3RMQA

Crystal structure of uncharacterized protein svir_20580 from saccharomonospora viridis (v71m mutant)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
MQRYLWQQADGKRHVYDTARHRVQAGRPFTALCGETVTPQTERGDLTAGLWFDGECPVCTIALAKALGWPMREISDLAHRFDWSPALITRLAEVLHCSFGEVVELTGARMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of uncharacterized protein Svir_20580 from Saccharomonospora viridis (V71M mutant)
rcsb
source organism Saccharomonospora viridis
molecule tags Structural genomics, unknown function
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16827 zf-HC3 zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.990 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rmqA01
3RMSA 3RMQA
chains in the Genus database with same CATH superfamily
2EYQA 7AT1B 1ZHIA 4BY6C 3CCQT 3CCJQ 1RAEB 1HSQA 2MF2A 4CC4B 1M2VB 1N6AA 3A8GB 3JB9G 1QMCA 2MAMA 2GQVA 2EJFA 2QA4T 1RAAB 1IHWA 3FC3A 1D3BA 1UDLA 1K73C 2JXBA 2X4JA 2V8KA 3UT1A 4F16A 1Z9ZA 4IUTA 4NL3A 4J9CA 3FJ5A 2QI2A 1PCXA 4MZMA 5GMKi 2DEQA 4OMMA 1AVZC 1YJNT 3X28B 2HEQA 3TREA 4CRIA 4O5VA 1OU8A 3GNGA 4BI3A 4IURA 1PWTA 1Q86C 3CD6T 3CCEA 2X4WA 2QEXA 2DLPA 1GFCA 2CSIA 2JS0A 4C92D 1PHTA 4QQDA 3UATA 4M7DE 3LGLA 3G6ET 2I0NA 4M7DD 1I0CA 3RR6A 4M77D 4C92F 3M5AA 3S6WA 1WX6A 5KE3A 1K73U 2DXBA 3S3OA 5HCKA 3FB9A 1YIJT 3QSUA 4M7DF 2P4TA 4DOWA 3RKYA 4M77F 2A7YA 3PIOA 2LCCA 1KG1A 1HYOA 4BI8B 2BZXA 5CQXA 2RQWA 4KT0E 3H0HA 1WXBA 1Y7XA 3SWNC 4M75C 3OSVA 1M2VA 4EMKB 6AT1B 4BACA 3VS3A 3INZA 1SRMA 2BZYA 2HKQB 4OMFB 1Q86U 3QPHA 3QWYA 3A8HB 3CCJT 5LJ3f 4FT2A 4J7IA 2P0QA 3GOXA 1MNDA 4WTOB 3M57A 5I21A 4DA4A 1PKTA 1X43A 1FMWA 3JCMQ 1RAIB 1T0HA 2E10A 2WSFE 2E6ZA 4FYXB 3P8DA 1G3TA 1ZUUA 3SD4A 3O8VA 2HSEB 1NEBA 1W2BS 4LDUA 1GCQC 2FYKA 2KI7A 2R57A 2EAYA 2NUPB 3JSCA 4JPBW 1GXIE 4PFZA 1JJ2A 3BDLA 3MHXA 2XU8A 2DEUA 4M77G 1AWWA 5CKHA 3CMAQ 5GAOr 5CAIA 1K1ZA 2R5AA 3JCMe 3OYLA 4M7AF 4F17A 5GMKe 2GTOA 3G7ZA 4PJNA 4J9FA 4DEXA 5LJ3g 2DE0X 2FPFA 2M02A 1K8AC 4AFQC 1OX9A 1W1FA 3J80E 4QVDA 4OMPA 2V26A 5KCHA 1VQ8Q 2YRVA 4JJBA 1H92A 4M78G 2DF6A 4II1A 2DVJA 3OMGA 1JXOA 3CCSQ 2LJ3A 4Y28E 4J6YA 1M90R 2LRQA 2HBPA 3U23A 2A0FB 4F7UE 3NTKA 4HCZA 2C0IA 4EMKA 3RMQA 4LD9K 3QYHB 3UF4A 2ED1A 4M7AG 2R58A 2WSEE 1KIKA 3OMCA 3NGPA 3EG0A 5IAYA 2KGTA 2P0KA 1QVPA 1MMDA 4MMKA 4BY6B 3DLMA 4LE9A 3VV0A 3EHRA 2ZZDA 3C4SA 2KYBA 1OEBA 2BTTA 2J6OA 1NZ9A 2M16A 2NUPA 3VS1A 2CSQA 1ZA2B 1M30A 2EGCA 3S3NA 4A53A 1G2BA 1TTHB 1XNIA 5GJWB 3FRNA 2YWWA 1KSWA 2DL7A 1K9AA 2WSCE 5CK9A 1M1GA 5KYYB 3CBOA 3CMAT 2YLCA 2A28A 5DLQE 2LNVA 1GFDA 4GLKA 3MPUB 2XDBA 4XU2A 1WJQA 3CBMA 2VXEA 2NLUA 2CDTA 2LQNA 2BKDN 1XTDA 1LVKA 1X75C 2JMAA 5LJ3h 2QA4A 1NBEB 4TVRA 2DXUA 1AEYA 3A98A 1WIEA 4C8QF 1VQ8T 3CEYA 1YWPA 3VU3C 2XDPA 1KHIA 4J9GA 1KC8R 4MZTA 1K9MR 2CGHA 1JQQA 2MPXC 4JRPA 1VQOT 4A54A 3UPUA 2DETA 2KDSA 4YTLA 4CC3A 3CCST 2RN8A 1AHJB 1YJ9A 4JZ4A 2DK3A 4M78C 4A4EA 4FW1A 3V7RA 3G1JA 5GMKm 3LW5E 4JLGA 4RTYA 4KGXB 2JMCA 2DYIA 2HMAA 4XTWA 3OYKA 1NLPC 2DBMA 2DTOA 4RG8A 3GPLA 1UGVA 3VS5A 2RI3A 1AT1B 4OF1A 2CP5A 2JUFA 2D6FA 4Y92A 2QQ9A 1VQMQ 4C5HA 3V7CA 1UEBA 4A4FA 3L2RA 4OMNA 1I07A 2AT1B 4LUEA 3OYFA 2KYMA 4C8QG 2KRSA 2J6FA 1TWBA 2KY9A 2GFUA 2VB6A 3CPWS 2PUKB 1QW1A 1C6VX 4J6WA 1Y96B 2KT8A 3FLGA 5KYYA 1V1CA 2FPDA 1IGUA 4RG2A 3CCUQ 3MKDA 3E9GA 3MEWA 2D0NA 3A5ZB 5LL6S 1VYVA 1G3YA 1KD1C 2K2MA 3CCJA 4N0AA 2DZCA 2ROTA 2M1HA 1YITA 5ECAA 3PMTA 2HZYA 1QCNA 2C0OA 3CCMQ 4E7LA 1FMKA 4OMLA 4EDUA 1R8OB 5LJ5j 1VA7A 1OYXA 1QVFA 1UFFA 3M55A 1X6BA 4J6XA 2XMFA 2GGRA 2ENMA 1PRLC 1FX7A 2X35A 3CCET 2DO3A 4C0ZA 3E1SA 2JJ9A 4FYYB 4DBQA 2KR3A 2QAZA 2OJ2A 1UGRB 2JTEA 4RKUE 2L2PA 3ME9A 3SHWA 5GANd 4BDYA 3QDRB 1G3WA 4PJJA 4C0FA 4D8KA 4ME7A 1JXMA 4FT4A 4OVAA 3RUXA 2EKHA 2RM4A 1IZ6A 2QQBA 4D8DA 3HRTA 2VASA 3OYDA 2OAWA 4OB0B 3EH2A 3CCRA 2RJEA 1BYMA 3EGDB 4X1VA 1GBQA 1Y96A 2GBQA 4C0DC 1YWOA 4FW2A 2K9GA 2CT4A 2L5QA 1BU1A 2LJ0A 2QK0A 4K11A 3THKA 3IQLA 1NJIR 2K6DA 2DTHA 4NOYA 2DJZA 3VS4A 1UE9A 5C0MA 1GCPA 2FL7A 1NPRA 3CCUT 1R0BG 4QQ6A 3G4SQ 1VQ7Q 2JT4A 2LQ8A 4EMGA 1BI2A 2RHZA 3L2UA 1ZBJA 4HCBA 3OYGA 1VQ4Q 3JAME 4LUDA 4B9WA 1YP5A 2MIOA 5DM7R 5FWCA 2H3JA 5A0GA 1X01A 2RQVA 3A8MB 4ZGEB 4IKFA 3CCMT 3M0RA 3BY7A 2A08A 1WDXA 4RUGA 3X25B 1U8RA 3J7AF 1OPKA 5A0DA 1D1CA 1M8MA 3EAEA 2A36A 3HFNA 2NYSA 3CMAA 4M78B 3CC7Q 4UC4A 3EHQA 4PL6A 1S72Q 2JS2A 4E7IA 4XTYA 2EYWA 1UECA 2JW4A 2NWMA 2ZAEA 3JCMf 3TSZA 4JS4A 4M75F 3EGDA 2AZSA 1RAFB 1Q82C 2IG0A 1X6OA 3S3MA 2RQUA 4M7AB 3CCLQ 1VQ8A 2XDDA 4HVVA 2BUDA 2JTFA 3M56A 3JB9D 1RLPC 3CCSA 2GTJA 3VS6A 2DRMA 1C0MA 3SDZA 1XQHA 2ZPBB 5GAOl 5KYWB 1X6GA 4N4HA 5LJ5e 3G71Q 3H0IA 3C12A 4BE1A 1YJWQ 3JCMg 2LDMA 1TS9A 2DM1A 3G4ST 1IO6A 3N5BB 5FLXE 3JB9I 1OULA 1VQ9Q 2K5LA 4PKCC 1VQ4T 1Q7YU 4CC2A 2DTIA 2EQIA 5GMKj 2CZ7B 1MHNA 4M75G 1EIFA 1GL5A 1WXUA 3LYIA 2OTJQ 3M4YA 1Q86R 2FZCB 4LDYA 2I2LA 1VUBA 4PJOG 1QP2A 3QWXX 2GFAA 3FEOA 1TU0B 2LQKA 4AFUC 1U3OA 4M78A 2NUZA 3NMZC 4AMCA 2EGEA 1D1BA 4QT7A 4ELZC 2PZ1A 4D6WA 4R55A 2IPOB 2QASA 2CZ1B 1YITQ 3I56Q 3AHUA 2EYXA 5GAOp 2LCLA 5FRNA 1O9SA 1OPLA 1YHQQ 3CC7T 2DBKA 2RI2A 1X27A 1H3HA 4F14A 2L8DA 3LH0A 2O2OA 3SB2A 2MCNA 4HCCA 3OBWA 4X9CA 4M7AA 3OW2S 3ASKA 4MZPA 1CKAA 2YLBA 1KHCA 2VUBA 1YJ9T 3QYGB 5GAMj 1ZSZC 1M3BA 3CCLT 1KQSA 3F70A 1SKUB 3MCAB 1PSFA 5KYWA 3LWHA 1T3LA 2CZ6B 2EYYA 2O31A 3PE0A 3E9FA 3OYNA 4C92E 1M5Q1 2COWA 1QKXA 3M59A 1UGQB 2P4RA 3OS5A 2ATCB 1WQ7A 4C8QB 1BBZA 5GJVB 3G71T 1N8RC 3CCRQ 2K3XA 4M77E 4OB1B 1ZX6A 1PM3A 4IUVA 1RL2A 3PFSA 4JZ3A 2CP2A 3HP9A 2DXCA 3CPWP 3MO8A 4PJLA 1VQ9T 2EWNA 3JCMh 2XD0A 1VQMA 2PTKA 4DBFA 5GMKh 5GAN2 2E65A 4C5IA 1BIBA 1N27A 2ESWA 2QDYB 3PGGA 1Q81R 1CKBA 1G8XA 2OTJT 1S1NA 1YI2Q 1K8AR 1TOVA 3CXCP 2E3IA 4J5YA 1TUGB 5CCAA 3CCVQ 2HSPA 5J39A 4M78D 1HJDA 4PJOC 1NPPA 3CCUA 1IRXA 3TQ7P 3AT1B 3R6OA 1N8RU 1YITT 3I56T 1V76A 3OS1A 4M78F 1YHQT 2E12A 2CH4A 5A0LA 2OTLQ 1M8VA 2X51A 4M7AE 5IH2A 2V8IA 1OI1A 1R77A 3REBB 4M7AD 3L2VA 2DNUA 3QJ6A 5LJ3d 5HK3A 5IHKA 1K0XA 3CCMA 4J9EA 1HD3A 4BE0A 2E70A 2JM9A 4ELYC 2X9HA 4RTZA 2XK0A 3PTAA 2V1QA 4RCBA 1HK9A 4C8QA 4DQ2A 1JU5C 3BDUA 2EYZA 8AT1B 2NUTB 2O4XB 2KAFA 4HXJA 5FU7C 1QVGA 3NHNA 4LN2A 4A4HA 1IREB 1SEMA 1N9SA 2E41A 3M0PA 2L89A 3MP6A 3VS2A 3M0TA 1K4US 2ZPGB 1NYFA 3CCRT 3UA7A 2HNIA 3ER0A 3TCJA 2G3RA 1PD0A 3TSWA 2VXFA 3I55Q 1EZZB 4E6RA 2HDAA 2ZCFB 2E1HA 5IHIA 1QCFA 1VYUA 3D7SB 4ESRA 2X3XD 4XAXB 1PKSA 2DXTA 3QUIA 4HKEA 3QZ9B 4J9DA 5I2MA 2DL4A 4XTZA 3WVDB 1NYGA 4AFZC 2RK1A 2EJGA 1YI2T 1M3AA 5GAMe 3O5ZA 4DBRA 3WXMB 3CCVT 3NTHA 3FDRA 3MP1A 3G4SA 5FW9A 1VQ7A 2KQWA 4JJCA 1V29B 3OB9A 9ATCB 1BI3A 4J9IA 5I11A 1VQ4A 3VRZA 4GBQA 5GAN7 2RNAA 2OTLT 1UTIA 3EG2A 1D0ZA 2DRKA 2QG9B 4O6JA 1U1SA 2KK4A 2KROA 3EFSA 3WVEB 3RNJA 1ACMB 1WJRA 2X4YA 3RESA 3EGUA 1ZSZB 2QYZA 3CC4Q 3QG1A 2NUTA 2O4XA 4JRKA 3RMSA 1JJ2P 4C8QE 2YHTA 1UG1A 2JZ2A 4C8QD 1ARKA 2DAQA 2CUBA 2XI9A 5GAOm 2RHUA 2O9VA 2FG0A 4ATOA 1WHJA 4FSSA 4AG1C 4BUGA 3CC7A 1M90C 4BE2A 5D6WA 4M7DC 1ZUYA 3UDCA 1S72A 4EIKA 2LVMA 4BD3A 2M9UA 3QDFA 3QJYA 5AYFA 3VJPA 2HBWA 4A4KA 3I55T 1M2OA 1AZEA 2LT4A 4JDSA 3LH5A 2DJQA 3LGFA 2DPPB 1LPLA 4ZNXA 3CCLA 2KMTA 2VWFA 2HQEA 4KUDK 1KD1R 5GAN5 2LX7A 5GAN4 2LJ1A 2QXFA 3VRYA 2K79A 1RUWA 3SWNB 4M75B 4ZTFA 2YXYA 2IIMA 2Y4XA 3G71A 1IHVA 2DX1A 4ZTJA 3A8OB 4PJOB 1LCKA 1YJWA 1M90U 1HXDA 1M1KC 5GAN3 3M0QA 4FU6A 4C5GA 1SSFA 2RHXA 3JCMc 2HCKA 1VQ9A 3OSSC 4DBHA 3HL8A 4XTXA 5CO7A 1TUDA 3HRSA 1ZSZA 3HKSA 1M9SA 1X69A 5GAOq 2OTJA 3OYJA 2PUOB 1IGQA 1WNLA 2MOXA 2XHCA 1YFNA 5KE2A 2LC4A 2EQMA 5IHNA 2GNCA 1FWZA 3X24B 2DL5A 3CC4T 3CXCS 2HKNA 3URGA 3OW2P 1UHFA 2W0ZA 4PJMA 1W2BA 1B07A 1KC8C 3JB9H 3OYEA 1IXDA 2KNBB 3MEUA 2K7AA 1JO8A 5LJ5g 3I56A 3PNWC 1AWJA 2E3HA 5FU6C 2KXDA 2VGMA 1YHQA 1LJOA 4L6V5 1M1KU 2J05A 4C5EA 5M9OA 5CKDA 2DKGA 4LDVA 2QTVA 3JCMW 1XJWB 3VUBA 1SHFA 4E7KA 2HL5C 4Z89A 3SWNA 4M75A 3CC2Q 4HT8A 1NG2A 3I9QA 4E7SA 3LX7A 1WI7A 3V7SA 1I81A 1K76A 2CS7A 2DYBA 3EG9B 2LCSA 5CR2A 4PJOA 1AZGB 1Y07A 4XTVA 3PIPA 1QWFA 2CP0A 1KC8U 1K9MU 2C06A 2FB7A 2YUOA 1VQMT 3HSBA 1BIAA 1SRLA 5KCOA 3UWNA 1M27C 2JM8A 1T0JA 1PD1A 1GCQA 1RLQC 1UJYA 1G3SA 3V8KA 2JN0A 2W10A 2YUQA 4J8OA 1KJWA 1QQJA 1Y57A 1UB4A 3VS0A 2DL3A 1VQPQ 3DKMA 2VC8A 2F2XA 4E47A 4E7JA 2ECZA 1WYXA 5GANj 1YI2A 1E6HA 3E2UA 3FIFA 1B34B 4KGZB 1WFWA 1R0CB 2F1LA 2AIRB 2DILA 2CP7A 2OI3A 3KXTA 1Q82R 2BE7D 3CCVA 4IIMA 3KBGA 3C0CA 2M0OA 4M4ZA 1MMAA 1OV3A 2EPDA 2GCXA 1MMNA 2RI5A 2P0PA 4JRIA 4LD6A 2CP3A 1RABB 1VQLQ 2CP6A 1ZA1B 2M51A 3OYYA 2RA2A 2CT3A 2E6NA 4RTXA 3JCMb 3OS2A 2OTLA 5LJ5h 2F5KA 2LMJA 4LNPA 1AOJA 3L1AA 1PG5B 3ZL7C 1UGSB 3V8JA 2PVDB 2LX9A 2FVUA 2DA9A 4Z02A 4M75E 1QCOA 1QVFP 3V8LA 4EMKC 3EG9A 4M75D 3ZBDA 3H41A 3CC2T 2R5MA 2XIDA 5HY6A 3TU4K 4QW2A 1JJ2S 4Q5WA 1I5OB 1Q7YC 4PJOD 4E7HA 1WLPB 4PLIA 4R56A 2PVOB 2BZ8A 1GBRA 4N4GA 1NJIC 3H6ZA 2F5TX 2FO0A 4V2SA 3LWIA 3BW1A 2KRNA 1RI9A 5GAOn 3BE3A 4PJOF 2EBPA 5KYNA 1BK2A 3I55A 1UHCA 1VQ6Q 3M58A 3JCMd 2RH2A 4OMQA 2G6FX 1YJNQ 1B34A 1OZ2A 5EG2A 5J3BA 1FXXA 1K73R 5FRMA 1VQPT 2CUDA 3P8BB 1K0SA 4RTUA 2L3SA 2MWPA 3I5SA 4OMOA 1T3SA 1RACB 2JVVA 1VQ7T 3CD6Q 5KYUB 4J9HA 1ZUKA 2ABLA 3ZEHA 3GIBA 1MMGA 2J06A 3CPWA 1WHHA 4A63B 1VQKQ 4QVZA 1VIFA 2AK5A 1NJIU 1UJ0A 4HCKA 1SSHA 5GAMf 3META 1SG5A 2JTMA 5IN1A 1VIEA 3M54A 3LLRA 1YIJQ 2LQWA 5D6YA 3VYGA 2V8JA 2VYTA 3M0UA 2GF7A 3JCMP 1VQNQ 1I8FA 1LNXA 2K5IA 3BFMA 3NTIA 2HD0A 2O9SA 5IXBA 1E7OA 1I4K1 1W6XA 2QQAA 4ORZA 4XK8E 1WHMA 2QGGA 3M4GA 3QKJA 3X20B 4F7UB 4ZN1A 3CC4A 2COZA 3TEEA 1VYTA 1VQ5Q 5C6SA 1S72T 1SF9A 4L5GA 1JB0E 4LXCA 5GAMg 2JOYA 5GANe 1TH7A 3MEVA 3X26B 2H3EB 4ZGDB 3EH1A 2CH4W 4CI0C 1ZSGA 2O88A 3A1PA 2MK5A 3JCMV 4IUUA 2DFUA 3OYIA 2X3WD 2ZPFB 2VKNA 4HT9A 2LP5A 1TXQA 4C0DB 4B6MA 1VQ6T 4OB2B 4ANJA 2K3BA 3SEMA 2RK2A 4KUIA 5CKFA 2GQIA 1U1TA 5KYUA 1MUZA 1WHGA 2RPNA 1KFZA 2EW3A 1X2QA 1PSEA 2EIFA 2LNHB 3RDVA 4BI4A 1YJWT 4AT1B 3TVTA 2EVRA 2L0AA 2PNIA 4DOVA 3VYHB 2QQRA 1QLYA 3HTRA 4BB7A 4XU0A 2SEMA 4N0AC 2KRMA 4Z8AA 1VQKT 1D0YA 4KGVB 1JEGA 2BIVA 1AWOA 2E5QA 2XKOC 4PLLA 4OGCA 3KUFA 1OX8A 2KE9A 2ZPIB 4FYVB 4J7FA 3RKWA 3HPWA 1XOVA 2QDLA 1YCSB 2PQWA 4M78E 3EFRA 4B9XA 1OOTA 4HVUA 4F7UA 3OYBA 1VQNT 1RADB 4XU1A 3QO3A 3L2QA 3I35A 2EQUA 2JNGA 2AHJB 4OB3B 1VQ5T 1D0XA 2FHDA 3I5RA 2FPEA 2K4YA 5L23A 3ULRB 2P84A 1VOMA 3L2WA 5GAMh 1E6GA 4C92G 1BCMA 3UA6A 5CVIA 4Z88A 3SFMA 3VS7A 4M7DG 4E7ZA 1N5ZA 3QHSA 1KQSP 4WCIA 3CC2A 2RF0A 1QVFS 2DIGA 1WJSA 1QKWA 1Q81C 4EPCA 2ZPEB 5IT9E 4AG2C 4R0KA 1IB8A 2CKKA 2YRDA 1WQWA 2X4XA 4WF2A 5LJ3j 2WACA 3M53A 2J7IA 2LTOA 2VGNA 3CBPA 5DY9A 2DMOA 1D09B 1MGQA 2KEAA 4JLIA 1JRIA 3OY9A 5GAN8 5A2QE 1WHKA 1VQOQ 2PVGB 3M9QA 1ABQA 1YN8A 4FYWB 3HRUA 2YRCA 3CQTA 3C94A 1EX4A 3JV3A 1SPKA 1I1JA 2F2WA 3NPFA 4XU3A 2L3RA 1J3TA 1G5VA 3PVQA 3Q1JA 1VQPA 4PFPA 1TSFA 5FROA 1ZBXA 2K5FA 1Y71A 4P5NA 2QGFB 2DIQA 5EC7A 1Q81U 4ZN3A 2OX7A 3CMEQ 4Y91A 4F7UF 2RO0A 4E2FB 3VUZA 4NS5A 2O01E 4HVWA 1K8AU 2D1XA 1M1FA 5CKBA 2YUNA 1LOJA 4A4GA 5CIUA 4GY5A 1VQLA 4JS5A 2DL8A 2EQJA 2EGAA 3M0SA 2VV5A 1OQKA 4XQ3A 3QZ5B 1H641 2V1RA 1PNJA 1BCOA 2D0QB 1M1KR 4C92C 4PFOA 2OAUA 1CSKA 3OW2A 2A37A 2ZPHB 1DJ7B 2EQKA 2IVWA 2KBTA 1RAHB 1WXTA 2YDLA 5AT1B 1Y0MA 2K57A 2FZKB 2MI6A 4M77C 2KXCA 4F04B 3CCQA 3OQ5A 1MV3A 1QVGP 4F7UG 5I22A 3DB4A 2DZ9A 4FCYA 3QBYA 3PMIA 1G83A 1UGPB 4LDWA 2HL3A 1O75A 4QVCA 4KRTA 5FWBA 4MDXA 1ZQ1A 2HQHA 1GRIA 2RMOA 1YNZA 3J81E 1ZLMA 5CQYA 1H8KA 1RI0A 1VQ6A 4JJDA 1NEGA 2ED0A 3CCEQ 2QEXQ 2KVQG 2B86A 1YBYA 1YJNA 3MP8A 3PVLA 4PK4A 4RTVA 1NE8A 1M3CA 3OA6A 1U06A 2FZGB 2DERA 2MMPA 3CD6A 1MV0B 5LJ5f 5HKCA 3CMET 4KH1B 4EMHA 3RIRA 3OYCA 1U5SA 1BKBA 1F1BB 1WHLA 4GLMA 3G6EA 4M7AC 2COYA 1FMVA 2DD5A 3GNFB 1VQKA 4QQGA 4AFSC 3DB3A 1X2KA 3C95A 2Y4YA 2YUPA 5LJ3e 5LJ5d 5KYXB 1YIJA 1B7TA 4IUQA 2B8AA 1B3QA 1EFNA 1VQNA 2J6KA 1K9MC 1BB9A 3JB9J 2K3YA 3JRZA 3KFVA 5FU7B 3H0FA 3H9NA 2H8HA 1VQ5A 2CREA 3QXEB 2Y90A 2VVKA 2QTXA 4J9BA 3ZFJA 1OU9A 3T9NA 4MMLA 4OP0A 2Z0WA 3GP8A 2RD1A 2AZVA 3L42A 3GF5A 1NLOC 2FRWA 5GANf 4FIBA 3VKIA 3CPFA 4VUBA 1QWEA 2F69A 4N4IA 1W4SA 2QEXT 4HA8A 3JCMJ 3OBYA 1BI1A 1KQSS 3EG1A 2FEIA 2M0YA 4RMOA 3JCMX 3DLLA 4KBMB 3NFCA 1W70A 1KD1U 5I2SA 1JBMA 1M4ZA 5GANg 5HK0A 5KH6A 3REAB 5KYXA 1C1AA 2RQRA 3P8HA 3EGXB 1Q7YR 1YCYA 5GAN6 2E4HA 1NM7A 2RQTA 1KK7A 4OGEA 3OYAA 2DVEA 4C8QC 1P92A 2FRYA 4KH0B 2DD4A 1KQ2A 2RJFA 4C92B 4C0GA 2L3QA 2CZ0B 4M7DB 1RAGB 1W2BP 2EJ9A 3MEAA 1PC0A 3GLXA 2PU9B 4RCCA 4M77B 4DEYA 4RTWA 4X34A 2A3LA 3R6NA 1A0NB 2AKKA 1TUCA 5CKEA 4ZGJB 3RKXA 2KSSA 2HAXA 2F2VA 1AD5A 2XG8D 2RHYA 2EFIA 3CCQQ 5J26A 4PJOE 1N9RA 3EFOB 4BDZA 3OYMA 4FSXA 5D7UA 1TG0A 2QA4Q 1SHGA 1FYNA 1PRMC 2HQXA 4QKUA 3OS0A 2E64A 4IIOA 3RBBB 3E19A 1I5LA 4MDWA 3L2ZA 2YSQA 3H8ZA 4FL6A 4CC7A 4JRQA 2LZ6B 1QVGS 1D3BB 1WA7A 1BI0A 2D8JA 4IUPA 4RTTA 1YJ9Q 4LDXA 4KULA 3EGXA 3OYHA 2K2VA 3HFOA 2BE9B 2MWOA 3GBQA 4L59A 4PNOA 2D9TA 2QQSA 1VQOA 5GANh 1Q95G 2AKLA 2RJDA 1KQ1A 4C92A 2EKOA 3EG3A 5L8RE 4JJNK 4X9DA 3JB9F 2RJCA 3G6EQ 1AWXA 4JUVA 2E5KA 5IXFA 4M7DA 1H3ZA 3FJPA 1WZOA 4FM4B 1D1AA 4M77A 1QP3A 1VQLT 5FU6B 2SRCA 3A8LB 2MYSA 3CMEA 2CYZB 2XICA 2RB6A 1ABOA 1WPYA 3QIIA 1WGSA 2ROLA 3RERA 3MJXA 3CXCA 1N8RR 2LT1A 1MNEA 4XTUA 2L3PA 1UUEA 1OZ3A 3HHTB 1Q82U 2RHIA 1Z9QA 5GMKl 5DLOA 2D8HA 5GAMd 2KT1A 2C0TA 3PT9A 2ZGWA 8ATCB 2YT6A 3EFOA 4J83A 4NL2A 5D6XA
chains in the Genus database with same CATH topology
3QHSA 5GAN4 2DTHA 4NOYA 2DJZA 2QXFA 2EYQA 5C0MA 2FL7A 1ZHIA 1NPRA 4M75B 3SWNB 3CCUT 4QQ6A 4BY6C 4ZTFA 3CCQT 3CC2A 1QVFS 2DIGA 2LQ8A 1WJSA 2MF2A 1BI2A 4EMGA 2Y4XA 1Q81C 2RHZA 1N6AA 3A8GB 4EPCA 3L2UA 2MAMA 2ZPEB 3G71A 3JB9G 2GQVA 4HCBA 3OYGA 3A8OB 4ZTJA 5IT9E 4PJOB 2CKKA 2EJFA 3JAME 2QA4T 1YJWA 1WQWA 1HXDA 4B9WA 2X4XA 5GAN3 1M1KC 1M90U 4FU6A 4WF2A 5LJ3j 5DM7R 2WACA 4C5GA 3M53A 1D3BA 3FC3A 1SSFA 2H3JA 2LTOA 2RHXA 2VGNA 3JCMc 5A0GA 1K73C 1VQ9A 3OSSC 1X01A 2X4JA 3CBPA 5DY9A 3HL8A 4XTXA 3A8MB 2V8KA 3UT1A 4ZGEB 1MGQA 4IUTA 4IKFA 4NL3A 3CCMT 4JLIA 3BY7A 5CO7A 1JRIA 2QI2A 3OY9A 5GAN8 5A2QE 4MZMA 3HRSA 5GMKi 3HKSA 1M9SA 2DEQA 2PVGB 5GAOq 2OTJA 3M9QA 3OYJA 3X25B 2PUOB 1YJNT 1U8RA 3J7AF 5A0DA 1WNLA 2XHCA 3HRUA 3X28B 5KE2A 2LC4A 3TREA 4CRIA 3C94A 2EQMA 4O5VA 3EAEA 3GNGA 3HFNA 4XU3A 4BI3A 2L3RA 4IURA 1G5VA 1FWZA 3Q1JA 1VQPA 3X24B 3CMAA 3CC4T 1Q86C 3CXCS 4M78B 3CD6T 3URGA 3CCEA 2X4WA 5FROA 2QEXA 1ZBXA 2K5FA 4UC4A 1Y71A 1W2BA 4P5NA 1KC8C 4PL6A 4C92D 3OYEA 3JB9H 2DIQA 3MEUA 4QQDA 1Q81U 4E7IA 4XTYA 4ZN3A 4M7DE 5LJ5g 3LGLA 4Y91A 3I56A 3G6ET 4F7UF 2RO0A 3PNWC 4M7DD 5FU6C 2VGMA 3VUZA 4NS5A 1LJOA 2O01E 4L6V5 3JCMf 1YHQA 1M1KU 4JS4A 1K8AU 1M1FA 4M77D 4M75F 5CKBA 4C5EA 4C92F 3M5AA 5M9OA 3S6WA 1Q82C 5KE3A 2IG0A 1X6OA 3S3MA 1LOJA 5CKDA 4M7AB 1K73U 2DXBA 2DKGA 4A4GA 1VQ8A 3S3OA 5CIUA 2XDDA 4GY5A 1VQLA 4JS5A 2BUDA 3FB9A 4LDVA 1YIJT 3QSUA 2JTFA 2EQJA 2P4TA 4M7DF 4DOWA 3M56A 3JB9D 3JCMW 2VV5A 3VUBA 3RKYA 4M77F 2A7YA 3PIOA 2LCCA 3CCSA 1KG1A 4BI8B 5CQXA 4KT0E 4E7KA 4XQ3A 3QZ5B 4M75A 1H641 3SDZA 3SWNA 1XQHA 4HT8A 2ZPBB 5GAOl 1Y7XA 2D0QB 4N4HA 4M75C 3SWNC 3LX7A 4C92C 2OAUA 3OSVA 3V7SA 1I81A 2ZPHB 4EMKB 1DJ7B 5LJ5e 2EQKA 2IVWA 4BACA 2CS7A 3C12A 3INZA 4BE1A 1Q86U 4OMFB 5CR2A 4PJOA 3QPHA 1Y07A 4XTVA 3JCMg 2LDMA 3PIPA 3A8HB 3G4ST 2K57A 1KC8U 3CCJT 1K9MU 3N5BB 5LJ3f 4FT2A 2MI6A 2FB7A 2P0QA 4J7IA 4M77C 5FLXE 3JB9I 3GOXA 3CCQA 1VQMT 3OQ5A 2K5LA 3M57A 5I21A 3HSBA 4PKCC 1BIAA 4F7UG 4DA4A 5KCOA 3JCMQ 3UWNA 1VQ4T 2E10A 2WSFE 3DB4A 1Q7YU 2DTIA 2DZ9A 2E6ZA 5GMKj 3QBYA 3PMIA 3P8DA 1G3TA 3SD4A 1UGPB 2CZ7B 1MHNA 3O8VA 1EIFA 4LDWA 4M75G 1W2BS 4LDUA 1O75A 3LYIA 4QVCA 1G3SA 2FYKA 3V8KA 2JN0A 4J8OA 3M4YA 2R57A 4LDYA 4MDXA 2I2LA 1ZQ1A 1UB4A 1VUBA 2EAYA 3JSCA 1GXIE 3J81E 1JJ2A 4PJOG 3BDLA 3MHXA 1QP2A 5CQYA 1RI0A 2GFAA 2XU8A 3FEOA 4M77G 5CKHA 3DKMA 2VC8A 1VQ6A 5GAOr 2LQKA 4E47A 5CAIA 4E7JA 2R5AA 3JCMe 4M78A 3OYLA 4M7AF 2KVQG 5GANj 1YI2A 3FIFA 1YBYA 5GMKe 1B34B 3G7ZA 4ELZC 5LJ3g 3MP8A 1YJNA 4D6WA 4R55A 1NE8A 2CZ1B 3AHUA 3OA6A 3KXTA 5GAOp 3CCVA 2LCLA 5FRNA 1O9SA 1K8AC 3CC7T 3KBGA 2MMPA 2RI2A 2M0OA 3J80E 3CD6A 2L8DA 2GCXA 4QVDA 3LH0A 3SB2A 2RI5A 2P0PA 4JRIA 4LD6A 5LJ5f 5HKCA 3OBWA 4HCCA 4X9CA 5KCHA 3CMET 4M7AA 2YRVA 4EMHA 3RIRA 3OYCA 3ASKA 3OW2S 4MZPA 1BKBA 4M7AC 3G6EA 3OYYA 2DD5A 2RA2A 2E6NA 3GNFB 2YLBA 1VQKA 4M78G 4II1A 4QQGA 3JCMb 3OS2A 3OMGA 2OTLA 1KHCA 5LJ5h 2VUBA 1YJ9T 3QYGB 5GAMj 2F5KA 3DB3A 4Y28E 3CCLT 3L1AA 3C95A 2Y4YA 4J6YA 1KQSA 1UGSB 3V8JA 5LJ3e 2LRQA 2HBPA 4F7UE 5LJ5d 2PVDB 3F70A 3NTKA 3MCAB 4HCZA 1PSFA 1YIJA 2LX9A 2FVUA 3LWHA 4EMKA 3RMQA 4LD9K 3QYHB 2CZ6B 4IUQA 3OYNA 3E9FA 4M75E 4Z02A 4C92E 1M5Q1 2B8AA 3V8LA 3M59A 4EMKC 1VQNA 4M75D 3ZBDA 1UGQB 4M7AG 2R58A 1K9MC 3CC2T 3OS5A 2R5MA 2WSEE 3JB9J 2K3YA 2XIDA 5HY6A 3OMCA 3JRZA 1WQ7A 4C8QB 5IAYA 3TU4K 2P0KA 4QW2A 3G71T 1N8RC 1QVPA 2K3XA 5FU7B 1JJ2S 4MMKA 4M77E 4Q5WA 1Q7YC 4OB1B 4PJOD 4E7HA 4PLIA 4BY6B 4R56A 2PVOB 3DLMA 1VQ5A 4IUVA 1RL2A 3PFSA 3HP9A 2DXCA 3QXEB 2Y90A 3MO8A 2QTXA 3VV0A 4N4GA 1NJIC 3H6ZA 2F5TX 4V2SA 1VQ9T 2EWNA 3LWIA 3OW2A 3BW1A 2ZZDA 3JCMh 3C4SA 3ZFJA 5GAOn 2XD0A 1VQMA 4PJOF 3T9NA 1NZ9A 5GMKh 5GAN2 2M16A 2E65A 4C5IA 1BIBA 1N27A 2QDYB 4MMLA 3PGGA 4OP0A 3I55A 3M58A 3JCMd 3S3NA 4A53A 2OTJT 3GP8A 2RD1A 2RH2A 1XNIA 3L42A 3GF5A 5GANf 3FRNA 1B34A 1OZ2A 4FIBA 5EG2A 5J3BA 1FXXA 2WSCE 3VKIA 5CK9A 1VQPT 5FRMA 3CPFA 4J5YA 3P8BB 1M1GA 5CCAA 3CBOA 3CMAT 4VUBA 2YLCA 5DLQE 5J39A 2MWPA 2LNVA 2F69A 4M78D 4GLKA 4N4IA 1W4SA 2QEXT 4PJOC 4HA8A 3JCMJ 2JVVA 1VQ7T 1NPPA 3CCUA 3OBYA 1BI1A 2XDBA 4XU2A 1KQSS 1WJQA 3CBMA 3R6OA 2VXEA 2NLUA 3ZEHA 1N8RU 3GIBA 1YITT 3I56T 2BKDN 4RMOA 1XTDA 1X75C 3JCMX 3CPWA 3OS1A 4M78F 3DLLA 4KBMB 5LJ3h 2E12A 1YHQT 4QVZA 3NFCA 2QA4A 1VIFA 5A0LA 4TVRA 1M8VA 4M7AE 1KD1U 5I2SA 2DXUA 2C06A 2V8IA 1OI1A 1NJIU 1JBMA 4M7AD 3L2VA 3QJ6A 5LJ3d 4C8QF 3CEYA 5GAMf 3META 1VQ8T 2JTMA 3VU3C 1M4ZA 5IN1A 2XDPA 1VIEA 1KHIA 3M54A 5GANg 5HK0A 3LLRA 5KH6A 5HK3A 4MZTA 5D6YA 3VYGA 2CGHA 3CCMA 4JRPA 1VQOT 2V8JA 4A54A 3UPUA 2KDSA 4YTLA 3CCST 2VYTA 1AHJB 4BE0A 2E70A 2GF7A 3P8HA 4ELYC 3JCMP 1YJ9A 2DK3A 4M78C 1I8FA 1LNXA 1YCYA 5GAN6 2K5IA 3BFMA 3NTIA 2HD0A 4A4EA 3V7RA 2XK0A 4OGEA 1I4K1 5GMKm 3PTAA 3LW5E 4RCBA 1HK9A 4C8QA 2QQAA 4JLGA 4XK8E 4DQ2A 3BDUA 3QKJA 3M4GA 4F7UB 2DVEA 3X20B 4C8QC 4ZN1A 1P92A 3OYAA 2O4XB 3CC4A 2KAFA 4XTWA 2DTOA 5FU7C 2DD4A 3TEEA 4A4HA 3OYKA 1QVGA 1IREB 1KQ2A 1N9SA 2E41A 2RJFA 2L89A 3MP6A 4RG8A 5C6SA 3GPLA 1S72T 4C92B 2RI3A 4L5GA 4C0GA 2ZPGB 1JB0E 2JUFA 4OF1A 2D6FA 2CZ0B 5GAMg 3CCRT 2JOYA 2QQ9A 5GANe 1TH7A 4M7DB 3MEVA 3V7CA 3X26B 2HNIA 4C5HA 3ER0A 1UEBA 3TCJA 4ZGDB 2EJ9A 2G3RA 3MEAA 4A4FA 3GLXA 4RCCA 2PU9B 3L2RA 2VXFA 4M77B 4CI0C 2ZCFB 2E1HA 4X34A 2A3LA 3JCMV 3OYFA 4C8QG 4IUUA 4XAXB 3OYIA 2DXTA 2ZPFB 2KY9A 2GFUA 3QUIA 4HKEA 3QZ9B 5CKEA 2PUKB 3CPWS 4HT9A 1QW1A 4C0DB 4ZGJB 5I2MA 4XTZA 3RKXA 3WVDB 1VQ6T 2KSSA 4J6WA 4OB2B 1Y96B 3FLGA 2HAXA 2RK1A 2EJGA 4RG2A 1YI2T 2XG8D 2RK2A 2RHYA 2EFIA 4KUIA 5CKFA 1U1TA 5J26A 4PJOE 1N9RA 5GAMe 4BDZA 3OYMA 3E9GA 3MEWA 1PSEA 2EIFA 4FSXA 3A5ZB 5LL6S 3NTHA 3WXMB 4BI4A 3CCVT 3FDRA 1YJWT 3MP1A 1G3YA 1KD1C 3G4SA 4DOVA 2HQXA 3OS0A 3CCJA 3VYHB 2E64A 1VQ7A 4N0AA 2KQWA 2QQRA 1V29B 3E19A 4BB7A 1I5LA 2DZCA 4MDWA 4XU0A 3L2ZA 2M1HA 3OB9A 3H8ZA 4FL6A 4N0AC 1BI3A 1YITA 1VQ4A 3PMTA 1VQKT 4JRQA 5GAN7 4E7LA 2OTLT 1QVGS 1D3BB 2BIVA 2E5QA 4EDUA 2XKOC 4PLLA 1BI0A 1R8OB 4IUPA 3KUFA 4OGCA 1OYXA 5LJ5j 4LDXA 4O6JA 1U1SA 4KULA 1QVFA 2KK4A 3OYHA 3EFSA 2K2VA 3WVEB 2ZPIB 3M55A 3HFOA 4J6XA 4J7FA 3RKWA 3HPWA 1WJRA 2MWOA 4L59A 1XOVA 4M78E 2PQWA 2X4YA 4PNOA 3EFRA 3RESA 4B9XA 1FX7A 2X35A 2D9TA 3CCET 2QQSA 1VQOA 2DO3A 3QG1A 4F7UA 3OYBA 4C0ZA 3E1SA 5GANh 1VQNT 2O4XA 2RJDA 4JRKA 1UGRB 3RMSA 1KQ1A 4C8QE 2YHTA 4XU1A 4RKUE 3QO3A 4C92A 2JZ2A 4C8QD 3ME9A 2EKOA 2DAQA 5L8RE 3L2QA 4X9DA 5GANd 4JJNK 4BDYA 2RJCA 3JB9F 3QDRB 1G3WA 2EQUA 2XI9A 2JNGA 5GAOm 2RHUA 2AHJB 4C0FA 4JUVA 4OB3B 4M7DA 4ME7A 1H3ZA 4ATOA 3FJPA 1VQ5T 3CC7A 4BUGA 1M90C 4BE2A 4FT4A 4OVAA 5D6WA 2FHDA 3RUXA 2RM4A 4M7DC 4FM4B 3UDCA 4M77A 2K4YA 1IZ6A 2QQBA 1QP3A 1S72A 1VQLT 3HRTA 5FU6B 3A8LB 2LVMA 3CMEA 2CYZB 2XICA 4OB0B 3OYDA 4BD3A 2M9UA 3CCRA 2RB6A 2RJEA 1WPYA 3QIIA 1WGSA 1BYMA 3QJYA 3RERA 5AYFA 3L2WA 3VJPA 3I55T 4A4KA 5GAMh 3CXCA 2LT4A 2LT1A 4JDSA 4XTUA 3LGFA 2DPPB 1Y96A 4C92G 1OZ3A 3HHTB 4C0DC 1Q82U 2RHIA 3CCLA 5GMKl 2KMTA 5DLOA 2HQEA 5GAMd 4KUDK 2L5QA 5CVIA 3PT9A 2ZGWA 3SFMA 5GAN5 4M7DG 4J83A 4NL2A 5D6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMS A;  3RMQ A; 
#chains in the Genus database with same CATH topology
 2EYQ A;  7AT1 B;  1ZHI A;  4BY6 C;  3CCQ T;  3CCJ Q;  1RAE B;  1HSQ A;  2MF2 A;  4CC4 B;  1M2V B;  1N6A A;  3A8G B;  3JB9 G;  1QMC A;  2MAM A;  2GQV A;  2EJF A;  2QA4 T;  1RAA B;  1IHW A;  3FC3 A;  1D3B A;  1UDL A;  1K73 C;  2JXB A;  2X4J A;  2V8K A;  3UT1 A;  4F16 A;  1Z9Z A;  4IUT A;  4NL3 A;  4J9C A;  3FJ5 A;  2QI2 A;  1PCX A;  4MZM A;  5GMK i;  2DEQ A;  4OMM A;  1AVZ C;  1YJN T;  3X28 B;  2HEQ A;  3TRE A;  4CRI A;  4O5V A;  1OU8 A;  3GNG A;  4BI3 A;  4IUR A;  1PWT A;  1Q86 C;  3CD6 T;  3CCE A;  2X4W A;  2QEX A;  2DLP A;  1GFC A;  2CSI A;  2JS0 A;  4C92 D;  1PHT A;  4QQD A;  3UAT A;  4M7D E;  3LGL A;  3G6E T;  2I0N A;  4M7D D;  1I0C A;  3RR6 A;  4M77 D;  4C92 F;  3M5A A;  3S6W A;  1WX6 A;  5KE3 A;  1K73 U;  2DXB A;  3S3O A;  5HCK A;  3FB9 A;  1YIJ T;  3QSU A;  4M7D F;  2P4T A;  4DOW A;  3RKY A;  4M77 F;  2A7Y A;  3PIO A;  2LCC A;  1KG1 A;  1HYO A;  4BI8 B;  2BZX A;  5CQX A;  2RQW A;  4KT0 E;  3H0H A;  1WXB A;  1Y7X A;  3SWN C;  4M75 C;  3OSV A;  1M2V A;  4EMK B;  6AT1 B;  4BAC A;  3VS3 A;  3INZ A;  1SRM A;  2BZY A;  2HKQ B;  4OMF B;  1Q86 U;  3QPH A;  3QWY A;  3A8H B;  3CCJ T;  5LJ3 f;  4FT2 A;  4J7I A;  2P0Q A;  3GOX A;  1MND A;  4WTO B;  3M57 A;  5I21 A;  4DA4 A;  1PKT A;  1X43 A;  1FMW A;  3JCM Q;  1RAI B;  1T0H A;  2E10 A;  2WSF E;  2E6Z A;  4FYX B;  3P8D A;  1G3T A;  1ZUU A;  3SD4 A;  3O8V A;  2HSE B;  1NEB A;  1W2B S;  4LDU A;  1GCQ C;  2FYK A;  2KI7 A;  2R57 A;  2EAY A;  2NUP B;  3JSC A;  4JPB W;  1GXI E;  4PFZ A;  1JJ2 A;  3BDL A;  3MHX A;  2XU8 A;  2DEU A;  4M77 G;  1AWW A;  5CKH A;  3CMA Q;  5GAO r;  5CAI A;  1K1Z A;  2R5A A;  3JCM e;  3OYL A;  4M7A F;  4F17 A;  5GMK e;  2GTO A;  3G7Z A;  4PJN A;  4J9F A;  4DEX A;  5LJ3 g;  2DE0 X;  2FPF A;  2M02 A;  1K8A C;  4AFQ C;  1OX9 A;  1W1F A;  3J80 E;  4QVD A;  4OMP A;  2V26 A;  5KCH A;  1VQ8 Q;  2YRV A;  4JJB A;  1H92 A;  4M78 G;  2DF6 A;  4II1 A;  2DVJ A;  3OMG A;  1JXO A;  3CCS Q;  2LJ3 A;  4Y28 E;  4J6Y A;  1M90 R;  2LRQ A;  2HBP A;  3U23 A;  2A0F B;  4F7U E;  3NTK A;  4HCZ A;  2C0I A;  4EMK A;  3RMQ A;  4LD9 K;  3QYH B;  3UF4 A;  2ED1 A;  4M7A G;  2R58 A;  2WSE E;  1KIK A;  3OMC A;  3NGP A;  3EG0 A;  5IAY A;  2KGT A;  2P0K A;  1QVP A;  1MMD A;  4MMK A;  4BY6 B;  3DLM A;  4LE9 A;  3VV0 A;  3EHR A;  2ZZD A;  3C4S A;  2KYB A;  1OEB A;  2BTT A;  2J6O A;  1NZ9 A;  2M16 A;  2NUP A;  3VS1 A;  2CSQ A;  1ZA2 B;  1M30 A;  2EGC A;  3S3N A;  4A53 A;  1G2B A;  1TTH B;  1XNI A;  5GJW B;  3FRN A;  2YWW A;  1KSW A;  2DL7 A;  1K9A A;  2WSC E;  5CK9 A;  1M1G A;  5KYY B;  3CBO A;  3CMA T;  2YLC A;  2A28 A;  5DLQ E;  2LNV A;  1GFD A;  4GLK A;  3MPU B;  2XDB A;  4XU2 A;  1WJQ A;  3CBM A;  2VXE A;  2NLU A;  2CDT A;  2LQN A;  2BKD N;  1XTD A;  1LVK A;  1X75 C;  2JMA A;  5LJ3 h;  2QA4 A;  1NBE B;  4TVR A;  2DXU A;  1AEY A;  3A98 A;  1WIE A;  4C8Q F;  1VQ8 T;  3CEY A;  1YWP A;  3VU3 C;  2XDP A;  1KHI A;  4J9G A;  1KC8 R;  4MZT A;  1K9M R;  2CGH A;  1JQQ A;  2MPX C;  4JRP A;  1VQO T;  4A54 A;  3UPU A;  2DET A;  2KDS A;  4YTL A;  4CC3 A;  3CCS T;  2RN8 A;  1AHJ B;  1YJ9 A;  4JZ4 A;  2DK3 A;  4M78 C;  4A4E A;  4FW1 A;  3V7R A;  3G1J A;  5GMK m;  3LW5 E;  4JLG A;  4RTY A;  4KGX B;  2JMC A;  2DYI A;  2HMA A;  4XTW A;  3OYK A;  1NLP C;  2DBM A;  2DTO A;  4RG8 A;  3GPL A;  1UGV A;  3VS5 A;  2RI3 A;  1AT1 B;  4OF1 A;  2CP5 A;  2JUF A;  2D6F A;  4Y92 A;  2QQ9 A;  1VQM Q;  4C5H A;  3V7C A;  1UEB A;  4A4F A;  3L2R A;  4OMN A;  1I07 A;  2AT1 B;  4LUE A;  3OYF A;  2KYM A;  4C8Q G;  2KRS A;  2J6F A;  1TWB A;  2KY9 A;  2GFU A;  2VB6 A;  3CPW S;  2PUK B;  1QW1 A;  1C6V X;  4J6W A;  1Y96 B;  2KT8 A;  3FLG A;  5KYY A;  1V1C A;  2FPD A;  1IGU A;  4RG2 A;  3CCU Q;  3MKD A;  3E9G A;  3MEW A;  2D0N A;  3A5Z B;  5LL6 S;  1VYV A;  1G3Y A;  1KD1 C;  2K2M A;  3CCJ A;  4N0A A;  2DZC A;  2ROT A;  2M1H A;  1YIT A;  5ECA A;  3PMT A;  2HZY A;  1QCN A;  2C0O A;  3CCM Q;  4E7L A;  1FMK A;  4OML A;  4EDU A;  1R8O B;  5LJ5 j;  1VA7 A;  1OYX A;  1QVF A;  1UFF A;  3M55 A;  1X6B A;  4J6X A;  2XMF A;  2GGR A;  2ENM A;  1PRL C;  1FX7 A;  2X35 A;  3CCE T;  2DO3 A;  4C0Z A;  3E1S A;  2JJ9 A;  4FYY B;  4DBQ A;  2KR3 A;  2QAZ A;  2OJ2 A;  1UGR B;  2JTE A;  4RKU E;  2L2P A;  3ME9 A;  3SHW A;  5GAN d;  4BDY A;  3QDR B;  1G3W A;  4PJJ A;  4C0F A;  4D8K A;  4ME7 A;  1JXM A;  4FT4 A;  4OVA A;  3RUX A;  2EKH A;  2RM4 A;  1IZ6 A;  2QQB A;  4D8D A;  3HRT A;  2VAS A;  3OYD A;  2OAW A;  4OB0 B;  3EH2 A;  3CCR A;  2RJE A;  1BYM A;  3EGD B;  4X1V A;  1GBQ A;  1Y96 A;  2GBQ A;  4C0D C;  1YWO A;  4FW2 A;  2K9G A;  2CT4 A;  2L5Q A;  1BU1 A;  2LJ0 A;  2QK0 A;  4K11 A;  3THK A;  3IQL A;  1NJI R;  2K6D A;  2DTH A;  4NOY A;  2DJZ A;  3VS4 A;  1UE9 A;  5C0M A;  1GCP A;  2FL7 A;  1NPR A;  3CCU T;  1R0B G;  4QQ6 A;  3G4S Q;  1VQ7 Q;  2JT4 A;  2LQ8 A;  4EMG A;  1BI2 A;  2RHZ A;  3L2U A;  1ZBJ A;  4HCB A;  3OYG A;  1VQ4 Q;  3JAM E;  4LUD A;  4B9W A;  1YP5 A;  2MIO A;  5DM7 R;  5FWC A;  2H3J A;  5A0G A;  1X01 A;  2RQV A;  3A8M B;  4ZGE B;  4IKF A;  3CCM T;  3M0R A;  3BY7 A;  2A08 A;  1WDX A;  4RUG A;  3X25 B;  1U8R A;  3J7A F;  1OPK A;  5A0D A;  1D1C A;  1M8M A;  3EAE A;  2A36 A;  3HFN A;  2NYS A;  3CMA A;  4M78 B;  3CC7 Q;  4UC4 A;  3EHQ A;  4PL6 A;  1S72 Q;  2JS2 A;  4E7I A;  4XTY A;  2EYW A;  1UEC A;  2JW4 A;  2NWM A;  2ZAE A;  3JCM f;  3TSZ A;  4JS4 A;  4M75 F;  3EGD A;  2AZS A;  1RAF B;  1Q82 C;  2IG0 A;  1X6O A;  3S3M A;  2RQU A;  4M7A B;  3CCL Q;  1VQ8 A;  2XDD A;  4HVV A;  2BUD A;  2JTF A;  3M56 A;  3JB9 D;  1RLP C;  3CCS A;  2GTJ A;  3VS6 A;  2DRM A;  1C0M A;  3SDZ A;  1XQH A;  2ZPB B;  5GAO l;  5KYW B;  1X6G A;  4N4H A;  5LJ5 e;  3G71 Q;  3H0I A;  3C12 A;  4BE1 A;  1YJW Q;  3JCM g;  2LDM A;  1TS9 A;  2DM1 A;  3G4S T;  1IO6 A;  3N5B B;  5FLX E;  3JB9 I;  1OUL A;  1VQ9 Q;  2K5L A;  4PKC C;  1VQ4 T;  1Q7Y U;  4CC2 A;  2DTI A;  2EQI A;  5GMK j;  2CZ7 B;  1MHN A;  4M75 G;  1EIF A;  1GL5 A;  1WXU A;  3LYI A;  2OTJ Q;  3M4Y A;  1Q86 R;  2FZC B;  4LDY A;  2I2L A;  1VUB A;  4PJO G;  1QP2 A;  3QWX X;  2GFA A;  3FEO A;  1TU0 B;  2LQK A;  4AFU C;  1U3O A;  4M78 A;  2NUZ A;  3NMZ C;  4AMC A;  2EGE A;  1D1B A;  4QT7 A;  4ELZ C;  2PZ1 A;  4D6W A;  4R55 A;  2IPO B;  2QAS A;  2CZ1 B;  1YIT Q;  3I56 Q;  3AHU A;  2EYX A;  5GAO p;  2LCL A;  5FRN A;  1O9S A;  1OPL A;  1YHQ Q;  3CC7 T;  2DBK A;  2RI2 A;  1X27 A;  1H3H A;  4F14 A;  2L8D A;  3LH0 A;  2O2O A;  3SB2 A;  2MCN A;  4HCC A;  3OBW A;  4X9C A;  4M7A A;  3OW2 S;  3ASK A;  4MZP A;  1CKA A;  2YLB A;  1KHC A;  2VUB A;  1YJ9 T;  3QYG B;  5GAM j;  1ZSZ C;  1M3B A;  3CCL T;  1KQS A;  3F70 A;  1SKU B;  3MCA B;  1PSF A;  5KYW A;  3LWH A;  1T3L A;  2CZ6 B;  2EYY A;  2O31 A;  3PE0 A;  3E9F A;  3OYN A;  4C92 E;  1M5Q 1;  2COW A;  1QKX A;  3M59 A;  1UGQ B;  2P4R A;  3OS5 A;  2ATC B;  1WQ7 A;  4C8Q B;  1BBZ A;  5GJV B;  3G71 T;  1N8R C;  3CCR Q;  2K3X A;  4M77 E;  4OB1 B;  1ZX6 A;  1PM3 A;  4IUV A;  1RL2 A;  3PFS A;  4JZ3 A;  2CP2 A;  3HP9 A;  2DXC A;  3CPW P;  3MO8 A;  4PJL A;  1VQ9 T;  2EWN A;  3JCM h;  2XD0 A;  1VQM A;  2PTK A;  4DBF A;  5GMK h;  5GAN 2;  2E65 A;  4C5I A;  1BIB A;  1N27 A;  2ESW A;  2QDY B;  3PGG A;  1Q81 R;  1CKB A;  1G8X A;  2OTJ T;  1S1N A;  1YI2 Q;  1K8A R;  1TOV A;  3CXC P;  2E3I A;  4J5Y A;  1TUG B;  5CCA A;  3CCV Q;  2HSP A;  5J39 A;  4M78 D;  1HJD A;  4PJO C;  1NPP A;  3CCU A;  1IRX A;  3TQ7 P;  3AT1 B;  3R6O A;  1N8R U;  1YIT T;  3I56 T;  1V76 A;  3OS1 A;  4M78 F;  1YHQ T;  2E12 A;  2CH4 A;  5A0L A;  2OTL Q;  1M8V A;  2X51 A;  4M7A E;  5IH2 A;  2V8I A;  1OI1 A;  1R77 A;  3REB B;  4M7A D;  3L2V A;  2DNU A;  3QJ6 A;  5LJ3 d;  5HK3 A;  5IHK A;  1K0X A;  3CCM A;  4J9E A;  1HD3 A;  4BE0 A;  2E70 A;  2JM9 A;  4ELY C;  2X9H A;  4RTZ A;  2XK0 A;  3PTA A;  2V1Q A;  4RCB A;  1HK9 A;  4C8Q A;  4DQ2 A;  1JU5 C;  3BDU A;  2EYZ A;  8AT1 B;  2NUT B;  2O4X B;  2KAF A;  4HXJ A;  5FU7 C;  1QVG A;  3NHN A;  4LN2 A;  4A4H A;  1IRE B;  1SEM A;  1N9S A;  2E41 A;  3M0P A;  2L89 A;  3MP6 A;  3VS2 A;  3M0T A;  1K4U S;  2ZPG B;  1NYF A;  3CCR T;  3UA7 A;  2HNI A;  3ER0 A;  3TCJ A;  2G3R A;  1PD0 A;  3TSW A;  2VXF A;  3I55 Q;  1EZZ B;  4E6R A;  2HDA A;  2ZCF B;  2E1H A;  5IHI A;  1QCF A;  1VYU A;  3D7S B;  4ESR A;  2X3X D;  4XAX B;  1PKS A;  2DXT A;  3QUI A;  4HKE A;  3QZ9 B;  4J9D A;  5I2M A;  2DL4 A;  4XTZ A;  3WVD B;  1NYG A;  4AFZ C;  2RK1 A;  2EJG A;  1YI2 T;  1M3A A;  5GAM e;  3O5Z A;  4DBR A;  3WXM B;  3CCV T;  3NTH A;  3FDR A;  3MP1 A;  3G4S A;  5FW9 A;  1VQ7 A;  2KQW A;  4JJC A;  1V29 B;  3OB9 A;  9ATC B;  1BI3 A;  4J9I A;  5I11 A;  1VQ4 A;  3VRZ A;  4GBQ A;  5GAN 7;  2RNA A;  2OTL T;  1UTI A;  3EG2 A;  1D0Z A;  2DRK A;  2QG9 B;  4O6J A;  1U1S A;  2KK4 A;  2KRO A;  3EFS A;  3WVE B;  3RNJ A;  1ACM B;  1WJR A;  2X4Y A;  3RES A;  3EGU A;  1ZSZ B;  2QYZ A;  3CC4 Q;  3QG1 A;  2NUT A;  2O4X A;  4JRK A;  3RMS A;  1JJ2 P;  4C8Q E;  2YHT A;  1UG1 A;  2JZ2 A;  4C8Q D;  1ARK A;  2DAQ A;  2CUB A;  2XI9 A;  5GAO m;  2RHU A;  2O9V A;  2FG0 A;  4ATO A;  1WHJ A;  4FSS A;  4AG1 C;  4BUG A;  3CC7 A;  1M90 C;  4BE2 A;  5D6W A;  4M7D C;  1ZUY A;  3UDC A;  1S72 A;  4EIK A;  2LVM A;  4BD3 A;  2M9U A;  3QDF A;  3QJY A;  5AYF A;  3VJP A;  2HBW A;  4A4K A;  3I55 T;  1M2O A;  1AZE A;  2LT4 A;  4JDS A;  3LH5 A;  2DJQ A;  3LGF A;  2DPP B;  1LPL A;  4ZNX A;  3CCL A;  2KMT A;  2VWF A;  2HQE A;  4KUD K;  1KD1 R;  5GAN 5;  2LX7 A;  5GAN 4;  2LJ1 A;  2QXF A;  3VRY A;  2K79 A;  1RUW A;  3SWN B;  4M75 B;  4ZTF A;  2YXY A;  2IIM A;  2Y4X A;  3G71 A;  1IHV A;  2DX1 A;  4ZTJ A;  3A8O B;  4PJO B;  1LCK A;  1YJW A;  1M90 U;  1HXD A;  1M1K C;  5GAN 3;  3M0Q A;  4FU6 A;  4C5G A;  1SSF A;  2RHX A;  3JCM c;  2HCK A;  1VQ9 A;  3OSS C;  4DBH A;  3HL8 A;  4XTX A;  5CO7 A;  1TUD A;  3HRS A;  1ZSZ A;  3HKS A;  1M9S A;  1X69 A;  5GAO q;  2OTJ A;  3OYJ A;  2PUO B;  1IGQ A;  1WNL A;  2MOX A;  2XHC A;  1YFN A;  5KE2 A;  2LC4 A;  2EQM A;  5IHN A;  2GNC A;  1FWZ A;  3X24 B;  2DL5 A;  3CC4 T;  3CXC S;  2HKN A;  3URG A;  3OW2 P;  1UHF A;  2W0Z A;  4PJM A;  1W2B A;  1B07 A;  1KC8 C;  3JB9 H;  3OYE A;  1IXD A;  2KNB B;  3MEU A;  2K7A A;  1JO8 A;  5LJ5 g;  3I56 A;  3PNW C;  1AWJ A;  2E3H A;  5FU6 C;  2KXD A;  2VGM A;  1YHQ A;  1LJO A;  4L6V 5;  1M1K U;  2J05 A;  4C5E A;  5M9O A;  5CKD A;  2DKG A;  4LDV A;  2QTV A;  3JCM W;  1XJW B;  3VUB A;  1SHF A;  4E7K A;  2HL5 C;  4Z89 A;  3SWN A;  4M75 A;  3CC2 Q;  4HT8 A;  1NG2 A;  3I9Q A;  4E7S A;  3LX7 A;  1WI7 A;  3V7S A;  1I81 A;  1K76 A;  2CS7 A;  2DYB A;  3EG9 B;  2LCS A;  5CR2 A;  4PJO A;  1AZG B;  1Y07 A;  4XTV A;  3PIP A;  1QWF A;  2CP0 A;  1KC8 U;  1K9M U;  2C06 A;  2FB7 A;  2YUO A;  1VQM T;  3HSB A;  1BIA A;  1SRL A;  5KCO A;  3UWN A;  1M27 C;  2JM8 A;  1T0J A;  1PD1 A;  1GCQ A;  1RLQ C;  1UJY A;  1G3S A;  3V8K A;  2JN0 A;  2W10 A;  2YUQ A;  4J8O A;  1KJW A;  1QQJ A;  1Y57 A;  1UB4 A;  3VS0 A;  2DL3 A;  1VQP Q;  3DKM A;  2VC8 A;  2F2X A;  4E47 A;  4E7J A;  2ECZ A;  1WYX A;  5GAN j;  1YI2 A;  1E6H A;  3E2U A;  3FIF A;  1B34 B;  4KGZ B;  1WFW A;  1R0C B;  2F1L A;  2AIR B;  2DIL A;  2CP7 A;  2OI3 A;  3KXT A;  1Q82 R;  2BE7 D;  3CCV A;  4IIM A;  3KBG A;  3C0C A;  2M0O A;  4M4Z A;  1MMA A;  1OV3 A;  2EPD A;  2GCX A;  1MMN A;  2RI5 A;  2P0P A;  4JRI A;  4LD6 A;  2CP3 A;  1RAB B;  1VQL Q;  2CP6 A;  1ZA1 B;  2M51 A;  3OYY A;  2RA2 A;  2CT3 A;  2E6N A;  4RTX A;  3JCM b;  3OS2 A;  2OTL A;  5LJ5 h;  2F5K A;  2LMJ A;  4LNP A;  1AOJ A;  3L1A A;  1PG5 B;  3ZL7 C;  1UGS B;  3V8J A;  2PVD B;  2LX9 A;  2FVU A;  2DA9 A;  4Z02 A;  4M75 E;  1QCO A;  1QVF P;  3V8L A;  4EMK C;  3EG9 A;  4M75 D;  3ZBD A;  3H41 A;  3CC2 T;  2R5M A;  2XID A;  5HY6 A;  3TU4 K;  4QW2 A;  1JJ2 S;  4Q5W A;  1I5O B;  1Q7Y C;  4PJO D;  4E7H A;  1WLP B;  4PLI A;  4R56 A;  2PVO B;  2BZ8 A;  1GBR A;  4N4G A;  1NJI C;  3H6Z A;  2F5T X;  2FO0 A;  4V2S A;  3LWI A;  3BW1 A;  2KRN A;  1RI9 A;  5GAO n;  3BE3 A;  4PJO F;  2EBP A;  5KYN A;  1BK2 A;  3I55 A;  1UHC A;  1VQ6 Q;  3M58 A;  3JCM d;  2RH2 A;  4OMQ A;  2G6F X;  1YJN Q;  1B34 A;  1OZ2 A;  5EG2 A;  5J3B A;  1FXX A;  1K73 R;  5FRM A;  1VQP T;  2CUD A;  3P8B B;  1K0S A;  4RTU A;  2L3S A;  2MWP A;  3I5S A;  4OMO A;  1T3S A;  1RAC B;  2JVV A;  1VQ7 T;  3CD6 Q;  5KYU B;  4J9H A;  1ZUK A;  2ABL A;  3ZEH A;  3GIB A;  1MMG A;  2J06 A;  3CPW A;  1WHH A;  4A63 B;  1VQK Q;  4QVZ A;  1VIF A;  2AK5 A;  1NJI U;  1UJ0 A;  4HCK A;  1SSH A;  5GAM f;  3MET A;  1SG5 A;  2JTM A;  5IN1 A;  1VIE A;  3M54 A;  3LLR A;  1YIJ Q;  2LQW A;  5D6Y A;  3VYG A;  2V8J A;  2VYT A;  3M0U A;  2GF7 A;  3JCM P;  1VQN Q;  1I8F A;  1LNX A;  2K5I A;  3BFM A;  3NTI A;  2HD0 A;  2O9S A;  5IXB A;  1E7O A;  1I4K 1;  1W6X A;  2QQA A;  4ORZ A;  4XK8 E;  1WHM A;  2QGG A;  3M4G A;  3QKJ A;  3X20 B;  4F7U B;  4ZN1 A;  3CC4 A;  2COZ A;  3TEE A;  1VYT A;  1VQ5 Q;  5C6S A;  1S72 T;  1SF9 A;  4L5G A;  1JB0 E;  4LXC A;  5GAM g;  2JOY A;  5GAN e;  1TH7 A;  3MEV A;  3X26 B;  2H3E B;  4ZGD B;  3EH1 A;  2CH4 W;  4CI0 C;  1ZSG A;  2O88 A;  3A1P A;  2MK5 A;  3JCM V;  4IUU A;  2DFU A;  3OYI A;  2X3W D;  2ZPF B;  2VKN A;  4HT9 A;  2LP5 A;  1TXQ A;  4C0D B;  4B6M A;  1VQ6 T;  4OB2 B;  4ANJ A;  2K3B A;  3SEM A;  2RK2 A;  4KUI A;  5CKF A;  2GQI A;  1U1T A;  5KYU A;  1MUZ A;  1WHG A;  2RPN A;  1KFZ A;  2EW3 A;  1X2Q A;  1PSE A;  2EIF A;  2LNH B;  3RDV A;  4BI4 A;  1YJW T;  4AT1 B;  3TVT A;  2EVR A;  2L0A A;  2PNI A;  4DOV A;  3VYH B;  2QQR A;  1QLY A;  3HTR A;  4BB7 A;  4XU0 A;  2SEM A;  4N0A C;  2KRM A;  4Z8A A;  1VQK T;  1D0Y A;  4KGV B;  1JEG A;  2BIV A;  1AWO A;  2E5Q A;  2XKO C;  4PLL A;  4OGC A;  3KUF A;  1OX8 A;  2KE9 A;  2ZPI B;  4FYV B;  4J7F A;  3RKW A;  3HPW A;  1XOV A;  2QDL A;  1YCS B;  2PQW A;  4M78 E;  3EFR A;  4B9X A;  1OOT A;  4HVU A;  4F7U A;  3OYB A;  1VQN T;  1RAD B;  4XU1 A;  3QO3 A;  3L2Q A;  3I35 A;  2EQU A;  2JNG A;  2AHJ B;  4OB3 B;  1VQ5 T;  1D0X A;  2FHD A;  3I5R A;  2FPE A;  2K4Y A;  5L23 A;  3ULR B;  2P84 A;  1VOM A;  3L2W A;  5GAM h;  1E6G A;  4C92 G;  1BCM A;  3UA6 A;  5CVI A;  4Z88 A;  3SFM A;  3VS7 A;  4M7D G;  4E7Z A;  1N5Z A;  3QHS A;  1KQS P;  4WCI A;  3CC2 A;  2RF0 A;  1QVF S;  2DIG A;  1WJS A;  1QKW A;  1Q81 C;  4EPC A;  2ZPE B;  5IT9 E;  4AG2 C;  4R0K A;  1IB8 A;  2CKK A;  2YRD A;  1WQW A;  2X4X A;  4WF2 A;  5LJ3 j;  2WAC A;  3M53 A;  2J7I A;  2LTO A;  2VGN A;  3CBP A;  5DY9 A;  2DMO A;  1D09 B;  1MGQ A;  2KEA A;  4JLI A;  1JRI A;  3OY9 A;  5GAN 8;  5A2Q E;  1WHK A;  1VQO Q;  2PVG B;  3M9Q A;  1ABQ A;  1YN8 A;  4FYW B;  3HRU A;  2YRC A;  3CQT A;  3C94 A;  1EX4 A;  3JV3 A;  1SPK A;  1I1J A;  2F2W A;  3NPF A;  4XU3 A;  2L3R A;  1J3T A;  1G5V A;  3PVQ A;  3Q1J A;  1VQP A;  4PFP A;  1TSF A;  5FRO A;  1ZBX A;  2K5F A;  1Y71 A;  4P5N A;  2QGF B;  2DIQ A;  5EC7 A;  1Q81 U;  4ZN3 A;  2OX7 A;  3CME Q;  4Y91 A;  4F7U F;  2RO0 A;  4E2F B;  3VUZ A;  4NS5 A;  2O01 E;  4HVW A;  1K8A U;  2D1X A;  1M1F A;  5CKB A;  2YUN A;  1LOJ A;  4A4G A;  5CIU A;  4GY5 A;  1VQL A;  4JS5 A;  2DL8 A;  2EQJ A;  2EGA A;  3M0S A;  2VV5 A;  1OQK A;  4XQ3 A;  3QZ5 B;  1H64 1;  2V1R A;  1PNJ A;  1BCO A;  2D0Q B;  1M1K R;  4C92 C;  4PFO A;  2OAU A;  1CSK A;  3OW2 A;  2A37 A;  2ZPH B;  1DJ7 B;  2EQK A;  2IVW A;  2KBT A;  1RAH B;  1WXT A;  2YDL A;  5AT1 B;  1Y0M A;  2K57 A;  2FZK B;  2MI6 A;  4M77 C;  2KXC A;  4F04 B;  3CCQ A;  3OQ5 A;  1MV3 A;  1QVG P;  4F7U G;  5I22 A;  3DB4 A;  2DZ9 A;  4FCY A;  3QBY A;  3PMI A;  1G83 A;  1UGP B;  4LDW A;  2HL3 A;  1O75 A;  4QVC A;  4KRT A;  5FWB A;  4MDX A;  1ZQ1 A;  2HQH A;  1GRI A;  2RMO A;  1YNZ A;  3J81 E;  1ZLM A;  5CQY A;  1H8K A;  1RI0 A;  1VQ6 A;  4JJD A;  1NEG A;  2ED0 A;  3CCE Q;  2QEX Q;  2KVQ G;  2B86 A;  1YBY A;  1YJN A;  3MP8 A;  3PVL A;  4PK4 A;  4RTV A;  1NE8 A;  1M3C A;  3OA6 A;  1U06 A;  2FZG B;  2DER A;  2MMP A;  3CD6 A;  1MV0 B;  5LJ5 f;  5HKC A;  3CME T;  4KH1 B;  4EMH A;  3RIR A;  3OYC A;  1U5S A;  1BKB A;  1F1B B;  1WHL A;  4GLM A;  3G6E A;  4M7A C;  2COY A;  1FMV A;  2DD5 A;  3GNF B;  1VQK A;  4QQG A;  4AFS C;  3DB3 A;  1X2K A;  3C95 A;  2Y4Y A;  2YUP A;  5LJ3 e;  5LJ5 d;  5KYX B;  1YIJ A;  1B7T A;  4IUQ A;  2B8A A;  1B3Q A;  1EFN A;  1VQN A;  2J6K A;  1K9M C;  1BB9 A;  3JB9 J;  2K3Y A;  3JRZ A;  3KFV A;  5FU7 B;  3H0F A;  3H9N A;  2H8H A;  1VQ5 A;  2CRE A;  3QXE B;  2Y90 A;  2VVK A;  2QTX A;  4J9B A;  3ZFJ A;  1OU9 A;  3T9N A;  4MML A;  4OP0 A;  2Z0W A;  3GP8 A;  2RD1 A;  2AZV A;  3L42 A;  3GF5 A;  1NLO C;  2FRW A;  5GAN f;  4FIB A;  3VKI A;  3CPF A;  4VUB A;  1QWE A;  2F69 A;  4N4I A;  1W4S A;  2QEX T;  4HA8 A;  3JCM J;  3OBY A;  1BI1 A;  1KQS S;  3EG1 A;  2FEI A;  2M0Y A;  4RMO A;  3JCM X;  3DLL A;  4KBM B;  3NFC A;  1W70 A;  1KD1 U;  5I2S A;  1JBM A;  1M4Z A;  5GAN g;  5HK0 A;  5KH6 A;  3REA B;  5KYX A;  1C1A A;  2RQR A;  3P8H A;  3EGX B;  1Q7Y R;  1YCY A;  5GAN 6;  2E4H A;  1NM7 A;  2RQT A;  1KK7 A;  4OGE A;  3OYA A;  2DVE A;  4C8Q C;  1P92 A;  2FRY A;  4KH0 B;  2DD4 A;  1KQ2 A;  2RJF A;  4C92 B;  4C0G A;  2L3Q A;  2CZ0 B;  4M7D B;  1RAG B;  1W2B P;  2EJ9 A;  3MEA A;  1PC0 A;  3GLX A;  2PU9 B;  4RCC A;  4M77 B;  4DEY A;  4RTW A;  4X34 A;  2A3L A;  3R6N A;  1A0N B;  2AKK A;  1TUC A;  5CKE A;  4ZGJ B;  3RKX A;  2KSS A;  2HAX A;  2F2V A;  1AD5 A;  2XG8 D;  2RHY A;  2EFI A;  3CCQ Q;  5J26 A;  4PJO E;  1N9R A;  3EFO B;  4BDZ A;  3OYM A;  4FSX A;  5D7U A;  1TG0 A;  2QA4 Q;  1SHG A;  1FYN A;  1PRM C;  2HQX A;  4QKU A;  3OS0 A;  2E64 A;  4IIO A;  3RBB B;  3E19 A;  1I5L A;  4MDW A;  3L2Z A;  2YSQ A;  3H8Z A;  4FL6 A;  4CC7 A;  4JRQ A;  2LZ6 B;  1QVG S;  1D3B B;  1WA7 A;  1BI0 A;  2D8J A;  4IUP A;  4RTT A;  1YJ9 Q;  4LDX A;  4KUL A;  3EGX A;  3OYH A;  2K2V A;  3HFO A;  2BE9 B;  2MWO A;  3GBQ A;  4L59 A;  4PNO A;  2D9T A;  2QQS A;  1VQO A;  5GAN h;  1Q95 G;  2AKL A;  2RJD A;  1KQ1 A;  4C92 A;  2EKO A;  3EG3 A;  5L8R E;  4JJN K;  4X9D A;  3JB9 F;  2RJC A;  3G6E Q;  1AWX A;  4JUV A;  2E5K A;  5IXF A;  4M7D A;  1H3Z A;  3FJP A;  1WZO A;  4FM4 B;  1D1A A;  4M77 A;  1QP3 A;  1VQL T;  5FU6 B;  2SRC A;  3A8L B;  2MYS A;  3CME A;  2CYZ B;  2XIC A;  2RB6 A;  1ABO A;  1WPY A;  3QII A;  1WGS A;  2ROL A;  3RER A;  3MJX A;  3CXC A;  1N8R R;  2LT1 A;  1MNE A;  4XTU A;  2L3P A;  1UUE A;  1OZ3 A;  3HHT B;  1Q82 U;  2RHI A;  1Z9Q A;  5GMK l;  5DLO A;  2D8H A;  5GAM d;  2KT1 A;  2C0T A;  3PT9 A;  2ZGW A;  8ATC B;  2YT6 A;  3EFO A;  4J83 A;  4NL2 A;  5D6X A; 
#chains in the Genus database with same CATH homology
 3QHS A;  5GAN 4;  2DTH A;  4NOY A;  2DJZ A;  2QXF A;  2EYQ A;  5C0M A;  2FL7 A;  1ZHI A;  1NPR A;  4M75 B;  3SWN B;  3CCU T;  4QQ6 A;  4BY6 C;  4ZTF A;  3CCQ T;  3CC2 A;  1QVF S;  2DIG A;  2LQ8 A;  1WJS A;  2MF2 A;  1BI2 A;  4EMG A;  2Y4X A;  1Q81 C;  2RHZ A;  1N6A A;  3A8G B;  4EPC A;  3L2U A;  2MAM A;  2ZPE B;  3G71 A;  3JB9 G;  2GQV A;  4HCB A;  3OYG A;  3A8O B;  4ZTJ A;  5IT9 E;  4PJO B;  2CKK A;  2EJF A;  3JAM E;  2QA4 T;  1YJW A;  1WQW A;  1HXD A;  4B9W A;  2X4X A;  5GAN 3;  1M1K C;  1M90 U;  4FU6 A;  4WF2 A;  5LJ3 j;  5DM7 R;  2WAC A;  4C5G A;  3M53 A;  1D3B A;  3FC3 A;  1SSF A;  2H3J A;  2LTO A;  2RHX A;  2VGN A;  3JCM c;  5A0G A;  1K73 C;  1VQ9 A;  3OSS C;  1X01 A;  2X4J A;  3CBP A;  5DY9 A;  3HL8 A;  4XTX A;  3A8M B;  2V8K A;  3UT1 A;  4ZGE B;  1MGQ A;  4IUT A;  4IKF A;  4NL3 A;  3CCM T;  4JLI A;  3BY7 A;  5CO7 A;  1JRI A;  2QI2 A;  3OY9 A;  5GAN 8;  5A2Q E;  4MZM A;  3HRS A;  5GMK i;  3HKS A;  1M9S A;  2DEQ A;  2PVG B;  5GAO q;  2OTJ A;  3M9Q A;  3OYJ A;  3X25 B;  2PUO B;  1YJN T;  1U8R A;  3J7A F;  5A0D A;  1WNL A;  2XHC A;  3HRU A;  3X28 B;  5KE2 A;  2LC4 A;  3TRE A;  4CRI A;  3C94 A;  2EQM A;  4O5V A;  3EAE A;  3GNG A;  3HFN A;  4XU3 A;  4BI3 A;  2L3R A;  4IUR A;  1G5V A;  1FWZ A;  3Q1J A;  1VQP A;  3X24 B;  3CMA A;  3CC4 T;  1Q86 C;  3CXC S;  4M78 B;  3CD6 T;  3URG A;  3CCE A;  2X4W A;  5FRO A;  2QEX A;  1ZBX A;  2K5F A;  4UC4 A;  1Y71 A;  1W2B A;  4P5N A;  1KC8 C;  4PL6 A;  4C92 D;  3OYE A;  3JB9 H;  2DIQ A;  3MEU A;  4QQD A;  1Q81 U;  4E7I A;  4XTY A;  4ZN3 A;  4M7D E;  5LJ5 g;  3LGL A;  4Y91 A;  3I56 A;  3G6E T;  4F7U F;  2RO0 A;  3PNW C;  4M7D D;  5FU6 C;  2VGM A;  3VUZ A;  4NS5 A;  1LJO A;  2O01 E;  4L6V 5;  3JCM f;  1YHQ A;  1M1K U;  4JS4 A;  1K8A U;  1M1F A;  4M77 D;  4M75 F;  5CKB A;  4C5E A;  4C92 F;  3M5A A;  5M9O A;  3S6W A;  1Q82 C;  5KE3 A;  2IG0 A;  1X6O A;  3S3M A;  1LOJ A;  5CKD A;  4M7A B;  1K73 U;  2DXB A;  2DKG A;  4A4G A;  1VQ8 A;  3S3O A;  5CIU A;  2XDD A;  4GY5 A;  1VQL A;  4JS5 A;  2BUD A;  3FB9 A;  4LDV A;  1YIJ T;  3QSU A;  2JTF A;  2EQJ A;  2P4T A;  4M7D F;  4DOW A;  3M56 A;  3JB9 D;  3JCM W;  2VV5 A;  3VUB A;  3RKY A;  4M77 F;  2A7Y A;  3PIO A;  2LCC A;  3CCS A;  1KG1 A;  4BI8 B;  5CQX A;  4KT0 E;  4E7K A;  4XQ3 A;  3QZ5 B;  4M75 A;  1H64 1;  3SDZ A;  3SWN A;  1XQH A;  4HT8 A;  2ZPB B;  5GAO l;  1Y7X A;  2D0Q B;  4N4H A;  4M75 C;  3SWN C;  3LX7 A;  4C92 C;  2OAU A;  3OSV A;  3V7S A;  1I81 A;  2ZPH B;  4EMK B;  1DJ7 B;  5LJ5 e;  2EQK A;  2IVW A;  4BAC A;  2CS7 A;  3C12 A;  3INZ A;  4BE1 A;  1Q86 U;  4OMF B;  5CR2 A;  4PJO A;  3QPH A;  1Y07 A;  4XTV A;  3JCM g;  2LDM A;  3PIP A;  3A8H B;  3G4S T;  2K57 A;  1KC8 U;  3CCJ T;  1K9M U;  3N5B B;  5LJ3 f;  4FT2 A;  2MI6 A;  2FB7 A;  2P0Q A;  4J7I A;  4M77 C;  5FLX E;  3JB9 I;  3GOX A;  3CCQ A;  1VQM T;  3OQ5 A;  2K5L A;  3M57 A;  5I21 A;  3HSB A;  4PKC C;  1BIA A;  4F7U G;  4DA4 A;  5KCO A;  3JCM Q;  3UWN A;  1VQ4 T;  2E10 A;  2WSF E;  3DB4 A;  1Q7Y U;  2DTI A;  2DZ9 A;  2E6Z A;  5GMK j;  3QBY A;  3PMI A;  3P8D A;  1G3T A;  3SD4 A;  1UGP B;  2CZ7 B;  1MHN A;  3O8V A;  1EIF A;  4LDW A;  4M75 G;  1W2B S;  4LDU A;  1O75 A;  3LYI A;  4QVC A;  1G3S A;  2FYK A;  3V8K A;  2JN0 A;  4J8O A;  3M4Y A;  2R57 A;  4LDY A;  4MDX A;  2I2L A;  1ZQ1 A;  1UB4 A;  1VUB A;  2EAY A;  3JSC A;  1GXI E;  3J81 E;  1JJ2 A;  4PJO G;  3BDL A;  3MHX A;  1QP2 A;  5CQY A;  1RI0 A;  2GFA A;  2XU8 A;  3FEO A;  4M77 G;  5CKH A;  3DKM A;  2VC8 A;  1VQ6 A;  5GAO r;  2LQK A;  4E47 A;  5CAI A;  4E7J A;  2R5A A;  3JCM e;  4M78 A;  3OYL A;  4M7A F;  2KVQ G;  5GAN j;  1YI2 A;  3FIF A;  1YBY A;  5GMK e;  1B34 B;  3G7Z A;  4ELZ C;  5LJ3 g;  3MP8 A;  1YJN A;  4D6W A;  4R55 A;  1NE8 A;  2CZ1 B;  3AHU A;  3OA6 A;  3KXT A;  5GAO p;  3CCV A;  2LCL A;  5FRN A;  1O9S A;  1K8A C;  3CC7 T;  3KBG A;  2MMP A;  2RI2 A;  2M0O A;  3J80 E;  3CD6 A;  2L8D A;  2GCX A;  4QVD A;  3LH0 A;  3SB2 A;  2RI5 A;  2P0P A;  4JRI A;  4LD6 A;  5LJ5 f;  5HKC A;  3OBW A;  4HCC A;  4X9C A;  5KCH A;  3CME T;  4M7A A;  2YRV A;  4EMH A;  3RIR A;  3OYC A;  3ASK A;  3OW2 S;  4MZP A;  1BKB A;  4M7A C;  3G6E A;  3OYY A;  2DD5 A;  2RA2 A;  2E6N A;  3GNF B;  2YLB A;  1VQK A;  4M78 G;  4II1 A;  4QQG A;  3JCM b;  3OS2 A;  3OMG A;  2OTL A;  1KHC A;  5LJ5 h;  2VUB A;  1YJ9 T;  3QYG B;  5GAM j;  2F5K A;  3DB3 A;  4Y28 E;  3CCL T;  3L1A A;  3C95 A;  2Y4Y A;  4J6Y A;  1KQS A;  1UGS B;  3V8J A;  5LJ3 e;  2LRQ A;  2HBP A;  4F7U E;  5LJ5 d;  2PVD B;  3F70 A;  3NTK A;  3MCA B;  4HCZ A;  1PSF A;  1YIJ A;  2LX9 A;  2FVU A;  3LWH A;  4EMK A;  3RMQ A;  4LD9 K;  3QYH B;  2CZ6 B;  4IUQ A;  3OYN A;  3E9F A;  4M75 E;  4Z02 A;  4C92 E;  1M5Q 1;  2B8A A;  3V8L A;  3M59 A;  4EMK C;  1VQN A;  4M75 D;  3ZBD A;  1UGQ B;  4M7A G;  2R58 A;  1K9M C;  3CC2 T;  3OS5 A;  2R5M A;  2WSE E;  3JB9 J;  2K3Y A;  2XID A;  5HY6 A;  3OMC A;  3JRZ A;  1WQ7 A;  4C8Q B;  5IAY A;  3TU4 K;  2P0K A;  4QW2 A;  3G71 T;  1N8R C;  1QVP A;  2K3X A;  5FU7 B;  1JJ2 S;  4MMK A;  4M77 E;  4Q5W A;  1Q7Y C;  4OB1 B;  4PJO D;  4E7H A;  4PLI A;  4BY6 B;  4R56 A;  2PVO B;  3DLM A;  1VQ5 A;  4IUV A;  1RL2 A;  3PFS A;  3HP9 A;  2DXC A;  3QXE B;  2Y90 A;  3MO8 A;  2QTX A;  3VV0 A;  4N4G A;  1NJI C;  3H6Z A;  2F5T X;  4V2S A;  1VQ9 T;  2EWN A;  3LWI A;  3OW2 A;  3BW1 A;  2ZZD A;  3JCM h;  3C4S A;  3ZFJ A;  5GAO n;  2XD0 A;  1VQM A;  4PJO F;  3T9N A;  1NZ9 A;  5GMK h;  5GAN 2;  2M16 A;  2E65 A;  4C5I A;  1BIB A;  1N27 A;  2QDY B;  4MML A;  3PGG A;  4OP0 A;  3I55 A;  3M58 A;  3JCM d;  3S3N A;  4A53 A;  2OTJ T;  3GP8 A;  2RD1 A;  2RH2 A;  1XNI A;  3L42 A;  3GF5 A;  5GAN f;  3FRN A;  1B34 A;  1OZ2 A;  4FIB A;  5EG2 A;  5J3B A;  1FXX A;  2WSC E;  3VKI A;  5CK9 A;  1VQP T;  5FRM A;  3CPF A;  4J5Y A;  3P8B B;  1M1G A;  5CCA A;  3CBO A;  3CMA T;  4VUB A;  2YLC A;  5DLQ E;  5J39 A;  2MWP A;  2LNV A;  2F69 A;  4M78 D;  4GLK A;  4N4I A;  1W4S A;  2QEX T;  4PJO C;  4HA8 A;  3JCM J;  2JVV A;  1VQ7 T;  1NPP A;  3CCU A;  3OBY A;  1BI1 A;  2XDB A;  4XU2 A;  1KQS S;  1WJQ A;  3CBM A;  3R6O A;  2VXE A;  2NLU A;  3ZEH A;  1N8R U;  3GIB A;  1YIT T;  3I56 T;  2BKD N;  4RMO A;  1XTD A;  1X75 C;  3JCM X;  3CPW A;  3OS1 A;  4M78 F;  3DLL A;  4KBM B;  5LJ3 h;  2E12 A;  1YHQ T;  4QVZ A;  3NFC A;  2QA4 A;  1VIF A;  5A0L A;  4TVR A;  1M8V A;  4M7A E;  1KD1 U;  5I2S A;  2DXU A;  2C06 A;  2V8I A;  1OI1 A;  1NJI U;  1JBM A;  4M7A D;  3L2V A;  3QJ6 A;  5LJ3 d;  4C8Q F;  3CEY A;  5GAM f;  3MET A;  1VQ8 T;  2JTM A;  3VU3 C;  1M4Z A;  5IN1 A;  2XDP A;  1VIE A;  1KHI A;  3M54 A;  5GAN g;  5HK0 A;  3LLR A;  5KH6 A;  5HK3 A;  4MZT A;  5D6Y A;  3VYG A;  2CGH A;  3CCM A;  4JRP A;  1VQO T;  2V8J A;  4A54 A;  3UPU A;  2KDS A;  4YTL A;  3CCS T;  2VYT A;  1AHJ B;  4BE0 A;  2E70 A;  2GF7 A;  3P8H A;  4ELY C;  3JCM P;  1YJ9 A;  2DK3 A;  4M78 C;  1I8F A;  1LNX A;  1YCY A;  5GAN 6;  2K5I A;  3BFM A;  3NTI A;  2HD0 A;  4A4E A;  3V7R A;  2XK0 A;  4OGE A;  1I4K 1;  5GMK m;  3PTA A;  3LW5 E;  4RCB A;  1HK9 A;  4C8Q A;  2QQA A;  4JLG A;  4XK8 E;  4DQ2 A;  3BDU A;  3QKJ A;  3M4G A;  4F7U B;  2DVE A;  3X20 B;  4C8Q C;  4ZN1 A;  1P92 A;  3OYA A;  2O4X B;  3CC4 A;  2KAF A;  4XTW A;  2DTO A;  5FU7 C;  2DD4 A;  3TEE A;  4A4H A;  3OYK A;  1QVG A;  1IRE B;  1KQ2 A;  1N9S A;  2E41 A;  2RJF A;  2L89 A;  3MP6 A;  4RG8 A;  5C6S A;  3GPL A;  1S72 T;  4C92 B;  2RI3 A;  4L5G A;  4C0G A;  2ZPG B;  1JB0 E;  2JUF A;  4OF1 A;  2D6F A;  2CZ0 B;  5GAM g;  3CCR T;  2JOY A;  2QQ9 A;  5GAN e;  1TH7 A;  4M7D B;  3MEV A;  3V7C A;  3X26 B;  2HNI A;  4C5H A;  3ER0 A;  1UEB A;  3TCJ A;  4ZGD B;  2EJ9 A;  2G3R A;  3MEA A;  4A4F A;  3GLX A;  4RCC A;  2PU9 B;  3L2R A;  2VXF A;  4M77 B;  4CI0 C;  2ZCF B;  2E1H A;  4X34 A;  2A3L A;  3JCM V;  3OYF A;  4C8Q G;  4IUU A;  4XAX B;  3OYI A;  2DXT A;  2ZPF B;  2KY9 A;  2GFU A;  3QUI A;  4HKE A;  3QZ9 B;  5CKE A;  2PUK B;  3CPW S;  4HT9 A;  1QW1 A;  4C0D B;  4ZGJ B;  5I2M A;  4XTZ A;  3RKX A;  3WVD B;  1VQ6 T;  2KSS A;  4J6W A;  4OB2 B;  1Y96 B;  3FLG A;  2HAX A;  2RK1 A;  2EJG A;  4RG2 A;  1YI2 T;  2XG8 D;  2RK2 A;  2RHY A;  2EFI A;  4KUI A;  5CKF A;  1U1T A;  5J26 A;  4PJO E;  1N9R A;  5GAM e;  4BDZ A;  3OYM A;  3E9G A;  3MEW A;  1PSE A;  2EIF A;  4FSX A;  3A5Z B;  5LL6 S;  3NTH A;  3WXM B;  4BI4 A;  3CCV T;  3FDR A;  1YJW T;  3MP1 A;  1G3Y A;  1KD1 C;  3G4S A;  4DOV A;  2HQX A;  3OS0 A;  3CCJ A;  3VYH B;  2E64 A;  1VQ7 A;  4N0A A;  2KQW A;  2QQR A;  1V29 B;  3E19 A;  4BB7 A;  1I5L A;  2DZC A;  4MDW A;  4XU0 A;  3L2Z A;  2M1H A;  3OB9 A;  3H8Z A;  4FL6 A;  4N0A C;  1BI3 A;  1YIT A;  1VQ4 A;  3PMT A;  1VQK T;  4JRQ A;  5GAN 7;  4E7L A;  2OTL T;  1QVG S;  1D3B B;  2BIV A;  2E5Q A;  4EDU A;  2XKO C;  4PLL A;  1BI0 A;  1R8O B;  4IUP A;  3KUF A;  4OGC A;  1OYX A;  5LJ5 j;  4LDX A;  4O6J A;  1U1S A;  4KUL A;  1QVF A;  2KK4 A;  3OYH A;  3EFS A;  2K2V A;  3WVE B;  2ZPI B;  3M55 A;  3HFO A;  4J6X A;  4J7F A;  3RKW A;  3HPW A;  1WJR A;  2MWO A;  4L59 A;  1XOV A;  4M78 E;  2PQW A;  2X4Y A;  4PNO A;  3EFR A;  3RES A;  4B9X A;  1FX7 A;  2X35 A;  2D9T A;  3CCE T;  2QQS A;  1VQO A;  2DO3 A;  3QG1 A;  4F7U A;  3OYB A;  4C0Z A;  3E1S A;  5GAN h;  1VQN T;  2O4X A;  2RJD A;  4JRK A;  1UGR B;  3RMS A;  1KQ1 A;  4C8Q E;  2YHT A;  4XU1 A;  4RKU E;  3QO3 A;  4C92 A;  2JZ2 A;  4C8Q D;  3ME9 A;  2EKO A;  2DAQ A;  5L8R E;  3L2Q A;  4X9D A;  5GAN d;  4JJN K;  4BDY A;  2RJC A;  3JB9 F;  3QDR B;  1G3W A;  2EQU A;  2XI9 A;  2JNG A;  5GAO m;  2RHU A;  2AHJ B;  4C0F A;  4JUV A;  4OB3 B;  4M7D A;  4ME7 A;  1H3Z A;  4ATO A;  3FJP A;  1VQ5 T;  3CC7 A;  4BUG A;  1M90 C;  4BE2 A;  4FT4 A;  4OVA A;  5D6W A;  2FHD A;  3RUX A;  2RM4 A;  4M7D C;  4FM4 B;  3UDC A;  4M77 A;  2K4Y A;  1IZ6 A;  2QQB A;  1QP3 A;  1S72 A;  1VQL T;  3HRT A;  5FU6 B;  3A8L B;  2LVM A;  3CME A;  2CYZ B;  2XIC A;  4OB0 B;  3OYD A;  4BD3 A;  2M9U A;  3CCR A;  2RB6 A;  2RJE A;  1WPY A;  3QII A;  1WGS A;  1BYM A;  3QJY A;  3RER A;  5AYF A;  3L2W A;  3VJP A;  3I55 T;  4A4K A;  5GAM h;  3CXC A;  2LT4 A;  2LT1 A;  4JDS A;  4XTU A;  3LGF A;  2DPP B;  1Y96 A;  4C92 G;  1OZ3 A;  3HHT B;  4C0D C;  1Q82 U;  2RHI A;  3CCL A;  5GMK l;  2KMT A;  5DLO A;  2HQE A;  5GAM d;  4KUD K;  2L5Q A;  5CVI A;  3PT9 A;  2ZGW A;  3SFM A;  5GAN 5;  4M7D G;  4J83 A;  4NL2 A;  5D6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...