4OKDA 2PZNA 1FWFC 5FD0A 3CT2A 4XO6A 4IOTA 4BF5A 3WMSA 1HKMA 4GY7A 2FLIA 1HO1A 1PJ9A 5I79A 4B3KA 1JDEA 1XH2A 1QNVA 4ZPWR 4PUKA 3A23A 1Z89A 3GG1A 4NNRA 3A47A 4GG9A 4GXWA 2VQUA 4W89A 4YJ5A 3ATYA 3VX1A 2XN1A 3RHGA 1I0BA 4FB7A 1JDCA 3L4XA 4O10A 4N6FA 2WPBA 4I5RA 4MWAC 3W71A 3ES7A 4B15A 1FWIC 1YBQB 3VZYA 3CUZA 3BJFA 1ZCOA 2QNEA 4Y6GA 4HNNA 3GXFA 1S5VA 3KVMA 4S3KA 3W7EA 3S8HA 3KCEA 3KOXA 3ALFA 3T1GA 3FJ6A 4LW7A 4QRNA 3GG8A 3MO7A 3VVGA 3IKDA 1SR9A 3H23A 3KUMA 4NL1A 3VGHA 1GHRA 4ZMGA 4JYEA 3THUA 5FEWA 3WJYA 2IQDA 4AHPA 3TTOA 4DBDA 3AXIA 1AZ1A 3W7CA 1LM1A 2Y7DA 3GR7A 2EGZA 2YXXA 4NKCA 2PD5A 2VEMA 3GNXA 4S3GA 2ISFA 4XWUA 3GZ3A 3O6CA 3O7UA 2J7CA 1JVNA 2J25A 1CWYA 1GOQA 5E09A 1UPPA 3W1TA 4EXAA 2R82A 4TTGA 4DHGA 3BAJA 4C6OA 1HKJA 5AZ0A 5HKGA 1PEZA 5LXEA 1DWIM 2VJXA 3UI4A 4QDPA 3ZQ9A 3PULA 3Q65A 3OGRA 3LBCA 4E8DA 4LFYA 3F1QA 4L9XA 1LLOA 4DIAA 4P61A 2DP3A 4FALA 1FKBA 1E6SM 4MJMA 3WH8A 1EXPA 1JCXA 1YXCA 3CL6A 1W5PA 1MW0A 3STFA 1U30A 3CLWA 1EWEA 5F1UA 1FUYA 4WQ6A 2AL1A 1XC4A 2WANA 4GO8A 2BLEA 4DZ3A 3R10A 3GPKA 1XGZA 3W6YA 3SZ8A 2OEKA 4ATLA 2W0UA 5D37A 3VX0A 4Q8UA 3TQKA 4I8DA 2G0WA 4IIBA 3BCJA 3O6AA 2F23A 3NOEA 4JTSA 3UQBA 3CIXA 2HPIA 3O63A 3PBYA 1G4EA 3H22A 3UGRA 1ODUA 4RPQA 3KS5A 3GDKA 2WB5A 3PA7A 4V15A 5D2TA 3THAA 3GXMA 4JIHA 3EWDA 1JJKA 2X42A 2D2JA 3TZNA 1GVQA 4PTXA 1BWKA 3DAQA 1FDZA 1QZ2A 1J6YA 1TMHA 4RV3A 3CQKA 5FEPA 3Q37A 2RURA 3BMWA 2CLMA 3UG5A 4DUWA 4BKNA 1MEIA 1RY0A 2C8NA 1NOWA 2YCIX 4UTFA 2C6QA 2C13A 1POKA 4WK9A 5FKYA 1WOBA 2JBMA 2P8BA 1A3HA 1JZ5A 5XIMA 3V0TA 3E02A 3WDQA 4HU4A 5CCZA 1S2TA 3CU2A 4AXKA 3M0VA 7REQA 1K02A 2OZ3A 1C8QA 2A1YA 1LOLA 3ABRA 5DFAA 4F2BA 5ABHA 4IXHA 3NURA 1CB7B 4GXPA 5HQMA 4GIVA 2VHLA 1CZ1A 1VFTA 2QGYA 4OIFA 4ZL1A 4MZYA 1QW8A 4ZQPA 3WFAA 4YTTA 3CMFA 1JPHA 3E0IA 4GH3A 2DPEA 2FGZA 3LLFA 3KABA 2CESA 3LV6A 2A2IA 4PCSA 1H7PA 3O0KA 4GXMA 1LBLA 2DEPA 3EGJA 1MUWA 2V5BA 4B2DD 3GKAA 1OIFA 1XUZA 5HWCA 3IJ8A 4MGGA 1XIMA 4AIEA 1VKFA 5I07A 3QR1A 1S5NA 3QOKA 2Q3RA 2OMAA 3D5HA 4E2BA 1EJTC 1PBGA 3FOKA 3GXTA 2FTPA 1VAHA 2GK1A 5GJMA 4B2DA 4LT9A 4JY8A 1H60A 1XLCA 5J5RA 2CXGA 3QSTA 5HPOA 4P7NA 2Q8XA 1V03A 1S2UA 4H83A 4X9YA 5DXXA 1HNYA 2FHBA 3VD9A 2DVTA 4O11A 3W75A 2NX9A 1SGJA 3NPXA 4LVGA 4KGLA 3OQEA 1K7EA 4MM1A 3HG2A 2NW0A 3CV2A 3GBEA 4GACA 3DI1A 1Q65A 3EA2A 2QLYA 4HMCA 3NR0A 1O1ZA 1TPFA 5I7GA 3WEOA 4LU0A 1Y7VA 2CNCA 4OU1A 4X0VA 5E9AA 1ITCA 3L0NA 3H2MA 4RJEA 1UKPA 4Y9MA 3VYLA 4ITZA 2VR2A 1A7XA 1YYAA 4CQ8A 4QROA 2Z2UA 3BLFA 1AVAA 1UA3A 1LUCB 1W9DM 2J8FA 1WPCA 1OX4A 4MVAA 3FS2A 2WBGA 2WVVA 1Z41A 1QPRA 2DG3A 2E6AA 4H8VA 2BASA 2PLKA 3LNPA 4C6QA 2ZX9A 3N3MA 3TR9A 2PDPA 4KFPA 2PZ0A 2WJDA 4YTQA 3SW6A 4IIGA 4UR7A 2V3DA 4JYSA 5D2YA 4UXDA 4ADUA 1QR7A 3W81A 4JQ2A 1OD0A 1U2YA 3I7SA 1H50A 2CZ5A 4LVFA 4L9YA 1EGZA 2HTMA 1KXQA 5DO2A 3N34A 4XD6A 5TQLA 3UYCA 3S5OA 3RPDA 4A2SA 3HGJA 3DECA 2OX4A 4MOZA 3OPSA 1V02E 2OZ8A 1UOZA 4I9TA 3VE7A 4CNUA 5G5IA 1HJSA 3C61A 1B90A 1A5SA 5KITA 1VBJA 3KL5A 3N4FA 3WMCA 1EF2A 2RDXA 1WZKA 1FWGC 4POCA 1TPC1 3NQFA 2HK1A 1YW5A 4DO7A 3W86A 1EGVA 2A3AA 4J9JA 1BTCA 3L0GA 3B97A 3TN3A 7REQB 3ZOAA 1R2RA 3N04A 4J3SA 1JGIA 2V38A 3L4ZA 3CL8A 4IT4A 5HULA 3FDGA 3W1MA 3MYOA 2J88A 4P8UA 4R88A 4V1XA 1UC4A 2M2AA 4Z42C 1R47A 3W83A 3RGTA 4C6FA 3S3GA 2CITA 2QIIA 4Z2JA 1CXFA 2H8XA 5BXRA 4E2OA 3CO8A 3V35A 2OGYA 3QLDA 1VPXA 4MWAE 1IZKA 3GVVA 1OG0A 3L23A 3V36A 4G7EA 2FMOA 1BVNP 1JRBA 2PB1A 2V30A 3BSGA 3SN1A 2KZHA 1G5AA 2Y4SA 1FWSA 2GK1B 4J3ZA 3SUUA 1TFVA 3WLPA 3U7VA 2YOCA 3FXGA 1O66A 1U79A 5BW6A 4J4KA 5BROA 4F0KA 1DQXA 2A7PA 3T0CA 1TPVA 1RV8A 3TOYA 1MFVA 4WVXA 1HL2A 3VAVA 4F9DA 2X1UA 1BYBA 4NU7A 2GVLA 1VFMA 3UZYA 1K8CA 2A3HA 3GIYA 4Z2GA 3S6TA 3MB9A 5CPQA 3COTA 4JX6A 1WDRA 5FA5A 3J7HA 1WUFA 2JIWA 2ESCA 2GJLA 4I7WA 4UTWC 3K46A 2ZRUA 5LHEA 2NXHA 4QJ1A 1JVWA 2QCDA 2VRQA 1XIGA 3NQ6A 1M41A 4FX8A 4NJIA 3LUTA 2EPLX 3OBKA 1YTEA 1JR1A 3HJZA 4JZ5A 1MNSA 4DXVA 3LBOA 3DC8A 4WHBA 3UPBA 4C7FA 5AB3A 1IT8A 5JXQA 5HA7A 3DXIA 3B9EA 1XIBA 4IX2A 4TW8A 1E6QM 4I5XA 2YLLA 3ZVHB 3WX7A 2CLOA 2ZIDA 3VTRA 4O13A 3UI5A 3W2MA 4LWWA 1RJPA 4EACA 5DCBA 2WVVB 3V0SA 2HROA 4IQLA 5REQA 4OVXA 1Y0EA 1IE7C 1R8LA 1ZGDA 2QPUA 1G01A 2VO5A 2VCAA 4HBOA 2QYGA 4GY0A 2PP3A 4UTHA 3MDUA 1WYIA 3WQOA 2DUXA 2EG7A 2ODOA 4UR8A 4DLMA 2ZRVA 3SR7A 4O1DA 4KS0A 2J47A 3EOSA 5JUVA 5GPGA 4CQ9A 4DWDA 3S9ZA 3STPA 4Z2KA 1NP2A 1VC4A 3VNDA 3LPOA 3O6YX 4JPGA 3C2FA 1JPDX 3PUOA 1X6UA 4JIQA 4C5YA 3FY1A 1FDYA 4PN2A 3EB4A 2ZVRA 2X2GA 4AEEA 1GYMA 1TTPA 4AVOA 3W24A 3CUFA 1VF8A 1MXSA 3H2EA 1JG9A 1TJPA 5EMUA 2VURA 2VEIA 2E09A 5BRBA 3SCNA 3IGHX 3TTEA 1A5CA 4NRSA 4WSHA 3VCNA 2CZEA 3BVJA 4V33A 3QTGA 4D6JA 3N14A 1L6GA 1FWNA 4QQUA 2E5CA 1Q2RA 1A5OC 3XINA 4OE7A 1ME7A 2WQDA 3SCRA 1TCOC 1CGWA 3ICJA 4QE1A 4QHRA 3N15A 4ZB2A 3C86A 3TN6A 1V6VA 2TRSA 3IV3A 3Q45A 1SPQA 3L4UA 3LM3A 2WHMA 1KLYA 1QATA 1Q6QA 2Z4GA 3SY8A 2GOKA 4G7EB 1ML1A 2OODA 3RX2A 2YDQA 4JDYA 2BXVA 1DJGA 2H6RA 4R7JA 2GQ8A 3VO0A 1C3FA 4FF5A 1FVPA 1XG3A 3R11A 3PTKA 5FL0A 4ZFMA 2FVMA 3WNNA 1CDGA 3ODKA 1QBAA 2ZYFA 1V0NA 5J04A 3F2DA 1RBLA 2RGLA 3CK5A 4LH8A 2GGJA 2OEMA 1E5JA 3M5ZA 4AZ5A 4W8AA 2QUUA 1MDLA 2Z26A 1SMDA 1CPUA 2Q02A 1B3XA 1KD0A 1XR2A 1JZ8A 3EWUA 3CWNA 3H2OA 3ITXA 1QPKA 4TX8A 3LS9A 4GA8A 2TODA 3WZ0E 5DO8A 4DPQA 5H8UA 2QCDB 4YVXA 3EWCA 3PZ9A 2I1OA 2ZADA 3CLMA 5G1TA 1CXIA 5HMEA 2REQA 3S5ZA 5FSEC 1W5QA 3F5LA 1KXHA 1OINA 3PTMA 3LD5A 3PBWA 5DT5A 1XGDA 4D1IA 2Z6IA 1ZB5A 3OIHA 4ZTYA 2ZR4A 2OWWA 1OIMA 3N29A 1GNXA 3ZT5A 2EF9A 2ZZ4A 3WF0A 1PDYA 2V2CA 4Y8FA 5GPRA 1C7SA 4JFKA 1PCKA 2PF8A 4MAVA 4XAFA 4CNTA 1TJRA 5REQB 3AIQA 3F4WA 4Q4QA 5HWNA 2Y8KA 4N4PA 2VEKA 5HTGA 3TA6A 3LX9A 4FO4A 3WMBA 4GIYA 3AXMA 5DMNA 5HATA 1NTHA 3CTTA 1CGXA 4PL1A 5DRCA 3DFHA 4LOCA 3URNA 4HMDA 2D0FA 2Z25A 2NZLA 1K03A 4YWSA 4LNCA 5EMYA 1XBXA 4O0QA 3VIMA 4RNJA 3UEQA 1ZY9A 4Q4RA 1GZ1A 3I3EA 4W5UA 1FH7A 1VEOA 1FKIA 4QS5A 1SO4A 5F2GA 5JH2A 2DQWA 4WCJA 1H7OA 1ZBKA 4XZWA 3FHQA 4NHVA 3FX4A 3M1ZA 2TYSA 4CVWA 4IFOA 4S1FA 4D9PA 4TU1A 2OYLA 4DPPA 5EMJA 4P8VA 3HG4A 1L6FA 1K1DA 3EWYA 3QQ1A 2QKFA 4DLFA 2MNRA 3BLIA 1ZFJA 3MTWA 2MLXA 2DG9A 2GYIA 5K2ZA 2XP7A 1V02A 1E1EA 1ESWA 4ZO7A 2PTYA 4F0RA 4I7VA 3RFAA 1T96A 3ITOA 1TV2A 1H1NA 4UFLA 4HNTA 1NMWA 4WY0F 4AZIA 1H5VA 5LNVA 3Q4DA 4XIMA 2X2YA 3LYEA 1JQVA 1VBUA 1Q45A 3MUIA 4RUBA 1UR3M 3NO1A 1QW7A 3SRFA 2FJUB 3G6MA 5DIUA 4NAFB 5D30A 2WMIA 1UOKA 3O5PA 3GXNA 4IQ2A 2EPHA 1EO5A 4MWAD 3ZSTA 4NNCA 3O5DA 4DEFA 2ZUMA 1BXCA 4X2PA 4ZQRA 3NM1A 1GEHA 2PGEA 1VCGA 2ZUSA 4RLIA 3UVIA 2W63A 3ZMRA 3ARZA 4YPJA 1X1OA 4NZCA 4MWAA 1A4MA 3W74A 3IVUA 2PRLA 1PTGA 3U4AA 3N3TA 2OWXA 2WBKA 1QTWA 1NELA 4D6HA 1BL4A 4MNLA 3R89A 1TUFA 2KI3A 1T0OA 3U2OA 5CEWA 3UGVA 3ECQA 2Y63A 1PO9A 4XAZA 4GZJA 2FQIA 5C7HA 4PSRA 1OC7A 2GDQA 4XVEA 3GU1A 4FLRA 3DH7A 1DORA 3V0UA 3B8SA 3RMEA 2Y70A 4BF9A 3LOTA 4Y9NA 1DIOA 3UI6A 5EL1A 3ME3A 2FPYA 4M82A 4F9JA 5A3HA 2P50A 3KAIA 2GWNA 4IGNA 1RK5A 4MSSA 1UR2A 4JTAA 1JNTA 1Q4WA 5DANA 3S2CA 1K3UA 2ZC8A 1FFRA 1W3IA 1NF7A 5BOOA 4L72B 4WGHA 2VFDA 3LU2A 3PWAA 2C0AA 2MLZA 4R34A 4TVCA 2VCCA 4O54A 5F2MA 4G8TA 3BCDA 1LT8A 2ZXQA 3YPIA 3BL3A 3AALA 2C7FA 5H2ZA 1U1HA 3N2MA 3RLVA 4HPGA 4Y9PA 1PVNA 4HHHA 2BFGA 4PFMA 5G1MA 2DZTA 4FAPA 3O5MA 4TX9A 2YXOA 1PZ2A 3O16A 4JCMA 3WK1A 2R1NA 2GSJA 6XIAA 2NQLA 1MVYA 3CEPA 3HFYA 3OODA 1R9XA 4DWSD 3LA4A 2IXUA 4LV4A 4AVFA 4RZ4A 4DRMA 1OT2A 4OZOA 2F61A 5B8IC 1KNWA 1AZ2A 3FFSA 1EC8A 1JF5A 2DW6A 1OG6A 3KOWA 4H01A 1W3NA 2YGYA 2INFA 2NVAA 2VX4A 1QAPA 2H8ZA 1OVDA 2OLSA 1KM3A 4DWSA 3IVSA 3N25A 5A6MA 4NJKA 5E6YA 3UA4A 1TTJA 1ROTA 4LYQA 4S3AA 1O6IA 4CQBA 4N9BA 3E0FA 2ZX8A 5F4WA 3V18A 4ZEPA 5D32A 4WOZA 3N4AA 1D2KA 3B04A 3GNDA 5C55A 4JTLA 1HUVA 3MY9A 5E6ZA 4IPXA 2TPSA 2QAFA 1NQKA 2ITKA 3NQ8A 2Q8ZA 2WMIB 1XFBA 4JFVA 2PWDA 3LCHA 3IAPA 5HMFA 1PZ3A 2BOGX 1S46A 1TQXA 3S6OA 2WHKA 3O5RA 4GGBA 5KETA 4U4MA 3TCEA 3M4HA 3M0LA 1VEMA 4DYJA 5HUPA 3TSBA 3P2VA 4R27A 4XD4A 1YNPA 1FWBC 3GLCA 4O1CA 4MWAB 2WCAA 2W9MA 3URQA 4RK8A 1KFCA 4NUWA 1XLBA 4JN6A 2YL6A 4QG6A 2PP1A 3AYVA 2ZUTA 4O8AA 2DSZA 5HQEA 3NJ3A 2PI6A 3QFEA 1XX1A 4W8BA 5I3IA 3UWYA 2C79A 3B9OA 1CB2A 2IQTA 2WJEA 4ODKA 3EX1A 3EX3A 4HK7A 1OY0A 3O5FA 2QF7A 1C92A 1S38A 2CLIA 4JTHA 2PV3A 4YIWA 1AW1A 1B31A 1EJXC 2PBGA 3PN8A 3OQ8A 3APYA 1UH2A 4R0XA 3QPYA 1W1IE 2PODA 4A8LA 1YE6A 4JKMA 3SADA 1QCWA 2Y61A 4XSMA 1L8PA 2FZDA 5AYXA 2YFOA 5B80A 4HNLA 1H41A 2WLYA 1WUEA 3QLLA 4E38A 4NXKA 2W91A 3IRSA 1XRFA 3UWVA 3UQIA 1I60A 3GVRA 2J27A 3D46A 4MJ4A 3BMBA 3UT0A 5BXTA 3GAYA 2Z2BA 2UZ5A 1I45A 5BYWA 1VBGA 3MHGA 3H26A 4WXZA 3E3HA 4WDUA 3PB2A 3VIIA 2XIJA 4ICNA 3WQCA 3TV8A 4R9OA 4IMEA 1UJQA 4DELA 2CETA 1EP3A 2Z6JA 2WLZA 3R12A 4PMOA 1QO2A 2DSWA 4O1EA 3R0UA 1KM1A 3PPHA 3WLKX 4BQ5A 2BDQA 1Q5MA 3USBA 2PC4A 1XH1A 5HNTA 4M6UA 4F40A 4QEHA 1CXKA 1DJIA 1SO3A 9XIAA 4CCEA 3EAUA 2WSKA 3AI0A 1MW3A 3KCJA 1FY6A 3I7RA 3FYOA 1N2VA 4CU7A 3OB8A 4PBEA 1F6KA 5FEZA 2GZXA 3L2MA 4ODMA 2XYLA 3BSMA 2K8IA 3QHMA 3KAOA 3VKKA 2GJNA 1SZRA 5DF0A 3PVFA 3TTQA 3THCA 1TPWA 7XIMA 1R9YA 4MF4A 4DJEC 1CLXA 1XIDA 3AHVA 4NZ1A 2E1DA 4CVUA 4IPNB 3W7DA 3WMLA 4TVUA 3ZJ8A 4H9VA 5C7VA 1XLIA 1R3TA 1UUMA 1SW7A 2O7SA 1TR1A 4P7OA 4U28A 1FKTA 2BY2A 2I56A 1ZAJA 4AMAA 3NI6A 4NNBA 3BG9A 1R3QA 2VL4A 4OWGA 1UH4A 3MQTA 4ODRA 2ACRA 1LP6A 4WRHA 3O5GA 1UHVA 2HNEA 1Q66A 1RP8A 3NSMA 3RF9A 4PMZA 4DUVA 3T0AA 3C2YA 1F8AB 3L68A 1EGMA 4KERA 3TJ4A 3GC4A 1TRDA 3CTLA 1CLVA 2PRMA 2BOEX 1JXJA 1BG4A 1CNVA 3LPPA 1U1UA 3IWPA 3UY7A 2G37A 4YN5A 4M7SA 3ID7A 2QUMA 3STCA 3TSMA 1VENA 1YPXA 2CWXA 3VDCA 3P14A 1ICSA 4R7OA 3WH7A 5A6JA 4FF7A 5C0QA 4MUPA 1HQTA 4LF2A 1VFSA 3CV7A 2OEJA 2J6VA 3G8RA 4I9AA 5A8QA 4EK7A 1VFOA 3G1HA 4YS1A 5B7ZA 4KCUA 4JFWA 5LHFA 1ZJIA 4J2MA 3RO6A 1NDYA 4GFIA 1FRBA 3EA3A 4IPPA 3QMTA 3W73A 3RYSA 4NRRA 2WMJA 2XGIA 4JKKA 3RG6A 1OADA 1AODA 1NY1A 3MSGA 4CCCA 1XS2A 3C2VA 3T44A 1GT8A 1FBAA 3QZEA 3UD6A 1ZQ5A 2D0GA 2VVSA 3PZVA 5AKQA 2A6LA 5EMMA 3VA8A 4PR4A 5AHNA 4X22A 1A4LA 4S2BA 3TVAA 2QR6A 3AC0A 1B2YA 1KFJA 3N73A 4IIDA 1IXOA 1J11A 1XIIA 1TRIA 1FKFA 3LGDA 1BXBA 3TLQA 1YEYA 1GOXA 4A3HA 1C7TA 3G77A 4DRJA 2CZVA 2RDUA 1GPWA 3WQ6A 3WO8A 1D8CA 3GSMA 3W28A 4AG0A 4BHYA 1EA9C 2J13A 3UZJA 1VGAA 1BEUA 4GE8A 1KGUA 2XVNA 3JYMA 3T4WA 4DJDC 1L6YA 2YZ5A 5DBTA 3H4WA 1P6WA 3SCOA 2QMKA 2VM8A 2VXNA 4LVDA 4M6QA 2OQYA 4PMJA 1FHVA 5SWUA 2YCJA 5EFFA 4YTSA 1POJA 3IARA 4ZPVR 4QT2A 1O95A 3EA1A 1K7XA 1LWJA 2XPBA 4JFMA 1KB3A 3BQ5A 3MSRA 4GI9A 2OT0A 1KW1A 2AMXA 1XPYA 3SSJA 5A95A 4KW2A 3C3NA 3O5LA 2LLEA 1J01A 3G1SA 4H19A 5A6KA 1AH0A 2I5IA 1UR4A 4IMAA 3EOLA 3O6DA 3KHJA 3DKLA 3W22A 4AD4A 1RQBA 1V79A 5IFTA 4PUNA 4NSBA 1Z69A 3SFWA 5I24A 3AUOA 1QNQA 5CPTA 4PULA 4PB4A 1FAPA 1LRQA 2QCNA 3QY7A 1RALA 1AA1B 3VDBA 4JTTA 4N19A 4HJFA 2H9AA 4MJZA 1V51A 3L65A 1W9UA 1A5AA 2Q09A 1IWAA 1M01A 1OFDA 4TQTA 3N17A 4FK9A 3P5YA 4NI8A 3CGMA 3H2NA 2QMJA 3BAYA 3FGCA 1E55A 2RUSA 1MSSA 3C5QA 1RA5A 3NL6A 2A3CA 3EB2A 1F8MA 3LG3A 3MP3A 3BLDA 3DG7A 3SBFA 1W54A 3WLSA 1TMQA 4ES4A 2PN0A 8XIMA 1KBLA 2J62A 3D3FA 3VM7A 1PX8A 2VZTA 1RPKA 2ZX7A 5I03A 2ZR6A 2J9YA 1RR2A 3G1YA 3P93A 3AWOA 3E2QA 4MADA 2E6YA 3ERPA 1PTDA 4PUWA 4C1NA 4M7TA 2XH7A 3ZT7A 3WLOA 1X7FA 1HJVA 4GZIA 1RJQA 1K70A 2V67A 3A4AA 3NDOA 1CGYA 1V3LA 3FAXA 3GS6A 1FFQA 1WDDA 3BC9A 1S3HA 2J7HA 4M6VA 3QTPA 1SJDA 4UQDA 5RUBA 3R2GA 5I00A 4J28A 1J0KA 5A8OA 3GW3A 1KFEA 3QFWA 2VN1A 3TC5A 1FHLA 3IUHA 4H7ZA 3RU6A 3ARTA 3WD4A 5CC3A 2XIBA 3H54A 4NZFA 2PURA 4AY7A 1DXFA 2IW0A 4QIUA 3WH0A 3TXZA 3ATZA 4H9YA 2OTDA 5I09A 1TCDA 2YBUA 1Z42A 4HARA 3EX4A 5DY3A 2Y78A 3UG3A 3M43A 4YXGA 2D3NA 1TPEA 3L7RA 4P5UA 1QNSA 4JFLA 3H21A 2VT0A 2Y8UA 1FKRA 4HK5A 4Q4KA 4ACZB 4M1BA 2ZRYA 3ZT6A 1ZPTA 2OVLA 2XVGA 5D04C 3QV6A 2BXZA 4ZSUA 3LTPA 2ASHA 3ABSA 4C6BA 3MDYB 3G24A 1EOMA 3V5FA 1GJWA 2VEGA 2G95A 3WLNA 1F3EA 3BE7A 3AS0A 2NXGA 3EDFA 4WDWA 1WBHA 2VMFA 1Q1CA 1F2JA 1Q7QA 1QASA 4H9TA 4IGHA 3LPGA 1G1YA 3V75A 3SJNA 3IJLA 2G3MA 1K7FA 1PZ1A 4K7YA 3LLXA 4NVTA 1XD0A 2ZKMX 5T26A 2HVNA 3SAZA 4PSPA 5KZMA 3V1HA 2GQAA 2DT2A 3NTYA 1XIFA 1VQTA 5FIPA 3QC3A 2ZQUA 1WDSA 2YLAA 3OZYA 2W61A 4Z2HA 4OUEA 2CZDA 1GWJA 4MB5A 3QY6A 2H9AB 4WKAA 2UY2A 1ISVA 2IUZA 4H6RA 4E3TA 5M17A 3CYVA 2I17A 3LHYA 4B5XA 4JN7A 5ECUA 2WMHA 3L4WA 3K5XA 2PTDA 4M51A 2DT0A 2QGHA 4GWEA 4BQ2A 2C3ZA 1J18A 1QOXA 2P0IA 1PWMA 3I6TA 3AS2A 4FNPA 4JQ3A 2PFHA 4GKLA 1EBGA 3OVGA 4R7WA 4PTVA 4HBEA 2VRKA 3A4JA 1N8FA 1W3LA 2CKSA 4UZUA 3M6YA 2XP8A 5IDZA 2VZSA 2E4TA 4O17A 4B5NA 3N2TA 2R1LA 4WXYA 4QG8A 2J9XA 1XLEA 1J10A 3HQOA 4GJIA 4L1WA 3USZA 3SY5A 5EFDA 1UKSA 2FTWA 4AAJA 3AU6A 3O9NA 4PB3A 4C1NB 3UXIA 3GFXA 3SO7A 2HVMA 1TYGA 3SGUA 3FAPA 4U5KA 2BV9A 2ADAA 3RM8A 1XCWA 5CPLA 2X16A 2VDHA 4U5IA 1KFKA 4A3RA 2X0YA 1TCMA 1E4LA 3BW3A 5HBFA 2PGWA 5DEZA 1B9BA 4XAYA 2RUDA 4CD8A 5H8MA 1YIXA 1D7KA 3VABA 1Q4NX 3PBGA 4ENLA 4D2JA 4ZFCA 5HXMA 4CD5A 5LNUA 4DI8A 4YYCA 4H8HA 2VELA 4QIBA 1GW1A 4E2VA 2PDKA 4L1XA 4JD4A 3JW7A 2X30A 1EKOA 3TTSA 3MHFA 4ERIA 2A85A 4AZHA 1LRTA 2VGGA 1A5MC 5DIVA 1I0DA 5DXYA 3O07A 1W0MA 5BWAA 2PDQA 3OVQA 3D6NA 4NX5A 5I23A 3ABXA 5CBIA 1V4YA 4US5A 1AD1A 2OSXA 4CU6A 5FF7A 2V82A 4JFJA 1JCHB 4P7RA 1G7UA 1V3MA 2QVHA 1VIZA 3NQ7A 1RBAA 2GUUA 5AC8A 4FR1A 2BB0A 1J8VA 2D20A 4IMCA 4YVVA 4AD0A 4TMBA 4XBSA 4LYRA 2CBIA 3VNLA 2CBJA 3AS1A 1K9FA 5CSUA 2XN2A 5D2VA 1W1PA 3A6OA 3EPOA 1XLLA 2OOGA 3I6EA 3TCZA 4S3EA 4N6EA 1UP0A 1UWTA 4LS1A 5BRQA 2WM0A 4YVPA 4EOUA 3CIWA 8CGTA 1ECEA 4CQAA 3EWXA 3HBLA 3TMLA 3SY1A 1P7TA 3RFWA 4BFAA 3SCSA 3RX3A 2HE8A 3HU7A 2V8ZA 3DHUA 6CGTA 1YXYA 3B03A 3QY8A 3N2OA 3UPWA 3ABQA 3BW4A 4DX3A 1V93A 5CG0A 1OGBA 1HFBA 3T05A 2QAPA 1W32A 4H3DA 4QSFA 2VWSA 4GUGA 3RPMA 4PUUA 2DZXA 2A6NA 1M6JA 3B0VC 5F4SA 1V08A 4JTJA 1S2VA 2GSEA 1FCQA 5EGRA 3H55A 4OOUA 4Q7BA 2YL9A 4MFDA 1JUBA 3TDBA 3PJUA 3TAOA 1E0XA 4GH1A 3WNOA 2CU0A 1DHKA 1JGMA 1SMAA 3OTRA 1XCXA 1OB0A 3S1GA 1A49A 3VGDA 1RVGA 5DLCA 3WH5A 1R6WA 3SJ3A 5TAOA 1QK2A 4QNWA 1G0CA 1FHUA 1Q3NA 1XUUA 4JX5A 4UWMA 4W8LA 3PBMA 2BY0A 4O16A 3WH6A 2CBUA 4K36A 4WLCA 3AS3A 2VC5A 1QVBA 1XD1A 1IGSA 1TO3A 4WF7A 1PV8A 1VJZA 4JY9A 2QV5A 4RNFA 2ETNA 2O7QA 3PUDA 1JF6A 4Q4OA 1CX9A 5FCZA 1NWSA 3W1LA 4DRSA 4KR0B 1F07A 5GNZA 3M5VA 1LDCA 1TX2A 5TNVA 3FKKA 3THDA 3SGGA 1V3HA 4U31A 4HPJA 3N1AA 3EIPA 1MEWA 5A8GA 3KADA 4GUHA 1XGEA 4O8RA 4XX6A 1TX0A 1TUXA 1GONA 5A69A 3SQLA 1RH9A 2BVWA 3NSXA 1A5NC 2AAAA 3DCPA 3B7XA 1BRLB 2E6FA 3SI9A 1IEWA 2P8CA 5JBFA 1M7PA 1GGOA 3VIGA 1QNRA 5IFPA 3LBMA 3E5PA 1KFBA 2UV8G 4CQCA 4ZR8A 2AGKA 2J9ZA 1QHOA 4X61A 4AZGA 4AZCA 1R3RA 5CSSA 1O5RA 1SW0A 1KM6A 1TTQA 3U5YA 1D6OA 2G3IA 3GC2A 3KWXA 3RIKA 4K38A 5HMSA 2G8ZA 1IF2A 3M46A 4O57A 2A3LA 1XYFA 1EJVC 1KQZA 3R79A 4TW7A 4ZO6A 4ZE4A 4WOQA 4ADTA 3KAGA 2PEVA 5HJYA 2FZ9A 5U4NA 3ARSA 1EYEA 1JNDA 5FJIA 4Z1CA 4PZVA 1QNOA 3NL3A 4HA3A 4C1KA 3S5YA 3M41A 3TP4A 4PA8A 2YPIA 3T6CA 4Q8WA 4L6DA 3WBWA 4M24A 1E6XM 3W02A 1B5TA 1YPFA 1IX5A 2PGFA 1ITUA 4IJBA 3CHVA 4C02B 2C1IA 1YDNA 1QPFA 3A5VA 1ZU8A 4GRSA 1ME8A 3T4CA 2F9RA 4Z0JA 2PDBA 4Q3MA 3UR2A 3DGRA 2CC0A 4KFOA 4XUGA 1DL3A 3CUXA 4OT7A 3W1NA 3DKJA 1UYQA 3W7OA 3SB0A 3TUUA 4UZSA 3UWWA 1PKNA 2O4MA 2JKAA 1T6MA 2DW7A 3TH6A 4B5WA 3HFTA 5HNNA 4G1KA 2PLJA 3C56A 4JQAA 4HOXA 1R3SA 2AKZA 4HTBA 3IK4A 4DF1A 5GNXA 4DJED 3PZNA 1J5SA 4J2PA 4BEUA 3ZO9A 1PTAA 7ODCA 2ZC1A 1LF1A 1XI3A 5A6AA 1S5MA 1XINA 2EJAA 1GW9A 2VKZG 8RUCA 3N12A 3O3RA 1GQIA 2DGAA 4BEQA 5TD4A 4DNHA 3VOGA 2V81A 4QE4A 4DJEA 1AW5A 1DWJM 2GVJA 3LCIA 1UIPA 1KBIA 1H0IA 1E56A 2XDFA 2PRHA 4O1AA 2O9RA 1TJ0A 2C1GA 2YJQA 2XHYA 5MKGB 3TEVA 1NH6A 2R8WA 4JIEA 5BU9A 4WEVX 4AX6A 4ZXOA 3GUWA 3GYEA 4GI8A 3SEPA 1C9WA 2IS7A 3UCQA 2FPVA 4Y90A 3P6LA 3W0KA 3W7KA 2J74A 3ZZ1A 1R9ZA 3NTPA 5D9OA 2W6RA 2GOUA 4UNIA 3SN4A 4IQCA 4DO5A 4HYWA 1T5AA 1GOIA 2YX0A 5FF2A 2O9TA 1YNQA 1I75A 4JCLA 1IT0A 3S42A 4RW5A 4ZGYA 2PPNA 3WL1A 1CIUA 4C7DA 3VC6A 3ANUA 3U7BA 1M65A 1EEPA 2Z00A 4B3LA 1RCOB 3Q58A 5A6LA 3NQEA 4AVNA 2KE0A 2VRJA 4FPSA 4IQJA 1XLDA 4MNKA 4A8NA 1R86A 4M56A 3DC0A 5AYBA 3MVIA 1WKFA 3W7PA 2AQVA 1O94A 5CC6A 3O5QA 1ZZMA 2CLHA 2DZWA 2FTYA 1O68A 1PPIA 1PE1A 3DZ1A 5JH1A 3WYZA 1W1B1 1F6YA 1ICPA 2QCCA 2FVLA 3C8FA 2KAUC 3NVDA 3OVRA 1HKVA 1VCVA 1W1A1 4H6QA 1F05A 3PAOA 3AIWA 4EE9A