3RM9A

Amcase in complex with compound 3
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 129
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm9A01
1UH2A 4PMZA 1A3HA 1QW8A 2J75A 1KGUA 4GZIA 3AQUA 5BXSA 4AD3A 1UOKA 1GONA 3QHMA 1CYGA 4WLCA 1NARA 2GVYA 5HOSA 3U7BA 4H04A 1RPKA 2ZUMA 3D5HA 5DO8A 3WIJA 4DWSB 2J7BA 1X6LA 4DWSD 2XIIA 2PWDA 4CD5A 4MJ4A 4JAWA 1E1FA 1JG9A 3AMCA 3T0BA 1E3XA 3T0AA 1UWSA 4PCSA 4CU7A 3EDFA 4ACZA 3SCRA 4UQBA 1WNOA 2OWXA 1W9UA 3BAKA 3VX0A 2ZOXA 4AD2A 1WDRA 4DWSA 2WCGA 2GSJA 5A6KA 4HMCA 1CDGA 2JFEX 2XVPA 4KWUA 4NI3A 3WN6A 1UKPA 1UUQA 2E0PA 3AS2A 1E5NA 3DECA 4M81A 3ZT7A 2BS9A 3L4WA 2YLAA 3ZOAA 5LA0A 4WJXA 7A3HA 1V0MA 1MYRA 1F4HA 1MFUA 1KQYA 3IJ8A 1XSJA 4GZEA 5A2AA 2J77A 1CGYA 1QHZA 1LWHA 3L2MA 1JYXA 2X0HA 3VGGA 1V6XA 3VDAA 3OBAA 1E1EA 1NWRA 1W3KA 1GQKA 3W37A 2XFRA 4N42A 2VTFA 4OZOA 5D8WA 4U3CA 3GBDA 1IV8A 2UY5A 3L4ZA 4J3VA 1XSIA 2BHZA 3NUKA 2DSZA 1US3A 3AOFA 3T2OA 3I3EA 1I1XA 3AMGA 2QF8A 1GJWA 2GFTA 3S2CA 1EO5A 1ZBVA 2ZUUA 3DYOA 1OINA 4WIWA 4PUEA 9CGTA 3FAWA 3VGFA 1J0IA 3MUY1 5E0CA 1K9DA 4MAZA 2C0HA 3WDPP 3WL0A 1TCMA 2QV4A 4D6CA 1XGZA 3VMOA 2CHNA 3SCPA 5HNNA 1PIGA 4MJ2A 5AY7A 4RE3A 1ODZA 3FW6A 3GM8A 4MDOA 3WUGA 1JZ8A 1WP6A 1LJYA 2JE8A 4AEEA 3W27A 1VRXA 1GORA 2WSKA 3VIGA 2YLLA 1MVYA 1L0PA 3UR8A 1YQ2A 1BYDA 2E8YA 4OKDA 3AZRA 1CEOA 2JIWA 3AMDA 1NOWA 1ZBCA 1IT0A 2E9BA 1DEDA 1BLIA 4JFTA 2WHKA 3OZPA 3MU7A 3UCQA 4S3JA 2E8ZA 1JYNA 3SCOA 1E70M 5DFAA 1J01A 2VX5A 5KEZA 1UQYA 5GQBA 4AZHA 3WNKA 2EPLX 3GZAA 1VFOA 1OWQA 1V02E 4DM1A 2XTKA 4ZXLA 3AIVA 2ZX9A 1UWQA 4OUEA 5DMYA 1E0WA 2JALA 1NOUA 2OSYA 3FXYA 5DT7A 5FCZA 1J12A 3MMUA 4F9JA 1U30A 4PSPA 1L8NA 4PMXA 5TD4A 4PTXA 1UQZA 5A6SA 5IHSA 1E6QM 1E4IA 1RP9A 3OB8A 5ABFB 2CNCA 1BAGA 1TVPA 4H2CA 2ESCA 1ISYA 1BG4A 3K8MA 5DEZA 3AYRA 3CZLA 2BXYA 1K9FA 5E0FA 5E6YA 1FOBA 2VQTA 4UQAA 3AFBA 2BY3A 3CZEA 3LPFA 1XV8A 2ZXBA 3UESA 1UA3A 3OIHA 3PZQA 1G94A 3RMEA 3PTQA 1J9YA 1GVYA 1XSKA 5E9AA 4HZ7A 5I77A 1QBAA 1BFNA 4UOJA 4HMDA 3VKKA 4AZ5A 1TA3A 2W92A 1FFRA 2G3JA 3LPGA 3JUGA 5GNXA 3WY1A 3VIIA 2GDVA 4P8WA 4OOZA 4P8UA 1HKJA 4DUXA 5A69A 1KWGA 4CU6A 5CZKA 3WF1A 2ZX5A 1HKKA 3CPUA 1Q4NX 4KMQA 3MKKA 3ZO9A 1TZ7A 5JBFA 4L4OA 1W9VA 5JIPA 2XG9A 4UOZA 3N13A 1H1NA 1OGGA 5A8QA 2BY1A 2ZX6A 3VIKA 5CGMA 4XX6A 2X0YA 4B9ZA 2C8NA 3PZIA 1QI2A 5I3DA 1HT6A 2YKKA 1W91A 2PF0A 5D9PA 3OLGA 3HU7A 4GPNA 1S46A 2V38A 3MUAA 4WF7A 2YL5A 2ZXQA 2BY2A 4JKMA 1JI1A 3ZR5A 3VD4A 3ARRA 3HMCA 2V3EA 1JNDA 1MQQA 3VIOA 1C8XA 4ATLA 2DT2A 3NCOA 3OGSA 4M80A 4JHZA 1TMQA 4CD8A 4M24A 1WCGA 2VT0A 2X09A 1NH6A 2DIEA 3MMWA 3EMCA 3MSGA 5A8NA 1WZAA 1A47A 5JBDA 1ZS2A 4A3YA 2PWFA 4CD7A 4XUYA 2XWEA 2W4XA 2WANA 1B3WA 1NM9A 1W3LA 1C8QA 2QMKA 4EK7A 1VFMA 1H09A 1E5JA 4B9YA 4UFKA 1EQCA 1O7AA 3IK2A 1JZ2A 3M7SA 5BXPA 2FH6A 4AZ7A 3W6MA 3RJYA 1FH7A 2OSWA 5M03A 2CBVA 4V27A 5M17A 2WW5A 4JFUA 3A47A 4TVDA 3ZJKA 1FP9A 4MAVA 1C93A 4FLQA 1PEZA 4IPLA 5I5RA 3VIJA 1EHNA 3K8LA 3AS0A 4F66A 3VMNA 3UG5A 4FLSA 4W88A 1V3HA 4MNLA 2PB1A 1VEPA 2VRQA 3GNRA 5BXTA 2EPKX 1E6XM 2CBJA 2CKRA 1J0JA 3N18A 4B16A 4AISA 1UD3A 3CUJA 3WSUA 5C70A 5FL0A 4LYRA 2WM0A 1KXHA 4CUCA 3BC9A 2WLZA 4AD5A 2J78A 2A3BA 2VX7A 4J3UA 2Y5EA 2D2OA 2D24A 5BXRA 2J79A 6A3HA 4W86A 5E6ZA 2CHOA 5I2UA 5M3WA 2ZXAA 3II1A 3GXFA 2WWDA 4BZYA 4Q22A 2PBOA 1AVAA 3FY1A 1LG2A 1H4PA 2D3LA 1FHLA 2YL9A 4GI9A 1ISXA 3CHCA 3VPLA 1JDDA 1MQPA 5CPSA 3FNDA 2PWHA 3AHZA 1EO7A 1VEOA 4ZXOA 5LA2A 1E6NA 3GDBA 3CHDA 4Z2HA 5BROA 3O6AA 2EPOA 4KGJA 3WH7A 4OJYA 1VBUA 3WDJA 3MV01 1UG6A 3ALGA 1OIMA 2PC8A 3PZNA 2IXUA 2X05A 3SCTA 3VD5A 3AXXA 1OIFA 2VZOA 3WD0A 4UQCA 1D2KA 4AD1A 1JNEA 1EDTA 4GKLA 1XH0A 2BXZA 4PMNA 1CXHA 1XCWA 1WZLA 4UQEA 2XWDA 1OM0A 1QNSA 4J3WA 4QCEA 3AHTA 4UFJA 4AZCB 1GCYA 1B2YA 1UH4A 1NOFA 2Z1KA 5I78A 6TAAA 3D3AA 2W63A 2O9OA 1US2A 3GH7A 2VVNA 3BLKA 1NQ6A 1QBBA 1CLXA 4D6HA 3POCA 2WB5A 2B31A 3L4VA 1VIWA 5HPCA 4Z2GA 3K4DA 3PZGA 4JL2A 3TOPA 1XRVA 1ZJAA 2VCCA 1Q6CA 2ZXDA 3OA5A 2G3MA 1BPLB 1B90A 4AD0A 4AZCA 3T2PA 5ABHA 1R85A 2E9MA 1B9ZA 5LYRA 4ZEPA 2J8GA 4TVUA 3RCNA 5IFPA 3PTMA 1RP8A 3U5YA 3OGVA 5CQ1A 3AXHA 1PJ9A 2O9PA 2O92A 4BS0A 2WHJA 4E4PA 1AMYA 4KH2A 1KR1A 5E09A 3RDKA 4L4PA 5CPTA 3WBEA 1J11A 4GQQA 1GUVA 2OLHA 1J10A 2WAGA 1PX3A 3I3DA 1CXEA 4K68A 5IHRA 3W24A 3L4YA 1LQ0A 2WBKA 2IUZA 1KCLA 4CN6A 3VD3A 3K46A 2ZUTA 1OSEA 4EAMA 2XHYA 2DGAA 4JKLA 1KBBA 8CGTA 5DT5A 1QI3A 5A8MA 1UH3A 2YA1A 4WSJA 3ZIZA 3AHYA 3VTRA 2OYMA 4FF5A 1MFVA 2XUCA 3KL0A 3RILA 1LL6A 2BNJA 3EMZA 5F7UA 1VB9A 3BSHA 4IM4A 4HMEA 1ECEA 1PZ3A 3MS8A 4DM2A 2FHCA 1JZ6A 3ARQA 3TA9A 2GJRA 3VIFA 1BTCA 2BY0A 2WMFA 2A3CA 5AYBA 3AHVA 4LQ1A 4D6EA 3RM9A 2OWWA 3VGBA 3WD4A 2WNWA 3BAWA 3WENA 1E56A 3ZM8A 2XGIA 4TOQA 3POHA 4X0NA 1O6IA 2GK1B 2G3NA 5BRPA 1GHSA 3WBAA 3SIMA 4HZ6A 3T0DA 3WMCA 1V6VA 5JUVA 3HN3A 2VMFA 2EJ1A 2A3AA 3MSDA 3VU2A 3RJXA 3BXWA 1ZL1A 4B3LA 2ZUWA 2DT0A 1FA2A 4CN1A 3CUHA 5ABGA 3B8SA 2YOCA 4PYSA 3ECQA 4FK9A 1HJVA 4LGXA 1B0IA 3WH6A 4OOUA 4A3HA 3CUFA 1W1YA 3FHQA 2WMGA 1V6UA 2A3HA 3NJ3A 2YDSA 1XYFA 2ZUSA 1G0CA 4PTWA 3ARPA 4F9DA 1VFUA 4MB1A 3BAXA 2J62A 3A4WA 1W9BM 2FHFA 1VF8A 3ZJ7A 3F5JA 4U5KA 4MB5A 3W0KA 4BQ5A 1VENA 5FD0A 3BCDA 3AS3A 1R87A 1G5AA 1KBKA 4D6DA 1EOKA 2FH8A 2CCRA 3HJEA 1ZBWA 1XC6A 1JGIA 1ITXA 1NWSA 4HZ8A 4RE2A 1W9DM 2VJXA 4HTYA 4AZGA 2ZE0A 1DWGM 1WKYA 3NSNA 3W4RA 3MANA 1EOMA 3WNNA 4P7QA 3U7VA 3N1AA 1PPIA 3LMYA 1PX4A 4GO8A 3RO8A 3WL1A 3F5LA 1UWTA 4F8XA 3LPPA 1XD1A 4TVCA 1UR8A 3NSMA 1WE5A 1W3HA 2VO5A 2ZWYA 2RGLA 3WDIA 1WDPA 3EDDA 2WVVB 1JL8A 1VBRA 1W32A 3UERA 3WQWA 2DH3A 3BAYA 2NT1A 4F79A 4YHEA 5GNYA 4KRUA 4BF7A 1UD2A 3CTTA 1QI0A 3SCUA 4LX4A 3THCA 4AIEA 1C7SA 3PZTA 1SFSA 4W7WA 2DSUA 3VX1A 1U33A 1G1YA 2WZEA 4WKAA 3W28A 3DYMA 3E1F1 3EDJA 1CPUA 2WVVA 1CXIA 3M46A 1I75A 5EFDA 1UR0A 1M53A 2DT3A 1JDCA 1DTUA 4PCTA 2PI6A 1C91A 2WZHA 3A3HA 3CIVA 2D0FA 1PZ2A 3N15A 2XVKA 2W5FA 4UZUA 2E9LA 3WMSA 3K8KA 4ZENA 5BWFA 2XSAA 2JEPA 1KCKA 3F4VA 4UOQA 4GZJA 1KB3A 2VC9A 4FLOA 3VNYA 1V0LA 4CGTA 3PZVA 4M56A 5ABFA 3QGVA 3WMBA 5M5DA 3GYCA 1PX8A 1W1PA 4U33A 3AIQA 2JIEA 2C7FA 4PMOA 1UKSA 5D9NA 1KWKA 3WH5A 1U2YA 1ISZA 4U2YA 3AMLA 1E0XA 3VIMA 3WUBA 3VGDA 4HPHA 2MANA 3IAQA 1GOKA 5I23A 2VOTA 5HPOA 4PSRA 1V6YA 3ARUA 4W87A 3UG4A 1GQLA 1UA7A 3W81A 4NSBA 1DWIM 3PZ9A 1AQHA 1P6WA 1JAKA 3EDEA 4BQ3A 2BV9A 3AIWA 1JD7A 1M7XA 1I1WA 6CGTA 1TUXA 3U57A 4V28A 2CEQA 4HPGA 5HDRA 4KRTA 3ZT5A 4JCMA 2VZUA 1JYVA 4HA1A 4CD6A 1B1YA 4GINA 2DSWA 1H5VA 4MNJA 1CENA 1K9EA 4HP5A 2XPKA 2GJXB 3ARVA 2PWEA 5CXPA 2CKSA 1UR1A 1HVXA 1HN1A 4W93A 1Q6EA 3FHAA 1JZ4A 3BMVA 4HA4A 4UNIA 4CN4A 2G3IA 3CZJA 2X8RA 4PMRA 3DHPA 3WH8A 1E4LA 4PMQA 1Q6FA 1V3KA 1J0HA 3PTKA 1JFXA 1W1VA 2UY3A 1BHGA 4XZWA 2GJXA 3A4AA 1DWFM 1GNXA 2V3GA 1OT1A 3WF0A 4BQ2A 1WDQA 2JEQA 1CECA 2WVTA 4YPJA 4QDMA 1DWAM 3BSGA 4IPNB 3WDQA 4W8LA 2O9TA 4HA3A 4AMCA 2VI0A 4UQDA 4ATDA 3CHFA 3GXMA 4JFWA 3AZSA 1B31A 2VR5A 3AMKA 3TONA 1ZB5A 2E4TA 4M8UA 3IAPA 4NF7A 1J0KA 5CSUA 3BAJA 2VUYA 2WVUA 1TE1A 2TAAA 1V3JA 1H49A 2FHBA 4ZE5A 3KL5A 1E9LA 4J28A 1KFWA 1KGWA 1XD0A 4AZIA 2NW0A 3WEZA 1FP8A 3FAXA 2D3NA 1UR9A 1K6AA 2YBUA 1NWUA 4W8AA 4BQ4A 1WZMA 3SEPA 1ISVA 1UKTA 2Y8KA 1GOIA 3GBEA 1UZ4A 5CG0A 4RE4A 3AIUA 2WC7A 1JD9A 3G6LA 2NT0A 2VCBA 2XSBA 3OG2A 3WF4A 3VDHA 1ZU8A 2HVMA 3OGRA 3W26A 4D6GA 2OYLA 1E55A 1H2JA 3OZOA 5D9OA 4UFHA 3GNPA 3TTYA 5A6LA 4X9YA 2JF6A 1Z32X 1EGZA 4W7UA 5A8PA 2CETA 1H3GA 1WZKA 1HF6A 3QOMA 4XB3A 3W29A 1D7FA 1XYZA 4ZE4A 3VDBA 8A3HA 1E72M 1OD0A 1V02A 1FH9A 1UD5A 4NRRA 2VZTA 3AXIA 1EDQA 2YJQA 1JAEA 3BMWA 3EDKA 1FH8A 2VL4A 1JFHA 3VGHA 1HIZA 2YBTA 4A4AA 3ARXA 4JZ5A 5ABEA 4AEFA 4P7RA 4H8VA 1F4AA 3WUEA 2ZICA 5ECUA 3M07A 3EBVA 3PBGA 1B3ZA 1J0YA 2G8ZA 1DWHM 4D6FA 3WELA 5E70A 3WH9A 1BYBA 3QHOA 1UR4A 1X1NA 2J7DA 3ARZA 2XJ7A 1E4MM 3OLDA 3CZGA 4EANA 1C7TA 3VGEA 3AI0A 4QP0A 1N82A 2D1ZA 1M01A 4DUWA 3TTQA 2V3FA 1HVQA 2WK2A 3K1DA 3VILA 2VZSA 1X6NA 2DIJA 2WMIB 4HOZA 2XVLA 1E71M 3IJ7A 4MB3A 2QMJA 4MPKA 1LLOA 2O9RA 1QNPA 3KEHA 2UY4A 1QHOA 3TP4A 4JHOA 5KZ6A 2WCAA 1JIBA 4Z2LA 1IZJA 1HJXA 1EDGA 1R86A 3N9KA 2DSVA 1LL4A 2VNCA 1E15A 2EQDA 2BHUA 3VIHA 5FOOA 1JZ7A 3BGAA 2DH2A 4JCLA 1CGTA 1E0VA 1H0GA 1LWJA 1UWIA 3THDA 1NP2A 4W89A 3TTOA 1E6RA 3APGA 4UTFA 3UR7A 4AY1A 2XYLA 3T08A 1UD8A 1WB0A 3QOKA 1CBGA 5D9MA 3UETA 1RH9A 2FGZA 2XM1A 1CXLA 1EA9C 2VRKA 3UG3A 4PMVA 4AYSA 1ESWA 4AZ6A 2AAAA 4B15A 3CBWA 1XHGA 2Y8VA 3VIPA 2Q8XA 2VX4A 2Y2WA 5A94A 3IANA 1QOXA 1HJWA 2WLYA 1HKIA 3WFZA 5LA1A 4LYPA 4CCCA 1BF2A 1E4NA 2FDMA 1LL7A 2A3EA 4Z2JA 1CIUA 4V2XA 4C7FA 2F2HA 1GQIA 4HOXA 5I79A 1OCQA 1PAMA 3SUWA 1WO2A 5EFFA 3TTSA 2J8FA 4UCFA 3ARYA 4AC1X 2W66A 2J7EA 4W5UA 2WHMA 2WZIA 1OGBA 5CGTA 3N12A 1GVIA 4ACYA 1KQZA 2G4FA 4E2OA 1FFQA 2NSXA 4TTGA 1J18A 3N11A 1HNYA 4W8BA 4ACZB 3GXDA 2EEXA 2XM2A 2OYKA 2QPUA 3EMQA 5JIWA 2WMHA 3W6LA 3DHUA 1QPKA 4J3XA 1NWTA 3SCNA 4PTMA 7TAAA 4U3AA 5D8ZA 5BCAA 2CITA 2WWCA 2Z1SA 5IDIA 3PHAA 2ZUNA 2EBNA 4UFIA 1B30A 2YA0A 3W38A 5A6AA 1XH2A 3AIRA 1VJSA 1D3CA 4AZBA 1MXDA 1PBGA 5EMYA 3OLEA 2ZIDA 4AWEA 4M82A 2VCAA 4IISA 3WNPA 4U2ZA 5CLWA 4J3SA 2PBGA 2CBUA 4R5EA 3L4UA 5GNZA 1C3FA 1JF5A 5FL1A 4P7OA 5A2CA 3ZR6A 4D72A 5A6BD 4R27A 1BYAA 4URIA 1UZ1A 3SUUA 1HP5A 1JXKA 2XFYA 2GJPA 4ZFMA 3WDHA 4H7VA 2GK1A 2AMGA 1Q6DA 1V0NA 3QR3A 4XV0A 1J0ZA 2J7CA 2ZX8A 4JIEA 1CTNA 3WEMA 3GH5A 1EHAA 3BH4A 3RPMA 1QNOA 2OWCA 2W67A 2YDQA 3WFLA 5A6BA 3CUIA 5BYWA 1GOQA 3MUIA 4J27A 4P8VA 3NDZA 1QHPA 1HJSA 1EIBA 3KWXA 5A8OA 5EBAA 2WMKA 3GTNA 2E3ZA 1MW0A 4QLJA 1E40A 4TX8A 4PMYA 1QNRA 1UWUA 5CPQA 2CERA 1V08A 4QCFA 2J25A 4LPCA 3W25A 5A1AA 2UWFA 1MW1A 1W2VA 1UR2A 3AYSA 4UFMA 4CVWA 1AQ0A 3OLIA 1K9TA 3SCWA 1E6ZA 4UZSA 1EXPA 1GJUA 2XVGA 4J7RA 3ZQ9A 4YN5A 1GOMA 4D1IA 2WCSA 4CU8A 5A95A 2ZX7A 3PZMA 3ZMRA 2WYSA 4XZBA 4AIOA 1UD6A 3AROA 2EO7A 2VURA 2Y4SA 3VM7A 3SURA 3VD9A 4FLRA 3WD3A 2CESA 4NRSA 3VO0A 4WK9A 2WKGA 2F61A 4MB4A 4WKFA 1GQJA 4PUDA 4BA0A 1ZJBA 1B3VA 3WKZA 5IXEA 3T2QA 1SMDA 5CJ5A 2QHAA 2VZVA 2W91A 4H8HA 4KGLA 1OD8A 3KE0A 5I6SA 4Z2KA 1Q6GA 2ZUVA 4PMDA 1WAWA 3GNOA 3WD1A 5FKYA 5BRQA 1QI5A 4N0RA 3O2LA 1OGSA 2WC4A 3WQ8A 5A3HA 4WKHA 2BHYA 2X2YA 2EPMX 2D22A 1GW1A 2WVSA 4JL1A 1H41A 3AIEA 1CGUA 4D1JA 1M04A 1KXQA 4TX6A 4FMVA 4TXEA 3J7HA 2X1IA 1JXJA 4PRWA 1R8LA 1R7OA 4M29A 4ATWA 3DYPA 2BFGA 3AHXA 3WNOA 4D71A 1CGWA 5HXMA 1CZ1A 2D0HA 3ZT6A 2GDUA 1XH1A 4AD4A 1VJZA 1GZJA 1HX0A 3WDRA 4AXNA 1CGXA 1QVBA 1TA3B 4CCDA 3NIYA 3CH9A 1HL9A 1G01A 1BVNP 2VX6A 5EB8A 1W9PA 4W7VA 5GPRA 4D6IA 1OBAA 1JI2A 4CCEA 1B3YA 4GI6A 1GOWA 1SYTA 2DT1A 4HU8A 4QFUA 4MTVA 1MQRA 1W9XA 3FN9A 3ZJ6A 3O9NA 2CBIA 5HBFA 1Y7VA 3VINA 4BCEA 4D6JA 4DWSC 3A4XA 4DUVA 3MO4A 5AC4A 3WF2A 1DWJM 3KL3A 1M03A 5AYIA 4LXFA 4E8CA 2CPUA 5C8BB 3CMJA 3CLWA 1B3XA 1UYQA 3M6DA 1QW9A 2E40A 4PEEA 3ZSSA 1BGGA 5CSYA 3ZJ8A 2JF7A 3NSXA 4TTUA 4GO9A 4OBSA 1GHRA 3BCFA 3SCQA 1EQPA 1VAHA 2QPSA 2CXGA 1UKOA 2EPNA 3F5KA 1V03A 3B9AA 4MADA 3B9DA 4MNMA 1VEMA 4EE9A 1FHDA 1HP4A 1JDAA 3AISA 4JFSA 1EH9A 3CMGA 2VVSA 1BQCA 3VMPA 2DSKA 4CD4A 3U5UA 2WSPA 4UQ9A 4H41A 1IZKA 1ITCA 1BGAA 1JF6A 1W1TA 1UHVA 3QHNA 5CLTA 1DP0A 5AC5A 4W5ZA 3NYDA 3AJ7A 2WHLA 1V3MA 1HJQA 1R7AA 3WQVA 2F8QA 4WSKA 1BSIA 1JZ5A 2CIPA 3VVGA 1HL8A 1TFVA 2RGMA 2FGLA 1CNVA 1TVNA 2XVNA 4Q7NA 2D23A 5A6JA 3BAIA 3WQ4A 3MV11 1BYCA 2XFFA 1MW2A 1RD6A 1JYWA 5JBEA 1OB0A 1XCXA 3SCSA 3RIKA 3GXIA 3MMDA 2D0GA 2XIBA 3W53A 2IXVA 1LG1A 4CKQA 1G9HA 3A6OA 4HU0A 1ODUA 2WC3A 1WPCA 4YHGA 5DF0A 3S6TA 3BLPX 3CZ8A 4GXPA 2PWGA 3VOCA 4X0VA 3WNMA 2WMJA 4MNKA 2YDRA 2W61A 1E3ZA 2DPEA 3VNZA 2WXDM 3LPOA 4OBRA 2G41A 2WPGA 1KXTA 4P7LA 3WEOA 3AZTA 1KGXA 1V6WA 4U31A 4NZCA 3VUPA 4QAWA 2D20A 4W85A 3W82A 4W84A 2AOSA 1GOOA 1KR0A 1UD4A 3CUGA 3L4XA 5FIPA 2W62A 2HISA 2V5CA 1TR1A 2YL6A 4ML4A 3VM5A 3CO4A 2Y24A 3SUTA 1CXFA 3ARSA 2VQUA 4JKKA 1H0IA 3VD7A 5I24A 2CYGA 4IUGA 1ZBKA 3ARTA 1PIFA 2WBGA 3G6MA 2J47A 4P7NA 1UWRA 2DEPA 1MXGA 4S3KA 3EYPA 4QLLA 5C71A 4PTVA 1AQMA 1CWYA 3VDCA 1E6SM 4HOWA 1JZ3A 4RL3A 4GIAA 4P8XA 1E73M 1VFFA 1E6PA 4J3TA 3CZKA 1W2PA 4LYQA 1ISWA 3RM8A 1TG7A 7CGTA 4M1RA 1UKQA 2DQXA 2YL8A 2J74A 1C90A 2VR4A 2WKLA 2DDXA 4PBGA 3SUVA 1W3JA 2BVTA 1HJUA 3MUZ1 3RM4A 1OT2A 3L2LA 3L4TA 1WDSA 3WQ5A 3ZSTA 2ZWZA 3KZSA 4H8UA 3CGTA 2VRJA 4C7DA 1GPFA 1KXVA 4UFLA 1QNQA 1V0KA 2J4GA 4GI8A 4Z2IA 4Y7EA 3SUSA 3UEQA 4AIUA 2V3DA 3ALFA 1NP0A 3T09A 3K4AA 4OIFA 3PN8A 3WQ6A 4E8DA 1V3IA 1HXJA 5IFTA 3SCVA 4UR9A 1C8YA 1BVZA 2BVDA 2J7HA 4PN2A 1C92A 2YA2A 1CLVA 4MDPA 4EKJA 2WMIA 2XGBA 3AS1A 3PZOA 3WUFA 1V3LA 1YHTA 5A6MA 3AICA 3N17A 2J7GA 4CVUA 2YIHA 4GQRA 3PZUA 1MWOA 2J7FA 1E43A 2V5DA 3NDYA 3N04A 3IJ9A 3WF3A 2BVYA 4C7GA 3AIBA 4PMUA 4U5IA 1HKMA 3GH4A 5A2BA 5D4YA 1CXKA 1CGVA 1BG9A 4QLKA 1LF1A 5I0DA 2UY2A 5JH8A 1DHKA 2GUYA 3B9EA 3ARWA 4TUFA 3WD2A 2EXOA 2QLYA 3I3BA 4B3KA 4AW7A 3DC0A 1SR0A 3WNLA 1SMAA 1MW3A 1H11A 4JFVA 2OSXA 1QI4A 3CHEA
chains in the Genus database with same CATH superfamily
1UH2A 3HPZA 4MWAE 4PMZA 1EC9A 1QW8A 3W1LA 3HG2A 4ROPA 2VDHA 3ZZ1A 1UOKA 3QHMA 4WLCA 3M0IA 2GVYA 3P14A 4QS5A 5HOSA 2FPVA 3EOEA 3U7BA 4H04A 5XIAA 1U83A 5E93A 1N1AA 2QJIA 1XDLA 4IGSA 2J7BA 4G8TA 3Q45A 1Q6HA 3IKGA 3DKLA 4UXDA 4CD5A 1E1FA 5TAOA 4DH0A 2FVMA 4S3EA 3H2OA 1BXNA 2OFNA 1UWSA 5HUPA 1KBIA 3P84A 2PUZA 4UQBA 3KOXA 4L61A 2ZOXA 1MEIA 1WDRA 3LI0A 2GVEA 4QNWA 3NQCA 2WCGA 4QQ3A 2FVLA 4JIQA 2GSJA 5A6KA 4GY0A 3ID7A 2OX1A 4UTMA 1XYAA 3S47A 3O5PA 5DMLA 3PNZA 3TZFA 1G7UA 1UKPA 1UUQA 2E0PA 2P5NA 7PTDA 1ZNNA 3STFA 1I2NA 1XLJA 4L9YA 3QKZA 5C9RA 1XSJA 3SRFA 2J77A 5AC7A 1X7FA 3B8VA 1V77A 1ML1A 4WGXA 3CWNA 3SECA 5HMFA 2G5WA 1W3KA 1JUKA 1O5QA 1NVMA 4OZOA 5D8WA 3D47A 2DG4A 3GBDA 4IUOA 3BPWA 1HL2A 2PLKA 4J3VA 5K9DA 2BHZA 3B4UA 2OEMA 2ZTJA 1US3A 2FLIA 3FKRA 4O8RA 1XQLA 1ZBVA 3DENA 4ORIA 5DANA 4JYSA 4K8EA 2QGYA 4AYGA 9CGTA 2PP1A 4U86A 1BKHA 4PB5A 5E0CA 4ZL1A 2PDWA 4QT3A 4MAZA 2C0HA 4C6FA 3WDPP 1TCMA 1VD6A 4X2RA 3VMOA 4YS1A 5FJTA 2PLJA 3KBSA 1H62A 2BX7A 2VOMA 5HNNA 1PIGA 4H6QA 4WQ6A 5AY7A 3L12A 1ODZA 3AU2A 3GM8A 3E96A 2MLXA 2NUWA 3AUOA 4JQ2A 1VRXA 4JTAA 5C9ZA 2VEKA 3NO5A 4OKDA 4JTSA 5LXXA 1ZBCA 4JFTA 4JTCA 4QRNA 2Q8ZA 2WHKA 4HPJA 3OZPA 8XIMA 3MU7A 4DAFA 4ZSTA 3KRBA 2E8ZA 4DO4A 3GIYA 1ZQ5A 4FIQA 5KEZA 1IYXA 4L6HA 1KM5A 4N6FA 3NQMA 3EXTA 4WDXA 3TA6A 3MTWA 1VFOA 4U85A 4QT2A 1OCBA 1FWHC 1QXLA 3EOUA 2ATSA 3AIVA 1FAPA 4Q4SA 2J88A 1YTDA 2JALA 1NOUA 5DT7A 3FXYA 3TW7A 4UTKA 2OPJA 2Y63A 2INFA 1U30A 3NZGA 1A3XA 2HDJA 4LFYA 2G50A 3IIVA 2ZQSA 1UQZA 2W0UA 5A6SA 3OB8A 1O95A 4MKNA 5ABFB 1PTGA 1BEUA 4QAIA 2GLKA 1SFTA 2ESCA 3L0KA 3FKKA 1T7LA 3NVTA 5E0FA 1OG0A 3T6CA 4UQAA 3W70A 3ENLA 3UESA 3PTQA 1J9YA 3N4EA 3V0SA 3MHFA 1DOSA 1XSKA 4QE5A 5HQLA 5I77A 1QBAA 4O11A 5KINA 1FFRA 5AC8A 2G3JA 1SZEA 3QF0A 4O18A 4JY9A 1KV5A 2GVLA 5J8LA 4GZ7A 1WXYA 4P8UA 1KWGA 4ZOCA 2OVLA 4WOZA 2OB3A 3B0YA 3CPUA 4KMQA 4J5NA 5JBFA 2QKFA 4XD3A 1DJNA 5K4XA 3N13A 1YNYA 1OFOA 2NLIA 5A8QA 3GXTA 1VFHA 4H6RA 4B9ZA 1UUMA 1P0BA 1OABA 1VR6A 1FKFA 2JZVA 1QI2A 3ATZA 3I10A 4GPNA 5I02A 1S46A 2HRWA 4WF7A 3TR9A 2BY2A 7TIMA 3ZR5A 1NDZA 2V3EA 1JNDA 3DU0A 3ES8A 3W7CA 4CNUA 1FDZA 5F2GA 4ATLA 3NCOA 1TMQA 4GVHA 4M24A 3NL3A 4S3BA 4FNPA 4GKTA 3CV6A 1LRTA 5KETA 1X39A 2Z7KA 3LHVA 5HNUA 3ZWSA 5A8NA 3CK5A 2J6VA 1DJGA 1PTAA 1A47A 4IQ2A 1YDNA 2J66A 5F2LA 2XP7A 5H8MA 3S5ZA 5JBDA 4XKYB 2PWFA 1A5UA 4DIPA 4DXXA 3W1QA 1B3WA 3KZ7A 1W3LA 1C8QA 1E5JA 3PAJA 5G4HC 1EQCA 3IK2A 3E12A 3VOJA 3N2CA 4ODQA 1VLWA 2FH6A 1J93A 3ONBA 3HQOA 1A50A 3UT0A 2WQPA 3RLHA 4V27A 2WW5A 1JCYA 4JEQA 4LRSA 3A47A 4TVDA 3MWAA 3TVAA 1Q2RA 1TCOC 5AHNA 4IXHA 3DEQA 4LB3A 1F9CA 2PF8A 5LXEA 4HZMA 1XYLA 1LROA 5HR7A 3LMZA 3GNRA 4AUBA 4JX4A 4Y9NA 2CBJA 3TYCA 3STGA 3KVJA 1EYMA 4B16A 4AISA 3WSUA 3HQPA 5FL0A 3VAWA 3STEA 1XW8A 2OGJA 4RUBA 3ABRA 2J78A 1GEHA 1GWJA 1XISA 3DG7A 1YADA 4NNCA 3GDTA 4L4MA 4UTUA 4GLEA 3GVGA 3JW7A 1RLCL 3KS6A 3EPMA 4WY0B 3GXFA 4QG8A 1ITQA 2WWDA 4BZYA 1H51A 3VZXA 3VKAA 3RO6A 2GQ8A 2GWGA 4GI9A 1ISXA 1LRQA 5I09A 2MLZA 3CHCA 1R2RA 3U8GA 3WQDA 3RUBL 5H8PA 2EAWA 3FEQA 3GVRA 4C6DA 3H7RA 3FK4A 4KGJA 4BFAA 5I7GA 1VBUA 1L8PA 1UG6A 3ALGA 3QC3A 3GU9A 3GSMA 2PC8A 5EYWA 5M2FX 3O5GA 2ICSA 2X05A 4IIFA 3VD5A 4F0LA 5FACA 1LBLA 2YX0A 3EWUA 3WD0A 4OFCA 1XG4A 5DX7A 4NYUA 2NXIA 1D2KA 1YNQA 3DHFA 5LGXA 3S2MA 1D3HA 5FEWA 1J4EA 4GKLA 2BXZA 4PMNA 1D7IA 1VCGA 4O14A 3PVFA 2EG6A 1TV4A 1PKYA 1EPXA 2OFJA 1EB3A 4LOCA 4QCEA 1XLBA 5AHIA 6TAAA 3D3AA 4UTTC 2QZRA 1TTJA 4I7WA 3H53A 4O8AA 1XLKA 2W6RA 3POCA 2WB5A 5HPCA 4G7EA 5DIVA 3PS7A 1XRVA 2ZXDA 3N2XA 3OA5A 1HUVA 2G3MA 1KFJA 3W7EA 5ABHA 4C60A 4IFRA 1B9ZA 3GTYX 3GHUA 5LYRA 2J8GA 4L64A 1OCJA 3MVTA 2HMCA 1PS9A 5IFPA 3N29A 1GW9A 1RP8A 3KABA 1M5WA 2V9DA 3MT1A 2PC4A 3EXRA 1PJ9A 3OQEA 2O9PA 3UI5A 4GGHA 2WHJA 2ZFAA 5JXQA 3IRDA 3KAFA 4UTHA 4QIBA 4GQQA 5EMKA 4YJ5A 1PX3A 2VFHA 1CXEA 4J4KA 1T8QA 3L4YA 3S6OA 4CN6A 2E67A 3K46A 1K7XA 1A0CA 2ZUTA 1LWIA 1OSEA 4IFKB 1L6WA 5FI8A 4KQNA 3W7LA 4JKLA 4E4UA 2RURA 1KBBA 2XP4A 4G6CA 1GVOA 2GJLA 2WSRA 4EP8C 4GFSA 3G0SA 5A8MA 2HXUA 1A5AA 3EX1A 4W9PA 3AHYA 3R12A 1ENUA 5GJMA 4A2SA 4A35A 1ONXA 2FHCA 1TSIA 4QHRA 3TA9A 3VIFA 1DJXA 4UTJA 2BY0A 1C29A 2V2DA 4N2YA 3AHVA 2WJEA 3BV7A 1LZOA 1TWZA 2Z2AA 1Q7ZA 5FF0A 3O0FA 2XGIA 3W1XA 4X0NA 1PL9A 2CZ5A 4LANA 3LZ5A 4EPEC 1WOBA 1XIHA 2BDQA 3WMCA 4HKPA 1X7IA 4Y9AA 1BWLA 3BV4A 1W31A 4N7QA 3BLOA 4HIBA 3OYXA 4DJDD 5I3KA 7REQB 2WSQA 3O5IA 5ABGA 3V1PA 3QFEA 3A64A 1HJVA 4LGXA 5AYXA 1B0IA 3FCPA 1WX0A 2X2GA 2NQZA 1V6UA 3NJ3A 1S5MA 3OBEA 1KNWA 1XYFA 2POTA 4DJDA 1G0CA 3LCFA 1JDEA 1FWEC 5AFDA 3FDGA 3SRKA 4FX7A 1PKLA 1KRBC 3LGGA 1VFUA 3TW9A 3KACA 1GTHA 2VWTA 2J62A 3A4WA 3O5KA 3VNKA 4L4LA 1M1BA 1VCFA 1WXJA 2AQWA 2HQAA 3W0KA 3G18A 1X98A 2HK1A 2PV3A 1TV2A 1AG1O 4JN6A 3S3GA 2VGGA 3W83A 4UIOA 2CCRA 3FEMA 2PRMA 3CV2A 1ITXA 4RE2A 3MDUA 4HTYA 1ZJIA 2AKMA 2AQVA 1P43A 1WKEA 4GXMA 1DWGM 3W1MA 3MANA 3BOXA 4PFHA 4B92A 4P7QA 1PPIA 3Q37A 1PX4A 3F5LA 1KLYA 4Q4RA 3A22A 3LPPA 4TVCA 3QR0A 4WY0F 3KVLA 4J9JA 5C2GA 2P3ZA 3TZNA 2DZXA 3WLNA 4H9TA 5D32A 2RGLA 1KT1A 1QT1A 4XAYA 3MY9A 3JS3A 4GC4A 1JL8A 3UERA 2NT1A 1UP3A 3HPAA 4DXVA 4X3ZA 1KLZA 3CHVA 3P60A 5JMUA 1SFSA 3UWZA 3LQLA 1BVWA 5HW6A 2FTPA 3VX1A 2VR2A 3M4HA 3EA1A 5H2ZA 4WKAA 3MSRA 4AX7A 3DYMA 3MJMA 5EFDA 3UWVA 2DT3A 4N9CA 5PTDA 4PCTA 2WZHA 2ODOA 3DAQA 1IWPA 3CB8A 4DZHA 4GZJA 1KB3A 3VNYA 3PB0A 1ME7A 4CGTA 2A5HA 2B7QA 5ABFA 5M5DA 1DYSA 3GYCA 3BTNA 5KZMA 4U33A 3THUA 3LI1A 2C7FA 1GYMA 3EXSA 3C5QA 1JCTA 1VFSA 3REQB 1XM3A 1UKSA 3IS4A 5FF2A 2EF9A 2Y6ZA 1E0XA 2BODX 1IT8A 2P0OA 1MEHA 3MWCA 1UWAA 2WNZA 1KTCA 2VOTA 4PUJA 5HPOA 1KC7A 3U2ZA 2DZPA 4WOQA 5FJOA 3ARUA 3H7VA 1GQLA 3E6EA 3W81A 1DWIM 3PZ9A 1AQHA 1Q6RA 2NX1A 3M0JA 1F73A 1JAKA 2Z0IA 2GUBA 3LNMA 4BQ3A 1XG3A 1VQTA 1HKWA 5CSSA 1M7XA 1WUEA 2CLEA 3W84A 3LU2A 2G96A 1LT7A 4XZLX 1RK5A 1D6OA 1KTBA 5HDRA 5IBXC 1JYVA 3S4TA 2XGZA 4GINA 2DQWA 3KVMA 2XPKA 1GVSA 2CLKA 3M47A 3GG7A 1QJWA 2REQB 1RCXB 1Q1CA 1A49A 1DVJA 1UR1A 1FKBA 1Q6UA 1OJXA 2BP1A 2QUTA 1K70A 3FHAA 4O13A 3BMVA 4RDVA 4HA4A 2F4EA 2G3IA 3BJFA 3CIXA 3LCHA 1AQFA 4RW3A 1RCQA 1V3KA 1BHGA 1OC5A 3M64A 2GJXA 3A4AA 1DWFM 1OT1A 2Q71A 3WF0A 1EEPA 1PHWA 4XSMA 5D2TA 1V93A 4UTWC 2DVTA 4JFKA 4IPNB 2V81A 4HA3A 4FNQA 4TMBA 2FKEA 4LVFA 4XSLA 3QBUA 4LU0A 4JFWA 3AZSA 2VDIA 1R3QA 3QFWA 1B31A 1RVGA 4QXIA 5LGZA 4PODA 1Z69A 1L6FA 1AJ2A 2E6AA 2KZHA 4BI5A 1KFWA 1KGWA 1HW6A 1XD0A 3H4WA 3V16A 1V7YA 1UR9A 4W8AA 1WZMA 1ISVA 2HCVA 2Y8KA 4A21A 3FJ6A 1UZ4A 3TKFA 1R0MA 3GG8A 2FMNA 1JD9A 3QKEA 1Q2SA 5FJRA 2VCBA 2XSBA 2ZC8A 2Z1XA 3OG2A 4EPKA 5FJIA 3VDHA 5CH9A 4N9EA 4S3CA 1LTDA 1H2JA 2XP8A 2Y7FA 5H6HA 3GNPA 3PG9A 2G4JA 2HNEA 4RLIA 3URQA 3A12A 1Z32X 4W7UA 3AWOA 3KDNA 5EMJA 3M0KA 4IPIA 3JRKA 1WZKA 3QOMA 3MP5A 4XB3A 4CNNA 4DYEA 2OEJA 2YJQA 3IGUA 3BMWA 3TDFA 4RXFA 2FTWA 4B5UA 3KP0A 2VC6A 1O1HA 1ZUAX 4IZGA 2HVOA 1J79A 2VCDA 2YBTA 4JZ5A 4F4RA 4IIDA 4H8VA 2X7VA 2V2HA 1EX1A 1X1ZA 3NQGA 3FAPA 2FYMA 3PBGA 1L2UA 1J0YA 2G8ZA 2NX9A 3NL5A 2PDXA 4HTBA 1F8IA 2VP8A 3ARZA 2PD9A 3RNDA 3OLDA 4GYJA 5CJNA 2VD8A 3VGEA 1XGDA 3AI0A 4RZBA 2ISVA 2HNHA 4FS9A 2V3FA 3SR7A 2WK2A 2VZSA 1TPVA 1X6NA 4JTUA 2DIJA 1TR9A 2P53A 1ONWA 3TP4A 4JHOA 2WCAA 4XD5A 3KX6A 5REQB 5DCDA 1HJXA 1EDGA 2OZTA 4JTLA 3H12A 3FJLA 3N9KA 3ITTA 5I3HA 2JGQA 2IPWA 3SZ8A 2BVWA 3BGAA 3W7KA 2TODA 5EU9A 1E0VA 1KM1A 3CEPA 2A79A 2D2GA 4UTFA 2BZNA 3T08A 3ANYA 3QOKA 3BZJA 4F2UA 3UETA 2XM1A 4NXKA 3KTCA 2VRKA 1ZFJA 1SW7A 2FFCA 3F03K 4B15A 6TIMA 2Y8VA 3BANA 4YTSA 1W26A 4KCTA 2Y2WA 3H54A 5A94A 1B4KA 3MBDA 3PC0A 2C18A 3WFZA 1XRFA 3ZVIA 4CCCA 1I45A 1BF2A 4ZODA 2FDMA 2A3EA 1T99A 3RLUA 4V2XA 5LNRA 3ODKA 4BR1A 2E6FA 1WO2A 1NELA 1PSCA 4UCFA 5AVHA 3W88A 1YATA 4W5UA 5CGTA 1OGBA 3N12A 1GVIA 4ACYA 3GVWA 3IV8A 2G4FA 3CAVA 3DX5A 2DG9A 2R1KA 3PBMA 2QDEA 1YPXA 3EA2A 3N11A 4Q6JA 4ACZB 3GW0A 4GQBA 3TCEA 3TCSA 2OYKA 2V5JA 1AL8A 3G1FA 1XKJA 1T8XA 4GMEA 3CWOX 1NWTA 3N4FA 7TAAA 3VKBA 3N2BA 4RZ4A 5IDIA 2EBNA 3NFUA 2HROA 1OCNA 3B40A 4FOKA 3W38A 5A6AA 4KCUA 2YCLB 4JNMA 1T40A 5C6MA 2FIQA 3OLEA 2ZIDA 4AWEA 4EF9A 1PVNA 4XD6A 1QU4A 3KW3A 1TPFA 2PBGA 2CBUA 3W07A 3P7YA 5FJUA 3E2VA 1TPB1 5GNZA 5B8IC 5HW8A 3QW3A 3QPEA 5FL1A 1FKSA 2AL2B 4D72A 5A6BD 4R27A 4URIA 1PUDA 1UZ1A 1JXKA 3PUOA 2PV1A 2GJPA 4Z1AA 1SM9A 4KESA 3PPGA 2PDUA 4HK5A 3UA4A 1Q6DA 1V0NA 4XV0A 1LLZA 3DGBA 3H22A 3WEMA 3BH4A 3PWGA 2OWCA 3W7PA 3ABQA 5LZLA 3PPFA 4NY2A 5A6BA 4GJJA 5BYWA 4P8VA 3KWXA 5A8OA 1SQ7A 5MKGB 3GTNA 3QV9A 4KWOA 1RSCA 4FI4A 4PMYA 3KRUA 4YVXA 2GVGA 2HS8A 2TYSA 4LPCA 3W25A 1MW1A 1W2VA 3CQ0A 4UNKA 1OYAA 3A5VA 1B54A 1O5KA 2J13A 4S1FA 3S1GA 2ZE3A 4IFOA 4QE4A 1DL3A 4FB7A 3TUUA 1E6ZA 3ZQ9A 2H3BA 1S3HA 3CGMA 2DZUA 5J04A 4ROQA 3MB9A 1EF2A 3F4DA 3PZMA 1CI1A 4IP5A 3E2QA 4XZBA 4ML9A 2P1FA 4DEFA 3E38A 3GC2A 3APTA 1OF6A 1TPDA 3OHMB 3SURA 3MI6A 3B7XA 3S0CA 3G22A 3E74A 2DZWA 1HGYA 5C54A 3HG3A 3G3DA 4M6VA 1EFZA 3DN5A 3V3WA 2VENA 2VZVA 3DIPA 4MUPA 3TH6A 5I6SA 3O5JA 3GNOA 4UDMA 4LAYA 5GPGA 3V18A 2PGFA 3URAA 5A3HA 1JRCA 1M6JA 1TZZA 3KP1A 2ITKA 2AMXA 3UYCA 1YDYA 3GHRA 3W9ZA 4FMVA 3J7HA 5LNWA 4PGLA 1WBHA 3AC0A 3RCYA 2PD5A 4M19A 4JQ1A 2IPGA 3TOYA 3PRAA 2KAUC 3M0HA 1CGWA 1CZ1A 1E1CB 2AAMA 3TSDA 2GDUA 3G24A 4AD4A 1VJZA 1HX0A 1Z7AA 4OGZA 3LRKA 4CCDA 4YYFA 4IJRA 3CH9A 2OT0A 3TR2A 3VABA 1ADSA 1VH7A 4HNLA 1G01A 5I98A 4I5XA 4X2PA 1BVNP 4F0KA 4S2BA 3NQ8A 4OTKA 1TPUA 1V6TA 3SDOA 1P0KA 4GI6A 1GOWA 4NUWA 2DT1A 4HU8A 1YLVA 1IEXA 4I9MA 4YVPA 1GQNA 1F3WA 1B5TA 3REQA 4XVDA 5BU9A 5TNVA 1D7KA 3NO3A 1EL3A 2TMDA 3D3FA 3VNIA 2FGBA 3P93A 1FVPA 3A4XA 3MO4A 4AQLA 1XLIA 4MSPA 3FGCB 3WF2A 3KL3A 5AYIA 2CPUA 4ZR8A 1QW9A 4HVXA 4PCPA 4PEEA 4FX6M 1P0EA 4YVVA 2QQ6A 2X30A 5CSRA 1GHRA 2PEVA 3SCQA 2CXGA 4ODKA 1UKOA 3F5KA 4MADA 2J8TA 4UBPC 1F05A 1EP1A 3UWWA 4EE9A 2VDGA 5CC6A 4Q8NA 5C0QA 3CMGA 3U5UA 3P81A 2QCNA 4H41A 1IZKA 4Y9PA 1B3OA 1HZYA 1W1TA 5AC5A 1GKRA 1XLLA 1V3MA 3MC5A 4I7VA 1R7AA 4IIEA 1BSIA 1DIEA 5FAJA 1JZ5A 3P61A 1HL8A 1ALDA 1CNVA 3L66A 3PR9A 2D23A 3UZYA 4JY8A 5D2YA 4XZIA 5EMMA 1KO0A 2VEMA 3BARA 4DB7A 4JQ3A 4ZOBA 4FPSA 3TQKA 3UR5A 3W53A 4C6BA 1G7VA 3A6OA 4PB4A 4HNOA 4TV6A 1J96A 1W3TA 3LTYA 2A2IA 3BQ5A 1B6CA 4YHGA 2HWGA 3S6TA 3NXFA 4GGQA 2PWGA 3VOCA 3DFTA 2WMJA 3K4WA 4Q6XA 4JTDA 1J4IA 1E3ZA 3VNZA 4OBRA 3RGCA 2WPGA 1V6WA 3UJSA 3TEVA 1K02A 5IDZA 3R0KA 4BEUA 2J6XA 4K1WA 3VC5A 2AOSA 3KHDA 1BD0A 1UOZA 3IVUA 4AXKA 3MCNA 4DRPA 1OK4A 4YCPA 4ML4A 3CO4A 2Y24A 1BKFA 1NF0A 2VM8A 1FWDC 3ARSA 4Q4PA 3S5NA 1H0IA 3N34A 3W1TA 3SB0A 3ARTA 4YNGA 4BF5A 1LOLA 4ZO7A 5AOUA 4S3KA 1N8IA 5C71A 4UC5A 4PUWA 4XKMA 4DBSA 4YXGA 1XX1A 2WO5A 5FEPA 1CWYA 3EB2A 3KTSA 1A4LA 3S46A 4RL3A 4P8XA 4DRJA 4J3TA 3CZKA 2NXGA 4UTLA 7CGTA 3NQEA 2Z00A 1K1DA 4DT4A 4QS6A 3MW7A 1JPHA 4TNSA 3DXIA 1YPFA 3MUZ1 1OFDA 2OQLA 4O54A 1PO9A 2R6OA 2ZWZA 2PDGA 4ZQPA 2VRJA 4C7DA 1GPFA 1KXVA 1OC7A 3U48A 3OZMA 1TQJA 1QNQA 1V0KA 2J4GA 2IKGA 2F7FA 3UEQA 4KS0A 4NJKA 2NV1A 3UY8A 5HR6A 5DXXA 4E8DA 2MLYA 3NPUA 2GYIA 5FA5A 3GU2A 3XINA 1GK8A 3PNUA 4ICCX 1F40A 3EX3A 2XGBA 3W1AA 4X22A 4TU1A 3LB0A 2F6KA 5A6MA 3N17A 3QMTA 1X6UA 5REQA 4GQRA 2Y7GA 2V5DA 2Z4GA 3OVQA 3MI2A 3N04A 2BVYA 4C7GA 5A2BA 5LSMA 1CXKA 1CT5A 3N6HA 4GBDA 4KIRA 1H5YA 3B9EA 3W2KA 3ARWA 1TWDA 4NZJA 3S8HA 4HYRA 3DI1A 3UWQA 1BXBA 1SR0A 1M41A 3VKJA 1PKMA 1YNPA 1O4UA 1PE1A 1KGUA 3LCLA 2OOGA 3AQUA 3G1YA 1E0UA 4O19A 3IGSA 1XIFA 3LTPA 1DORA 1XIDA 3D5HA 5DO8A 3EGJA 4PH6A 5HQEA 3WQCA 1Y0OA 2O56A 1X6LA 4DWSD 2A6LA 1UBPC 3PF3A 2XIIA 1TWIA 2ZDSA 4L1GA 3RMJA 3UF8A 4RZ6A 1PWLA 1XBZA 4PCSA 4RXGA 4ACZA 3RAOA 1W9UA 3EOSA 1T41A 3IIPA 4N4QA 4AD2A 2P4VA 4DWSA 1CB7B 5F2MA 3A9IA 3QVQA 4H7CA 4KQZA 2QYGA 3BL3A 2OO0A 2JFEX 1I8JA 4NI3A 4KWUA 3WJXA 8XIAA 4DO7A 1D8WA 3AWNA 4IMAA 5KZEA 1QPFA 2D69A 1POKA 2OOFA 1E5NA 5DQPA 1BQGA 3ZT7A 2C16A 1NFBA 2ZRXA 4AVOA 4DF1A 5LA0A 4JYFA 1EIXA 1UW9A 3EX4A 1MYRA 2ZA2A 2KO7A 3VNJA 1KQYA 3IJ8A 4DRNA 3LYEA 2F6UA 4AEOA 1CGYA 3K1GA 1UR3M 4UUIA 3FA3A 3L2MA 1SO4A 2NQ9A 3VDAA 1SR9A 3SW6A 3CU2A 1E1EA 1FKTA 3N25A 4LJ3A 4N42A 2VTFA 4ZB2A 4LAXA 3ZFHA 4B5NA 1WAUA 3B8DA 4WHBA 5CPNA 3AOFA 3MA8A 2RSEA 1UROA 3BLLA 1QPOA 3MKVA 5HJLA 3MUY1 4O53A 2ZZ1A 1DV7A 3I6CA 3WL0A 4DELA 3W7GA 1AH0A 2CHNA 2ISSA 2PP0A 1T6MA 4FO4A 2I1OA 1A0EA 1U5HA 3WUGA 3TNBA 2JE8A 1Q6OA 4AEEA 3W27A 1S5NA 4LY4A 1SO3A 1L0PA 3UR8A 1FX6A 1KBJA 5AN7A 1NOWA 4DO5A 2QJNA 2E9BA 1DEDA 4O12A 1RQEA 1IHIA 4IGHA 1JYNA 4Q8OA 5DFAA 3PB2A 1GTEA 1J01A 2VX5A 2XH0A 3LQGA 1UQYA 5GQBA 5DIUA 2EPLX 1R3RA 3FYYA 1FKGA 3E5PA 4ZXLA 2B5UB 2ZX9A 4F48A 4OUEA 4O0ZA 3NDOA 3B0PA 3HQNA 3UYIA 4L5ZA 3WBYA 4IHCA 3CNYA 3MZ2A 4PSPA 5HWNA 4WUIA 1L8NA 1RPXA 4PMXA 2NVCA 5IHSA 1E6QM 4KBXA 3DFQA 5ABTA 1E4IA 4RV8A 4HNUA 4NQ1A 2E25A 5DEZA 3AYRA 3CZLA 4WVXA 3GR4A 1DJHA 3VKDA 1FTXA 2VQTA 3WJWA 1XV8A 1VFTA 2ZXBA 3L5LA 2Y88A 3P5ZA 3IJ6A 3PANA 1SW3A 1NMWA 5AKQA 4IQDA 3UZJA 3UGRA 1JULA 3WJZA 4AZ5A 4FIRA 1IXOA 4JQAA 1I9CB 4C1KA 4HYVA 5C7HA 3M5ZA 3VIIA 3ANUA 4P8WA 4N9BA 1NIUA 2VFEA 2ACUA 1HKJA 1TJ1A 4CU6A 1FXPA 4LEQA 4NAFB 1Q4NX 3DDMA 1IX5A 3ZO9A 5CPLA 5JIPA 1LP6A 2CZFA 2ZTKA 2A7NA 1V4YA 3GUWA 2XG9A 1SJAA 1XLCA 4OBTA 2NSOA 1H1NA 2Y7DA 1F61A 2BY1A 2ZX6A 3G5EA 3W73A 4GUIA 5JH2A 2X0YA 2GQAA 1VYSX 1ZAJA 3PZIA 1X1OA 4F0MA 4Z1CA 1AODA 3ES7A 1OQFA 2YKKA 2PF0A 4XAPA 2V38A 3MUAA 3QQ1A 4C91A 1M65A 2YL5A 3TK7A 3PRDA 2I57A 2YGYA 3FGCA 3VD4A 3HMCA 3UFYA 4BWLA 1TTPA 2DT2A 4TR9A 4M80A 5DITA 4JHZA 3MCOA 4CD8A 2A7RA 2OZ0A 4OUIA 1ITUA 1WCGA 2X09A 3R13A 3UXLA 1NH6A 1SO5A 4EOUA 4DBWA 1GKPA 1FUYA 3NZPA 5LIWX 3MSGA 1UMLA 1WZAA 3ZS4A 1T0OA 1TWWA 2E28A 1OVDA 1RZMA 1ZS2A 2VC5A 4GNJA 4DJDC 4A3YA 1F5ZA 2QCLA 3SQMA 4CD7A 2XWEA 3P8JA 5HMDA 1VFMA 1XFCA 3TW6A 4LAZA 2PPGA 3W6MA 2GGIA 3RJYA 5F2IA 1C8VA 4V1YA 5M17A 3L65A 4QQUA 1GZ1A 2GVJA 3SAZA 3B0VC 3ZJKA 2C1IA 4FLQA 5FESA 4B5VA 1PEZA 4IPLA 3NG3A 1H63A 1EHNA 3K8LA 2Z2UA 1XLFA 3SRDA 4FLSA 2X1TA 4W88A 4GJ1A 1FWIC 1V3HA 5EPDA 5C9WA 1VEPA 2CW6A 2AKZA 3O5LA 3M9YA 1J6OA 4CLMA 4DYKA 5BXTA 3G1DA 1E6XM 1YE4A 1J0JA 3WLHA 3CUJA 4LYRA 2EULA 3GX9A 1XINA 3NA8A 4CUCA 3BC9A 4J3UA 2VX7A 3URNA 2ZRUA 2Y5EA 5K4ZA 5BXRA 4ZPTR 5EL1A 4MYAA 1QAPA 2OGYA 1TMLA 2NVAA 3IACA 3BGGA 3F4NA 3GHSA 5D04C 5I2UA 2TPSA 4TX9A 4G50A 1AVAA 4C90A 1SGJA 5HJYA 1LG2A 1FHLA 3ELFA 4GC3A 4ILSA 2X7WA 3WLIA 4DN1A 1IEIA 1RBOB 2BASA 3VPLA 1JDDA 1MQPA 4L1XA 4O50A 2PWHA 3AHZA 1EO7A 1VEOA 4ZXOA 3K5XA 1E6NA 3ZVHB 4HBEA 4IIGA 4PL2A 1QZ2A 5C5YA 2ZZ4A 4K8GA 3WQEA 1QRQA 3TCZA 4NVTA 1SZGA 3O6AA 2EPOA 4MZ1A 4OJYA 2PODA 3MV01 3QM3A 1VRDA 2IXUA 1DIDA 1OIFA 3GQYA 4UQCA 2P0IA 2Q8LA 5HINA 3PTDA 4AHQA 1EDTA 2DG3A 1NMVA 2PPPA 1MDRA 1EBHA 1CXHA 3VCNA 3UZXA 9XIAA 2NWRA 4J3WA 4H3DA 1V7AA 3PA7A 4AZCB 3QMRA 4IQLA 1UH4A 2Z1KA 4K2SA 5DN1A 4NZ3A 2V5BA 2W63A 2O9OA 1US2A 3GH7A 2VVNA 4Q32A 1NQ6A 5HUOA 3H23A 3WBWA 3L4VA 1PWMA 3V0TA 1VIWA 4Z2GA 3TMQA 1ZJAA 4G2DA 1H7PA 4JDBA 2V8ZA 1BPLB 3NPVA 3BDKA 4EPDC 1F6KA 4ZEPA 2PU0A 3UBPC 2RJHA 2Y5JA 1HGWA 1W3NA 4IPJA 4TO8A 3PTMA 4E3VA 2UZ9A 4J2PA 1EKOA 3OGVA 4IIHA 5CQ1A 4B5SA 3AXHA 3ITVA 4KH2A 1KM4A 5E09A 4QSHA 2WPBA 5CPTA 4ICNA 3UQIA 1GUVA 1J10A 3UZWA 4YTQA 1KRMA 1XIBA 3NEHA 4K68A 3QZ6A 1FHUA 4JTGA 2IUZA 4QEEA 4S3DA 3VD3A 2RFGA 2YFNA 2UZ5A 4R34A 5DY3A 3NM3A 3BLDA 2DGAA 4HB7A 5U7SA 8CGTA 2NX3A 4QG6A 2SFPA 1FCQA 5DT5A 1JQVA 1Y0EA 1UH3A 5CZ0A 4BI6A 2XN2A 3ZIZA 3VTRA 1TRDA 2XN0A 2XH4A 2PDKA 4IT1A 3RILA 2XP5A 4HD5A 5C2CA 5F7UA 4GUGA 4IM4A 3GFYA 4DXKA 2UV8G 4DM2A 1PHQA 2ZCGA 1DKWA 4GXWA 2A3CA 4AWTA 4D6EA 4ONVA 4US5D 3T55A 3VZYA 2JKAA 2WNWA 4W9OA 1KKOA 2C3ZA 3KFTA 1DXEA 3WBAA 3SIMA 3B8TA 1V6VA 3MUCA 5JUVA 3HN3A 2VMFA 1FCVA 1AFSA 2ON3A 3CQJA 2EJ1A 4DRKA 3MSDA 3B0UX 3W76A 1ZL1A 1TJ2A 4US5A 1VZWA 2DT0A 3H6OA 3TFCA 1XBXA 1FKHA 4W4QA 1R9ZA 1DJYA 4NG3A 4ITZA 3IEBA 4PYSA 4A2RA 2XIMA 2G95A 3LGEA 3B0XA 4A3HA 3CUFA 4RCXA 2WMGA 4B5WA 4HNCA 1XGEA 2PGEA 2ZUSA 1UIOA 3M41A 4Y6GA 4C1LA 4XZMX 4HCHA 4Q8QA 3BMBA 4PTWA 4RK8A 2INZA 4L3NA 4MG4A 4A3QA 4O1CA 3LLDA 1B9BA 1G69A 3W3OA 2GGGA 2FHFA 3ZJ7A 4U5KA 3XIMA 2MUCA 1T96A 4MB5A 2FZMA 1H7NA 4BQ5A 5SWUA 2DZBA 4QJ3B 5F4XA 3BCDA 3TAKA 3AS3A 1E51A 1KBKA 3UXAA 1EOKA 3PJUA 4HNTA 4IWWA 2FH8A 1KW1A 1ZBWA 1XC6A 1JGIA 5F4SA 4HZ8A 1VYRA 4WSHA 2VJXA 2ZC1A 4JEJA 4KWVA 3F2CA 3ATYA 3NTYA 3NSNA 1EOMA 3A3WA 1VPYA 1ZJHA 3WNNA 1QW7A 1E44A 4GO8A 2WNNA 3MBFA 4UMBA 3VXGA 8RUCA 3VCRA 1HO4A 3EWXA 3NSMA 4OV4A 2VO5A 2G0WA 2ZWYA 4UWMA 4X60A 2PGRA 1AH4A 2W3ZA 1BF6A 2WVVB 1MRAA 1VBRA 1W32A 3UZZA 3NM1A 4F79A 2WJZA 4KRUA 1SU5A 4QG9A 4S3FA 3CTTA 3EY6A 1QI0A 2R8WA 4LX4A 4HQVA 3SQSA 3THCA 1AL7A 1DJQA 1EJUC 3T40A 3PZTA 3R2GA 3NQVA 2PURA 4Z42C 8TIMA 2YCJA 1U33A 4IL0A 4J4NA 3AALA 3Q94A 3EDJA 4DZIA 2QAFA 1O68A 1W56A 4MM1A 1UR0A 1M53A 4K36A 3CGNA 4PCFA 1VBJA 4G1NA 1P0DA 1C91A 3CIVA 1VLIA 4LUTB 3ITLA 3EAUA 3XISA 1F3EA 2XSAA 2JEPA 3F4VA 1BSLA 2BGNE 1BXCA 2VC9A 3PZVA 1OADA 3TLQA 3QGVA 3WMBA 1GGOA 1UZHA 1TPC1 4JFJA 4PMOA 3FDKA 1UJQA 4ZQRA 3PULA 3WH5A 4ECLA 1U2YA 1ISZA 3R8GA 3CQIA 1LT8A 1IQ8A 3CL7A 3C8FA 4HN4A 3WUBA 1ZLPA 3VGDA 4HPHA 2MANA 3IAQA 3ZXWA 5AB3A 3N73A 4EWND 3H2CA 4S3GA 4PSRA 4Y9OA 3R7MA 3FXGA 4JNZA 4W87A 1JRBA 1Q5MA 4RDWA 1UB3A 3KCLA 1LRNA 5CC7A 4ZTYA 2RDWA 1XQKA 3EDEA 2MPHA 1P6CA 1YYAA 1G4PA 2PDMA 4PTDA 4YCOA 1TIWA 4WDUA 3LEPA 4KRTA 4LB4A 4JCMA 4LVBA 4NZ5A 5FJJA 1B1YA 2DSWA 5AZ0A 4EVZA 4GIRA 3LG3A 4HP5A 1FWJC 1GZGA 4O4VA 3LSBA 1PZ0A 5FEZA 1QOQA 3SGUA 2QUMA 1P5QA 1DQUA 5H91A 3T8LA 3GO2A 1KT0A 4CN4A 3I6RA 3G1AA 2FAPA 3DHPA 4HPNA 4CCZA 4PMQA 4I3GA 1Q6FA 1S5TA 2QDHA 3PTKA 1L6SA 3T9PA 4XZWA 5FSEC 5T26A 3SJNA 3N3TA 1ONRA 2QCGA 5HA7A 1ZCNA 1DBTA 1WDQA 2JEQA 1CECA 2PCQA 4L7ZA 4YPJA 1OX4B 2ACRA 4Q8MA 3BSGA 1QWKA 4PULA 4W8LA 2ZQVA 2TRSA 3C0SA 2RUCA 1JR1A 4H1ZA 2QVHA 1TYGA 4ATDA 3CHFA 3GXMA 5DXYA 2CHRA 4PZVA 2X1RA 3TONA 1ZB5A 2E4TA 4AVFA 4M8UA 3IAPA 1QATA 4NF7A 3IK8A 3BAJA 2VUYA 3UI4A 3DOPA 3G1SA 4S3AA 1TE1A 3USZA 2BXVA 2FHBA 3KL5A 4Q3MA 1E9LA 5DBTA 4AZIA 2NW0A 1FP8A 2C14A 2D3NA 1MDLA 1UKTA 4OVXA 3GBEA 5CG0A 2QULA 3FOKA 4HNNA 3VAVA 6PTDA 1PV8A 1UP2A 3UG8A 2NT0A 1KA9F 4JIPA 1AW5A 1ZU8A 3OGRA 4TW7A 3W26A 2OYLA 4YYCA 4I9JA 4MYXA 2DJLA 3OZOA 2VKZG 3LHTA 4RNHA 3TTYA 5A6LA 1MI3A 2XDFA 5A8PA 4GJIA 3OTRA 4FNRA 5DLCA 3E0IA 4LS2A 4G2PA 3CXOA 8A3HA 3T7VA 1RALA 3UI6A 4DNMA 1E72M 1OD0A 1SSDA 2EPHA 1UD5A 2VZTA 3AXIA 1EDQA 2Q09A 2LJ4A 2NLYA 2Z6IA 1JFHA 1TMHA 3DESA 1ME8A 1HIZA 3ARXA 1YEYA 5ABEA 4P7RA 1THFD 3HPSA 3OVRA 5ECUA 2FDSA 2HVNA 4E5TA 2CC0A 1RVKA 4D6FA 5B7YA 3AUJA 3WH9A 5CAKA 3M43A 3QHOA 1X1NA 4D2JA 2ISFA 4GVFA 3VC6A 1IWBA 1XKYA 2B7NA 5HWJA 1TCDA 3MYOA 3CZGA 2QDGA 3JZUA 1K8ZA 5TBOA 2QUNA 1ZTVA 3ZVHA 1FWCC 2D1ZA 4ODPA 6XIAA 3OEXA 3K1DA 3G3MA 4RW5A 2XVLA 1JUEA 4WJ8A 3EKZA 1NDYA 3R89A 2QPXA 4FOUA 3VOIA 4Z2LA 6ENLA 4V33A 2A3LA 4IT6A 2VNCA 4JTIA 3RU6A 3UJEA 3EOLA 3BGJA 1IE7C 1CGTA 1H0GA 3U3HA 1XBVA 4I9TA 3TTOA 1E6RA 3M5XA 3TC3A 3TV8A 2IKIA 1UD8A 3G2GA 3KLKA 2DVUA 1NAL1 3UG3A 3AJXA 1N7KA 2QCEA 4NL1A 1OZMA 2QJJA 3CBWA 5CBIA 2VFDA 3R8HA 5HQMA 2R1MA 3PY2A 2Y70A 5A6TC 2DUXA 1OG6A 4IJBA 1HJWA 2WLYA 4J3ZA 4ZQMA 1JNTA 1EP3A 1EF3A 4LUIA 2GQ9A 3OIXA 1KRAC 1MUCA 4C7FA 2OT1A 1TQXA 2PA6A 1PAMA 3LRLA 3SUWA 1FJDA 3TTSA 1H60A 2J8FA 3SADA 1QR7A 2JK2A 2R9RA 1KQZA 3WX7A 2NSXA 3LHZA 3I7RA 1LCOA 1MZHA 3AU6A 1K7FA 2YR1A 5LHEA 3EKLA 1S39A 3TN6A 2QPUA 3P2VA 3Q2DA 4O1DA 3EMQA 5JIWA 2WMHA 3DHUA 1QPKA 4TV5A 3PUEA 2M1IA 1K8YA 4U28A 4U3AA 1OYBA 2CITA 3S83A 4S2CA 2ZUNA 1U1HA 1B30A 1SVDA 3AIRA 1VJSA 4AZBA 1MXDA 1F74A 1PBGA 4GBUA 3LBCA 5EMYA 5LNUA 2VCAA 4LWWA 3WNPA 2Y0FA 4IH3A 3KUMA 5CLWA 3JVAA 3NZQA 3L68A 2HPIA 3DERA 1JF5A 1NSGA 1MO0A 5A2CA 2Y61A 4PMJA 1AMKA 3LERA 1X8CA 1T5AA 2HE8A 3KOZA 3WBXA 1JCMP 4WZHA 2AWGA 2AMGA 2GGJA 1J0ZA 1XI3A 4JIEA 1CTNA 4DJFD 1EHAA 4GCAA 3RPMA 1QNOA 3TQPA 1EUAA 3WQGA 1FWFC 1VHCA 2ZA1A 3MVIA 4YTTA 3WFLA 3CUIA 1GOQA 1MEWA 1IZCA 4J27A 1JNSA 4PRTA 3QH2A 3NDZA 1EIBA 1QASA 4KETA 3NI6A 2ALRA 4JQ4A 3G8EA 2E3ZA 3C6CA 1E40A 3TLLA 3UPBA 4DJFA 3FV9A 4BKNA 3TTEA 3S42A 5A1AA 2VXNA 4M6PA 1S5WA 3QXBA 3AYSA 4REQB 3DFHA 1GYLA 4ZSUA 3NR0A 4NYYA 4DRMA 4IPXA 3VOFA 1K9TA 5TF0A 4ODRA 2XVGA 5T9CE 1H1ZA 4LAOA 4YIWA 7ODCA 3SIZA 3HGSA 4AU0A 4R0XA 4J4OA 1RJPA 3GVVA 2VURA 3VD9A 5HWBA 4FLRA 1XYMA 5I3GA 2BMBA 1VFLA 5KTLA 2WQDA 1FWAC 3VO0A 4WGHA 1W8SA 2WKGA 3UWYA 2EGZA 1GQJA 1ZJBA 2ZYFA 5G2WA 1Z44A 3PWAA 3GTHA 3ITYA 4IG2B 3T2QA 2FZDA 5CJ5A 4H8HA 4KGLA 1W8GA 1OD8A 4NI8A 3L21A 4Z2KA 5K9XA 2ZUVA 4PMDA 4HK6A 4EXAA 3O07A 2I5QA 4AMAA 2RQSA 2HZGA 4WKHA 2WKJA 1TZ9A 2XU2A 1K03A 5HANA 1B4EA 3TN5A 4H19A 2Z1VA 4M7SA 4D1JA 1KXQA 1RJRA 4TX6A 2I7GA 4TXEA 1VGAA 2ZA3A 4PRWA 1R8LA 2VGFA 2XIQA 5LNVA 2KX9A 5KZDA 5DRCA 4M29A 4MFDA 4ATWA 2HE5A 2QUUA 3KBVA 3AHXA 3T8QA 3WNOA 4ASTA 3N3MA 4DF2A 5AVNA 3IUDA 3B97A 2VN1A 4L80A 1GZJA 4AXNA 4F2TA 1CGXA 1QVBA 3NIYA 1OX5A 3TC7A 4F2BA 2ZZ5A 3CEUA 4U4MA 4NXSA 2VX6A 1O60A 1W9PA 1PB0A 3GDKA 1ZCOA 4D6IA 1JPKA 3N6QA 3CUXA 4CCEA 3HB9A 4ICMA 5D37A 4QFUA 3GK0A 4UTTA 1LUCB 4C6PA 2C15A 3T44A 2YFOA 2NVDA 4GK8A 3C2EA 4R85A 3O9NA 1FKJA 1XF0A 4KWWA 5AHLA 3R10A 5HBFA 3A5FA 3VINA 1NSJA 4XG1A 1HFBA 4GABA 3EKGA 2GOKA 4ENLA 4D6JA 4DWSC 1EZWA 4GCXA 1F6PA 1AJZA 1QK2A 3WK3A 4DJEC 4L65A 1DWJM 1M03A 3N14A 3OZYA 3P3BA 4LXFA 4E8CA 5C8BB 1LM1A 2HPMA 1CB2A 4IMCA 4RE0A 1DQXA 2F23A 2CFFA 4C6OA 3NQAA 3KHJA 1KFCA 4GO9A 2HTMA 4OBSA 3T4WA 4QZVB 2Y5SA 1VAHA 4ODOA 2P76A 3B9AA 4GH3A 3H2AA 4Q8WA 3KBMA 1FHDA 1HP4A 1JDAA 4O10A 3VUSA 2IPFA 3NNTA 2WSPA 1REQB 2YZRA 3PAOA 3FYPA 1UIPA 6REQB 4ZVJA 5CLTA 3NGJA 4J1OA 4W5ZA 3NYDA 3AJ7A 5CJMA 2ETNA 1HJQA 2WSYA 4WSKA 5DY2A 5KMYA 2FGLA 3SY8A 3SGGA 2OO6A 4DX3A 3BW3A 4KWSA 3MV11 1BYCA 1XCXA 2FB2A 4HBOA 2Q3RA 3H55A 4RKAA 2D0GA 4A8LA 3R6IA 5HW7A 2BOFX 4ODMA 1QDSA 1R46A 3BG9A 3CWHA 1WPCA 5DF0A 5I07A 5F4WA 1K7EA 3NQ7A 4GXPA 3RG6A 3CYJA 1QFEA 4ODNA 4MNKA 4KEMA 2DPEA 1W5QA 2WXDM 2GSEA 5E0KA 1XLEA 3V5OA 1EJTC 4HU4A 4MKSA 3VNLA 2PGWA 1ROUA 4U31A 1OEPA 4MY1A 1E9IA 4IQJA 4JFIA 1F76A 2JKEA 6ALDA 3W82A 5I3FA 1GOOA 1UPPA 2PN0A 4LW7A 2B7PA 1TR1A 1RD5A 3T0TA 1QCWA 3DG3A 4JKKA 3E3HA 3GB6A 4Z17A 1A5SA 1QUMA 4IUGA 1SZRA 3KCOA 3N4AA 4Z08A 1XRSA 4N19A 4GIEA 2NQLA 2CLOA 2QR6A 4QLLA 4PTVA 2C1HA 1S2TA 4BF8A 2H9AB 2H6RA 3VDCA 4LNYA 1L2QA 4C1NA 2PDHA 4GIAA 1VFFA 3PSVA 1W2PA 4D9PA 1TJPA 5TQLA 4M1RA 2DQXA 2J74A 4B5TA 1WOAA 2VR4A 2DDXA 3F7JA 1CLKA 4JOMA 5KSWA 3G1XA 3FFSA 2OKOA 4TQTA 3VFCA 4FR6A 1HJUA 3RM4A 4E2BA 1LQ2A 3PPHA 2Z2BA 4AF0A 4OQVA 1WDSA 2F38A 2V82A 1QNVA 3CGTA 2NUXA 1JQXA 3UJ2A 3UPMA 4MWAC 3GXNA 3B8UA 2HK0A 5HUAA 1YW1A 3T09A 4QE1A 4O1EA 3QTPA 5DMMA 1HXJA 5IFTA 4KR0B 4UR9A 5BZAA 3NO1A 1BVZA 3STPA 3H7UA 1RA0A 2YA2A 4C6LA 4C6NA 3VDGA 4NAEB 4CQBA 1GVFA 3WUFA 3M44A 2NUYA 4GG9A 1V3LA 1YHTA 2BB0A 4HGXA 2J7GA 1JCNA 2CZVA 1Z8AA 4G9PA 3S5OA 3NURA 2YIHA 3LHWA 1MWOA 4ZCWA 4WXZA 2W79A 4HCDA 3WF3A 1S3TC 4OV9A 5HWMA 2PWUA 4PMUA 3GH4A 2M08A 5D4YA 2I9UA 2B81A 5TIMA 3CO8A 4QLKA 4BWLC 1ZPTA 5I0DA 3RR4A 2I17A 3E0VA 3L5MA 4TUFA 4LTSA 4JD4A 4B3KA 2ANUA 1EPVA 2DIKA 3WK2A 1XUZA 1H11A 2OSXA 1J4RA 4JIHA 1A3HA 3O0KA 2ACSA 2TSYA 4DNHA 1GONA 4AWUA 1CYGA 1FKIA 1NARA 4LF1A 3M7WA 4IMFA 1I2QA 1RPKA 2ZUMA 1EJRC 2XIOA 3MZNA 4FEZA 2QGHA 5E1QA 1ZSXA 4GHRA 4DZ2A 4XAFA 4MPQA 2PZNA 4PUNA 1P4CA 4XBKA 3TWAA 2PWVA 4MJ4A 2YW3A 1JG9A 2BSLA 3AMCA 3S1UA 4NNBA 3T0BA 1CW2A 3T0AA 2IKHA 3GU1A 1U22A 3EDFA 3LM3A 2BTMA 3W7NA 1JCHB 3M16A 2OWXA 2VFGA 3VX0A 4H9MA 2XP9A 4QJ1A 3W75A 4FXRA 4LUJA 5HTGA 3Q67A 5BW6A 3DFNA 3TC6A 3DFYA 2R1PA 2ZVIA 3BLIA 3SY5A 2PDIA 2ABBA 3WN6A 3P0WA 2FZNA 1H7OA 1I2PA 3E0LA 1TB3A 3ZOAA 5J6EA 3OA3A 4PL1A 7A3HA 1R9XA 2DUAA 3T1GA 1V0MA 2RH9A 3WLTA 4GZEA 4HJFA 4FNSA 2JKPA 4FXJA 1LWHA 1EJWC 3ABOA 3NPXA 2X0HA 1Q6IA 1S2CA 1V6XA 1TV3A 3P67A 5CGQA 2XFRA 4U3CA 2NZLA 3CT2A 2OXNA 3V36A 1IV8A 3EA3A 2UY5A 3L4ZA 3S9YA 2OCZA 3I3EA 2EJAA 3AMGA 1NJJA 1KFEA 4AX6A 2GFTA 3S2CA 4QEHA 1EO5A 1MNSA 2ZUUA 3ITGA 4ZZ9A 3DC8A 1CX9A 4WIWA 3FAWA 4HSNA 3VGFA 5GJPA 9RUBA 2QV4A 1TV8A 4D6CA 4ZBCA 3FSUA 2XPBA 4PR4A 2F2DA 4RNIA 1VP5A 4MJ2A 3TYZA 4RE3A 4EACA 2XN1A 3JXVA 1LJYA 4GGBA 3WLOA 2WSKA 2YLLA 1GVQA 1MVYA 1LDCA 1VHNA 3AZRA 1CEOA 2JIWA 2PTDA 1IT0A 1M5YA 3VKCA 2ATMA 3WLKX 4S3JA 3SSJA 1E70M 2PDJA 2PDBA 2FVKA 3W2NA 4GYKA 2VELA 4AZHA 1IEWA 2RHGA 1OWQA 2QIWA 4DM1A 2XTKA 3W74A 4RPPA 1UWQA 3DGRA 1E0WA 3TXVA 5FCZA 3I7QA 4Q33A 3IPWA 3SFKA 4LS1A 3HMJG 1Q3NA 3SBFA 2B4GA 4F9JA 3LA4A 3NOYA 5TD4A 4INFA 4J2MA 1WXZA 1PINA 3C2VA 1BAGA 1TVPA 1UASA 1Z3NA 4C5ZA 4O0KA 1W0MA 1ISYA 1XFBA 1TTQA 4LUSB 4DRHA 2BXYA 3W1PA 5E6YA 3K13A 1FOBA 2CU0A 3UPWA 2FKPA 3UVIA 3O7UA 4MHBA 3LPFA 5B80A 3E9AA 3LXCA 3CV7A 4K37A 1UA3A 3ZLHA 3OIHA 3PZQA 1G94A 3RMEA 1GVYA 3U9IA 2WZMA 3PWIA 5E9AA 1OYCA 3SN4A 1BFNA 4UOJA 3FYOA 3VKKA 4BK9A 1Z42A 3GFZA 1ZALA 5E5CA 1XCFA 3CAKA 5GNXA 4OOZA 5D09A 1F3XA 4DUXA 5FF4A 3B06A 5CZKA 3WF1A 5DRIA 6XIMA 2ZX5A 3MKKA 1H50A 4L4OA 4UNLA 3T0CA 2YB1A 3DUGA 1P7TB 2NV2A 3GPKA 2JBMA 5BMXA 2C8NA 4DY1A 4GY1A 3W1UA 1HT6A 3ISIX 3M6YA 4H6KA 3NWRA 1W91A 4MLJA 5D9PA 3QYQA 3RFAA 1L6YA 4KT2A 2ZXQA 3T81A 3B9OA 1JI1A 3GDLA 3QQWA 3ARRA 2VD9A 1C8XA 3O5RA 3NYZA 3HPFA 4ZMGA 2C13A 3DFSA 2BWGA 2CLFA 3EMCA 3GYEA 4V15A 1UPMB 2CZEA 3WJYA 1R3VA 1TRIA 1M7PA 1A5OC 1KTNA 1YTEA 1DE6A 3WO8A 2ACQA 2IMRA 4QNEA 1OFPA 4B9YA 5EMUA 1O7AA 1MNZA 1JZ2A 3NAVA 3UZ5A 4K7YA 1FH7A 4XKYA 2CBVA 1JCLA 1TELA 4HSOA 4LC8A 3N2OA 3EB3A 3GRIA 4JFUA 2Q01A 4ZO8A 2Z29A 3DFOA 1C93A 5I5RA 2R1LA 4FA3A 3VIJA 2A6NA 1P1MA 2E77A 4R3UA 3CV1A 3VMNA 4XAKA 3UG5A 3O5FA 2G97A 4DAIA 1LQAA 2OTDA 1J6YA 1RA5A 2VRQA 4O2TA 3MHUA 1EGVA 1FQ0A 3GNXA 1QO2A 4GOAA 3N18A 4KEVA 1FY6A 1GPWA 4NHVA 5JH1A 5EBUA 2WM0A 3KCEA 5CZSA 1E9YB 3UXKA 1NFPA 3C86A 1TUFA 4ZO6A 2WLZA 4AD5A 5CBBA 3HM7A 1G6CA 3L2IA 2D24A 5AECA 2WJDA 4W86A 1JJKA 2YB4A 3TJIA 5C2XA 5M3WA 2ZXAA 4Q22A 1XL9A 3FY1A 3LM7A 5C9XA 1QPLA 5D38A 4LAMA 5LIYX 5CPSA 3FNDA 1EX5A 4XZHA 5LA2A 3QN3A 3GDBA 3TU9A 3CHDA 4Z2HA 1X96A 3CMFA 4GYPA 4ZQOA 3KOWA 4WY0A 3O5OA 4LVAA 3LUTA 5LIXX 1OIMA 1IF2A 4O15A 2JQXA 2Y62A 4YLWA 3OVGA 3SCTA 2VZOA 3HA1A 1VC4A 4AD1A 1JNEA 4GD0A 3P5YA 1I0BA 3LN3A 3TXZA 4UQEA 4TX0A 1Q8JA 1QNSA 4UFJA 3TX9A 1GCYA 5I78A 3NL6A 1AZ1A 4MGVA 3BURA 4POCA 1PTDA 3GAKA 3ZLFA 2X16A 3BLKA 3WQFA 1RY0A 3V35A 1YKWA 3QGAC 4JL2A 3TOPA 2VCCA 5M1TA 1Q6CA 1YXYA 2OODA 2V69A 4O1AA 1KCZA 1L9WA 4LRTA 1WKDA 3LD5A 3PBUA 1QWGA 3U4AA 4O17A 4S38A 4R9OA 4NAEA 3MI3A 1AZ2A 3RCNA 4GNKB 2E5CA 3U5YA 5HJXA 2V2CA 4I8DA 2OLSA 1ZAHA 4C6QA 3YPIA 4LBSA 4C6JA 2GL5A 1MUMA 3MMTA 4E4PA 2PBCA 4FNUA 3F4CA 4L4PA 1ZENA 1J11A 3SN0A 2OKTA 3I3DA 2ISWA 3B3DA 3HOJA 5IHRA 1K3UA 2WBKA 3BW2A 5HATA 4DYJA 1F7BA 4EAMA 4DIAA 4M5PA 3I4EA 3NEVA 5G5IA 3RN6A 3QSRA 1Q45A 4WSJA 4QSFA 1GT8A 1FCBA 4FF5A 2AGKA 2OYMA 1MFVA 1GG0A 2AQOA 3KL0A 2BNJA 4V1XA 4UMCA 1ECEA 5DCEA 1PZ3A 3MS8A 4IFKA 4JS3A 1JZ6A 2NV9A 3ARQA 4JHMA 3RX2A 3U4FA 1AH3A 1BTCA 2WMFA 5AYBA 4LQ1A 1KD0A 3QC0A 4A8IA 3M0VA 3RM9A 3WD4A 1RBAA 3ZM8A 1OX6A 1O6IA 2GK1B 1M68A 4XVEA 2G3NA 4ODLA 1GHSA 3TN3A 4FAMA 2GSHA 4Z1BA 3HO8A 2BBFA 2A3AA 3VU2A 5CZTA 3RJXA 3BXWA 1R47A 2ZUWA 1FA2A 4FP1A 1DPMA 1H7XA 3IVSA 3CUHA 1Q66A 3TDBA 3G0UA 1Z6KA 4JBRA 3HBLA 4FK9A 2PLMA 1BWKA 3SQLA 1QTWA 3VOHA 3R25A 3I6TA 1W1YA 3FHQA 2YDSA 4DLMA 3FVMA 4GY7A 4DVOA 2OR2A 2X0SA 1U5VA 4F9DA 3N2TA 4QJ5B 7REQA 3QLDA 3BAXA 2FZBA 3FVDA 3F5JA 3GIPA 1ONEA 3LS9A 2O4MA 3RLGA 3TYBA 1VENA 2J9YA 5CZJA 1R87A 1G5AA 3CT7A 4D6DA 2OJPA 1H7RA 5C55A 4QJ4B 1W9DM 3V75A 4UR8A 4AZGA 2ZE0A 4FXFA 4CQDA 1WKYA 1PKNA 4JIRA 4U10A 3W4RA 1N8WA 3MHGA 2FB3A 5GJNA 3N1AA 3EEGA 3RO8A 4RNFA 4QGCA 4RNJA 4HHLA 1UR8A 1BL4A 2YPIA 1XLGA 2E68A 4FXSA 4XD4A 3WDIA 3B05A 4DI9A 2FTYA 1S2VA 5GNYA 4BF7A 1UD2A 4G56A 1FCUA 4AIEA 4X63A 4W7WA 2R1NA 1JPIA 1YE6A 3QJAA 4ES4A 4OU1A 5BU6A 3O5MA 4IXXA 2I5GA 1C9DA 4H00A 3M46A 1I75A 4PCNA 2OQHA 1YXCA 4B91A 4GX9A 1VKFA 2C0AA 1DTUA 3WK1A 2PI6A 3A3HA 2D0FA 4M6UA