3RM9A

Amcase in complex with compound 3
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 129
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm9A01
4W7WA 2BY2A 1L0PA 2WC3A 2BFGA 3ARSA 2BS9A 1B1YA 2JF6A 1HJUA 2ZXQA 3OLGA 2O9TA 3WUBA 2E40A 1GZJA 1CEOA 4UFMA 3BAXA 1PIGA 4MPKA 2X2YA 3IAPA 4HZ7A 5A6MA 1E6ZA 1MXDA 4XZBA 5JBEA 5DF0A 4UCFA 4H41A 1KBKA 2X0YA 4X0VA 1UKSA 3BAJA 3AROA 4D1JA 4AIUA 1GHRA 3WENA 3ZJ7A 1E15A 3GZAA 1ZBCA 3GTNA 3UR7A 4DM1A 4HP5A 2ZWZA 2GSJA 4HA4A 3AICA 1RP9A 2JFEX 3T0DA 2VX7A 1PX8A 2VURA 1M04A 3VINA 2WBGA 3SUWA 1C90A 4BS0A 2B31A 4U33A 1O6IA 4FMVA 4QCEA 2CKRA 1JD7A 3AOFA 2UWFA 2CHNA 3W26A 1CECA 3W82A 1ZL1A 1SYTA 3N13A 3W4RA 1UR1A 1EH9A 1R7OA 1W91A 3BSHA 4P7RA 5D9OA 3AZTA 2E9LA 1W1TA 1C93A 1E72M 1Y7VA 4QDMA 4HOZA 1VBUA 1HJQA 3VMPA 5I24A 2WHJA 1J0ZA 4PTXA 2FHFA 5IFPA 3IJ7A 3IK2A 3VOCA 1UG6A 1ODUA 1ZBWA 1KXHA 4BZYA 3CMJA 1K6AA 3WY1A 1ITXA 3VDCA 3VDBA 3BMVA 4Z2KA 1NOFA 1PEZA 2XVGA 4JKLA 2WHLA 5CLWA 3MSDA 5CPSA 3MV11 3MMWA 1R8LA 2VZTA 1E43A 4J3VA 1VEOA 1UKQA 1KXTA 3KL3A 4FLOA 2ZXBA 4CGTA 2WM0A 5LA1A 4LX4A 2WKGA 1WDSA 1XHGA 1D2KA 1B3ZA 2EPOA 3MV01 1C7SA 4W8LA 2J7DA 1KGUA 1DEDA 2GVYA 1H3GA 1OCQA 3EDKA 2WVVA 2J4GA 4Z2HA 2WZIA 1EIBA 3N9KA 4BQ2A 2PI6A 5E6ZA 4W7VA 4A4AA 1EQPA 5I6SA 3OGSA 2WBKA 1JZ7A 4ACYA 1K9EA 1E0WA 5DMYA 3W0KA 2BY1A 2VZSA 1XH1A 3POHA 3RDKA 2BY3A 2QPSA 1ESWA 1G5AA 2ZE0A 4MB4A 1EOMA 3VD3A 1JZ5A 3ARZA 4XV0A 4MTVA 1LLOA 2XIIA 4DM2A 4AD5A 1CGWA 3VIJA 4CD5A 5M5DA 1R87A 2QLYA 2DSKA 5CJ5A 4AISA 1PIFA 1UKPA 4DWSB 3LPPA 1DWHM 3ZJKA 1CLXA 3N04A 1BHGA 1QHOA 1XC6A 3PN8A 1BG9A 4NSBA 4D71A 4TX6A 4S3JA 1BLIA 1TCMA 5FCZA 1RD6A 1A47A 5GNZA 2ZUWA 2DSZA 1W3HA 4Y7EA 2FDMA 1V3HA 1K9FA 3VD4A 2YL6A 3LPFA 2WMIB 5CGMA 2FHCA 4JL1A 3EDFA 1MFVA 3MSGA 3OG2A 2X05A 4AZ5A 1UWQA 5I77A 4ZXLA 1ZBKA 3K46A 4URIA 1H0IA 1DWIM 1QPKA 2CNCA 3T0BA 3WFLA 4AZCA 1NWRA 2OWWA 3OZOA 1VBRA 3RPMA 2V3DA 1QBAA 1XCWA 3SCOA 1UD6A 1J11A 3AHTA 3UESA 4AIEA 4CN6A 3QHOA 4KRUA 4WSJA 4UOJA 2XM1A 1WZMA 3ARXA 1MQQA 1Q6FA 4UFIA 4L4OA 3K8KA 1WDRA 1E3XA 4AD3A 4RL3A 2YDRA 3MS8A 3O2LA 3VIHA 4GI9A 1QHPA 3WF2A 4JAWA 4P8XA 4PRWA 3T0AA 2GK1A 1C8XA 1F4AA 5E9AA 2YL9A 3M7SA 7TAAA 1V0LA 2JEPA 3U7BA 2EPKX 1HT6A 3LMYA 1V6VA 3JUGA 1FP9A 2GUYA 3FHQA 4CU6A 5JBFA 2D24A 2XM2A 2ZX7A 1CNVA 4JHZA 3WD3A 3F4VA 5ECUA 2EPLX 4GI6A 1UH4A 3AYRA 3ZT7A 5CXPA 1S46A 1WB0A 1VRXA 3GNPA 3ECQA 1UKTA 1JFXA 3WF0A 2PWHA 3ARTA 2NT0A 4U2YA 3T08A 4TVCA 3L2MA 4YN5A 4CD6A 4NZCA 1EOKA 1LL6A 4Z2GA 3VGGA 3AS2A 4P7LA 3RM8A 4PEEA 3L4YA 4KGLA 3AS3A 2XVPA 3UR8A 2HVMA 4AZCB 4UR9A 3O6AA 2OYLA 4UQBA 2ZXDA 2X8RA 2DIEA 4J3XA 2WMIA 3WUEA 3CUJA 2Y8VA 2YIHA 1HJSA 3VMNA 2W66A 3N17A 4BQ3A 2GJXB 2OSWA 1J0KA 4Z2LA 1KB3A 3ARWA 1TR1A 1GCYA 2OLHA 4J3WA 1W9UA 1UH3A 2IXUA 5M3WA 3SCSA 4JCLA 4MNLA 5DFAA 3VM5A 2GK1B 3K4DA 4ZE5A 5A69A 1CXKA 1NM9A 3NDZA 1EHNA 4HU0A 4P7OA 4HMEA 1HX0A 1GPFA 1OM0A 2BNJA 3AXHA 4HA3A 1TA3B 3ZM8A 2E8YA 2MANA 2OSXA 3WBAA 4LXFA 3VIFA 3FNDA 1H41A 3AXIA 3CHDA 3ZO9A 4F9DA 1HKMA 4XX6A 3WH8A 1E5NA 1OB0A 5EMYA 4PMOA 1L8NA 1J10A 1GQJA 3TONA 2XVLA 4W8BA 5DEZA 3D3AA 4AZ6A 4PTWA 1GQLA 1OD0A 5D8WA 1FP8A 3SCQA 4AIOA 4W85A 3VILA 3CZLA 3PZUA 5M03A 1E6PA 3AHZA 1EA9C 2VL4A 1F4HA 3A47A 2VVNA 3EYPA 2Q8XA 3ARYA 4ACZA 1DHKA 2J7BA 2YKKA 5DO8A 3BAWA 4WLCA 4AW7A 4BA0A 4D6HA 2XG9A 2GDUA 1CYGA 1EDGA 3GDBA 2F61A 1HJWA 1PZ3A 3VPLA 2XFYA 2ZUVA 2GFTA 2J8GA 4PSPA 5JBDA 1W9PA 3ZIZA 1TZ7A 4E2OA 1V0NA 2CITA 3VGHA 4UFLA 2BY0A 3CZKA 1BSIA 4AY1A 1BAGA 4W5ZA 3WMCA 4B9YA 3KWXA 2G4FA 4JZ5A 1MVYA 5BXSA 4CN4A 1C3FA 2WYSA 1B0IA 4QLKA 2WSKA 1CGTA 4CCDA 1UWUA 5BXPA 4U5KA 3WEOA 5LA2A 1MQRA 1BVNP 1V6YA 2FH6A 1M53A 1UQYA 3BMWA 1WDQA 3I3DA 4YHEA 1W3LA 5EFDA 2VMFA 4ACZB 3BLKA 3VTRA 3SCWA 4WKFA 2XSBA 3GH4A 3EBVA 2VRJA 4D6EA 1VJSA 4ZENA 3ZT5A 3OZPA 1WCGA 1B30A 3WQWA 1E40A 3ZT6A 1OGBA 2E8ZA 3WH9A 1LG2A 3AIVA 3U57A 1BF2A 4D6IA 3AHVA 4ZE4A 3WH5A 1ZS2A 4GI8A 4N0RA 4UNIA 1R86A 3VKKA 3WQ6A 5A6SA 5CPQA 1SR0A 1BYDA 1J0HA 2PWGA 4XUYA 3DC0A 2BV9A 1UD8A 2J7FA 1UD3A 3W37A 1E1EA 3BC9A 2O9OA 3OLDA 2RGMA 1GOQA 1GW1A 3S6TA 3QHMA 3MANA 3N1AA 5C8BB 4V2XA 1B31A 4NRRA 4F79A 3DYPA 1W9VA 4X9YA 8CGTA 1FOBA 1PX4A 1JZ6A 1WPCA 4S3KA 3G6MA 1X6NA 1CIUA 3MO4A 3IJ9A 2VCBA 3SURA 2QMKA 1NQ6A 1UWTA 2CERA 4D72A 3T2OA 4D1IA 1KBBA 3OLIA 5A6LA 3AQUA 3WFZA 1E1FA 4FLSA 4W7UA 3GXMA 1B3VA 2VX6A 4MNJA 3AFBA 2D1ZA 3N11A 3GYCA 1JZ2A 1N82A 1V3IA 4IUGA 1GJUA 1RH9A 2FHBA 3UG5A 5JUVA 2Y5EA 4FK9A 2ZUTA 3A6OA 2YBUA 1UKOA 2VX5A 1UUQA 3AYSA 3WF1A 4AZIA 4LYPA 3RJXA 1JD9A 3OGVA 1IZKA 1CWYA 1X1NA 2FH8A 3UETA 1WNOA 3MMUA 2YLLA 2Z1SA 2G3JA 2QF8A 3VIOA 2BHUA 3ZMRA 5BRQA 1OIFA 4PMNA 1M7XA 1TVPA 3ZSSA 4W84A 4TX8A 5A8PA 1OSEA 4XZWA 3PTKA 3B9DA 2QPUA 3WMSA 2UY2A 3CLWA 3CGTA 4WK9A 3TP4A 3GXIA 1QHZA 3W6MA 3MU7A 3SIMA 3GNRA 1KR1A 5AC4A 3VMOA 3PZOA 4LQ1A 2YJQA 1ISZA 1VF8A 1ISXA 5ABGA 5E09A 4MDOA 1UQZA 3U5YA 1OT1A 3AIBA 1JI2A 1G01A 3A4WA 1U33A 1NWSA 3A4XA 4W86A 4MDPA 4HZ6A 4XB3A 2ZUNA 2CETA 1C92A 5KZ6A 2ZICA 3AIUA 1V6UA 1UHVA 2VC9A 4OBSA 4UFKA 1QI5A 3SUUA 1JZ3A 1MYRA 1QBBA 4GIAA 2WB5A 1QNSA 1WDPA 4V28A 3ARPA 1YHTA 5ABHA 4OZOA 3FY1A 1UD4A 2EQDA 3BSGA 1ZU8A 2YL8A 5A8NA 1BYCA 1E55A 1JAKA 4L4PA 2VR5A 4DUWA 2Z1KA 2DEPA 3F5LA 4DUXA 3ZJ8A 3FHAA 1UD5A 4GO8A 1D3CA 2AMGA 3NSMA 2Y24A 3PTQA 3QHNA 1MW2A 1B2YA 2DT2A 3VDHA 4ATWA 3SCPA 3SUSA 1A3HA 2PWDA 5EB8A 2EO7A 4U3CA 2D2OA 1B90A 3CPUA 2D3LA 2ZWYA 2G41A 1W1YA 3RM4A 1JDAA 5I2UA 1BGAA 1W9DM 2VT0A 5D9MA 1U30A 3PZIA 3QR3A 5A95A 1GQKA 2J77A 3AIQA 2Y8KA 1DWJM 7CGTA 1E71M 1H11A 3GXDA 1C7TA 3WQ5A 1JF5A 5HNNA 2EBNA 4A3HA 3CUGA 2BHZA 2X1IA 3MMDA 2XVKA 5CGTA 2CBUA 2VRQA 4EKJA 4RE3A 2O92A 1XYZA 1OINA 1HF6A 2XPKA 3VD9A 4AWEA 3RMEA 2XIBA 4N42A 3EMQA 4MJ2A 2GJXA 3WQVA 2WMGA 3WNKA 4B16A 1OGSA 4J3SA 2XSAA 2DGAA 2UY3A 5IDIA 4IPLA 3FN9A 4OBRA 4IISA 4CCCA 1ISWA 2J74A 3AMKA 2BVYA 2AOSA 1E73M 2J8FA 4J28A 1GOOA 2PBOA 3VD7A 4EAMA 1JXKA 3KE0A 2G3IA 4B15A 4CKQA 1HL8A 1HP5A 3W27A 1LL7A 4AZGA 1UD2A 3GH5A 3OGRA 4AEEA 4IM4A 3ALFA 2VQUA 3UERA 4GXPA 3NJ3A 3W24A 2ZX6A 4W88A 5A6BA 1HJVA 1J0IA 2XVNA 1DWAM 2XFFA 3A3HA 4AD2A 3E1F1 1NP2A 2J25A 4EANA 3L4ZA 5BWFA 2DSVA 5A6KA 1J0YA 5CSUA 1VFFA 4WKHA 4DWSC 2C8NA 2YA0A 3VNYA 1QNPA 3RIKA 3TTYA 1TUXA 1C8QA 1UZ1A 2V3FA 3VGFA 1E6XM 1UR0A 3VGDA 1Q6GA 3WDQA 4MB1A 5LYRA 3NUKA 3TOPA 2BVTA 1CXIA 3K8LA 2D0FA 4UQCA 3WL0A 2E9MA 3PZQA 5D9PA 1E6RA 1MW1A 2WCAA 3W29A 5C70A 1HKJA 5I5RA 1XV8A 5CLTA 4QLJA 2ZIDA 3WNOA 1HKIA 4D6GA 3CZJA 4IPNB 2VRKA 1B9ZA 5HXMA 2V3GA 4H04A 1B3XA 1DTUA 4TVUA 3VNZA 3B8SA 3TTQA 3CHCA 3UEQA 2YBTA 3A4AA 3ZR6A 5HDRA 2OWXA 1MQPA 4UQEA 1ISYA 3RJYA 3K1DA 3QOKA 1NH6A 5D4YA 1CTNA 3II1A 2VVSA 5TD4A 4Z2IA 1TE1A 3WF3A 2V38A 4UTFA 2Y4SA 3L2LA 4F9JA 2V3EA 1GOKA 2WANA 1WE5A 5GQBA 4ATLA 4B9ZA 2A3EA 4GO9A 6A3HA 4QCFA 1DWFM 4AD4A 2IUZA 2VX4A 3GBDA 1O7AA 1E4LA 3G6LA 2F8QA 1J12A 1QNQA 5HBFA 1H09A 3W28A 2HISA 1HVXA 4QP0A 4WKAA 4KWUA 3DYMA 4UOZA 2YDSA 4FLQA 1Q6DA 5DT7A 1GOWA 2A3AA 4CD8A 2DT3A 3CO4A 1XSJA 1W3JA 3T09A 5I79A 1E9LA 3CTTA 4PYSA 1CGVA 4ML4A 1PPIA 5A2BA 1OIMA 2WHKA 1E3ZA 4JL2A 3UCQA 1KWGA 4PTMA 1J0JA 1XH0A 3AIWA 4R27A 2JE8A 3F5KA 2J79A 4HMCA 3APGA 4KGJA 2J7EA 1GHSA 4GQQA 3GBEA 3K8MA 1OGGA 2E3ZA 4PMVA 1HP4A 2WWDA 5IHSA 2ZUMA 1DP0A 1HKKA 5IFTA 3VM7A 2JALA 2VZOA 4JFTA 2WHMA 3GNOA 1X6LA 2O9RA 2EPMX 2NT1A 1JYXA 1E6SM 1AVAA 1UR2A 2ZX8A 3EMZA 2J7GA 4QFUA 2DH3A 1XD0A 3PZVA 4DUVA 4PUEA 1MW3A 4MNKA 5D8ZA 4HOWA 3OBAA 4AZBA 2CBJA 4V27A 3LPGA 5ABEA 3WL1A 2YDQA 4GPNA 4WF7A 1J9YA 1ITCA 1XSIA 1UWRA 3L4VA 4RE2A 4PTVA 4W87A 1HIZA 4OJYA 2Y2WA 1LQ0A 1GUVA 4BCEA 2XTKA 1H1NA 4PCSA 1HNYA 2OYMA 4J3TA 5E6YA 2EJ1A 1V08A 1BTCA 3PZNA 3DHPA 3RCNA 4Q22A 3FAXA 3BCFA 3EMCA 1KCKA 2V5DA 4QAWA 1UA3A 3IANA 3NIYA 1G94A 2UY5A 1P6WA 4BQ4A 4CUCA 4HA1A 1E4MM 1KGXA 1I75A 1JXJA 4M80A 4UQDA 4MNMA 3AS1A 1HJXA 3PTMA 4P7QA 2ZXAA 2W5FA 1CXHA 3WUGA 5E0FA 1M03A 4HTYA 3GH7A 1OD8A 2UY4A 2V5CA 1CZ1A 3PZMA 4A3YA 2WVUA 2VO5A 1SMDA 2CBIA 4TUFA 2DQXA 1WKYA 5DT5A 1JDDA 4H8VA 4MAVA 5FIPA 2W4XA 2OWCA 3PZGA 1W9XA 3WQ4A 2PB1A 4AZ7A 4UZUA 5FL0A 4W89A 4AXNA 1ZJAA 3L4UA 3B9AA 3AHXA 3W38A 5GPRA 1JG9A 1TVNA 4LYQA 2W91A 4R5EA 3T2QA 1KXQA 2PWEA 7A3HA 2VI0A 3OLEA 2WLZA 4HMDA 4PN2A 1V6XA 1XYFA 3WNMA 1HL9A 4B3KA 4CCEA 4M82A 2YA1A 3WUFA 1VFUA 4JKMA 3CZGA 4M29A 1RP8A 1US2A 3VDAA 4D6CA 2VQTA 4AEFA 2OSYA 1EGZA 1JYNA 4MB3A 1OWQA 3BXWA 3EDJA 2XGIA 2QHAA 1W2VA 1LJYA 4W8AA 1QW9A 3MKKA 1ZJBA 2E9BA 4WSKA 3THCA 3UG3A 4BF7A 3DHUA 4W93A 4CU7A 3EDDA 3S2CA 3ZOAA 1V0KA 4GKLA 4DWSD 3WH7A 2VNCA 1AQMA 3WDHA 3WEMA 3T2PA 1JAEA 1VJZA 1CXLA 5F7UA 2DDXA 3IAQA 1KXVA 4BQ5A 3W53A 5I3DA 2WMHA 3CUFA 1B3WA 1E4NA 3NCOA 4PUDA 1KR0A 2D3NA 1EO7A 2PF0A 3WD1A 1KQYA 1V0MA 2EEXA 1UA7A 1V6WA 3AXXA 4QLLA 1CENA 4NI3A 5BCAA 4AD1A 2WXDM 3WNPA 5A2AA 1G1YA 1UWIA 4PMDA 5I0DA 3SCTA 2YA2A 3AS0A 3U5UA 5IXEA 1BG4A 2DSUA 3HN3A 4JIEA 2JIEA 4MJ4A 1I1WA 1K9TA 2XWDA 5A6JA 2O9PA 1IV8A 1VFMA 2YL5A 2A3HA 5LA0A 4JFVA 3AZSA 3BAKA 2CKSA 2ZX5A 1EQCA 1IT0A 4JKKA 5A8OA 4HU8A 4HPGA 3FAWA 1AQ0A 1CLVA 1BYBA 2RGLA 4CD4A 5A3HA 1JL8A 3WDPP 1BGGA 3W25A 4UQAA 3J7HA 2ZOXA 3K4AA 4OOZA 3PZTA 1EXPA 2WVTA 4YHGA 5CG0A 2ZUSA 1QI3A 1Q6CA 1Q6EA 3VX0A 3VX1A 1QVBA 3WIJA 1W3KA 3CIVA 4PMRA 4CVWA 5A6BD 2EPNA 1CGXA 3AJ7A 1US3A 3ARUA 1VFOA 5JIPA 1NWUA 1QNOA 4PMXA 3WD4A 5FL1A 3BAYA 2J75A 4OUEA 3WQ8A 3MUZ1 2GJRA 5BROA 3NSNA 1OT2A 3PHAA 2IXVA 3I3BA 2DIJA 3CZ8A 3VGEA 1EDTA 2DPEA 1NOWA 1MWOA 1UOKA 1FFRA 3AMLA 4PBGA 5A1AA 3W81A 4Q7NA 1NWTA 2DT1A 4AD0A 4UFHA 4CU8A 4M24A 1FHLA 2PWFA 1DWGM 4P8UA 4D6FA 2D22A 5IHRA 2YLAA 4M56A 1E6QM 2EXOA 3I3EA 2BHYA 1E5JA 3OA5A 1PJ9A 1ZB5A 3PBGA 2E0PA 2C0HA 5A8MA 2A3BA 1G0CA 2WPGA 3IJ8A 2D0GA 4JFWA 1G9HA 3FXYA 2DT0A 3HJEA 1PX3A 4U31A 1ECEA 1CGYA 1XSKA 4FLRA 5HPOA 3WMBA 3VUPA 2JEQA 1JF6A 1FH8A 1B3YA 2CBVA 3HMCA 4KRTA 3AHYA 1VEPA 1OBAA 2VR4A 2VZUA 1E6NA 1V3MA 3ARRA 4J27A 3SCNA 3WDIA 2CIPA 3CH9A 5AY7A 1J01A 3TA9A 1VENA 4CD7A 3NSXA 3O9NA 2NW0A 1TMQA 2CYGA 2WKLA 5AYIA 1KCLA 1IZJA 4UOQA 4PMQA 3FW6A 5A94A 1C91A 2WWCA 3ALGA 2DH2A 3OB8A 2OYKA 1WZAA 1BQCA 5EBAA 3N12A 3U7VA 2VCCA 3VO0A 1TFVA 1HVQA 3HU7A 6CGTA 2XHYA 3BGAA 2XJ7A 1CDGA 2WCSA 4UQ9A 4TXEA 1YQ2A 3F5JA 3SCRA 2TAAA 4AZHA 3CMGA 2F2HA 1FHDA 2J78A 4JHOA 2J7CA 5HPCA 2YOCA 1SFSA 3RO8A 5I23A 2J7HA 4D6DA 1R85A 2G8ZA 4UZSA 4E8DA 1JNDA 1UR4A 5FD0A 5M17A 2VOTA 3MUIA 4X0NA 3VIIA 4WIWA 3W6LA 3GM8A 3B9EA 2WZHA 4CN1A 4W5UA 3SCUA 2VJXA 3RILA 1GJWA 6TAAA 1Q4NX 3ARQA 2WC7A 3MUY1 2E4TA 3SEPA 1VEMA 1CGUA 5JIWA 3WELA 3AMGA 3KEHA 4AMCA 2FGLA 5D9NA 4KH2A 2C7FA 2J47A 3WSUA 4ZEPA 2W61A 1E0XA 1HN1A 1QOXA 1WP6A 1XD1A 3KL0A 4HOXA 2JF7A 1LL4A 3KL5A 3WF4A 1H0GA 1KFWA 4JCMA 4U3AA 4ZFMA 4EE9A 4OIFA 1PAMA 2W92A 4JFSA 5E0CA 1ZBVA 4AC1X 1JYVA 3QOMA 5C71A 5CQ1A 4ZXOA 1EHAA 1JIBA 1GVIA 1VIWA 2QMJA 4AYSA 3VVGA 1V3LA 4HZ8A 1FH7A 5EFFA 4LPCA 1BFNA 3DECA 3SUVA 3VIKA 3AISA 2D20A 3WEZA 3M6DA 3WDJA 3POCA 4OOUA 5BXTA 1JYWA 1BVZA 5JH8A 2WVSA 2PC8A 2D0HA 3BH4A 1PZ2A 1UZ4A 3AMCA 3AI0A 2CPUA 2FGZA 3CHFA 3GXFA 5CZKA 2BXYA 3M46A 3RM9A 2W63A 1WZLA 4LYRA 1KQZA 5A8QA 2WMFA 1ISVA 4GZJA 2ZX9A 4OKDA 3ZJ6A 4C7DA 4TTUA 2CESA 1QNRA 3VD5A 5FOOA 2W62A 1M01A 2WVVB 1RPKA 1JZ4A 4H7VA 4MADA 2GJPA 1QI0A 4LGXA 1LF1A 1ODZA 1E56A 3WNNA 2ZUUA 1GORA 2CHOA 1C8YA 3WH6A 4J7RA 1VB9A 4E4PA 2VUYA 3SCVA 2A3CA 1GQIA 4PMZA 3VGBA 2J62A 2WCGA 3THDA 2BXZA 3LPOA 4NRSA 5FKYA 5I78A 3BCDA 1NOUA 2WMKA 1QW8A 2WSPA 3CHEA 3PZ9A 5CPTA 1H4PA 3VIMA 1KWKA 5A2CA 2QV4A 3VIGA 1H2JA 1SMAA 3CUIA 3BAIA 3WBEA 4PMYA 3AIRA 2BVDA 1MFUA 3ZR5A 2WK2A 1TG7A 1UR9A 1CXEA 1E0VA 4D6JA 4TTGA 1NP0A 1V02A 3MUAA 1H5VA 1UR8A 1GONA 3WN6A 1PBGA 2CEQA 1JFHA 5HOSA 3KZSA 1W1PA 3TTSA 4FF5A 4GQRA 1CXFA 4C7FA 2XUCA 4J3UA 1LWHA 1FH9A 1H49A 3NDYA 4P8VA 1XCXA 2XGBA 5A6AA 1JNEA 2G3NA 5BYWA 4Z2JA 2D23A 4JFUA 1TA3A 2JIWA 4NF7A 3WNLA 4H8UA 4GINA 3WKZA 1FA2A 2G3MA 4HPHA 1W32A 5BXRA 3ARVA 3CUHA 1BYAA 2WW5A 1GOIA 3N18A 4PMUA 1NARA 1AMYA 1XH2A 1E70M 1CPUA 2WNWA 1VAHA 4CVUA 4B3LA 5AC5A 3CZEA 2XWEA 3M07A 3CBWA 2XYLA 8A3HA 1QI2A 4P8WA 1V3JA 1BPLB 1FFQA 3TTOA 1J18A 3AMDA 2WLYA 4U2ZA 1AQHA 4TOQA 1XRVA 3WD2A 1WZKA 2X09A 1E4IA 1K9DA 1GOMA 4F8XA 1W1VA 3SUTA 3DYOA 5GNYA 1U2YA 4C7GA 1HXJA 4GZIA 1MXGA 2WAGA 4WJXA 2VTFA 2CXGA 2CCRA 4E8CA 3N15A 4GZEA 4PCTA 5KEZA 2WMJA 1GNXA 1UWSA 2VZVA 3AIEA 4M8UA 1I1XA 4KMQA 1QI4A 4MAZA 4U5IA 4H8HA 4M1RA 2WC4A 3L4TA 4EK7A 1V02E 1WO2A 1JI1A 3AZRA 3BLPX 4UFJA 4RE4A 1V03A 4DWSA 5BRPA 4M81A 3D5HA 2W67A 1W2PA 2DSWA 1JDCA 1XGZA 3ZQ9A 1EDQA 1LWJA 3OIHA 2VCAA 1GVYA 3VIPA 1UH2A 3EDEA 1W9BM 5CSYA 5GNXA 4F66A 3NYDA 1CBGA 4H2CA 1D7FA 5E70A 4PSRA 5ABFA 3WD0A 2X0HA 1KGWA 5ABFB 1JZ8A 4YPJA 3L4WA 4P7NA 3L4XA 4MB5A 9CGTA 2GDVA 1EO5A 3WDRA 1MW0A 4K68A 1R7AA 2NSXA 3UG4A 2AAAA 3QGVA 1JGIA 1UYQA 4TVDA 3VU2A 2PBGA 3ZSTA 1V3KA 1Z32X 2WZEA 1LG1A 2ESCA 5AYBA 2XFRA 4ATDA 1WAWA
chains in the Genus database with same CATH superfamily
4W7WA 1A3WA 1DJHA 4DRKA 2WC3A 4IIDA 3LI0A 3ARSA 3G1DA 1HJUA 4HSHA 4XQ6A 3WUBA 4N6FA 1V7YA 2CFFA 1W1ZA 1UBPC 5DRCA 3H2OA 3KBSA 2MLZA 1KO0A 4HPXA 2X2YA 2XN1A 1K4HA 4HZ7A 1VHNA 1FXQA 1YX1A 4NAFA 4O54A 3SSZA 3GR7A 2M2AA 5DF0A 3FS2A 4XAGA 2X0YA 2ICSA 2HPMA 4UXDA 3RG6A 4DY1A 2NVAA 3GTNA 3EWXA 4DM1A 2GSJA 1WXYA 1SU5A 3T7VA 1IGWA 3VINA 1TTQA 2F9RA 1O6IA 3PP7A 4MWAA 2Z2BA 4JEJA 1J8VA 1JD7A 2OEMA 4PUJA 2O4MA 3ODKA 4YTQA 3W26A 1CECA 3W82A 1SYTA 3N13A 4A8RA 3WJXA 1UR1A 1W91A 3CWOX 2XDFA 3TK7A 2E9LA 1XYMA 1HJQA 1Q6RA 5I02A 2WHJA 4PTXA 3IK2A 1VRDA 1Z6KA 5K7JA 5HUPA 1ODUA 1KXHA 5F4SA 1IEIA 4DEFA 3VDBA 3BMVA 4S1FA 3RNDA 3SZ8A 1KFEA 1PEZA 5GJNA 4AAJA 4MKVA 5U7SA 2WHLA 2QJJA 1R38A 2HXUA 5CLWA 3FX4A 3MSDA 5CPSA 2PGEA 4O0KA 4IQLA 3VI2A 4C1LA 1VEOA 4TU1A 4WGHA 1KXTA 3KDOA 3TW9A 4LX4A 4OT7A 3B0XA 3I6TA 3SBFA 3MHGA 1D2KA 2PLCA 3G1AA 2WOQA 2OKTA 3A5VA 3KRBA 1OFRA 4ZSTA 4O18A 4KCTA 2J4GA 2CZDA 2GJNA 5MHBA 2ZQSA 4IGMA 1QO2A 1PTGA 2PI6A 3ORWA 1WV2A 3UWQA 5BOEA 3KAHA 1KBJA 3BE7A 4A4AA 5I6SA 4LS1A 4S23A 5AHLA 5A8GA 3O5DA 2FZDA 1QAPA 3W7JA 4IP5A 3ZS4A 3QQWA 3RFWA 2VZSA 2Z25A 4HB7A 3S5ZA 2NV1A 4K7VA 2OB3A 2ZE0A 3TYUA 4MTVA 4DM2A 4AD5A 4CD5A 3CPRA 1X38A 2YCIX 3W02A 2XP7A 1TPDA 4HD5A 3M41A 2DSKA 1FD9A 2PBCA 3BWWA 3H6OA 4M3PA 2ZR4A 1GVEA 8TIMA 5LIYX 3P93A 1VYPX 2GOUA 4QS6A 4FI4A 4F48A 3LLXA 1RJPA 1QHOA 4UTTC 4PCFA 3VNLA 4S3JA 4DH0A 3SQLA 3H12A 1R6WA 2OVLA 1RD6A 5GNZA 2ZUWA 1W3HA 5AB3A 1JJKA 3LPFA 4Q8MA 5DCEA 3BDKA 3EX2A 3N9RA 2FMOA 3C2EA 3OG2A 3NL3A 1UWQA 1I9CB 3HFYA 2PV3A 1DWIM 1QPKA 3T0BA 3WFLA 2P76A 4AZCA 2OWWA 1YDYA 4JTQA 4UUIA 3GIPA 3GW3A 3ONBA 3OZOA 4LT9A 2OG9A 3SN0A 2V3DA 1QBAA 2B0MA 4RUBA 3SCOA 2PRHA 1PCWA 3AHTA 3NEVA 2A5HA 4WSJA 5H6HA 2GGGA 3OQ8A 4UR8A 2OQLA 5K9CA 3EXSA 1E3XA 4LVDA 3VIHA 4QXIA 3E2QA 1QHPA 2KFWA 3WF2A 3NL5A 4X60A 3TLLA 4PRWA 4YTSA 2QKFA 2GK1A 3RYSA 2NX3A 1HQTA 3SI9A 3H7RA 2E6AA 2DG3A 3PSWA 2J88A 5D2WA 3OOBA 4YLWA 2RDTA 1H7OA 2D24A 2XM2A 4YYFA 1BL4A 4MMWA 4W9TA 1CNVA 4G7EA 3WD3A 3LU2A 5JVLA 1DIKA 1S46A 4IMAA 3UA4A 3ECQA 3C8FA 1JQVA 4GQGA 3BV4A 4MPQA 2PU1A 3WF0A 3GIYA 2NT0A 5EGRA 4H6QA 4UDMA 1D8WA 4GIRA 4PGLA 1WKEA 4CD6A 1EOKA 3EKLA 1WBJA 4P7LA 1Q4WA 5CC6A 3L4YA 4KGLA 1EL3A 4KWSA 2HVMA 4IPJA 3G1YA 4XD3A 1BRLB 2X8RA 5I07A 4N6EA 4J3XA 2PZ0A 1AW2A 2WMIA 4KEZA 4GYKA 3CUJA 2YIHA 2PWVA 2Q3RA 1DKWA 3EPMA 2GJXB 1O1HA 5LXEA 2HJPA 3FSUA 1J0KA 1DHPA 1KB3A 4DNHA 4N9BA 1TR1A 2OLHA 3NQCA 1Z3NA 4J3WA 5D33A 1UH3A 2IXUA 4IMFA 4MNLA 1DXEA 3RU8X 1TRIA 2DJLA 4DIPA 3QJAA 3K4DA 1NM9A 1EHNA 3C4UA 4P7OA 3VCNA 3ES7A 4ZTYA 3BW3A 1OM0A 4O53A 4LB3A 2RFGA 2MANA 2OSXA 4ROPA 4YVXA 4AXKA 1UPPA 5EMUA 3CHDA 2BP1A 5DBTA 1XUUA 2BOGX 4PMOA 3RXZA 3TONA 2Z6JA 2GQ8A 2XVLA 3QVQA 3O6CA 4AZ6A 2B7OA 1XLLA 3TROA 3C61A 1FP8A 1FKJA 4AIOA 3VILA 4CQDA 4EWND 1ZCNA 3C2YA 1F4HA 2PC4A 4O19A 3BMXA 2VVNA 3FDKA 5HW6A 1GTEA 4MF4A 2J7BA 5CSSA 2VGBA 3BAWA 3EAUA 4AW7A 1TVLA 3PSVA 2QCNA 2X0SA 1CYGA 1DJQA 3GDBA 3H7UA 2F61A 1EZ2A 1TTIA 1P4CA 2ZUVA 2GFTA 1PZ0A 2L5HA 2CITA 2WZMA 3VGHA 3JW7A 2MNTA 4K6AA 3SN1A 1BAGA 4HKPA 1FCBA 3FEQA 4RV3A 3TC6A 3B0YA 3JZUA 4JXCA 1A3XA 3U2EA 1C3FA 2WYSA 2GQ3A 1CGTA 1UWUA 1Q85A 3KAFA 1BVNP 3HGRA 2YB1A 3JVAA 2P3ZA 3ID7A 1M53A 2ZZ4A 3JYMA 1WDQA 3R4IA 1W3LA 1LROA 2VMFA 1H1YA 1VBHA 3T9PA 3VTRA 3SCWA 4WKFA 2XSBA 2AAMA 3RLGA 1LP6A 3C52A 4D6EA 4K3ZA 2FB3A 2C1GA 1AK5A 3W73A 3HPZA 3ZT6A 1OGBA 2Z2AA 1EP1A 1P43A 3LTYA 4WRHA 4PRTA 1CLKA 3TMQA 4UC5A 5DRIA 3HQ1A 2PPPA 1ZS2A 4UNIA 9RUBA 1SR0A 1BYDA 2PWGA 4WOQA 1CCWB 1NFBA 3P8JA 3LHWA 4MWAC 1UD3A 4C1NB 3S47A 1ZP4A 3BC9A 1KA9F 1K7XA 5H8MA 2Z24A 1GOQA 4KW2A 3S6TA 3QHMA 3M16A 1ITQA 5C8BB 2PDXA 4F79A 3NPWA 5FACA 4C1KA 1FOBA 4S3KA 1QRQA 1NMWA 3U3HA 2VCBA 3EXTA 3IIXA 2QMKA 1NQ6A 3MBDA 1W5MA 4LRTA 3OLIA 1QZ2A 3R8RA 4UTUA 4B5UA 4LAWA 2DP3A 2HBXA 5DANA 1IXQA 3W7DA 2VX6A 1JZ2A 3SO7A 3KTSA 3BLEA 1V3IA 1SVDA 2Y5EA 3A6OA 4G8TA 4EPKA 2PE4A 1VS1A 3DERA 4R85A 3A23A 1UKOA 2VX5A 1UUQA 4LUYA 1QOPA 1YRRA 3SDOA 2V5LA 3GHSA 3WF1A 4GJJA 1GEHA 4LYPA 3RJXA 1JD9A 2HS8A 1R2SA 4BWLC 4R33A 1IR2A 4C02B 2OGJA 3UGRA 2ISWA 2FH8A 3LCLA 3IVTA 6TIMA 2Z1SA 3UXIA 1JPDX 3G18A 3VIOA 3GG0A 2XP4A 3ME3A 5CZ0A 4NXSA 1OIFA 3NQGA 3O0KA 3ZSSA 1A0DA 3H2AA 3WLPA 4LNCA 2UY2A 3CQJA 3CGTA 1IT8A 2ZDRA 3TP4A 3GXIA 3MU7A 5HUOA 3S9ZA 1L6SA 4ZQMA 4HVXA 5AC4A 3IIVA 3VMOA 3ANVA 3KRSA 1VF8A 5ABGA 4C90A 4O2TA 1OC5A 5E09A 3HG5A 3DDMA 4LY4A 1NWSA 4WX2A 4S39A 2PD5A 4XB3A 2CETA 2ZUNA 5DMNA 1V6UA 2OEJA 1UHVA 2QJNA 5CPLA 4UFKA 6XIAA 3TDBA 1WDPA 2NXHA 2VYOA 1F5ZA 3MUXA 1GRJA 4E3VA 1T6MA 3FY1A 3MO7A 2EQDA 4OUIA 3MC5A 1JAKA 4PL1A 1FHVA 3M43A 1TQXA 1FWTA 2PP1A 1PS9A 1FKXA 1RBAA 2CLEA 4HBEA 4XAYA 4NP7A 3PTQA 3QHNA 4HSNA 1D7HA 1D6OA 1B2YA 2Z1BA 4WDXA 4LY8A 2PWDA 3B8WA 1EUAA 4BI5A 5CZTA 4KEVA 1W1YA 1BGAA 5D9MA 1U30A 5A95A 4RDYA 1GQKA 2Y8KA 3FLUA 7CGTA 1E71M 4GWEA 1H11A 1C7TA 3WQ5A 4ORMA 2X1IA 2Y85A 1PKLA 2RDWA 2XVKA 1TPH1 3FYOA 2CBUA 1OADA 4RX0A 3W01A 4DF2A 4Q8PA 1H60A 2UZ9A 1OYBA 4O8RA 4FP1A 1XYZA 1HF6A 4DRQA 4AC7C 3EOLA 4GJIA 1VFLA 1X97A 4UTWC 4N42A 1U83A 3R94A 4GABA 3N2MA 3E5BA 4MLJA 6PTDA 3V1HA 3WNKA 3I6EA 3QMTA 3AWOA 4J3SA 5EMMA 3VE9A 2XP6A 3CV7A 3GAKA 3FN9A 4QE4A 1X1OA 3BV7A 4A05A 5F2GA 2J8FA 3R7MA 1GG0A 1KM3A 5T9BG 1JPIA 5DN1A 2ZQVA 1GOOA 2J6XA 3DFHA 4ZOCA 3LX9A 1GWJA 4I6VA 1HKWA 1WX0A 5ENLA 4AZGA 4H3DA 4GNKB 2GGJA 5BMXA 2OX1A 2Y7DA 2VQUA 4GXPA 4DPPA 3VNMA 2ZX6A 2JK2A 3OODA 3IJLA 4MSSA 3EOEA 4BF5A 1NVMA 2EKCA 3NFUA 4ZS6A 4LH8A 4MG4A 4BEUA 3AAMA 1JGMA 4C6NA 3GTHA 3TTYA 2QZRA 3GYEA 1EJWC 5LGXA 1UZ1A 1XYLA 1SFTA 1E6XM 4ZQRA 1UR0A 5LYRA 2PDPA 2JKAA 3WQFA 2D0FA 3WL0A 5D9PA 3HGOA 3KCJA 3WBYA 2ZIDA 3S5YA 2XP8A 3MHFA 2AQVA 5C9UA 5F2LA 2NUWA 3B9NA 2V3GA 3PS7A 2F6XA 3SFWA 4LYKA 1DTUA 3FJNA 2A2IA 4TVUA 1JCXA 1TMHA 1XQKA 3CU2A 3HB9A 2YBTA 3BG5A 3ZR6A 4R0XA 5HDRA 5E9XA 2OWXA 1MQPA 3RJYA 3K1DA 4QGCA 1EF3A 3FCPA 4FNSA 4Z2IA 1XI3A 1TE1A 2GPTA 2Y4SA 4Y2WA 2BVWA 4WSHA 1W26A 5GQBA 1IIGA 3PB0A 4L5ZA 1RVGA 3DESA 3C2FA 1PB0A 4AD4A 3GVRA 3LRKA 4EVZA 4G2PA 1IR1A 3E38A 3G6LA 2F8QA 4Q8UA 3PPGA 2XH7A 2CLHA 4Y9MA 3QZEA 2EPHA 1S38A 4FLQA 2A3AA 4CNOA 2G97A 4PC8A 2YFNA 4G9PA 3TCSA 3WQGA 3MKVA 1E9LA 2PN0A 1A0CA 2D73A 3F4NA 3M1ZA 2IPJA 1O12A 4O1DA 4TV6A 3TNOA 1XIBA 1XLFA 4PTMA 1J0JA 2Y5SA 2R24A 4LAMA 3KCEA 3APGA 3MW7A 1XYCA 4EPDC 4O1AA 1QK0A 1R2RA 1OGGA 3O5KA 1K8ZA 3GXTA 4AVOA 2ZZ3A 2UBPC 3HPFA 2B7QA 3I7RA 3LGEA 5EL1A 4PUUA 2Z7GA 4CQAA 3GNOA 2X41A 1JYXA 3CB8A 1E6SM 1R9ZA 2E5CA 2ZX8A 2PUZA 2J7GA 4GFSA 2JQXA 4JFJA 1TIWA 3S3GA 3AUOA 4PUEA 3B40A 3T4WA 4QJ5B 2V68A 3L0KA 3LPGA 1DE6A 3VC6A 1KT0A 5HJLA 1T41A 3GD6A 1U5VA 1S1PA 4U28A 4K8HA 1XJBA 1XSIA 4PTVA 2QGHA 4LAUA 3HV8A 4O12A 2Y2WA 1SO6A 3TFXA 5AYXA 1GUVA 3MI6A 5HMDA 1LDCA 2XTKA 2INFA 3CL6A 4QROA 5E93A 2OYMA 4C5ZA 4KRZA 2IKGA 2EJ1A 1BTCA 4LVAA 5FI8A 3ITYA 4CNNA 1EEXA 3IJ6A 2KI3A 5CJNA 2QVNA 1G94A 2WKJA 2UY5A 2R9RA 4UNKA 3DFYA 3CAVA 1E4MM 1I75A 1JXJA 5D30A 4MNMA 5KSWA 3AS1A 1HJXA 1M41A 3NZPA 4P7QA 1RLDA 2ZXAA 3LV5A 4S2CA 2QQ6A 1QO5A 1XFCA 3LERA 4I7VA 3NPXA 4ZA0A 4JFIA 2V5CA 5FJOA 4QBXA 1CZ1A 1XDJA 2WVUA 2VO5A 1MUMA 4TUFA 1SMDA 2VELA 1ZP3A 2OWCA 4H9MA 3HQPA 4AZ7A 1FKWA 4C6LA 4UZUA 1RQHA 3T44A 4JX5A 4W89A 1ZJAA 3L4UA 2PDHA 3LLFA 2J24A 4UBPC 3EX1A 2VD8A 4C6OA 1BTMA 2QYGA 2IKJA 3H2NA 2PWEA 4PN2A 4L4MA 3W22A 3K30A 1THFD 5GJMA 3I65A 3WNMA 2ADAA 4IT6A 1VFUA 2KE0A 1C9HA 5AECA 5DXYA 4M29A 3DGBA 3VDAA 1HGYA 2HSAA 4AEFA 4G5DA 3DZ1A 1TPC1 1OWQA 3GY1A 2QVHA 3BXWA 4Z1DA 4RXGA 1W2VA 4GUFA 4B92A 4W8AA 4Y9AA 1ZJBA 2E9BA 1X7IA 2ZADA 3ZOAA 1K6WA 5F4WA 2VC6A 1TB3A 1WXJA 3OVPA 1JAEA 3B03A 1VJZA 1CXLA 2OO0A 1KXVA 3W53A 2P50A 4IFOA 1B3WA 3NCOA 3VFLA 1RQBA 1V0MA 3S1UA 2EEXA 3QEZA 2RJHA 2WXDM 3MDWA 4O17A 3WNPA 5K4XA 4Q8VA 5I0DA 1YNQA 4PA8A 3U5UA 1Z42A 3HN3A 2PDWA 3V5OA 4JIEA 2ZTJA 5B7YA 1Q1CA 4IJBA 5K9DA 2O9PA 2ZA1A 1DE5A 3T0TA 1TWIA 3EB2A 4JFVA 1CB7B 2YCLB 3AZSA 3QFWA 5A6TC 1G4EA 4LV9A 3WK3A 5A8OA 2IPGA 3Q2DA 4HU8A 6ENLA 3EX3A 4HPGA 3FAWA 4J1OA 2XIMA 1WKDA 3R0DA 1F76A 4LCRA 1BYBA 3HGSA 2YXGA 1H7RA 3REQB 1NDWA 3WDPP 1BGGA 2VFDA 3CGNA 4JBRA 1BWLA 4OOZA 4YHGA 5CG0A 4GISA 2QR6A 1QI3A 1YW5A 1Q6EA 1DV7A 5F2MA 1QVBA 4DJDC 4G6CA 4PMRA 2FKPA 2VFGA 1UOZA 3GG8A 3PC0A 5JIPA 1QNOA 4HN4A 1LUCA 5FL1A 2PLKA 1QPRA 3WH0A 4OUEA 1FKDA 4XKMA 2JBMA 2V0TA 3MUZ1 1TPFA 4YL2A 1ADSA 2VXNA 3U2OA 1H62A 3CZ8A 1NOWA 5FA5A 1YE6A 1MWOA 1UOKA 4HYRA 5F1UA 4TR9A 3I4KA 4PBGA 4PUNA 3W81A 1NWTA 2Q5AA 2YYUA 4RW3A 1Q8AA 3L66A 5C7VA 1DWGM 4FO4A 1DJZA 2IS7A 2QJGA 4DRNA 2YLAA 2EXOA 1PE1A 2VOMA 1T0OA 3UZXA 2C0HA 2WPGA 2OODA 4FN2A 3FYYA 1XISA 3UJFA 1ECEA 1F9CA 1EX1A 4B4FA 3UPBA 5HPOA 3WMBA 3GRIA 1BF6A 2JEQA 1K3UA 2RH9A 2F6KA 3QSTA 1OBAA 4OGZA 3TAOA 3G0UA 3U0HA 3LNMA 4QDWA 3WDIA 2Y7FA 4K1WA 2XGZA 1TMQA 1DIDA 3B7XA 4HJWA 4B5XA 2PSNA 4GX9A 3JRKA 2YB4A 4CQ9A 1XBYA 5A94A 1IT7A 4D2JA 2P88A 4B91A 5AC7A 2DH2A 3OB8A 1WZAA 2PCEA 1XIDA 3PG8A 5E5CA 1D7KA 1MI3A 4JGDA 3DFQA 4JTEA 5KZEA 4DXXA 5FAJA 1CDGA 1JCJA 2J66A 5EMLA 4GY0A 1KLZA 2ZZ5A 4L1GA 4QSFA 5C0QA 1BWKA 1K70A 1TELA 1YQ2A 3G3DA 1YXDA 4IT1A 3AC0A 3GC4A 1TRDA 3CMGA 4DZAA 2H8XA 2J78A 2ATMA 1D7JA 1R85A 2Q71A 2XN2A 2PDMA 1N8WA 2DUZA 3GM8A 3W23A 4XO7A 3EGJA 2F4EA 2I5QA 3A3XA 4CN1A 3SCUA 2VJXA 3RILA 3DFOA 4REQA 1Z7AA 1TYGA 3RK8A 2OCZA 4KFPA 5JIWA 1MEHA 1FKHA 4GH1A 1YXYA 4I5UA 2FGLA 5AHEA 2PDQA 3M5ZA 3ONCA 2PDBA 3KL0A 1XD1A 1IE7C 3QV9A 5FF4A 1ITUA 3E12A 3NNTA 2JF7A 1I60A 4IMEA 5KINA 1LBFA 5FJIA 4JCMA 4U3AA 4ZFMA 4LC8A 1LRNA 4B3ZA 4MJZA 5PTDA 1JYVA 2PV1A 5CQ1A 1VIWA 3KBWA 4NZ5A 4K38A 2OZ8A 4M5PA 4LPCA 3R11A 1Z9AA 4GYPC 3SUVA 3VIKA 1AW5A 3WDJA 4BFAA 4O8AA 5CAHA 1DTNA 4BF8A 2I57A 2Z1XA 5J8LA 2QT3A 3PWAA 4AIBA 1Q2SA 3AI0A 1TZZA 2CPUA 2Q6ZA 2BODX 1U1HA 2BXYA 1LT8A 4JOMA 2W63A 1WZLA 4QS5A 2WMFA 1KCXA 1T99A 3WLIA 4GZJA 4OKDA 4TTUA 2CESA 2KGJA 1SZGA 1IWBA 4MADA 3W88A 3N29A 4LGXA 1ODZA 2P0OA 3DFSA 2HE5A 4JYEA 2XH4A 1LORA 4DJFA 1VB9A 2A3CA 3L2IA 4OE7A 5DXXA 4PMZA 3UVIA 4F0KA 2WCGA 5FKYA 4L9XA 3S1XA 4LWWA 2WMKA 1QW8A 5T91A 3ZVIA 2WSPA 2IPWA 3PZ9A 4HNLA 2Y89A 5C2CA 1BKSA 1W54A 4LCQA 3WBEA 3BAIA 4QE5A 4FXSA 4PMYA 3VCRA 1VCFA 1FAPA 1TG7A 1E0VA 1RCXB 1QOQA 1XRFA 1UR8A 5JXQA 3P81A 3WN6A 1A5OC 1LOLA 1H1ZA 1MXSA 4L9YA 1UP3A 2I5IA 4O0QA 1ZZMA 6XIMA 1B5TA 1FH9A 1MRAA 4JQ2A 2FB2A 4NHVA 2XGBA 5A6AA 3DUGA 2CLLA 1E9IA 5G2IA 5H8PA 1JNEA 5BYWA 4Z2JA 5CPNA 1TWDA 2OZ0A 4H8UA 4V15A 2G3MA 5HUAA 4YTUA 3WLLA 4F0LA 1TPWA 3N18A 2ALDA 1DIOA 4PMUA 4H7CA 4IJCA 2V8ZA 4IL0A 4US6A 4CVUA 1Z69A 3OVGA 2NVDA 3LDVA 1PWLA 3M07A 2C1IA 4P8WA 1V3JA 1BPLB 5HJYA 1FFQA 3DN5A 1XIJA 3WK0A 3O7UA 2PGRA 4XZHA 4TOQA 1R3VA 4TW7A 2CLOA 3NQEA 1WZKA 4MUZA 2RSEA 2X09A 2WSQA 1K9DA 1IF2A 3ABXA 1W1VA 3SUTA 3QM3A 3WLJA 4R53A 3GHTA 1E9ZB 2GQAA 4POCA 4ZCWA 5BWAA 3W7HA 2V67A 2OX4A 1V8EA 3RPDA 4RNFA 4GZEA 1X6UA 1Y0EA 2VZVA 3D46A 1I1XA 1QI4A 4MAZA 2ZRYA 4U5IA 4XIAA 3W2NA 3LTPA 2QDHA 5IBXA 3INPA 1KRCC 1YNYA 4JYSA 3FVMA 1V03A 4CCZA 5BRPA 3BLIA 3D5HA 4GC3A 1XLKA 1XGZA 3F4CA 1P0KA 4PR4A 4AY8A 4DJFD 1LWJA 3OU8A 1W9BM 4ZQPA 1TJ0A 1M7JA 5IRPA 1D7FA 2GOKA 3WD0A 1KGWA 2X0HA 3ITTA 3O16A 4KQNA 2OLSA 5I03A 4P61A 1ZFJA 1UYQA 3ATZA 5K4ZA 2V82A 4LAKA 4NNRA 3LXBA 2XFRA 1R47A 5MKGB 3FEMA 4ATDA 2GUUA 3C3UA 1L0PA 4V1XA 5HA7A 4JNZA 4ERIA 5C5YA 2BS9A 2JF6A 2ZXQA 3OLGA 1DQUA 1V79A 1G7VA 1GZJA 2W27A 3N3TA 1Z44A 4PTDA 3HO8A 3MYPA 3IKDA 1XBVA 3O06A 3WJZA 5A6MA 3XIMA 2YBVA 4XZBA 1S1RA 5AVHA 1MNSA 4X0VA 1PINA 2ZCGA 4TMBA 3O05A 1XGDA 3ZJ7A 1E15A 4TW6A 3GZAA 4HCLA 3P2VA 3QLLA 3RF9A 2CXEA 5G1YA 1XC4A 2QUTA 4I9JA 4HP5A 3RUBL 4HA4A 3I4EA 5HAOA 5BMWA 4K39A 1DJNA 3STFA 3NR0A 1L6FA 3T0DA 2VX7A 1PX8A 2VURA 1IX5A 4H9TA 1PDYA 4O52A 4E2BA 3SUWA 1MUWA 2CLIA 1G4SA 4U33A 4JICA 3PJUA 3ZZ1A 1HL2A 3E96A 1KW1A 3DG3A 5A5WA 4XZLX 3RR1A 1XLEA 1KM6A 4DRIA 1YW1A 1CX9A 1EH9A 1ZJIA 4N4QA 4P7RA 4M7TA 4KETA 1DXFA 5D9OA 3TYZA 1W1TA 2Z27A 1C93A 1E72M 1VBUA 3VMPA 5F4XA 3GDKA 2FHFA 5C55A 3D47A 1QPFA 3UI4A 4FR6A 3PAOA 1OYAA 3SFKA 4H4IA 4EOUA 3WY1A 3M6YA 4Z2KA 3W1TA 2B81A 3B0VC 3GHUA 3O5FA 1M3UA 1BXCA 3MV11 5E0KA 3MMWA 3IACA 4LEQA 3PANA 4HPNA 1ZTVA 3GTIA 4DNMA 5CZJA 1F40A 1OFEA 4F0SA 4CGTA 2WKGA 1TJ2A 3QGKC 3E0WA 4RKAA 1RD5A 5FESA 4LBSA 3MV01 4ADTA 4QEEA 2JZVA 2Z1VA 2HEJA 2J7DA 2CHRA 1KGUA 3EOSA 3VOGA 3EDKA 3B9OA 4WOZA 3ZVHA 4Z2HA 4QITA 4OECA 4MJMA 3SN4A 4BQ2A 4GY1A 3HIJA 5E6ZA 4W7VA 3WLNA 3F4WA 2WBKA 3TH6A 3WLOA 4DXKA 4ACYA 5DMYA 4JQAA 5C9ZA 4J2MA 2QPSA 3HM7A 4DO4A 5CCZA 3W7QA 3VD3A 2X1RA 4N9DA 1SZNA 3AXMA 3EY6A 3VIJA 5TIMA 3FSTA 1R87A 4F4RA 2QLYA 5BXJA 3CQHA 3KX6A 2REQA 1ME8A 4OVXA 3V75A 4E2DA 1IEVA 1EC9A 1V51A 3LPPA 1OG0A 4TX9A 1Q7ZA 2BZNA 2QDEA 4E6MA 1QPOA 1MO0A 3IS4A 1GKRA 3R0UA 1A53A 1JDEA 2F2KA 4M19A 1ELSA 1XC6A 1BG9A 3NPUA 3LBCA 2O4QA 2NQ5A 3WQEA 1UMYA 4KFNA 3O5LA 5ABTA 2CC0A 1TCMA 3URNA 1QASA 2FDMA 2R94A 2YL6A 4AB4A 2CZEA 4QQ3A 1I2OA 2QCMA 3TWAA 2BMBA 1MFVA 1JCLA 2X05A 3ELFA 3N2OA 4ZXLA 1ZBKA 2MNRA 3GXNA 1V7AA 3PBUA 1OZMA 2CNCA 4ZFCA 3M0ZA 3RPMA 1YDVA 4GGBA 1FCUA 3E6EA 3L23A 1KRAC 3NGFA 3QHOA 1R9XA 3B8DA 1MQQA 3QPZA 4AD3A 4DVOA 4RL3A 4AU0A 3O2LA 2PWUA 1F7BA 2XIQA 4IIHA 5LZLA 3GIQA 2Q3OA 1C8XA 5E9AA 2GGEA 2YL9A 3M7SA 1IHIA 3PNUA 7TAAA 1M7OA 1TV4A 1AFSA 4ICCX 3NVTA 3KLLA 2PDJA 3L0GA 3OP2A 5J6EA 1VBJA 1V6VA 3JUGA 1ONWA 2GUYA 3RGTA 1JQXA 3WZ0E 4A8LA 1Q3NA 3W7GA 3NZ1A 1EP2A 4J4OA 4AX6A 1XYBA 2YFOA 3BG3A 4JHZA 1OC7A 2AMXA 3T81A 2EPLX 4GI6A 3O5MA 4TYOA 4ILSA 1UKTA 2Q09A 4C6CA 1JFXA 3FK4A 2PWHA 1TV7A 3IUHA 3TA6A 4M6PA 9XIAA 1GK8A 5IOBA 4ZO9A 1A5AA 4YN5A 1LL6A 5GPGA 3VGGA 3UGVA 3AS2A 4QT2A 4MWAE 3BGJA 1FRBA 4XIMA 1VBGA 1FVPA 3CAKA 1TZ9A 3UR8A 2OZTA 5B8IC 4U86A 3HOJA 2DZAA 4AZCB 4UQBA 4K2SA 2RUCA 1M1BA 5DLCA 3WUEA 2I5GA 2Y8VA 3QYSA 1I2NA 4FNRA 4ALDA 1HJSA 5HT1A 2W66A 2OSWA 4HNCA 4Z2LA 3ARWA 3SRFA 5D2YA 3IV8A 3H53A 4IQJA 1Z8AA 5M3WA 7ODCA 2QUNA 4QSHA 1V77A 1ZY9A 1OK4A 4C6KA 5D02A 2C19A 2Y7GA 3KCLA 3VM5A 1X8FA 2GK1B 2O7QA 2AL1A 1CXKA 2BASA 5LIUX 3SSJA 3S5OA 2VFIA 1IWAA 2BNJA 4QT3A 1JCTA 3E2SA 4HA3A 2PDIA 3ZM8A 2E8YA 4LXFA 1H41A 3AXIA 3ZO9A 4OWGA 4ZR8A 2R1KA 3WCZA 1OB0A 4A35A 4Z0SA 5EMYA 3EA2A 1L8NA 1OYCA 1EJRC 1J10A 3LN3A 5H2ZA 2AKZA 3D3AA 4RJEA 1RK5A 1O95A 1GQLA 3IJDA 1OD0A 2DY3A 1KV5A 3TUUA 3PZUA 5M03A 1E6PA 1CW2A 4GUJA 2N87A 2FZBA 3AHZA 3CYVA 2VL4A 3BW4A 2BGNE 3GKFA 4HNVA 3T8QA 2OR2A 1DHKA 4Q8NA 5DO8A 5CBIA 2P3EA 4BA0A 3W7OA 2GDUA 4XAFA 3NXLA 1PZ3A 1C29A 3VPLA 2XFYA 3RITA 1TZ7A 4QG6A 4E2OA 1V0NA 4IXXA 1F07A 1JRBA 2BY0A 5DQPA 3MSYA 4I9TA 2QDGA 4W5ZA 3WMCA 4B9YA 3KWXA 2G4FA 1AD4A 4CEXC 2BGSA 4CN4A 3M5XA 4QDPA 1WDWA 4C6QA 4QLKA 1S5NA 1DPMA 5BXPA 1ONRA 3UWUA 1G69A 5LA2A 3ICJA 4B5NA 3GVGA 1TO3A 3CQKA 3EWCA 4AH7A 4EACA 3M0IA 4YHEA 3R6IA 4NNBA 4ACZB 2ZA3A 3S4TA 3YPIA 1YNPA 2ZQ0A 3RX3A 1F2JA 5AFDA 3ABOA 1KKOA 4ZENA 1KFBA 3CASA 3WQWA 1X98A 4Z42C 2E8ZA 1LG2A 3AIVA 1BF2A 3AHVA 1FDJA 1XFBA 4N0RA 4GI8A 4ENLA 3VKKA 1BRLA 2O56A 1F3TA 4MY8A 3GX9A 3DC0A 1QK2A 2BV9A 4RZ6A 1UD8A 3GVWA 2J7FA 2ZZ2A 2D2JA 1AJ0A 1F3XA 2O9OA 4XD4A 1GW1A 3G1VA 3QPYA 2VN1A 4V2XA 2DZVA 4ZMGA 1RCQA 4Y9NA 4R9OA 1W9VA 4GGHA 2H90A 1RA5A 3LHTA 3NWRA 4XKYA 3G6MA 1F74A 1FCVA 1ZGDA 2Y61A 1KTNA 3S46A 3F1QA 1F3WA 3UCDA 3KVJA 4EF8A 3QTGA 5A6LA 1EPXA 4FIQA 3WFZA 3FOKA 3PK7A 4J3ZA 3SADA 5GVJA 5HWMA 4EPEC 3UQAA 4DYJA 1B3VA 3LCGA 5CC7A 1WA3A 3AFBA 3Q65A 5C9WA 3CEPA 4L4LA 4PUMA 4QZVB 2NXGA 1W1A1 1RH9A 5JUVA 4Q32A 3R0KA 5K9XA 4C1NA 1LLZA 4AZIA 4GGQA 4AQLA 3GDLA 3UZJA 1OFAA 3UXDA 4FAPA 4JHMA 3TSDA 3NAVA 4ORIA 3V35A 1WNOA 1IGSA 4LALA 2E6DA 3LGGA 4AG0A 2FIQA 4ZO7A 2G3JA 4WDWA 1OZQA 2WNNA 2I17A 5I09A 3T1GA 5CG7A 4G7FA 4PMNA 4JTTA 1TVPA 4F3HA 3BQ5A 3BOXA 3Q4DA 3CTLA 3PTKA 3WMSA 1B9BA 2QPXA 2CLFA 4GCXA 2QW5A 5ECVA 3EPNA 2QUUA 3W87A 1KR1A 1VFTA 2QCEA 3PZOA 3BW2A 4LQ1A 2PU0A 1ISZA 3RR4A 3U5YA 1OT1A 3B8IA 1JI2A 3B8VA 1ZAHA 4LRSA 3A4WA 1U33A 1ADOA 3AU6A 3LQLA 2ZICA 1VLIA 4X2PA 2VGGA 3AIUA 4ZO8A 2VEGA 1F6YA 1HGWA 4AHPA 2RKXA 3SUUA 9XIMA 4LU0A 4J4NA 4G50A 2OOFA 4V28A 2YR1A 3BJTA 5ABHA 4OZOA 3BSGA 1VC4A 4DUWA 2DEPA 4DUXA 1W17A 4M6QA 4U10A 4Q4OA 4IICA 1D3CA 1MZRA 4RDVA 4C6PA 3QLDA 1MW2A 1G4PA 3VDHA 1TV3A 1A3HA 3BSMA 5EB8A 2EO7A 2D2OA 4IIBA 3PUEA 2G41A 5BU9A 2P8BA 5I2UA 1M9HA 3RRXA 2VT0A 3W86A 4GK8A 4DRSA 1R2TA 1RY8A 1SO3A 2XH2A 2REQB 4RW5A 1DWJM 2NX9A 3BZGA 3GXDA 1JF5A 3HGJA 1PO9A 5HNNA 1XM3A 2EBNA 4A3HA 2BHZA 3C86A 1QXLA 3QKZA 3IK8A 4B5WA 1FXPA 4EKJA 4RZ4A 4QIBA 1OINA 4NJIA 3W1LA 3RMEA 4Q3MA 3R89A 3MKCA 4XZNX 1EYMA 3BOFA 1JRCA 2GJXA 2LKNA 3WQVA 3N6QA 3NGJA 3WK2A 2RUSA 3GTFA 3LSCA 3EOUA 1OGSA 4B16A 2PP0A 2XSAA 3URAA 5IDIA 2X1SA 1JUKA 4IPLA 3P5ZA 4OBRA 1ISWA 3TJLA 4NQ1A 5AHIA 3W9ZA 3FIGA 1E73M 1OX4B 1V6TA 4J28A 4PE8A 5FF2A 3KW3A 3VK5A 2PV2A 2ODOA 3HA1A 5HATA 5KITA 3E0VA 4PEKA 2PBOA 3KE0A 5G2HA 1HO1A 4B15A 3S9IA 2ZTKA 1A4LA 1H7NA 4CQBA 1VKFA 1ZALA 3EPOA 1LL7A 1UD2A 3IV3A 3ALFA 4Q8QA 4JS3A 1J0IA 3DI0A 1VFSA 3B06A 3E1F1 4RCXA 1NP2A 2IQ0A 1KKRA 2ATSA 5EMJA 3DAQA 2YW3A 2DSVA 3B4UA 1OY0A 5CSUA 4X9SA 1SSGA 4DWSC 4WQ6A 2XN0A 1GEQA 1O94A 2V3FA 3VGFA 1ICSA 4IF2A 4JTHA 4JTRA 3G8EA 1Q6GA 5BRBA 1DL3A 1CXIA 1KLYA 4UQCA 3PZQA 4MYXA 4EP8C 2ZBTA 4OQVA 4JNMA 5I5RA 1XV8A 4QLJA 4FF7A 3WNOA 2QAPA 4UR7A 4D6GA 3IVUA 4IPNB 1QMLA 4IL2A 1B9ZA 1UZHA 1XBZA 4P2VA 1Q63A 4LBRA 3T4CA 4H04A 4CLMA 2VFHA 3PPFA 4FOUA 4YXGA 2GQ9A 4IMDA 3TYEA 3QY8A 3CHCA 2B7PA 4AHOA 5I06A 2E68A 4GLEA 4G1KA 1NH6A 5D4YA 1EYWA 2Y6ZA 2YCLA 3II1A 1NF0A 2X2GA 3WF3A 1E1CB 4Q4KA 4F9JA 2V3EA 1Y65A 1FWBC 2WANA 3TYBA 3OPSA 4B9ZA 2A3EA 4QCFA 3W84A 3QGAC 1DBTA 3TW7A 3PR9A 3LEPA 4E3TA 2X1TA 1O7AA 4C6FA 2PEVA 5HBFA 1H09A 4O15A 1RSCA 4WKAA 2ACRA 2ZA2A 2FVLA 4UOZA 2V2CA 1PDZA 4NKCA 1GOWA 1SJAA 5AYZA 2LGOA 3TC5A 4PODA 1XSJA 3QW4B 4WVXA 1U1JA 3CTTA 4GKTA 4N2YA 4FNUA 3MJMA 1RLCL 4JL2A 1J96A 1L2UA 3W2LA 4HMCA 1GHSA 3EZ4A 4GQQA 5G4WA 1JEZA 3LCHA 4Q4RA 1EGVA 4PMVA 5IHSA 1AW1A 4IHCA 3G8RA 2J9ZA 3U8GA 4IQ2A 3D0CA 3R2GA 2LJ4A 5IFTA 2JALA 2VZOA 3KAIA 4JFTA 2B5UB 2C3ZA 2EPMX 2NT1A 3W72A 1EYEA 1UROA 1AVAA 3B0PA 5CKSA 1O1ZA 3UY8A 1XD0A 2FVKA 3BCJA 3TIMA 4ZVJA 1MW3A 4MNKA 5D8ZA 2ITKA 3SY1A 1S5MA 5SWUA 5DCBA 3TWBA 3IJIA 3W7LA 4GPNA 1A5CA 1J9YA 1ITCA 4RE2A 1YLVA 3ZWTA 1A5KC 1U5HA 4RDWA 1LQ0A 3USZA 4GNVA 1XLIA 4B5SA 4PCSA 1H1NA 1HNYA 5DCDA 1F8IA 4LVGA 2KR7A 3M0KA 4HK6A 3CM4A 3PZNA 3RCNA 4Q22A 1FKBA 3FAXA 3LHYA 4DB7A 3GNNA 3P60A 7ENLA 1KCKA 1UP0A 1RBLA 3UJ2A 1CB2A 3IANA 3NIYA 3DKJA 3K4WA 4CUCA 1XDLA 4DI8A 3N2TA 3GR8A 2W5FA 1AZ1A 4B5TA 3LXCA 6REQB 3WUGA 2C6QA 3RLUA 2QCLA 3M0XA 3Q67A 1AA1B 4HTYA 3IIPA 1O5KA 2EGZA 3CWNA 1FCQA 3PZMA 3QV8A 4DROA 3UJSA 1IXNA 4L64A 5DT5A 1JDDA 4H8VA 5FIPA 3PZGA 3WQ4A 4C91A 2LLEA 4ZB2A 3P14A 2QNEA 3IARA 3IGHX 5FL0A 4AXNA 2ISVA 2HXTA 1KFCA 4LYQA 2E5BA 2P10A 2GSHA 2Y62A 4R5EA 1KXQA 1ZUAX 8XIMA 3BL3A 3E0LA 2HMCA 4ICMA 4ZZ9A 2R91A 3PBYA 2A6NA 4WR3A 2EG8A 3LRLA 1EP3A 2MUCA 4CCEA 1H7WA 3A64A 2YA1A 3W7RA 4JKMA 1RK6A 1RP8A 3G1XA 2VQTA 2OSYA 2C14A 1HZYA 2DUAA 3C8NA 2A7NA 1TV2A 2E25A 4LUTB 3EDJA 2XGIA 4BY3A 3TZFA 2A7RA 1QW9A 1FWGC 3THCA 4XZIA 3UG3A 4H1ZA 4CU7A 4MOZA 3UJEA 2JKPA 3IIOA 3GW0A 1AQMA 1YBQB 3T2PA 4DLFA 1UW9A 3PY2A 4WCJA 5I3DA 3CUFA 3AYTA 4JIHA 2PRMA 4IG2B 3NRKA 1HG3A 2D3NA 3ITGA 4I3GA 1KQYA 3DHFA 3E49A 3EIPA 3RO6A 5GJPA 3GUWA 4LS2A 4QLLA 5A2AA 1VJIA 1G1YA 4PMDA 3SCTA 3NZGA 4JQ1A 2DSUA 7PTDA 3GLCA 4AWSA 4W9PA 4RDZA 4JFKA 5A6JA 1IV8A 4RK8A 2A3HA 5LA0A 3OZYA 3F2CA 5C54A 4LS0A 1EQCA 4JKKA 1M6JA 1A5BA 3KRZA 2PGFA 3H2FA 3IHZA 1OCNA 4GG9A 4FALA 2ZQUA 1RY0A 1MRQA 3W2KA 3K4AA 1EXPA 3IUDA 8RUCA 1Q6CA 3VX1A 1XL9A 2ZRUA 5FEXA 4CVWA 2EPNA 1CGXA 3NO1A 5JU6A 1XP3A 4LF2A 3TR2A 3PUGA 4JDYA 3KHJA 3LA4A 2CW6A 3WQ8A 2QS8A 4Q33A 1XLAA 1JUBA 3OQEA 1EJ7L 3OVRA 2GJRA 3L65A 4I6KA 3TXZA 3NSNA 1OT2A 3TW6A 2DIJA 4IIEA 3VGEA 1EDTA 3IUIA 4M6UA 3GVQA 3U9IA 3TYCA 3GR4A 4UFHA 4CU8A 4M24A 4P8UA 3L9CA 3BOLA 5IHRA 3QMRA 3I3EA 4HHPA 1E5JA 5DY3A 2A3BA 3IJ8A 4GJ1A 3LB0A 1LBMA 1Q45A 1LOQA 2DT0A 4X61A 3NG3A 4C65A 4X3ZA 3TN6A 3FA4A 3ZLHA 2WSRA 3EKZA 1FH8A 3HMCA 2JGQA 5I3HA 4KRTA 2GYIA 4DJFC 1VEPA 3T07A 2VR4A 1SZFA 1AH0A 4J27A 3TU9A 1FWSA 2CIPA 3I10A 4TX0A 4Y8EA 2PAJA 2XZ7A 1ZQ5A 3R13A 4OHQA 2E5DA 3NOEA 4J9JA 4NJGA 4FA3A 1C91A 3L12A 3ALGA 3OIXA 4MIMA 1QR7A 1BQCA 4H2HA 3TQVA 1DOSA 2VCCA 3STEA 2QCFA 3A13A 3EXRA 2IW0A 3BARA 5BOOA 4NX5A 2A6LA 1O4UA 2XJ7A 1HXVA 2XIOA 3OOQA 3TCZA 1PBKA 3B97A 4L1XA 4XVEA 5C9RA 4TXEA 3F5JA 4GMEA 1S5WA 2RURA 1N55A 4JHOA 1SFSA 3CLMA 3RO8A 3IGUA 2J7HA 4FSAA 4D6DA 4Q7BA 2V5KA 1P6CA 2G8ZA 4UZSA 4E8DA 1JNDA 1DVJA 3UCCA 5M17A 1XLCA 3VIIA 3DBPA 1PHQA 2WZHA 2ANUA 3GUGA 3RRAA 5K2ZA 4LB4A 2JKEA 3N4FA 3ARQA 3MUY1 1NSJA 1CGUA 2NVCA 3AMGA 2C79A 4PZVA 2C7FA 2J47A 4QX4A 4RV8A 4C6BA 3ANYA 2W6RA 5XIMA 1HN1A 3DEQA 3DGRA 3DHDA 4HOXA 3GNXA 1LL4A 4O11A 3UXAA 4IFKB 1EPVA 1JCNA 3WF4A 1KFWA 1UBSA 1W1B1 6REQA 4KIEA 3VDGA 1I8JA 4IG2A 3LS9A 3CK5A 4MYAA 7REQA 3VVGA 4CNTA 2ZVIA 4HZ8A 3HV9A 4IJRA 1BD0A 5EFFA 4HYVA 1Z89A 3AISA 2D20A 3T8LA 3M6DA 4ZOAA 5DIUA 1UB3A 4OOUA 5BXTA 3FAPA 1XDMA 1S3TC 1H63A 3BH4A 5FJPA 4ZOBA 1FUYA 2DZWA 3CHFA 4HCHA 1E1CA 3IWPA 4GVHA 2G5WA 1ZAIA 5A8QA 1ISVA 3I7QA 3NO5A 4C7DA 1KM4A 4FOKA 4O1CA 4W9QA 5CSRA 5FOOA 1SGJA 1W1IE 2W62A 2GJPA 1QI0A 3NI6A 4Z17A 7TIMA 1LF1A 4DUOA 2HK0A 2ZUUA 3KVMA 2V63A 5BNKA 4TQTA 3S6OA 4XISA 3PJTA 3TNBA 2FGBA 3S0CA 3VIMA 3H26A 5DIVA 2QV4A 1UIOA 1TSIA 1H2JA 1SMAA 5DY2A 3MDYB 3AIRA 1MFUA 2GUBA 3BANA 3U4FA 4XO6A 1KT1A 1V02A 1ROTA 1MDLA 2CEQA 1JFHA 5HOSA 2Z7KA 1W1PA 5REQA 3UZ5A 4ODNA 3TTSA 4O50A 1FX6A 4GQRA 2VEIA 2PA6A 2XUCA 3G1RA 1O5XA 4IOTA 2QIWA 3WBXA 1KC7A 1YDOA 2JIWA 1TA3A 4HT3A 4JFUA 3WNLA 4RNHA 4GINA 1TWWA 4NG3A 1E44A 3VXGA 4DBUA 1VYSX 4MUPA 4ODLA 4H19A 3VNDA 4KCWA 1US0A 3FJ6A 3KBJA 4AF0A 1CPUA 3P82A 3DG6A 1F3EA 2HDJA 4B3LA 5AC5A 3CZEA 2XYLA 1A5SA 1QI2A 3PUDA 1XIHA 1I0DA 2Q01A 3FA3A 3TTOA 3L0NA 1XWYA 1XPYA 5TAOA 4U2ZA 5T8GA 3WQPA 5D38A 4PMJA 3CV2A 3O1NA 1XLBA 1E4IA 4WEVX 5AC8A 1O68A 5GNYA 1P6BA 4C7GA 3W85A 3MA8A 4GZIA 2DZBA 4WJXA 3LZ3A 1RUSA 5T9CE 3VKBA 4NAFB 5G4EA 1W0MA 1OG6A 4Q4SA 5AC6A 4HK7A 2TYSA 4KMQA 4H8HA 3KVLA 4JIIX 3L4TA 5AYYA 1WO2A 4DBSA 3GU9A 2Q02A 1F6KA 2O7SA 2HNHA 4F0MA 2DIKA 3RX2A 1W2PA 2DSWA 3ZQ9A 1EXBA 1T11A 1XGEA 1EDQA 2G4JA 2KZHA 4RPQA 3M0HA 1DQXA 1GVYA 5HTGA 4RZBA 3H2MA 4NU7A 5CSYA 4F66A 1WUEA 4HU3A 5E70A 5D03A 4TNSA 1BWVA 1X96A 4H8NA 1JZ8A 1QPLA 1JNTA 2GDVA 1TQJA 2CZVA 4K68A 2NSXA 1VCGA 3MVIA 1JGIA 2PBGA 3TAKA 2WZEA 3KP1A 1I2PA 2ESCA 3N6HA 4C6MA 4QEHA 1WAWA 3CAQA 4HQVA 4LAYA 4MVAA 3VKJA 2BFGA 5AKQA 3GDMA 2FVMA 4H9UA 4AFYA 1B1YA 2QV5A 2V5JA 2E40A 3MWAA 1CEOA 4GE8A 3O5JA 4UFMA 3BAXA 2DUXA 1X7FA 1XUZA 2QUVA 1E6ZA 2Z29A 3W1AA 4ODPA 4UCFA 4LF1A 1KBKA 2NLYA 4D1JA 1GHRA 1XLHA 2R82A 3MP5A 3UR7A 1XICA 2NZLA 4GQBA 3C0LA 2ZWZA 3MDUA 1TJRA 2E77A 1Y5XA 4M7SA 3VNJA 1QNVA 3W7KA 2V5BA 3WYZA 1GYLA 1Q6IA 2FPYA 2ZFAA 4GIVA 1F8AB 1T96A 2HZGA 2OFJA 1UCWA 1J6YA 3QZ6A 4QCEA 2CKRA 3PJXA 5LNWA 3AOFA 4UMBA 2FZ8A 1DJYA 1S2CA 4JR5A 3W4RA 1R7OA 5CH9A 2XP5A 1SW3A 3BSHA 3AZTA 4JD4A 3GZ3A 5TF0A 3U48A 4HOZA 4HSOA 5I24A 1J0ZA 5LIKX 3V0UA 4NZFA 5IFPA 3CEUA 2RAGA 3IJ7A 1PXGA 3VOCA 4C5YA 4K7YA 4A2RA 1SJCA 4BZYA 3FYPA 3W1QA 3SGZA 1TPVA 1K6AA 2PURA 1ITXA 3VDCA 4OV9A 4JQ4A 1SZEA 2XVGA 4BEQA 4S3CA 1FKFA 4JKLA 3LUTA 4TO8A 3M47A 3KCOA 4US5A 3W07A 3IK4A 4OU1A 1AD1A 3LG3A 3H8AA 3N2CA 4MSPA 3VOHA 3KL3A 4FLOA 4GUIA 4O1EA 2ZXBA 1ECQA 2WM0A 3C0QA 2WPBA 4KWVA 1Q13A 1EA0A 1XHGA 2VM8A 4DJDA 2F84A 2EPOA 1C7SA 3QH2A 2GVYA 1GOXA 1H3GA 2WVVA 3E0IA 4IQDA 2I7GA 5EY5A 1EIBA 2OT1A 4H9ZA 3OVQA 5TQLA 3O5EA 4I5RA 3MI3A 5HR7A 1EQPA 1KCZA 2Z00A 4HYWA 3OGSA 1C8VA 4FHAA 1SW0A 1JZ7A 1E0WA 4KCVA 3RDKA 1EJUC 3POHA 3ZR4A 2BY3A 3UG8A 1ESWA 1G5AA 3WX7A 1JZ5A 4XV0A 1HKVA 4J4KA 2XIIA 3O5QA 5FEPA 3KXQA 3V5FA 3AUJA 5M5DA 3JS3A 4IPIA 4MGGA 5CJ5A 4AISA 1PIFA 1OABA 5AHMA 4RR4A 1DWHM 2PS2A 3ZJKA 3SIZA 1A80A 1EJXC 3N04A 1Q7QA 4WY0A 4IFRA 4DO5A 1XKYA 4TW8A 1ZRQA 4NSBA 4D71A 4FX7A 2KO7A 1YPXA 3CL7A 4TX6A 3GWQA 3EWZA 2PTXA 3LMZA 3TQ0A 2IKIA 5FCZA 3W2JA 4HJFA 1A47A 3QY7A 5J04A 1PKMA 4Y7EA 3W2UA 1K9FA 1UJQA 3VD4A 1AL7A 1G6CA 2FHCA 2CLKA 3EDFA 4YTTA 3SQMA 1XIIA 1N8IA 3MSGA 5I77A 3L7RA 3K46A 3M5VA 1OFBA 1H0IA 1PHWA 2PRLA 1VQTA 1Q6LA 1NWRA 2OZ3A 5IM51 1XIMA 2F23A 1P7TB 2YDAA 3UZZA 1J79A 1XCWA 5C9XA 3ISIX 3UBPC 2EG7A 4CN6A 4KRUA 4UOJA 3WJSA 3APTA 2A3LA 3ARXA 3GS6A 1Q6FA 1VGAA 1W56A 1WDRA 2YDRA 3MS8A 4GI9A 2D2GA 3T55A 3VYLA 4JAWA 1H7PA 4P8XA 3UR2A 3T0AA 5CEWA 3ZXWA 2PLJA 3V3WA 3T40A 2JEPA 1ME7A 3U7BA 5EKYA 2EKGA 3A4JA 2PDKA 3KTXA 3LMYA 3FHQA 2HK1A 3SY8A 2XPAA 2ZX7A 2HWGA 3PUOA 4PCPA 5IDZA 5ECUA 1O60A 2F21A 1UH4A 3OZMA 3ZT7A 3MT1A 4NXKA 3A22A 4K8GA 1WB0A 4IQCA 3KS6A 6ALDA 4AX7A 3QMSA 4TVCA 1WKFA 2H3DA 2TSYA 1OQFA 3L2MA 1HTIA 3VOFA 3HFTA 3RM8A 1XF0A 2ALRA 2QXWA 4QJ3B 2BOFX 1U1UA 4PEEA 3AS3A 3THQA 4EXBA 3LGDA 3V5CA 3FDGA 1OX4A 3GU0A 4UR9A 3W7IA 2PDUA 3VCCA 2DIEA 3TJIA 4DZ2A 4KEMA 1OFDA 5I98A 3Q94A 3N17A 2YYTA 4BQ3A 5M2FX 5FJTA 1JPMA 4H01A 2YGYA 1AUSL 1W9UA 4QRNA 4AF0B 5LIXX 3NQ7A 3KOFA 5DFAA 3UR5A 3DH7A 3BLFA 3WJWA 5A69A 4GY7A 3PWIA 3N34A 1FKKA 4HU0A 1J4EA 1KTBA 1VPYA 3ITXA 3SY5A 4HMEA 3PF3A 1HX0A 1D7IA 2PDGA 1TA3B 3Q58A 1MEWA 3PFMA 1T40A 4QNEA 3NQDA 3VIFA 3FNDA 4JN6A 4F9DA 1HKMA 3V1PA 4QE1A 3WH8A 3M5YA 4W8BA 1HO4A 3MYOA 5DEZA 4I90A 3T78A 1PKNA 3L5LA 1N1AA 4XZMX 3SCQA 1TV5A 2ZR6A 1EA9C 2J6VA 3TX9A 2Q8XA 3ABQA 1T5AA 3L5AA 3ARYA 4L6HA 4S3EA 2XG9A 1EDGA 3C3NA 4YIWA 3E2VA 1HJWA 1E0UA 1Z48A 2CWXA 3VAVA 4NIRA 4PSPA 4GI4A 3O8AA 1IIHA 3IJQA 3VZXA 4UFLA 3ZVHB 3CZKA 4C6JA 3MSRA 4AVNA 3S83A 4JZ5A 5BXSA 3VKAA 5HJXA 4QTGA 1B0IA 3HZ3A 2WSKA 4U5KA 3LY0A 4O16A 3WEOA 4DF0A 1MQRA 3VE7A 3XINA 4ADUA 3HBLA 3DC8A 2NX1A 2SFPA 1A0EA 4LTSA 3C5QA 4NI8A 2FH6A 4I7UA 4LAZA 1R3YA 3O63A 1KM1A 1ZJHA 1YMYA 1EX5A 3W1XA 2FPVA 1S2VA 2POZA 4FEZA 1VJSA 4HPJA 3OZPA 2DU2A 1XIGA 1B30A 1FBAA 1WBHA 3U57A 4D6IA 1QUMA 2QEZA 4CEUC 3L5MA 3WH5A 1R86A 3P67A 3TXVA 5CPQA 1SUXA 3ES8A 4XUYA 3CUXA 4R34A 4MFEA 2G50A 2WQPA 8XIAA 3N2BA 1QT1A 1QPNA 1R9HA 2I16A 2XPBA 1J5SA 5EYWA 2RGMA 1AZ2A 3GC2A 3VOJA 1NDVA 3MANA 4O13A 1YTEA 5XINA 4L3NA 1J5TA 3WFAA 3CIWA 1HUVA 3DYPA 2E7FA 4GH3A 4X9YA 8CGTA 1JZ6A 2BDQA 4Q8TA 4PL2A 5FJJA 3WMLA 4ROQA 1T7LA 1UWTA 3JU2A 4D72A 2ABBA 1KBBA 3VAWA 3ABSA 3UXKA 3AQUA 1LOSA 1EKOA 1S2AA 3M0VA 3GXMA 3A9IA 4R7WA 1GVOA 1VPQA 3EKGA 2IQTA 5BZAA 2V69A 3QV7A 1FKSA 4IUGA 1GJUA 4AEOA 4FK9A 2ZUTA 3CB3A 2D9FA 2VD9A 4TMCA 2X7VA 2R1MA 1TCDA 3AYSA 1ZCOA 3C2VA 3G77A 1O66A 4ZODA 3GU2A 3UETA 3P8IA 1F05A 3GG1A 4WHBA 3S8HA 3CO8A 2ZRWA 1LQ2A 3R8GA 4DZIA 2QJMA 3LCIA 1EC7A 4O28A 2RDUA 3C2RA 1X8CA 1LM1A 3UD6A 1M7XA 4KKXA 4W84A 3H9RB 4TX8A 3VNKA 3VKCA 5A8PA 3B9DA 3CLWA 2FFCA 2M1IA 3SIMA 1EC8A 2RUDA 2Y70A 3GNRA 3G2GA 4NYYA 2VEFA 2ONEA 4LAOA 1M68A 1UQZA 3AIBA 2W3ZA 7REQB 3A4XA 3LCWA 3MVTA 3KDNA 2I14A 4HZ6A 1FWDC 4LCSA 1G67A 1QI5A 4YYCA 1AG1O 1MYRA 1QBBA 2WB5A 4IFKA 1QNSA 2NQZA 2CLMA 5HULA 3NURA 1YHTA 3HG4A 3DG7A 5U4NA 4WY0F 4LV4A 1UD4A 1XBXA 3UWEA 4ITZA 3H4GA 2YL8A 3QW3A 3VZYA 1BYCA 1E55A 4O10A 4UMAA 5J5RA 1OF6A 2W0UA 2GVEA 4NAEA 4JTAA 4NILA 1P5BA 3OYZA 3FHAA 1UD5A 4J40A 1AL8A 2AMGA 3NSMA 3H54A 3O6DA 4BK9A 1NFGA 4LVFA 1GVFA 3CHVA 3SUSA 4MKSA 4DO6A 4U3CA 1ZHAA 1FWWA 1XCFA 2ZWYA 4RXFA 2QF7A 1U79A 1JDAA 1GZGA 3QR3A 3CQIA 1ADDA 3PZIA 3TSMA 3AIQA 3FV9A 4AVFA 2VFEA 1GGOA 3LHZA 2J9XA 3NOYA 4GIYA 3ENLA 2J8TA 4XSLA 3MMDA 1JCHB 4KIRA 5LXXA 3IPWA 5CGTA 4G56A 2VRQA 1J93A 1EQ3A 3DKLA 4RE3A 1AJZA 2XPKA 1X39A 4AWEA 1P0BA 5HW8A 5LHEA 5FJRA 2ACSA 4JFMA 3LXAA 3EMQA 4MJ2A 3G1HA 2DW7A 1FWEC 4A8IA 2OQHA 5FJUA 2DGAA 2WJFA 3NL2A 4I5XA 2R14A 2OELA 2VR2A 4QG8A 4IISA 3N4AA 4LEFA 2J74A 3QYQA 3AMKA 2BVYA 2AOSA 3KACA 2Z28A 4XBKA 1NAL1 1BQGA 1SZRA 4I9AA 1JXKA 3CL8A 2G3IA 3UZWA 2KX9A 3QR0A 1VCVA 1HL8A 1HP5A 2ZRZA 3W27A 4GNJA 2FZNA 1DQWA 3NEHA 3W24A 5A6BA 4DBWA 2XVNA<