3RMQA

Crystal structure of uncharacterized protein svir_20580 from saccharomonospora viridis (v71m mutant)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
MQRYLWQQADGKRHVYDTARHRVQAGRPFTALCGETVTPQTERGDLTAGLWFDGECPVCTIALAKALGWPMREISDLAHRFDWSPALITRLAEVLHCSFGEVVELTGARMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein Svir_20580 from Saccharomonospora viridis (V71M mutant)
rcsb
source organism Saccharomonospora viridis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16827 zf-HC3 zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.990 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rmqA01
3RMQA 3RMSA
chains in the Genus database with same CATH superfamily
2YLCA 1E7OA 2FRWA 1VQ9Q 3QDRB 3OSSC 5CKDA 1H3ZA 4TVRA 4HCBA 4RTTA 2LMJA 2X4YA 3KFVA 4JZ4A 2VYTA 3JSCA 3EAEA 3SEMA 1KC8R 3BY7A 2LT4A 2YRDA 2VB6A 1ZX6A 3EFOB 1M2VB 1Y7XA 2JZ2A 3CCJT 1VQ7T 4NL2A 2PNIA 2O01E 5J26A 3LYIA 3OS0A 4JJCA 4A4HA 1JU5C 3RERA 2F2WA 4X1VA 2OJ2A 1KG1A 3OBYA 4C8QB 5GAOn 1W4SA 2G6FX 1TS9A 5CQXA 2QQAA 1OI1A 1D0YA 1VQKQ 2RNAA 2EWNA 1TUDA 1B07A 2LC4A 1RAEB 4KGXB 4AMCA 2O88A 4M7AD 2DA9A 3M56A 3M4GA 4HVVA 4A4FA 3M53A 1BYMA 3CMAT 4WTOB 2ROTA 1YWPA 2DERA 5CR2A 1KQSS 1N27A 1X27A 4HVUA 1KD1R 1WQ7A 3TSZA 2KDSA 2BTTA 1N5ZA 1YI2A 1U8RA 5D6WA 3TCJA 1GBQA 4Y91A 2FZKB 2IPOB 2HEQA 1XJWB 2FO0A 2O4XB 2VXFA 1K9AA 4XU1A 2L3PA 1VQMQ 1Y57A 2JT4A 4BI3A 3RDVA 2RN8A 4JJNK 1EZZB 3MHXA 1E6HA 1PG5B 2RJFA 2SRCA 1VQ5T 2XMFA 1R0BG 3QYGB 3QWYA 3HPWA 1YIJQ 2HMAA 2MWOA 2NUZA 3QBYA 4EMKA 1I5OB 3UATA 2K3BA 4HXJA 5A0DA 2QGGA 2JOYA 1NEGA 1QKWA 4PJNA 2QEXT 5FWBA 2E5QA 4LD9K 5LJ3g 2JS0A 5I2SA 1R8OB 1YN8A 1AOJA 2GTJA 1G2BA 2DEQA 1VYVA 3EGXA 4F04B 5GAOq 1OZ2A 4BE2A 1G8XA 2NLUA 2MYSA 4RCCA 2K3XA 4KUIA 1I5LA 1MGQA 1KQ1A 1WFWA 4PJOC 1M30A 5AYFA 2J7IA 2R5AA 3HL8A 3PNWC 2K5FA 3OYGA 1AZEA 2FHDA 1K8AC 4QT7A 2QEXQ 4R55A 4MZPA 1PRMC 4J9GA 2Y4YA 4PFOA 3JB9F 3EFOA 2MAMA 4C5IA 4JS5A 3JB9H 2WSCE 2RHXA 1X43A 2ED1A 3TREA 2E41A 2JVVA 5A0LA 2QK0A 3H0IA 4M7DC 3EG0A 5GAN8 2QAZA 4IKFA 2JM9A 3MJXA 5AT1B 4M7AF 2GNCA 4M7AB 1ZBJA 1I07A 2EJFA 2F2VA 3SWNB 4J7FA 2YUQA 1UB4A 3QG1A 4XU3A 2QDYB 2E65A 4KULA 4XTZA 3CPWS 2EAYA 2P0QA 2ZCFB 1N9SA 1TU0B 4QQDA 2XU8A 3CCSA 4KRTA 2LX7A 3VS2A 3DB4A 3S3NA 1ZBXA 1S72T 2OTLT 5LJ3e 1VQMA 1Q82R 1WGSA 2KROA 3CC7A 1ZUYA 2LJ1A 2PTKA 2DD4A 3P8HA 2XI9A 3OA6A 4ZN1A 2KGTA 1V29B 2KVQG 1Z9QA 2CUBA 1RADB 4ZGDB 2HZYA 1I4K1 4YTLA 4IUQA 4K11A 1KQSP 5KYWB 3PE0A 3OYYA 4JRIA 2ZPFB 1SG5A 2X9HA 1YJ9T 3VS6A 3VS7A 3A5ZB 4JRPA 1YHQT 1SPKA 2JXBA 3TVTA 2QA4T 2DO3A 1WHLA 1NJIR 1ACMB 3META 1RL2A 4PKCC 1OYXA 4RCBA 1IHVA 2LDMA 2OTJA 1RAAB 5GAMe 1JJ2P 4JLIA 4RKUE 4J9HA 4XK8E 5EG2A 1AWOA 5D7UA 5FRMA 2LT1A 2KNBB 1GFCA 1X6BA 4C5EA 2D1XA 3A98A 2YT6A 4M7DF 2EQKA 4M78B 3CMEQ 3CC2Q 4AG1C 3DLMA 1CKAA 3WVEB 2RHZA 5LJ3h 3EG3A 3M0RA 2RQWA 2O2OA 3EGXB 4ZTFA 3OYCA 3G4ST 5GMKl 1LJOA 3L2QA 3REBB 3QZ5B 3QPHA 4N0AA 4OB0B 4M78D 2GFAA 2L3QA 3CCUA 4J9FA 4MMLA 2K6DA 1K9MR 1K8AR 2KRMA 4EDUA 1UEBA 3L42A 1Q81U 3WXMB 3I56T 5I11A 1WQWA 1PC0A 4DBFA 1Q82C 2RQRA 3C12A 2E5KA 1ZSZA 1NE8A 2EGEA 3P8BB 3CXCA 2XHCA 3A8GB 3VS1A 4J6YA 1AHJB 3G7ZA 4M77E 2RK1A 1Q7YR 1NJIU 5IXBA 2AHJB 4J83A 2XDPA 2LCLA 4M77B 3BDLA 3NPFA 5I2MA 1EFNA 3RMSA 5KYXA 2PU9B 5DLOA 3EFRA 2R58A 1NLOC 1TSFA 3FC3A 3JCMh 2X3WD 2G3RA 2F2XA 5KE2A 3ASKA 2BZYA 1PD0A 1YFNA 2IVWA 2QQSA 1G3YA 2COZA 2E3HA 3UPUA 3CCRT 1NJIC 3I5RA 4NS5A 2W10A 3J7AF 2JUFA 4Y28E 4M75F 1RAGB 1O9SA 2CP5A 5L23A 5LJ5e 4M77A 3VKIA 4PJOD 4V2SA 1HJDA 3CC7Q 2VGMA 1NYFA 3JCMe 5KYWA 3VU3C 2E64A 1GBRA 2QASA 3KUFA 4LDUA 2WSFE 3C95A 5CKBA 4FU6A 3VV0A 1T0JA 4DA4A 2E4HA 1JJ2A 3TU4K 3CC2A 4JPBW 5FWCA 3H9NA 2CZ6B 5GMKj 3JCMJ 4LXCA 1VQNQ 4R56A 1B34A 2QQ9A 1XTDA 2A7YA 2P0PA 3M0QA 3ULRB 1MMDA 2KI7A 3CBOA 2ATCB 2DZCA 2EQJA 1G3SA 1KFZA 1VQPA 4E7SA 5CKEA 1VIFA 1D1AA 4J6WA 3CCEA 1AZGB 1ZHIA 2K5IA 3MCAB 2D0QB 1Q86C 3L2ZA 1QVGS 4DOVA 1BK2A 2NUTB 4ANJA 4XAXB 2ED0A 3LH0A 2JMAA 1UJYA 1QVPA 1K0SA 2DTOA 2KSSA 2LQWA 2CUDA 1LVKA 4X34A 2MPXC 4GLMA 2LP5A 2RB6A 2CREA 2H8HA 1VIEA 4M75G 1SKUB 1U1SA 5HK3A 1OEBA 1ZQ1A 2E70A 1WHMA 1WXTA 1KD1C 2A36A 1VQNT 4C92A 3M59A 4N4IA 1NEBA 2QEXA 3H41A 4M7AG 1FMWA 2KQWA 3QYHB 4HCZA 1YIJT 1OULA 5GANh 3QSUA 2DL4A 1OQKA 2AKKA 3HRTA 2BUDA 3FIFA 1J3TA 3L2UA 2K2MA 2E6NA 4Z02A 4LDXA 4B6MA 3UT1A 3NHNA 5FROA 2DXCA 1G3TA 4AFUC 1TXQA 1FXXA 3JAME 2DYIA 2I0NA 3MP1A 1UGPB 1QCOA 1YCSB 3PIPA 3LX7A 1UE9A 5KYUA 4D6WA 1M8VA 2X4WA 3QKJA 3JRZA 4PJLA 4IIOA 4IUPA 3BE3A 5KH6A 2DVEA 1V1CA 4MDXA 2L8DA 2VWFA 4C92C 3OB9A 1VQ8Q 2HBWA 2E3IA 3CCMQ 1NPRA 1PD1A 2DILA 4L6V5 4RG2A 1OZ3A 3H8ZA 5A2QE 3CQTA 2KEAA 3E9GA 2E6ZA 2GGRA 4B9XA 3CD6Q 1W6XA 1OPLA 4PL6A 4M77F 2KT1A 1IB8A 1E6GA 2YDLA 4FL6A 3MP8A 3I55T 3RBBB 3CCMA 2FPEA 2DPPB 2D8JA 2K5LA 1QMCA 3GBQA 3SFMA 1Y07A 1Z9ZA 3ZFJA 2DFUA 1H3HA 2DYBA 5GAOr 1FMKA 1WZOA 2VUBA 1JXOA 5GANe 4FCYA 4EMGA 3VRZA 4E6RA 1PSEA 5IH2A 1VQLA 5CK9A 5IHIA 4JJDA 2OTJT 1VQPT 1IXDA 2LJ3A 1SHFA 4HT8A 2NUTA 1TOVA 5IHKA 5ECAA 4MZTA 4D8KA 2VXEA 3E1SA 4DQ2A 1S1NA 3R6NA 4A54A 2EQUA 3SB2A 2R57A 3VS4A 3QUIA 4DBHA 4IIMA 3I55A 1M3AA 2J6KA 1JJ2S 2X35A 4E47A 2K9GA 4C0DC 3CCVA 2J6OA 2E1HA 3CMAQ 4M7DE 2K3YA 1A0NB 4C92B 2F5TX 4BE0A 2HKQB 2NWMA 3X24B 1I1JA 2YRCA 1Q7YU 2GF7A 3PFSA 1VQMT 4C8QA 3SWNC 2ZGWA 4C92E 4JRKA 5GAN7 3OS5A 1D09B 4FYXB 3SHWA 2L89A 1M3BA 1MMNA 2QI2A 3G1JA 4X9CA 2AZSA 4C8QD 4ELYC 2SEMA 5GMKm 2QQRA 4UC4A 3LW5E 1T3LA 5CO7A 1MUZA 1HXDA 1YI2Q 1IZ6A 4WCIA 4OMOA 1YNZA 2HQXA 2QG9B 5KYUB 3HSBA 1RLPC 2HCKA 2ECZA 3OYIA 4E7IA 2DMOA 3JCMg 2AZVA 2EBPA 5LJ5f 3HFOA 5DY9A 1TWBA 2RQVA 4FT2A 4CC2A 2CZ7B 1YIJA 1QLYA 4M77D 2E10A 2K79A 2P4TA 2W0ZA 4ZGEB 3CCUQ 2LQNA 3JCMX 4KGZB 3I35A 2OAWA 2RQTA 3AT1B 4B9WA 2EKOA 1YJ9Q 4FW2A 1LNXA 2BE9B 2QTXA 1UGVA 2D0NA 2RI5A 3CCVT 5GAMf 4A4KA 2VVKA 1WJQA 4MZMA 4LDWA 2PQWA 1ZA2B 3OQ5A 4M4ZA 3CCEQ 4A63B 1C6VX 3M0UA 1VQ6Q 4M75A 2HKNA 2X51A 3FJPA 3SD4A 2KYMA 4KT0E 3DB3A 1IGUA 3G4SA 3CC4T 2CYZB 2XG8D 3FB9A 3HP9A 4IUVA 5GJVB 4D8DA 4F16A 5M9OA 1HSQA 1YWOA 5GANf 2DEUA 1C1AA 2HL5C 1WA7A 2KT8A 5GMKi 3QDFA 4IUUA 1VQLT 2XKOC 1YITQ 3EH1A 3CCVQ 1K73C 3F70A 1ZUKA 3H0HA 3FRNA 2X4JA 3C0CA 2FEIA 3M57A 2GCXA 1VQOQ 1AT1B 2HQHA 4XTXA 2Y4XA 3U23A 3CC2T 4M75D 2EW3A 2VV5A 3EG9B 4C5HA 4KUDK 1M27C 1I8FA 1YJ9A 4RTVA 1KC8C 4EMKB 4C92F 2M9UA 1O75A 2ZZDA 4PNOA 1IHWA 2A3LA 3EHRA 3RESA 4RMOA 4EMHA 2NUPA 2QGFB 4L5GA 3X28B 4E7LA 4OMQA 3GNGA 3OYFA 5GAMd 3VJPA 4M75E 1D0ZA 1KSWA 2Y90A 1MNEA 3X25B 2DRMA 1YHQQ 3JCMQ 2AT1B 2M1HA 5CKHA 2LJ0A 2QTVA 3RIRA 2AKLA 2J05A 4LDYA 1S72A 2OTLA 1T3SA 1QVGA 2QXFA 2ZPIB 2LVMA 2LZ6B 2HNIA 3R6OA 1VQ5A 1NBEB 2DJZA 1T0HA 3FLGA 4M7DA 2GQIA 5GANd 2AK5A 1K1ZA 3JV3A 2LCSA 2D9TA 2EYZA 1VUBA 4OP0A 4N4HA 2YUOA 3A8LB 2FZGB 1M1GA 1UHCA 1X2QA 2MOXA 5HKCA 1YI2T 1RAFB 3OYDA 2EGAA 4RTXA 1VQ7A 2KMTA 4C0ZA 3JB9G 1M1KU 2CKKA 3CCET 4M78G 2X4XA 2EPDA 1I81A 1W1FA 3QIIA 5D6XA 1M5Q1 4XTVA 1ZSZC 3CC4A 4HCCA 1ZA1B 2FPDA 2FYKA 1KQSA 4PJOG 3CCUT 5LL6S 1Q86R 2EKHA 2JMCA 1VQPQ 1WHKA 1G83A 2HAXA 1VQ8T 4PLLA 3M0TA 1JO8A 3S3OA 4C8QF 2RJDA 3NGPA 1AWJA 4RTWA 3M58A 3OS1A 4M77C 1LPLA 3GPLA 4M78C 4II1A 4KH1B 2JN0A 2VASA 1IRXA 3A8MB 4QKUA 3VS5A 4BD3A 4M78A 2V26A 2CT3A 4N0AC 1VQOA 2O4XA 1TG0A 1M1FA 5GMKe 1VYUA 3UA6A 3RKXA 4KGVB 1AVZC 1VQ9T 4BDYA 1YBYA 2K4YA 2A0FB 1TUCA 2L0AA 3GF5A 4M7DG 1LCKA 3V7SA 2L3RA 3QZ9B 2PUOB 3H0FA 1CSKA 3BW1A 2XD0A 1JQQA 1K8AU 1QCFA 2QDLA 2C0TA 1VQLQ 2H3EB 1WHJA 3JCMb 1WNLA 2MI6A 4OMLA 3GP8A 1K0XA 1QP2A 2QA4A 1PRLC 2PVOB 2CDTA 2YUNA 1JEGA 1V76A 5KYYA 2WACA 1UDLA 2FPFA 4HVWA 1KHIA 2YWWA 1Q95G 3NTKA 1ABQA 2RH2A 1QW1A 1D0XA 4AG2C 1GCPA 4GY5A 2MMPA 1UTIA 2DVJA 1DJ7B 4LD6A 1QQJA 2JM8A 3I5SA 4A53A 2B8AA 1SRMA 4LDVA 4QW2A 4MMKA 1NLPC 4J8OA 4P5NA 4PJOB 3P8DA 2V1QA 2XICA 4ZN3A 2M16A 4FSSA 4VUBA 2L2PA 1UUEA 3I56A 5CIUA 3NTHA 3J81E 5GJWB 3FDRA 2ZAEA 1KC8U 1UGSB 1UGRB 3A1PA 2EYXA 3OYEA 4PLIA 3RR6A 4O6JA 2COWA 4M7DD 2XIDA 2KYBA 3EGUA 3UWNA 3IQLA 3CCSQ 2LTOA 3EG2A 2MF2A 2RD1A 3MKDA 1M90U 1GFDA 3M5AA 2KXCA 2DX1A 5GMKh 4EIKA 1H8KA 4XTWA 1BI3A 2ROLA 3QHSA 4ZGJB 1K73U 4OMNA 2GTOA 2KE9A 1PM3A 1Q82U 2V8IA 3MP6A 1BB9A 4AFQC 4LNPA 1D3BA 3CCLT 1C0MA 1HD3A 1U06A 4AT1B 1OX8A 2XDBA 2CZ1B 2DJQA 4QQGA 3RKWA 1WDXA 1OU8A 5KYXB 1M90C 2ZPGB 2XK0A 3ER0A 3H6ZA 1B3QA 1N6AA 3ZEHA 3OYLA 4PFZA 5KE3A 2O9VA 5A0GA 4E7ZA 1M2VA 4ELZC 1TTHB 1GXIE 3CCMT 1SEMA 2HQEA 4Z89A 2L5QA 2EQIA 3MO8A 3HTRA 2LX9A 1VQ5Q 4M75C 3CPWP 2M0OA 2FG0A 3ME9A 4BDZA 3C94A 4A4EA 1CKBA 2JJ9A 2CP7A 2GFUA 4RTUA 3CEYA 3ZL7C 3OMGA 3QJYA 2O9SA 1M3CA 1UJ0A 1HYOA 4CI0C 2IIMA 4M7AA 5GANj 4BUGA 3M0SA 3AHUA 4C92G 2DIGA 1QKXA 2CP6A 1PCXA 2DBKA 1ZUUA 2V1RA 2ESWA 3EH2A 2YLBA 4JJBA 3EGDB 4RTZA 1RI0A 1VQKA 3OS2A 3LWIA 5FRNA 3O8VA 4BY6B 2RF0A 3GNFB 2CP2A 2KXDA 3PGGA 2RJEA 2RA2A 1BBZA 3LWHA 4ATOA 3CMEA 1BU1A 3NTIA 3A8OB 1YJWA 1OU9A 3OBWA 3MEVA 5GAOl 2DK3A 1QVFA 4FYWB 2I2LA 1WHGA 2MIOA 4OVAA 2RI2A 3RKYA 4PJMA 2BKDN 1VQNA 1X6OA 9ATCB 3OYHA 5KCOA 2F5KA 1MHNA 2JS2A 2RO0A 3EG1A 2HBPA 1WIEA 2FVUA 1M2OA 2DXBA 3GOXA 3V8LA 2DZ9A 4J9IA 3CCST 4C92D 2EIFA 2KAFA 1Y71A 3O5ZA 3JCMP 2J6FA 3CBMA 4JZ3A 2VKNA 1QVFP 2KK4A 1BIAA 2M0YA 3CPFA 2FB7A 4C0FA 3JB9D 2OI3A 2DXTA 2JW4A 1X01A 3LGLA 1EX4A 5LJ5h 4EMKC 4QVCA 5CAIA 4OF1A 4PJOF 2KR3A 3RUXA 4X9DA 2DKGA 1NZ9A 3QWXX 2EQMA 3PVQA 1BI1A 4LUEA 1IGQA 4OB3B 2X3XD 1W2BP 1Q81C 3V8JA 4ORZA 5KCHA 4J9BA 1KQ2A 3S3MA 3M4YA 4M77G 5LJ3j 4FYYB 3QJ6A 2DRKA 2C06A 3CMET 3THKA 3QO3A 2K7AA 4FIBA 3TSWA 1BCOA 5C0MA 1W2BA 1YITA 5DLQE 2QQBA 2RHUA 3JCMW 5GAN2 4DBQA 4PJOE 1YP5A 1MV3A 3HRUA 8ATCB 1RUWA 1F1BB 1AWWA 2L3SA 1BI2A 3VUBA 3GLXA 1KHCA 2V8JA 4LUDA 1OV3A 4E2FB 1Y96A 2VC8A 3SWNA 4DEYA 5IAYA 3G4SQ 1AD5A 1VOMA 4J5YA 1JRIA 3OYBA 3CMAA 4DBRA 5LJ5d 5FU7B 1PSFA 1B34B 3M0PA 5IXFA 5DM7R 1WXUA 5J3BA 3DLLA 1ZSGA 1LOJA 5FW9A 3SDZA 3CCRA 5FLXE 1WJRA 1S72Q 2OTLQ 2K57A 1BIBA 1Y0MA 3JCMV 2M51A 5FU6B 4IUTA 4Y92A 1PHTA 2PVGB 1XOVA 2HSEB 3OY9A 4JS4A 3L2VA 2COYA 3TEEA 2RJCA 4J6XA 3Q1JA 3OYMA 1WX6A 4F7UE 1GL5A 4OB2B 3MEAA 1VQ6A 5I21A 2DF6A 3MEWA 4M7AE 2GQVA 4F7UB 1FMVA 1YCYA 5GAOp 2BIVA 3T9NA 4E7KA 2E12A 2CSQA 3EHQA 1TUGB 4WF2A 3HRSA 2ZPBB 1FWZA 2CZ0B 2OTJQ 1UHFA 1MMGA 1IO6A 2RMOA 3EFSA 4RG8A 2O31A 3C4SA 1YJNT 4J9DA 2P84A 3D7SB 2DLPA 2EVRA 3TQ7P 3VUZA 4NL3A 2ABLA 1BI0A 2CH4A 3BDUA 3N5BB 2JTEA 2YUPA 1PWTA 1D1BA 5FU6C 3G6EQ 1I0CA 5J39A 1M90R 1Q81R 2GBQA 3L2WA 4OGCA 1JB0E 4XTYA 1YJWQ 1K9MU 4GLKA 1BCMA 2FZCB 3I55Q 3CBPA 4F17A 1ZLMA 4QVZA 2Z0WA 4Q5WA 3M9QA 1XNIA 1RACB 2CS7A 1VA7A 2P0KA 4HKEA 1QP3A 1RLQC 1KIKA 1NM7A 4IURA 4ZNXA 5IHNA 4JLGA 1GRIA 1WXBA 5C6SA 3S6WA 1H92A 3OW2P 1R77A 5LJ5g 4LE9A 3G6EA 1QVFS 3FEOA 2B86A 2EYQA 1B7TA 4PK4A 3URGA 4E7JA 1WYXA 1KK7A 2DAQA 4F7UG 2EJ9A 4RUGA 3VYHB 1YHQA 2RI3A 2JTMA 2LRQA 2ENMA 1GCQA 2CGHA 4FM4B 3OW2A 3I9QA 1OX9A 3OYAA 4J9CA 4FSXA 1P92A 2LQ8A 4LN2A 2FL7A 2JTFA 1N9RA 2DM1A 1RI9A 1Y96B 1U1TA 2ZPHB 2BZ8A 2DETA 2C0OA 1HK9A 1WI7A 1Q7YC 5CCAA 2PVDB 2C0IA 2EFIA 2RPNA 3CC7T 3E2UA 2HSPA 4FT4A 3HKSA 1W70A 4OGEA 2F69A 4R0KA 2KRNA 1TH7A 1U3OA 1VQ7Q 3CCJQ 2M02A 2CH4W 4C8QC 2RQUA 1K9MC 3CD6A 3V7CA 1VQOT 2K2VA 3E9FA 1VQ4A 5GAOm 3ZBDA 2HDAA 2AIRB 1QWEA 1SSHA 4BB7A 1D1CA 1ZSZB 1RAHB 1Q86U 3OYNA 1YITT 3RNJA 1NPPA 4F7UA 2PZ1A 2DD5A 2J06A 2RHIA 5CKFA 3PMTA 2EJGA 3PMIA 3CCQT 3L2RA 4CRIA 2P4RA 5LJ5j 5IT9E 4BE1A 2LCCA 3LLRA 3V8KA 2DTHA 1VYTA 3G71Q 3INZA 1R0CB 1M1KR 4EPCA 3CCLQ 6AT1B 5HY6A 5KYNA 1M8MA 2A28A 5GAN4 4BY6C 4HT9A 4M7DB 1G3WA 3OYJA 5GAN3 4CC4B 1NG2A 2RK2A 2DE0X 2R5MA 3UA7A 4KBMB 1YJWT 3PVLA 2MK5A 3QXEB 1KJWA 2EYWA 5LJ3f 2HD0A 2RM4A 3HFNA 3REAB 1QVGP 3PIOA 4DEXA 4C0DB 1NYGA 4A4GA 4OMPA 3BFMA 3JB9J 3OYKA 1VQ6T 3X20B 2OAUA 2LNHB 3X26B 5EC7A 1JXMA 3WVDB 2NUPB 2OX7A 4XU2A 1ARKA 2A08A 8AT1B 1SSFA 1WHHA 4C8QE 1AEYA 4RTYA 1EIFA 3M54A 2QA4Q 1IREB 1OOTA 1X2KA 4M78F 3HHTB 4C0GA 3JCMf 5HK0A 5GAN6 2WSEE 2XDDA 1JBMA 2DIQA 1RABB 5LJ3d 4NOYA 1X69A 4QVDA 2F1LA 4KH0B 2LQKA 4M78E 1SF9A 4QQ6A 4Z8AA 5GAMh 3E19A 4DOWA 1UFFA 4BACA 3JCMc 1X75C 2A37A 1UGQB 3KBGA 3GIBA 4FYVB 1K76A 1M1KC 2KRSA 4HCKA 3CPWA 3J80E 3CCQQ 1GCQC 3JB9I 2MWPA 3VS0A 1WLPB 2YXYA 4N4GA 2DTIA 5GANg 1OPKA 1QWFA 2YSQA 1WJSA 5I22A 2DL5A 4OMFB 1KD1U 3CCLA 2D8HA 5KYYB 1K4US 4MDWA 3OSVA 2MCNA 2CT4A 2KBTA 2RHYA 4CC7A 3I56Q 1M4ZA 1X6GA 1UG1A 3FJ5A 1XQHA 5IN1A 2VGNA 4OB1B 5D6YA 4ME7A 2PUKB 3CCQA 3PTAA 4C8QG 1WPYA 3LGFA 3CCRQ 4CC3A 5GAMj 3NFCA 1PNJA 2DNUA 5FU7C 2BE7D 1VQ4Q 3VS3A 1SHGA 2FRYA 3OW2S 2DBMA 1H641 4PJJA 4XU0A 4JRQA 4JUVA 4Z88A 3DKMA 3NMZC 4GBQA 3CCJA 2YHTA 4J9EA 3M55A 1M9SA 3RMQA 3VYGA 2CP3A 4BI8B 2JNGA 2V8KA 1YJNA 2QYZA 2ZPEB 2H3JA 1ABOA 3UDCA 4E7HA 1BKBA 3LH5A 1QCNA 3OMCA 2YRVA 4JDSA 2BZXA 2NYSA 2DL3A 3VRYA 7AT1B 4ZTJA 4M75B 2CSIA 1U5SA 5GAN5 1MMAA 1N8RC 4L59A 3A8HB 4HA8A 1UECA 1D3BB 1MNDA 3KXTA 3CXCP 3G71A 1PKTA 1VQKT 4PJOA 4J7IA 4M7AC 1N8RR 2CP0A 1RAIB 2KY9A 4OMMA 3UF4A 3JCMd 1VQ4T 2HL3A 3EG9A 3CD6T 3V7RA 2DL7A 4XQ3A 4PFPA 4F7UF 4BI4A 1PKSA 4FW1A 1FYNA 4XTUA 3CXCS 4F14A 3CC4Q 3EGDA 4AFSC 5CQYA 3G6ET 2LNVA 5L8RE 1VQ9A 3MPUB 5CVIA 1SRLA 2DXUA 3MEUA 3PT9A 3L1AA 1MV0B 1YJNQ 2D6FA 2DL8A 1AWXA 2EGCA 1K73R 3G71T 1G5VA 4ESRA 5GAMg 1W2BS 1N8RU 2EYYA 2IG0A 4C5GA 4O5VA 4AFZC 1VQ8A 5HCKA 1FX7A
chains in the Genus database with same CATH topology
2YLCA 1VUBA 4OP0A 3MEWA 2CZ6B 5GMKj 3JCMJ 4N4HA 4M7AE 2GQVA 3QDRB 4F7UB 3A8LB 3OSSC 4R56A 1YCYA 5CKDA 2BIVA 3T9NA 5GAOp 4TVRA 4E7KA 1I5LA 1B34A 1M1GA 4HCBA 2E12A 2QQ9A 1XTDA 2A7YA 2X4YA 1YI2T 5HKCA 2P0PA 4WF2A 3OYDA 3HRSA 2ZPBB 1VQ7A 2VYTA 3CBOA 2DZCA 3JSCA 2EQJA 3EAEA 1FWZA 2CZ0B 2KMTA 1G3SA 4C0ZA 3JB9G 1M1KU 1VQPA 2CKKA 3CCET 3EFSA 3BY7A 4M78G 4RG8A 5CKEA 1VIFA 4J6WA 3CCEA 3C4SA 2LT4A 2X4XA 1YJNT 1ZHIA 2K5IA 1I81A 3QIIA 5D6XA 3MCAB 2D0QB 1Q86C 1M5Q1 3VUZA 3L2ZA 1Y7XA 2JZ2A 4XTVA 3CCJT 1VQ7T 4NL2A 4NL3A 2O01E 5J26A 3LYIA 3OS0A 1QVGS 3CC4A 4HCCA 1BI0A 3BDUA 4DOVA 3N5BB 4A4HA 2FYKA 3RERA 5FU6C 1KQSA 5J39A 4PJOG 4XAXB 3LH0A 3CCUT 5LL6S 3L2WA 4OGCA 1QVPA 1JB0E 2HAXA 4XTYA 3OBYA 1VQ8T 1KG1A 4PLLA 1K9MU 2DTOA 4C8QB 5GAOn 2KSSA 2RJDA 4C8QF 3S3OA 1VQ8A 4GLKA 1W4SA 3CBPA 4X34A 4QVZA 4Q5WA 3M9QA 5CQXA 1XNIA 2RB6A 2CS7A 2QQAA 3M58A 3OS1A 4M77C 1OI1A 2P0KA 3GPLA 4M78C 4HKEA 4II1A 1QP3A 2JN0A 1VIEA 4M75G 3A8MB 3CC2A 4BD3A 1U1SA 4M78A 4N0AC 2EWNA 5HK3A 4IURA 1VQOA 2O4XA 1ZQ1A 1M1FA 2LC4A 2E70A 4JLGA 5GMKe 3RKXA 1KD1C 5C6SA 3S6WA 1VQNT 1VQ9T 4M7AD 4BDYA 3M56A 5LJ5g 3G6EA 3M4GA 1YBYA 4C92A 3M59A 2K4YA 4N4IA 3GF5A 4A4FA 3V7SA 4M7DG 1QVFS 3M53A 2QEXA 1BYMA 3FEOA 3CMAT 4M7AG 2EYQA 2KQWA 3QYHB 4HCZA 2L3RA 3QZ9B 2PUOB 1YIJT 5GANh 3QSUA 5CR2A 1KQSS 1N27A 3BW1A 3URGA 2XD0A 1K8AU 1WQ7A 3HRTA 2BUDA 3FIFA 2KDSA 4E7JA 2DAQA 4F7UG 3L2UA 3JCMb 1YI2A 1WNLA 2EJ9A 2MI6A 2E6NA 1U8RA 4Z02A 3GP8A 5D6WA 3TCJA 4LDXA 1QP2A 4Y91A 3VYHB 2QA4A 3UT1A 2PVOB 5FROA 1YHQA 2RI3A 2JTMA 2DXCA 1G3TA 2LRQA 2O4XB 2VXFA 2WACA 2CGHA 1FXXA 4XU1A 3JAME 1KHIA 4FM4B 3OW2A 3MP1A 1UGPB 3NTKA 4BI3A 3OYAA 2RH2A 3PIPA 1QW1A 1P92A 2LQ8A 3LX7A 4FSXA 4JJNK 3MHXA 2FL7A 2JTFA 1N9RA 4D6WA 2MMPA 1Y96B 2RJFA 4GY5A 1U1TA 2X4WA 1DJ7B 2ZPHB 3QKJA 1VQ5T 1M8VA 4LD6A 3JRZA 2B8AA 4LDVA 4A53A 3QYGB 4IUPA 5KH6A 1HK9A 3HPWA 4QW2A 1Q7YC 2DVEA 4MMKA 5CCAA 4MDXA 2L8DA 2MWOA 2PVDB 3QBYA 4C92C 4EMKA 4J8OA 4P5NA 2EFIA 4PJOB 3OB9A 3P8DA 3CC7T 1NPRA 2XICA 4ZN3A 5A0DA 4FT4A 3HKSA 2M16A 2JOYA 4OGEA 2QEXT 4L6V5 2E5QA 4RG2A 1OZ3A 3H8ZA 4VUBA 5A2QE 3I56A 2F69A 4LD9K 1TH7A 5CIUA 3NTHA 5LJ3g 3J81E 5I2SA 3E9GA 1R8OB 2E6ZA 4C8QC 3FDRA 4B9XA 1KC8U 1K9MC 3CD6A 3V7CA 1VQOT 2K2VA 3E9FA 1VQ4A 4PL6A 5GAOm 3ZBDA 4M77F 1UGSB 2DEQA 1UGRB 3OYEA 4PLIA 4FL6A 4BB7A 3MP8A 5GAOq 1OZ2A 4O6JA 3I55T 4BE2A 2NLUA 3CCMA 2XIDA 4RCCA 4M7DD 1Q86U 3UWNA 3OYNA 2DPPB 2K3XA 1YITT 1NPPA 2LTOA 4KUIA 2MF2A 2RD1A 1MGQA 4F7UA 1M90U 3M5AA 2DD5A 2RHIA 1KQ1A 5CKFA 5GMKh 3PMTA 2EJGA 2K5LA 3PMIA 4XTWA 4PJOC 3CCQT 5AYFA 1BI3A 3L2RA 3SFMA 2R5AA 4CRIA 1Y07A 3HL8A 3PNWC 3QHSA 3ZFJA 4ZGJB 1K73U 2K5FA 3OYGA 2FHDA 1K8AC 5LJ5j 5IT9E 4R55A 4BE1A 2LCCA 4MZPA 5GAOr 3LLRA 1Q82U 2V8IA 2DTHA 3V8KA 3MP6A 2VUBA 3INZA 1D3BA 3CCLT 4EPCA 5GANe 2Y4YA 4EMGA 5HY6A 5GAN4 1PSEA 4BY6C 2XDBA 2CZ1B 1VQLA 3JB9F 1G3WA 5CK9A 4QQGA 5GAN3 3OYJA 3RKWA 4M7DB 2MAMA 2RK2A 2OTJT 2R5MA 1VQPT 4C5IA 4JS5A 3JB9H 2WSCE 4KBMB 4HT8A 1YJWT 1M90C 2ZPGB 2RHXA 2XK0A 3ER0A 3H6ZA 4MZTA 1N6AA 3QXEB 3ZEHA 2VXEA 3E1SA 5LJ3f 3TREA 4DQ2A 2E41A 2HD0A 2JVVA 5A0LA 5KE3A 3OYLA 4A54A 5A0GA 4M7DC 2EQUA 2RM4A 3HFNA 3SB2A 5GAN8 3PIOA 4C0DB 4IKFA 2R57A 3QUIA 4ELZC 4A4GA 4M7AF 4M7AB 1GXIE 3CCMT 2EJFA 3BFMA 3I55A 2HQEA 3JB9J 3SWNB 3OYKA 3X20B 1VQ6T 4J7FA 1JJ2S 2OAUA 2X35A 3X26B 4E47A 1UB4A 3WVDB 3QG1A 2L5QA 4XU3A 4XU2A 2QDYB 2E65A 4C0DC 4KULA 4XTZA 3CPWS 2EAYA 3CCVA 3MO8A 2P0QA 2ZCFB 1SSFA 4C8QE 2LX9A 1N9SA 4QQDA 2XU8A 3CCSA 2E1HA 4M75C 1EIFA 4M7DE 3M54A 3DB4A 2M0OA 2K3YA 1IREB 3ME9A 4BDZA 3C94A 3S3NA 1ZBXA 4A4EA 4C92B 2F5TX 4M78F 4BE0A 3HHTB 3X24B 1S72T 2OTLT 2GFUA 4C0GA 3JCMf 5HK0A 5LJ3e 5GAN6 2GF7A 1VQMA 3CEYA 1Q7YU 3PFSA 2WSEE 1VQMT 4C8QA 1WGSA 3SWNC 3CC7A 2ZGWA 3OMGA 4C92E 1JBMA 2DIQA 3QJYA 4JRKA 2XDDA 5LJ3d 4CI0C 5GAN7 3OS5A 4NOYA 4M7AA 5GANj 2DD4A 4BUGA 3P8HA 2XI9A 4B9WA 3OA6A 4ZN1A 2L89A 1V29B 2KVQG 2QI2A 4QVDA 4X9CA 3AHUA 4C92G 2DIGA 4ZGDB 4C8QD 1I4K1 4YTLA 4ELYC 2LQKA 4IUQA 4M78E 4QQ6A 5GAMh 5GMKm 2QQRA 2YLBA 3E19A 3OYYA 4DOWA 4JRIA 4UC4A 4BACA 2ZPFB 3JCMc 1RI0A 3LW5E 1VQKA 5CO7A 3OS2A 3LWIA 5FRNA 1YJ9T 1HXDA 1X75C 3O8VA 1IZ6A 1UGQB 3KBGA 3A5ZB 4BY6B 3GIBA 4JRPA 3GNFB 1YHQT 3PGGA 2HQXA 1M1KC 3HSBA 2RJEA 2QA4T 2RA2A 3CPWA 3LWHA 2DO3A 3J80E 3OYIA 4E7IA 4ATOA 3CMEA 3JCMg 3NTIA 5LJ5f 3META 1RL2A 3HFOA 5DY9A 3JB9I 2MWPA 4PKCC 1OYXA 4N4GA 2DTIA 3A8OB 1YJWA 4RCBA 4FT2A 5GANg 4HT9A 3OBWA 2LDMA 2CZ7B 3MEVA 5GAOl 1YIJA 4M77D 2OTJA 2DK3A 5GAMe 1WJSA 2E10A 4JLIA 4RKUE 1QVFA 2P4TA 4OMFB 1KD1U 4XK8E 2I2LA 5EG2A 5FRMA 2LT1A 3CCLA 4OVAA 2RI2A 4C5EA 3RKYA 4MDWA 3OSVA 2BKDN 4ZGEB 4M7DF 3JCMX 1VQNA 1X6OA 2RHYA 2EQKA 4M78B 3OYHA 1M4ZA 5KCOA 2F5KA 1MHNA 2RO0A 1XQHA 3DLMA 2HBPA 4OB1B 2EKOA 2VGNA 5D6YA 5IN1A 3WVEB 1LNXA 2RHZA 2FVUA 5LJ3h 2DXBA 2QTXA 4ME7A 3GOXA 3V8LA 2DZ9A 2PUKB 3CCQA 3PTAA 4C8QG 1WPYA 3CCST 3LGFA 4C92D 2RI5A 2EIFA 3NFCA 5GAMj 2KAFA 3OYCA 1Y71A 4ZTFA 3G4ST 3JCMP 5GMKl 1LJOA 3CCVT 3L2QA 3QZ5B 4A4KA 5GAMf 1WJQA 4MZMA 3CBMA 4LDWA 2PQWA 3OQ5A 5FU7C 2KK4A 3QPHA 4N0AA 1BIAA 4OB0B 4M75A 3OW2S 4M78D 3FJPA 3CPFA 2FB7A 2GFAA 1H641 4C0FA 3CCUA 4XU0A 3SD4A 3JB9D 4KT0E 4JRQA 3DB3A 4MMLA 4JUVA 2DXTA 3G4SA 1X01A 3LGLA 4EDUA 3DKMA 1UEBA 3CC4T 3L42A 2CYZB 5LJ5h 3CCJA 2XG8D 3WXMB 1Q81U 2YHTA 3FB9A 3HP9A 1M9SA 3M55A 4IUVA 3RMQA 3VYGA 4EMKC 4QVCA 5CAIA 5M9OA 5GANf 3I56T 4BI8B 2JNGA 4OF1A 2V8KA 4PJOF 1WQWA 1YJNA 5GMKi 3RUXA 4X9DA 4IUUA 1Q82C 2ZPEB 2H3JA 1VQLT 2DKGA 3C12A 1NZ9A 3UDCA 1NE8A 2EQMA 4E7HA 1BI1A 2XKOC 1BKBA 2XHCA 3A8GB 3P8BB 3OMCA 2YRVA 4JDSA 3CXCA 4J6YA 4OB3B 1AHJB 1K73C 3F70A 3G7ZA 4M77E 1Q81C 3V8JA 2RK1A 3FRNA 2X4JA 5KCHA 1KQ2A 3S3MA 3M4YA 4ZTJA 4M77G 1NJIU 2AHJB 4J83A 4M75B 5LJ3j 2XDPA 3M57A 2LCLA 5GAN5 2GCXA 1N8RC 4L59A 4M77B 3BDLA 3QJ6A 3A8HB 4XTXA 2C06A 4HA8A 3CMET 2Y4XA 5I2MA 3QO3A 3RMSA 3CC2T 2PU9B 4M75D 4FIBA 5DLOA 2VV5A 3EFRA 2R58A 4KUDK 4C5HA 5C0MA 1W2BA 1YITA 1D3BB 5DLQE 3FC3A 3KXTA 2QQBA 3G71A 3JCMh 2RHUA 3JCMW 1I8FA 5GAN2 1YJ9A 1KC8C 2G3RA 4EMKB 5KE2A 4C92F 1VQKT 2M9UA 4PJOE 3ASKA 3HRUA 4J7IA 4PJOA 1O75A 2ZZDA 4PNOA 4M7AC 3VUBA 1BI2A 3GLXA 1KHCA 2KY9A 2V8JA 3JCMd 2IVWA 1VQ4T 2QQSA 1Y96A 2A3LA 3RESA 4RMOA 2VC8A 1G3YA 3SWNA 3V7RA 3CD6T 4EMHA 3UPUA 3CCRT 1NJIC 5IAYA 3X28B 4L5GA 4NS5A 4XQ3A 4F7UF 3GNGA 4E7LA 4BI4A 3OYFA 4J5YA 1JRIA 3OYBA 5GAMd 3CMAA 3VJPA 5LJ5d 2JUFA 4M75E 4Y28E 5FU7B 3J7AF 4XTUA 1PSFA 1B34B 2Y90A 4M75F 3X25B 5DM7R 3CXCS 5J3BA 1H3ZA 5CQYA 3G6ET 2LNVA 3DLLA 3JCMQ 5L8RE 2M1HA 5CKHA 1VQ9A 1O9SA 5CVIA 5LJ5e 1LOJA 4M77A 2DXUA 3RIRA 3SDZA 3CCRA 5FLXE 4LDYA 1WJRA 3MEUA 3VKIA 2K57A 1S72A 2OTLA 4V2SA 4PJOD 3PT9A 1BIBA 2VGMA 3JCMV 3JCMe 2QXFA 1QVGA 3VU3C 3L1AA 5FU6B 2ZPIB 2LVMA 2E64A 4IUTA 2PVGB 1XOVA 3KUFA 2HNIA 2D6FA 3OY9A 3R6OA 4JS4A 3L2VA 1VQ5A 4LDUA 2WSFE 2DJZA 3C95A 3TEEA 3G71T 5CKBA 2RJCA 4J6XA 3Q1JA 4FU6A 1G5VA 3VV0A 5GAMg 3OYMA 4DA4A 1W2BS 1N8RU 4F7UE 3FLGA 4M7DA 2IG0A 5GANd 1JJ2A 4C5GA 4O5VA 4OB2B 3MEAA 1VQ6A 3TU4K 5I21A 2D9TA 1FX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMQ A;  3RMS A; 
#chains in the Genus database with same CATH topology
 2YLC A;  1E7O A;  2FRW A;  1VQ9 Q;  3QDR B;  3OSS C;  5CKD A;  1H3Z A;  4TVR A;  4HCB A;  4RTT A;  2LMJ A;  2X4Y A;  3KFV A;  4JZ4 A;  2VYT A;  3JSC A;  3EAE A;  3SEM A;  1KC8 R;  3BY7 A;  2LT4 A;  2YRD A;  2VB6 A;  1ZX6 A;  3EFO B;  1M2V B;  1Y7X A;  2JZ2 A;  3CCJ T;  1VQ7 T;  4NL2 A;  2PNI A;  2O01 E;  5J26 A;  3LYI A;  3OS0 A;  4JJC A;  4A4H A;  1JU5 C;  3RER A;  2F2W A;  4X1V A;  2OJ2 A;  1KG1 A;  3OBY A;  4C8Q B;  5GAO n;  1W4S A;  2G6F X;  1TS9 A;  5CQX A;  2QQA A;  1OI1 A;  1D0Y A;  1VQK Q;  2RNA A;  2EWN A;  1TUD A;  1B07 A;  2LC4 A;  1RAE B;  4KGX B;  4AMC A;  2O88 A;  4M7A D;  2DA9 A;  3M56 A;  3M4G A;  4HVV A;  4A4F A;  3M53 A;  1BYM A;  3CMA T;  4WTO B;  2ROT A;  1YWP A;  2DER A;  5CR2 A;  1KQS S;  1N27 A;  1X27 A;  4HVU A;  1KD1 R;  1WQ7 A;  3TSZ A;  2KDS A;  2BTT A;  1N5Z A;  1YI2 A;  1U8R A;  5D6W A;  3TCJ A;  1GBQ A;  4Y91 A;  2FZK B;  2IPO B;  2HEQ A;  1XJW B;  2FO0 A;  2O4X B;  2VXF A;  1K9A A;  4XU1 A;  2L3P A;  1VQM Q;  1Y57 A;  2JT4 A;  4BI3 A;  3RDV A;  2RN8 A;  4JJN K;  1EZZ B;  3MHX A;  1E6H A;  1PG5 B;  2RJF A;  2SRC A;  1VQ5 T;  2XMF A;  1R0B G;  3QYG B;  3QWY A;  3HPW A;  1YIJ Q;  2HMA A;  2MWO A;  2NUZ A;  3QBY A;  4EMK A;  1I5O B;  3UAT A;  2K3B A;  4HXJ A;  5A0D A;  2QGG A;  2JOY A;  1NEG A;  1QKW A;  4PJN A;  2QEX T;  5FWB A;  2E5Q A;  4LD9 K;  5LJ3 g;  2JS0 A;  5I2S A;  1R8O B;  1YN8 A;  1AOJ A;  2GTJ A;  1G2B A;  2DEQ A;  1VYV A;  3EGX A;  4F04 B;  5GAO q;  1OZ2 A;  4BE2 A;  1G8X A;  2NLU A;  2MYS A;  4RCC A;  2K3X A;  4KUI A;  1I5L A;  1MGQ A;  1KQ1 A;  1WFW A;  4PJO C;  1M30 A;  5AYF A;  2J7I A;  2R5A A;  3HL8 A;  3PNW C;  2K5F A;  3OYG A;  1AZE A;  2FHD A;  1K8A C;  4QT7 A;  2QEX Q;  4R55 A;  4MZP A;  1PRM C;  4J9G A;  2Y4Y A;  4PFO A;  3JB9 F;  3EFO A;  2MAM A;  4C5I A;  4JS5 A;  3JB9 H;  2WSC E;  2RHX A;  1X43 A;  2ED1 A;  3TRE A;  2E41 A;  2JVV A;  5A0L A;  2QK0 A;  3H0I A;  4M7D C;  3EG0 A;  5GAN 8;  2QAZ A;  4IKF A;  2JM9 A;  3MJX A;  5AT1 B;  4M7A F;  2GNC A;  4M7A B;  1ZBJ A;  1I07 A;  2EJF A;  2F2V A;  3SWN B;  4J7F A;  2YUQ A;  1UB4 A;  3QG1 A;  4XU3 A;  2QDY B;  2E65 A;  4KUL A;  4XTZ A;  3CPW S;  2EAY A;  2P0Q A;  2ZCF B;  1N9S A;  1TU0 B;  4QQD A;  2XU8 A;  3CCS A;  4KRT A;  2LX7 A;  3VS2 A;  3DB4 A;  3S3N A;  1ZBX A;  1S72 T;  2OTL T;  5LJ3 e;  1VQM A;  1Q82 R;  1WGS A;  2KRO A;  3CC7 A;  1ZUY A;  2LJ1 A;  2PTK A;  2DD4 A;  3P8H A;  2XI9 A;  3OA6 A;  4ZN1 A;  2KGT A;  1V29 B;  2KVQ G;  1Z9Q A;  2CUB A;  1RAD B;  4ZGD B;  2HZY A;  1I4K 1;  4YTL A;  4IUQ A;  4K11 A;  1KQS P;  5KYW B;  3PE0 A;  3OYY A;  4JRI A;  2ZPF B;  1SG5 A;  2X9H A;  1YJ9 T;  3VS6 A;  3VS7 A;  3A5Z B;  4JRP A;  1YHQ T;  1SPK A;  2JXB A;  3TVT A;  2QA4 T;  2DO3 A;  1WHL A;  1NJI R;  1ACM B;  3MET A;  1RL2 A;  4PKC C;  1OYX A;  4RCB A;  1IHV A;  2LDM A;  2OTJ A;  1RAA B;  5GAM e;  1JJ2 P;  4JLI A;  4RKU E;  4J9H A;  4XK8 E;  5EG2 A;  1AWO A;  5D7U A;  5FRM A;  2LT1 A;  2KNB B;  1GFC A;  1X6B A;  4C5E A;  2D1X A;  3A98 A;  2YT6 A;  4M7D F;  2EQK A;  4M78 B;  3CME Q;  3CC2 Q;  4AG1 C;  3DLM A;  1CKA A;  3WVE B;  2RHZ A;  5LJ3 h;  3EG3 A;  3M0R A;  2RQW A;  2O2O A;  3EGX B;  4ZTF A;  3OYC A;  3G4S T;  5GMK l;  1LJO A;  3L2Q A;  3REB B;  3QZ5 B;  3QPH A;  4N0A A;  4OB0 B;  4M78 D;  2GFA A;  2L3Q A;  3CCU A;  4J9F A;  4MML A;  2K6D A;  1K9M R;  1K8A R;  2KRM A;  4EDU A;  1UEB A;  3L42 A;  1Q81 U;  3WXM B;  3I56 T;  5I11 A;  1WQW A;  1PC0 A;  4DBF A;  1Q82 C;  2RQR A;  3C12 A;  2E5K A;  1ZSZ A;  1NE8 A;  2EGE A;  3P8B B;  3CXC A;  2XHC A;  3A8G B;  3VS1 A;  4J6Y A;  1AHJ B;  3G7Z A;  4M77 E;  2RK1 A;  1Q7Y R;  1NJI U;  5IXB A;  2AHJ B;  4J83 A;  2XDP A;  2LCL A;  4M77 B;  3BDL A;  3NPF A;  5I2M A;  1EFN A;  3RMS A;  5KYX A;  2PU9 B;  5DLO A;  3EFR A;  2R58 A;  1NLO C;  1TSF A;  3FC3 A;  3JCM h;  2X3W D;  2G3R A;  2F2X A;  5KE2 A;  3ASK A;  2BZY A;  1PD0 A;  1YFN A;  2IVW A;  2QQS A;  1G3Y A;  2COZ A;  2E3H A;  3UPU A;  3CCR T;  1NJI C;  3I5R A;  4NS5 A;  2W10 A;  3J7A F;  2JUF A;  4Y28 E;  4M75 F;  1RAG B;  1O9S A;  2CP5 A;  5L23 A;  5LJ5 e;  4M77 A;  3VKI A;  4PJO D;  4V2S A;  1HJD A;  3CC7 Q;  2VGM A;  1NYF A;  3JCM e;  5KYW A;  3VU3 C;  2E64 A;  1GBR A;  2QAS A;  3KUF A;  4LDU A;  2WSF E;  3C95 A;  5CKB A;  4FU6 A;  3VV0 A;  1T0J A;  4DA4 A;  2E4H A;  1JJ2 A;  3TU4 K;  3CC2 A;  4JPB W;  5FWC A;  3H9N A;  2CZ6 B;  5GMK j;  3JCM J;  4LXC A;  1VQN Q;  4R56 A;  1B34 A;  2QQ9 A;  1XTD A;  2A7Y A;  2P0P A;  3M0Q A;  3ULR B;  1MMD A;  2KI7 A;  3CBO A;  2ATC B;  2DZC A;  2EQJ A;  1G3S A;  1KFZ A;  1VQP A;  4E7S A;  5CKE A;  1VIF A;  1D1A A;  4J6W A;  3CCE A;  1AZG B;  1ZHI A;  2K5I A;  3MCA B;  2D0Q B;  1Q86 C;  3L2Z A;  1QVG S;  4DOV A;  1BK2 A;  2NUT B;  4ANJ A;  4XAX B;  2ED0 A;  3LH0 A;  2JMA A;  1UJY A;  1QVP A;  1K0S A;  2DTO A;  2KSS A;  2LQW A;  2CUD A;  1LVK A;  4X34 A;  2MPX C;  4GLM A;  2LP5 A;  2RB6 A;  2CRE A;  2H8H A;  1VIE A;  4M75 G;  1SKU B;  1U1S A;  5HK3 A;  1OEB A;  1ZQ1 A;  2E70 A;  1WHM A;  1WXT A;  1KD1 C;  2A36 A;  1VQN T;  4C92 A;  3M59 A;  4N4I A;  1NEB A;  2QEX A;  3H41 A;  4M7A G;  1FMW A;  2KQW A;  3QYH B;  4HCZ A;  1YIJ T;  1OUL A;  5GAN h;  3QSU A;  2DL4 A;  1OQK A;  2AKK A;  3HRT A;  2BUD A;  3FIF A;  1J3T A;  3L2U A;  2K2M A;  2E6N A;  4Z02 A;  4LDX A;  4B6M A;  3UT1 A;  3NHN A;  5FRO A;  2DXC A;  1G3T A;  4AFU C;  1TXQ A;  1FXX A;  3JAM E;  2DYI A;  2I0N A;  3MP1 A;  1UGP B;  1QCO A;  1YCS B;  3PIP A;  3LX7 A;  1UE9 A;  5KYU A;  4D6W A;  1M8V A;  2X4W A;  3QKJ A;  3JRZ A;  4PJL A;  4IIO A;  4IUP A;  3BE3 A;  5KH6 A;  2DVE A;  1V1C A;  4MDX A;  2L8D A;  2VWF A;  4C92 C;  3OB9 A;  1VQ8 Q;  2HBW A;  2E3I A;  3CCM Q;  1NPR A;  1PD1 A;  2DIL A;  4L6V 5;  4RG2 A;  1OZ3 A;  3H8Z A;  5A2Q E;  3CQT A;  2KEA A;  3E9G A;  2E6Z A;  2GGR A;  4B9X A;  3CD6 Q;  1W6X A;  1OPL A;  4PL6 A;  4M77 F;  2KT1 A;  1IB8 A;  1E6G A;  2YDL A;  4FL6 A;  3MP8 A;  3I55 T;  3RBB B;  3CCM A;  2FPE A;  2DPP B;  2D8J A;  2K5L A;  1QMC A;  3GBQ A;  3SFM A;  1Y07 A;  1Z9Z A;  3ZFJ A;  2DFU A;  1H3H A;  2DYB A;  5GAO r;  1FMK A;  1WZO A;  2VUB A;  1JXO A;  5GAN e;  4FCY A;  4EMG A;  3VRZ A;  4E6R A;  1PSE A;  5IH2 A;  1VQL A;  5CK9 A;  5IHI A;  4JJD A;  2OTJ T;  1VQP T;  1IXD A;  2LJ3 A;  1SHF A;  4HT8 A;  2NUT A;  1TOV A;  5IHK A;  5ECA A;  4MZT A;  4D8K A;  2VXE A;  3E1S A;  4DQ2 A;  1S1N A;  3R6N A;  4A54 A;  2EQU A;  3SB2 A;  2R57 A;  3VS4 A;  3QUI A;  4DBH A;  4IIM A;  3I55 A;  1M3A A;  2J6K A;  1JJ2 S;  2X35 A;  4E47 A;  2K9G A;  4C0D C;  3CCV A;  2J6O A;  2E1H A;  3CMA Q;  4M7D E;  2K3Y A;  1A0N B;  4C92 B;  2F5T X;  4BE0 A;  2HKQ B;  2NWM A;  3X24 B;  1I1J A;  2YRC A;  1Q7Y U;  2GF7 A;  3PFS A;  1VQM T;  4C8Q A;  3SWN C;  2ZGW A;  4C92 E;  4JRK A;  5GAN 7;  3OS5 A;  1D09 B;  4FYX B;  3SHW A;  2L89 A;  1M3B A;  1MMN A;  2QI2 A;  3G1J A;  4X9C A;  2AZS A;  4C8Q D;  4ELY C;  2SEM A;  5GMK m;  2QQR A;  4UC4 A;  3LW5 E;  1T3L A;  5CO7 A;  1MUZ A;  1HXD A;  1YI2 Q;  1IZ6 A;  4WCI A;  4OMO A;  1YNZ A;  2HQX A;  2QG9 B;  5KYU B;  3HSB A;  1RLP C;  2HCK A;  2ECZ A;  3OYI A;  4E7I A;  2DMO A;  3JCM g;  2AZV A;  2EBP A;  5LJ5 f;  3HFO A;  5DY9 A;  1TWB A;  2RQV A;  4FT2 A;  4CC2 A;  2CZ7 B;  1YIJ A;  1QLY A;  4M77 D;  2E10 A;  2K79 A;  2P4T A;  2W0Z A;  4ZGE B;  3CCU Q;  2LQN A;  3JCM X;  4KGZ B;  3I35 A;  2OAW A;  2RQT A;  3AT1 B;  4B9W A;  2EKO A;  1YJ9 Q;  4FW2 A;  1LNX A;  2BE9 B;  2QTX A;  1UGV A;  2D0N A;  2RI5 A;  3CCV T;  5GAM f;  4A4K A;  2VVK A;  1WJQ A;  4MZM A;  4LDW A;  2PQW A;  1ZA2 B;  3OQ5 A;  4M4Z A;  3CCE Q;  4A63 B;  1C6V X;  3M0U A;  1VQ6 Q;  4M75 A;  2HKN A;  2X51 A;  3FJP A;  3SD4 A;  2KYM A;  4KT0 E;  3DB3 A;  1IGU A;  3G4S A;  3CC4 T;  2CYZ B;  2XG8 D;  3FB9 A;  3HP9 A;  4IUV A;  5GJV B;  4D8D A;  4F16 A;  5M9O A;  1HSQ A;  1YWO A;  5GAN f;  2DEU A;  1C1A A;  2HL5 C;  1WA7 A;  2KT8 A;  5GMK i;  3QDF A;  4IUU A;  1VQL T;  2XKO C;  1YIT Q;  3EH1 A;  3CCV Q;  1K73 C;  3F70 A;  1ZUK A;  3H0H A;  3FRN A;  2X4J A;  3C0C A;  2FEI A;  3M57 A;  2GCX A;  1VQO Q;  1AT1 B;  2HQH A;  4XTX A;  2Y4X A;  3U23 A;  3CC2 T;  4M75 D;  2EW3 A;  2VV5 A;  3EG9 B;  4C5H A;  4KUD K;  1M27 C;  1I8F A;  1YJ9 A;  4RTV A;  1KC8 C;  4EMK B;  4C92 F;  2M9U A;  1O75 A;  2ZZD A;  4PNO A;  1IHW A;  2A3L A;  3EHR A;  3RES A;  4RMO A;  4EMH A;  2NUP A;  2QGF B;  4L5G A;  3X28 B;  4E7L A;  4OMQ A;  3GNG A;  3OYF A;  5GAM d;  3VJP A;  4M75 E;  1D0Z A;  1KSW A;  2Y90 A;  1MNE A;  3X25 B;  2DRM A;  1YHQ Q;  3JCM Q;  2AT1 B;  2M1H A;  5CKH A;  2LJ0 A;  2QTV A;  3RIR A;  2AKL A;  2J05 A;  4LDY A;  1S72 A;  2OTL A;  1T3S A;  1QVG A;  2QXF A;  2ZPI B;  2LVM A;  2LZ6 B;  2HNI A;  3R6O A;  1VQ5 A;  1NBE B;  2DJZ A;  1T0H A;  3FLG A;  4M7D A;  2GQI A;  5GAN d;  2AK5 A;  1K1Z A;  3JV3 A;  2LCS A;  2D9T A;  2EYZ A;  1VUB A;  4OP0 A;  4N4H A;  2YUO A;  3A8L B;  2FZG B;  1M1G A;  1UHC A;  1X2Q A;  2MOX A;  5HKC A;  1YI2 T;  1RAF B;  3OYD A;  2EGA A;  4RTX A;  1VQ7 A;  2KMT A;  4C0Z A;  3JB9 G;  1M1K U;  2CKK A;  3CCE T;  4M78 G;  2X4X A;  2EPD A;  1I81 A;  1W1F A;  3QII A;  5D6X A;  1M5Q 1;  4XTV A;  1ZSZ C;  3CC4 A;  4HCC A;  1ZA1 B;  2FPD A;  2FYK A;  1KQS A;  4PJO G;  3CCU T;  5LL6 S;  1Q86 R;  2EKH A;  2JMC A;  1VQP Q;  1WHK A;  1G83 A;  2HAX A;  1VQ8 T;  4PLL A;  3M0T A;  1JO8 A;  3S3O A;  4C8Q F;  2RJD A;  3NGP A;  1AWJ A;  4RTW A;  3M58 A;  3OS1 A;  4M77 C;  1LPL A;  3GPL A;  4M78 C;  4II1 A;  4KH1 B;  2JN0 A;  2VAS A;  1IRX A;  3A8M B;  4QKU A;  3VS5 A;  4BD3 A;  4M78 A;  2V26 A;  2CT3 A;  4N0A C;  1VQO A;  2O4X A;  1TG0 A;  1M1F A;  5GMK e;  1VYU A;  3UA6 A;  3RKX A;  4KGV B;  1AVZ C;  1VQ9 T;  4BDY A;  1YBY A;  2K4Y A;  2A0F B;  1TUC A;  2L0A A;  3GF5 A;  4M7D G;  1LCK A;  3V7S A;  2L3R A;  3QZ9 B;  2PUO B;  3H0F A;  1CSK A;  3BW1 A;  2XD0 A;  1JQQ A;  1K8A U;  1QCF A;  2QDL A;  2C0T A;  1VQL Q;  2H3E B;  1WHJ A;  3JCM b;  1WNL A;  2MI6 A;  4OML A;  3GP8 A;  1K0X A;  1QP2 A;  2QA4 A;  1PRL C;  2PVO B;  2CDT A;  2YUN A;  1JEG A;  1V76 A;  5KYY A;  2WAC A;  1UDL A;  2FPF A;  4HVW A;  1KHI A;  2YWW A;  1Q95 G;  3NTK A;  1ABQ A;  2RH2 A;  1QW1 A;  1D0X A;  4AG2 C;  1GCP A;  4GY5 A;  2MMP A;  1UTI A;  2DVJ A;  1DJ7 B;  4LD6 A;  1QQJ A;  2JM8 A;  3I5S A;  4A53 A;  2B8A A;  1SRM A;  4LDV A;  4QW2 A;  4MMK A;  1NLP C;  4J8O A;  4P5N A;  4PJO B;  3P8D A;  2V1Q A;  2XIC A;  4ZN3 A;  2M16 A;  4FSS A;  4VUB A;  2L2P A;  1UUE A;  3I56 A;  5CIU A;  3NTH A;  3J81 E;  5GJW B;  3FDR A;  2ZAE A;  1KC8 U;  1UGS B;  1UGR B;  3A1P A;  2EYX A;  3OYE A;  4PLI A;  3RR6 A;  4O6J A;  2COW A;  4M7D D;  2XID A;  2KYB A;  3EGU A;  3UWN A;  3IQL A;  3CCS Q;  2LTO A;  3EG2 A;  2MF2 A;  2RD1 A;  3MKD A;  1M90 U;  1GFD A;  3M5A A;  2KXC A;  2DX1 A;  5GMK h;  4EIK A;  1H8K A;  4XTW A;  1BI3 A;  2ROL A;  3QHS A;  4ZGJ B;  1K73 U;  4OMN A;  2GTO A;  2KE9 A;  1PM3 A;  1Q82 U;  2V8I A;  3MP6 A;  1BB9 A;  4AFQ C;  4LNP A;  1D3B A;  3CCL T;  1C0M A;  1HD3 A;  1U06 A;  4AT1 B;  1OX8 A;  2XDB A;  2CZ1 B;  2DJQ A;  4QQG A;  3RKW A;  1WDX A;  1OU8 A;  5KYX B;  1M90 C;  2ZPG B;  2XK0 A;  3ER0 A;  3H6Z A;  1B3Q A;  1N6A A;  3ZEH A;  3OYL A;  4PFZ A;  5KE3 A;  2O9V A;  5A0G A;  4E7Z A;  1M2V A;  4ELZ C;  1TTH B;  1GXI E;  3CCM T;  1SEM A;  2HQE A;  4Z89 A;  2L5Q A;  2EQI A;  3MO8 A;  3HTR A;  2LX9 A;  1VQ5 Q;  4M75 C;  3CPW P;  2M0O A;  2FG0 A;  3ME9 A;  4BDZ A;  3C94 A;  4A4E A;  1CKB A;  2JJ9 A;  2CP7 A;  2GFU A;  4RTU A;  3CEY A;  3ZL7 C;  3OMG A;  3QJY A;  2O9S A;  1M3C A;  1UJ0 A;  1HYO A;  4CI0 C;  2IIM A;  4M7A A;  5GAN j;  4BUG A;  3M0S A;  3AHU A;  4C92 G;  2DIG A;  1QKX A;  2CP6 A;  1PCX A;  2DBK A;  1ZUU A;  2V1R A;  2ESW A;  3EH2 A;  2YLB A;  4JJB A;  3EGD B;  4RTZ A;  1RI0 A;  1VQK A;  3OS2 A;  3LWI A;  5FRN A;  3O8V A;  4BY6 B;  2RF0 A;  3GNF B;  2CP2 A;  2KXD A;  3PGG A;  2RJE A;  2RA2 A;  1BBZ A;  3LWH A;  4ATO A;  3CME A;  1BU1 A;  3NTI A;  3A8O B;  1YJW A;  1OU9 A;  3OBW A;  3MEV A;  5GAO l;  2DK3 A;  1QVF A;  4FYW B;  2I2L A;  1WHG A;  2MIO A;  4OVA A;  2RI2 A;  3RKY A;  4PJM A;  2BKD N;  1VQN A;  1X6O A;  9ATC B;  3OYH A;  5KCO A;  2F5K A;  1MHN A;  2JS2 A;  2RO0 A;  3EG1 A;  2HBP A;  1WIE A;  2FVU A;  1M2O A;  2DXB A;  3GOX A;  3V8L A;  2DZ9 A;  4J9I A;  3CCS T;  4C92 D;  2EIF A;  2KAF A;  1Y71 A;  3O5Z A;  3JCM P;  2J6F A;  3CBM A;  4JZ3 A;  2VKN A;  1QVF P;  2KK4 A;  1BIA A;  2M0Y A;  3CPF A;  2FB7 A;  4C0F A;  3JB9 D;  2OI3 A;  2DXT A;  2JW4 A;  1X01 A;  3LGL A;  1EX4 A;  5LJ5 h;  4EMK C;  4QVC A;  5CAI A;  4OF1 A;  4PJO F;  2KR3 A;  3RUX A;  4X9D A;  2DKG A;  1NZ9 A;  3QWX X;  2EQM A;  3PVQ A;  1BI1 A;  4LUE A;  1IGQ A;  4OB3 B;  2X3X D;  1W2B P;  1Q81 C;  3V8J A;  4ORZ A;  5KCH A;  4J9B A;  1KQ2 A;  3S3M A;  3M4Y A;  4M77 G;  5LJ3 j;  4FYY B;  3QJ6 A;  2DRK A;  2C06 A;  3CME T;  3THK A;  3QO3 A;  2K7A A;  4FIB A;  3TSW A;  1BCO A;  5C0M A;  1W2B A;  1YIT A;  5DLQ E;  2QQB A;  2RHU A;  3JCM W;  5GAN 2;  4DBQ A;  4PJO E;  1YP5 A;  1MV3 A;  3HRU A;  8ATC B;  1RUW A;  1F1B B;  1AWW A;  2L3S A;  1BI2 A;  3VUB A;  3GLX A;  1KHC A;  2V8J A;  4LUD A;  1OV3 A;  4E2F B;  1Y96 A;  2VC8 A;  3SWN A;  4DEY A;  5IAY A;  3G4S Q;  1AD5 A;  1VOM A;  4J5Y A;  1JRI A;  3OYB A;  3CMA A;  4DBR A;  5LJ5 d;  5FU7 B;  1PSF A;  1B34 B;  3M0P A;  5IXF A;  5DM7 R;  1WXU A;  5J3B A;  3DLL A;  1ZSG A;  1LOJ A;  5FW9 A;  3SDZ A;  3CCR A;  5FLX E;  1WJR A;  1S72 Q;  2OTL Q;  2K57 A;  1BIB A;  1Y0M A;  3JCM V;  2M51 A;  5FU6 B;  4IUT A;  4Y92 A;  1PHT A;  2PVG B;  1XOV A;  2HSE B;  3OY9 A;  4JS4 A;  3L2V A;  2COY A;  3TEE A;  2RJC A;  4J6X A;  3Q1J A;  3OYM A;  1WX6 A;  4F7U E;  1GL5 A;  4OB2 B;  3MEA A;  1VQ6 A;  5I21 A;  2DF6 A;  3MEW A;  4M7A E;  2GQV A;  4F7U B;  1FMV A;  1YCY A;  5GAO p;  2BIV A;  3T9N A;  4E7K A;  2E12 A;  2CSQ A;  3EHQ A;  1TUG B;  4WF2 A;  3HRS A;  2ZPB B;  1FWZ A;  2CZ0 B;  2OTJ Q;  1UHF A;  1MMG A;  1IO6 A;  2RMO A;  3EFS A;  4RG8 A;  2O31 A;  3C4S A;  1YJN T;  4J9D A;  2P84 A;  3D7S B;  2DLP A;  2EVR A;  3TQ7 P;  3VUZ A;  4NL3 A;  2ABL A;  1BI0 A;  2CH4 A;  3BDU A;  3N5B B;  2JTE A;  2YUP A;  1PWT A;  1D1B A;  5FU6 C;  3G6E Q;  1I0C A;  5J39 A;  1M90 R;  1Q81 R;  2GBQ A;  3L2W A;  4OGC A;  1JB0 E;  4XTY A;  1YJW Q;  1K9M U;  4GLK A;  1BCM A;  2FZC B;  3I55 Q;  3CBP A;  4F17 A;  1ZLM A;  4QVZ A;  2Z0W A;  4Q5W A;  3M9Q A;  1XNI A;  1RAC B;  2CS7 A;  1VA7 A;  2P0K A;  4HKE A;  1QP3 A;  1RLQ C;  1KIK A;  1NM7 A;  4IUR A;  4ZNX A;  5IHN A;  4JLG A;  1GRI A;  1WXB A;  5C6S A;  3S6W A;  1H92 A;  3OW2 P;  1R77 A;  5LJ5 g;  4LE9 A;  3G6E A;  1QVF S;  3FEO A;  2B86 A;  2EYQ A;  1B7T A;  4PK4 A;  3URG A;  4E7J A;  1WYX A;  1KK7 A;  2DAQ A;  4F7U G;  2EJ9 A;  4RUG A;  3VYH B;  1YHQ A;  2RI3 A;  2JTM A;  2LRQ A;  2ENM A;  1GCQ A;  2CGH A;  4FM4 B;  3OW2 A;  3I9Q A;  1OX9 A;  3OYA A;  4J9C A;  4FSX A;  1P92 A;  2LQ8 A;  4LN2 A;  2FL7 A;  2JTF A;  1N9R A;  2DM1 A;  1RI9 A;  1Y96 B;  1U1T A;  2ZPH B;  2BZ8 A;  2DET A;  2C0O A;  1HK9 A;  1WI7 A;  1Q7Y C;  5CCA A;  2PVD B;  2C0I A;  2EFI A;  2RPN A;  3CC7 T;  3E2U A;  2HSP A;  4FT4 A;  3HKS A;  1W70 A;  4OGE A;  2F69 A;  4R0K A;  2KRN A;  1TH7 A;  1U3O A;  1VQ7 Q;  3CCJ Q;  2M02 A;  2CH4 W;  4C8Q C;  2RQU A;  1K9M C;  3CD6 A;  3V7C A;  1VQO T;  2K2V A;  3E9F A;  1VQ4 A;  5GAO m;  3ZBD A;  2HDA A;  2AIR B;  1QWE A;  1SSH A;  4BB7 A;  1D1C A;  1ZSZ B;  1RAH B;  1Q86 U;  3OYN A;  1YIT T;  3RNJ A;  1NPP A;  4F7U A;  2PZ1 A;  2DD5 A;  2J06 A;  2RHI A;  5CKF A;  3PMT A;  2EJG A;  3PMI A;  3CCQ T;  3L2R A;  4CRI A;  2P4R A;  5LJ5 j;  5IT9 E;  4BE1 A;  2LCC A;  3LLR A;  3V8K A;  2DTH A;  1VYT A;  3G71 Q;  3INZ A;  1R0C B;  1M1K R;  4EPC A;  3CCL Q;  6AT1 B;  5HY6 A;  5KYN A;  1M8M A;  2A28 A;  5GAN 4;  4BY6 C;  4HT9 A;  4M7D B;  1G3W A;  3OYJ A;  5GAN 3;  4CC4 B;  1NG2 A;  2RK2 A;  2DE0 X;  2R5M A;  3UA7 A;  4KBM B;  1YJW T;  3PVL A;  2MK5 A;  3QXE B;  1KJW A;  2EYW A;  5LJ3 f;  2HD0 A;  2RM4 A;  3HFN A;  3REA B;  1QVG P;  3PIO A;  4DEX A;  4C0D B;  1NYG A;  4A4G A;  4OMP A;  3BFM A;  3JB9 J;  3OYK A;  1VQ6 T;  3X20 B;  2OAU A;  2LNH B;  3X26 B;  5EC7 A;  1JXM A;  3WVD B;  2NUP B;  2OX7 A;  4XU2 A;  1ARK A;  2A08 A;  8AT1 B;  1SSF A;  1WHH A;  4C8Q E;  1AEY A;  4RTY A;  1EIF A;  3M54 A;  2QA4 Q;  1IRE B;  1OOT A;  1X2K A;  4M78 F;  3HHT B;  4C0G A;  3JCM f;  5HK0 A;  5GAN 6;  2WSE E;  2XDD A;  1JBM A;  2DIQ A;  1RAB B;  5LJ3 d;  4NOY A;  1X69 A;  4QVD A;  2F1L A;  4KH0 B;  2LQK A;  4M78 E;  1SF9 A;  4QQ6 A;  4Z8A A;  5GAM h;  3E19 A;  4DOW A;  1UFF A;  4BAC A;  3JCM c;  1X75 C;  2A37 A;  1UGQ B;  3KBG A;  3GIB A;  4FYV B;  1K76 A;  1M1K C;  2KRS A;  4HCK A;  3CPW A;  3J80 E;  3CCQ Q;  1GCQ C;  3JB9 I;  2MWP A;  3VS0 A;  1WLP B;  2YXY A;  4N4G A;  2DTI A;  5GAN g;  1OPK A;  1QWF A;  2YSQ A;  1WJS A;  5I22 A;  2DL5 A;  4OMF B;  1KD1 U;  3CCL A;  2D8H A;  5KYY B;  1K4U S;  4MDW A;  3OSV A;  2MCN A;  2CT4 A;  2KBT A;  2RHY A;  4CC7 A;  3I56 Q;  1M4Z A;  1X6G A;  1UG1 A;  3FJ5 A;  1XQH A;  5IN1 A;  2VGN A;  4OB1 B;  5D6Y A;  4ME7 A;  2PUK B;  3CCQ A;  3PTA A;  4C8Q G;  1WPY A;  3LGF A;  3CCR Q;  4CC3 A;  5GAM j;  3NFC A;  1PNJ A;  2DNU A;  5FU7 C;  2BE7 D;  1VQ4 Q;  3VS3 A;  1SHG A;  2FRY A;  3OW2 S;  2DBM A;  1H64 1;  4PJJ A;  4XU0 A;  4JRQ A;  4JUV A;  4Z88 A;  3DKM A;  3NMZ C;  4GBQ A;  3CCJ A;  2YHT A;  4J9E A;  3M55 A;  1M9S A;  3RMQ A;  3VYG A;  2CP3 A;  4BI8 B;  2JNG A;  2V8K A;  1YJN A;  2QYZ A;  2ZPE B;  2H3J A;  1ABO A;  3UDC A;  4E7H A;  1BKB A;  3LH5 A;  1QCN A;  3OMC A;  2YRV A;  4JDS A;  2BZX A;  2NYS A;  2DL3 A;  3VRY A;  7AT1 B;  4ZTJ A;  4M75 B;  2CSI A;  1U5S A;  5GAN 5;  1MMA A;  1N8R C;  4L59 A;  3A8H B;  4HA8 A;  1UEC A;  1D3B B;  1MND A;  3KXT A;  3CXC P;  3G71 A;  1PKT A;  1VQK T;  4PJO A;  4J7I A;  4M7A C;  1N8R R;  2CP0 A;  1RAI B;  2KY9 A;  4OMM A;  3UF4 A;  3JCM d;  1VQ4 T;  2HL3 A;  3EG9 A;  3CD6 T;  3V7R A;  2DL7 A;  4XQ3 A;  4PFP A;  4F7U F;  4BI4 A;  1PKS A;  4FW1 A;  1FYN A;  4XTU A;  3CXC S;  4F14 A;  3CC4 Q;  3EGD A;  4AFS C;  5CQY A;  3G6E T;  2LNV A;  5L8R E;  1VQ9 A;  3MPU B;  5CVI A;  1SRL A;  2DXU A;  3MEU A;  3PT9 A;  3L1A A;  1MV0 B;  1YJN Q;  2D6F A;  2DL8 A;  1AWX A;  2EGC A;  1K73 R;  3G71 T;  1G5V A;  4ESR A;  5GAM g;  1W2B S;  1N8R U;  2EYY A;  2IG0 A;  4C5G A;  4O5V A;  4AFZ C;  1VQ8 A;  5HCK A;  1FX7 A; 
#chains in the Genus database with same CATH homology
 2YLC A;  1VUB A;  4OP0 A;  3MEW A;  2CZ6 B;  5GMK j;  3JCM J;  4N4H A;  4M7A E;  2GQV A;  3QDR B;  4F7U B;  3A8L B;  3OSS C;  4R56 A;  1YCY A;  5CKD A;  2BIV A;  3T9N A;  5GAO p;  4TVR A;  4E7K A;  1I5L A;  1B34 A;  1M1G A;  4HCB A;  2E12 A;  2QQ9 A;  1XTD A;  2A7Y A;  2X4Y A;  1YI2 T;  5HKC A;  2P0P A;  4WF2 A;  3OYD A;  3HRS A;  2ZPB B;  1VQ7 A;  2VYT A;  3CBO A;  2DZC A;  3JSC A;  2EQJ A;  3EAE A;  1FWZ A;  2CZ0 B;  2KMT A;  1G3S A;  4C0Z A;  3JB9 G;  1M1K U;  1VQP A;  2CKK A;  3CCE T;  3EFS A;  3BY7 A;  4M78 G;  4RG8 A;  5CKE A;  1VIF A;  4J6W A;  3CCE A;  3C4S A;  2LT4 A;  2X4X A;  1YJN T;  1ZHI A;  2K5I A;  1I81 A;  3QII A;  5D6X A;  3MCA B;  2D0Q B;  1Q86 C;  1M5Q 1;  3VUZ A;  3L2Z A;  1Y7X A;  2JZ2 A;  4XTV A;  3CCJ T;  1VQ7 T;  4NL2 A;  4NL3 A;  2O01 E;  5J26 A;  3LYI A;  3OS0 A;  1QVG S;  3CC4 A;  4HCC A;  1BI0 A;  3BDU A;  4DOV A;  3N5B B;  4A4H A;  2FYK A;  3RER A;  5FU6 C;  1KQS A;  5J39 A;  4PJO G;  4XAX B;  3LH0 A;  3CCU T;  5LL6 S;  3L2W A;  4OGC A;  1QVP A;  1JB0 E;  2HAX A;  4XTY A;  3OBY A;  1VQ8 T;  1KG1 A;  4PLL A;  1K9M U;  2DTO A;  4C8Q B;  5GAO n;  2KSS A;  2RJD A;  4C8Q F;  3S3O A;  1VQ8 A;  4GLK A;  1W4S A;  3CBP A;  4X34 A;  4QVZ A;  4Q5W A;  3M9Q A;  5CQX A;  1XNI A;  2RB6 A;  2CS7 A;  2QQA A;  3M58 A;  3OS1 A;  4M77 C;  1OI1 A;  2P0K A;  3GPL A;  4M78 C;  4HKE A;  4II1 A;  1QP3 A;  2JN0 A;  1VIE A;  4M75 G;  3A8M B;  3CC2 A;  4BD3 A;  1U1S A;  4M78 A;  4N0A C;  2EWN A;  5HK3 A;  4IUR A;  1VQO A;  2O4X A;  1ZQ1 A;  1M1F A;  2LC4 A;  2E70 A;  4JLG A;  5GMK e;  3RKX A;  1KD1 C;  5C6S A;  3S6W A;  1VQN T;  1VQ9 T;  4M7A D;  4BDY A;  3M56 A;  5LJ5 g;  3G6E A;  3M4G A;  1YBY A;  4C92 A;  3M59 A;  2K4Y A;  4N4I A;  3GF5 A;  4A4F A;  3V7S A;  4M7D G;  1QVF S;  3M53 A;  2QEX A;  1BYM A;  3FEO A;  3CMA T;  4M7A G;  2EYQ A;  2KQW A;  3QYH B;  4HCZ A;  2L3R A;  3QZ9 B;  2PUO B;  1YIJ T;  5GAN h;  3QSU A;  5CR2 A;  1KQS S;  1N27 A;  3BW1 A;  3URG A;  2XD0 A;  1K8A U;  1WQ7 A;  3HRT A;  2BUD A;  3FIF A;  2KDS A;  4E7J A;  2DAQ A;  4F7U G;  3L2U A;  3JCM b;  1YI2 A;  1WNL A;  2EJ9 A;  2MI6 A;  2E6N A;  1U8R A;  4Z02 A;  3GP8 A;  5D6W A;  3TCJ A;  4LDX A;  1QP2 A;  4Y91 A;  3VYH B;  2QA4 A;  3UT1 A;  2PVO B;  5FRO A;  1YHQ A;  2RI3 A;  2JTM A;  2DXC A;  1G3T A;  2LRQ A;  2O4X B;  2VXF A;  2WAC A;  2CGH A;  1FXX A;  4XU1 A;  3JAM E;  1KHI A;  4FM4 B;  3OW2 A;  3MP1 A;  1UGP B;  3NTK A;  4BI3 A;  3OYA A;  2RH2 A;  3PIP A;  1QW1 A;  1P92 A;  2LQ8 A;  3LX7 A;  4FSX A;  4JJN K;  3MHX A;  2FL7 A;  2JTF A;  1N9R A;  4D6W A;  2MMP A;  1Y96 B;  2RJF A;  4GY5 A;  1U1T A;  2X4W A;  1DJ7 B;  2ZPH B;  3QKJ A;  1VQ5 T;  1M8V A;  4LD6 A;  3JRZ A;  2B8A A;  4LDV A;  4A53 A;  3QYG B;  4IUP A;  5KH6 A;  1HK9 A;  3HPW A;  4QW2 A;  1Q7Y C;  2DVE A;  4MMK A;  5CCA A;  4MDX A;  2L8D A;  2MWO A;  2PVD B;  3QBY A;  4C92 C;  4EMK A;  4J8O A;  4P5N A;  2EFI A;  4PJO B;  3OB9 A;  3P8D A;  3CC7 T;  1NPR A;  2XIC A;  4ZN3 A;  5A0D A;  4FT4 A;  3HKS A;  2M16 A;  2JOY A;  4OGE A;  2QEX T;  4L6V 5;  2E5Q A;  4RG2 A;  1OZ3 A;  3H8Z A;  4VUB A;  5A2Q E;  3I56 A;  2F69 A;  4LD9 K;  1TH7 A;  5CIU A;  3NTH A;  5LJ3 g;  3J81 E;  5I2S A;  3E9G A;  1R8O B;  2E6Z A;  4C8Q C;  3FDR A;  4B9X A;  1KC8 U;  1K9M C;  3CD6 A;  3V7C A;  1VQO T;  2K2V A;  3E9F A;  1VQ4 A;  4PL6 A;  5GAO m;  3ZBD A;  4M77 F;  1UGS B;  2DEQ A;  1UGR B;  3OYE A;  4PLI A;  4FL6 A;  4BB7 A;  3MP8 A;  5GAO q;  1OZ2 A;  4O6J A;  3I55 T;  4BE2 A;  2NLU A;  3CCM A;  2XID A;  4RCC A;  4M7D D;  1Q86 U;  3UWN A;  3OYN A;  2DPP B;  2K3X A;  1YIT T;  1NPP A;  2LTO A;  4KUI A;  2MF2 A;  2RD1 A;  1MGQ A;  4F7U A;  1M90 U;  3M5A A;  2DD5 A;  2RHI A;  1KQ1 A;  5CKF A;  5GMK h;  3PMT A;  2EJG A;  2K5L A;  3PMI A;  4XTW A;  4PJO C;  3CCQ T;  5AYF A;  1BI3 A;  3L2R A;  3SFM A;  2R5A A;  4CRI A;  1Y07 A;  3HL8 A;  3PNW C;  3QHS A;  3ZFJ A;  4ZGJ B;  1K73 U;  2K5F A;  3OYG A;  2FHD A;  1K8A C;  5LJ5 j;  5IT9 E;  4R55 A;  4BE1 A;  2LCC A;  4MZP A;  5GAO r;  3LLR A;  1Q82 U;  2V8I A;  2DTH A;  3V8K A;  3MP6 A;  2VUB A;  3INZ A;  1D3B A;  3CCL T;  4EPC A;  5GAN e;  2Y4Y A;  4EMG A;  5HY6 A;  5GAN 4;  1PSE A;  4BY6 C;  2XDB A;  2CZ1 B;  1VQL A;  3JB9 F;  1G3W A;  5CK9 A;  4QQG A;  5GAN 3;  3OYJ A;  3RKW A;  4M7D B;  2MAM A;  2RK2 A;  2OTJ T;  2R5M A;  1VQP T;  4C5I A;  4JS5 A;  3JB9 H;  2WSC E;  4KBM B;  4HT8 A;  1YJW T;  1M90 C;  2ZPG B;  2RHX A;  2XK0 A;  3ER0 A;  3H6Z A;  4MZT A;  1N6A A;  3QXE B;  3ZEH A;  2VXE A;  3E1S A;  5LJ3 f;  3TRE A;  4DQ2 A;  2E41 A;  2HD0 A;  2JVV A;  5A0L A;  5KE3 A;  3OYL A;  4A54 A;  5A0G A;  4M7D C;  2EQU A;  2RM4 A;  3HFN A;  3SB2 A;  5GAN 8;  3PIO A;  4C0D B;  4IKF A;  2R57 A;  3QUI A;  4ELZ C;  4A4G A;  4M7A F;  4M7A B;  1GXI E;  3CCM T;  2EJF A;  3BFM A;  3I55 A;  2HQE A;  3JB9 J;  3SWN B;  3OYK A;  3X20 B;  1VQ6 T;  4J7F A;  1JJ2 S;  2OAU A;  2X35 A;  3X26 B;  4E47 A;  1UB4 A;  3WVD B;  3QG1 A;  2L5Q A;  4XU3 A;  4XU2 A;  2QDY B;  2E65 A;  4C0D C;  4KUL A;  4XTZ A;  3CPW S;  2EAY A;  3CCV A;  3MO8 A;  2P0Q A;  2ZCF B;  1SSF A;  4C8Q E;  2LX9 A;  1N9S A;  4QQD A;  2XU8 A;  3CCS A;  2E1H A;  4M75 C;  1EIF A;  4M7D E;  3M54 A;  3DB4 A;  2M0O A;  2K3Y A;  1IRE B;  3ME9 A;  4BDZ A;  3C94 A;  3S3N A;  1ZBX A;  4A4E A;  4C92 B;  2F5T X;  4M78 F;  4BE0 A;  3HHT B;  3X24 B;  1S72 T;  2OTL T;  2GFU A;  4C0G A;  3JCM f;  5HK0 A;  5LJ3 e;  5GAN 6;  2GF7 A;  1VQM A;  3CEY A;  1Q7Y U;  3PFS A;  2WSE E;  1VQM T;  4C8Q A;  1WGS A;  3SWN C;  3CC7 A;  2ZGW A;  3OMG A;  4C92 E;  1JBM A;  2DIQ A;  3QJY A;  4JRK A;  2XDD A;  5LJ3 d;  4CI0 C;  5GAN 7;  3OS5 A;  4NOY A;  4M7A A;  5GAN j;  2DD4 A;  4BUG A;  3P8H A;  2XI9 A;  4B9W A;  3OA6 A;  4ZN1 A;  2L89 A;  1V29 B;  2KVQ G;  2QI2 A;  4QVD A;  4X9C A;  3AHU A;  4C92 G;  2DIG A;  4ZGD B;  4C8Q D;  1I4K 1;  4YTL A;  4ELY C;  2LQK A;  4IUQ A;  4M78 E;  4QQ6 A;  5GAM h;  5GMK m;  2QQR A;  2YLB A;  3E19 A;  3OYY A;  4DOW A;  4JRI A;  4UC4 A;  4BAC A;  2ZPF B;  3JCM c;  1RI0 A;  3LW5 E;  1VQK A;  5CO7 A;  3OS2 A;  3LWI A;  5FRN A;  1YJ9 T;  1HXD A;  1X75 C;  3O8V A;  1IZ6 A;  1UGQ B;  3KBG A;  3A5Z B;  4BY6 B;  3GIB A;  4JRP A;  3GNF B;  1YHQ T;  3PGG A;  2HQX A;  1M1K C;  3HSB A;  2RJE A;  2QA4 T;  2RA2 A;  3CPW A;  3LWH A;  2DO3 A;  3J80 E;  3OYI A;  4E7I A;  4ATO A;  3CME A;  3JCM g;  3NTI A;  5LJ5 f;  3MET A;  1RL2 A;  3HFO A;  5DY9 A;  3JB9 I;  2MWP A;  4PKC C;  1OYX A;  4N4G A;  2DTI A;  3A8O B;  1YJW A;  4RCB A;  4FT2 A;  5GAN g;  4HT9 A;  3OBW A;  2LDM A;  2CZ7 B;  3MEV A;  5GAO l;  1YIJ A;  4M77 D;  2OTJ A;  2DK3 A;  5GAM e;  1WJS A;  2E10 A;  4JLI A;  4RKU E;  1QVF A;  2P4T A;  4OMF B;  1KD1 U;  4XK8 E;  2I2L A;  5EG2 A;  5FRM A;  2LT1 A;  3CCL A;  4OVA A;  2RI2 A;  4C5E A;  3RKY A;  4MDW A;  3OSV A;  2BKD N;  4ZGE B;  4M7D F;  3JCM X;  1VQN A;  1X6O A;  2RHY A;  2EQK A;  4M78 B;  3OYH A;  1M4Z A;  5KCO A;  2F5K A;  1MHN A;  2RO0 A;  1XQH A;  3DLM A;  2HBP A;  4OB1 B;  2EKO A;  2VGN A;  5D6Y A;  5IN1 A;  3WVE B;  1LNX A;  2RHZ A;  2FVU A;  5LJ3 h;  2DXB A;  2QTX A;  4ME7 A;  3GOX A;  3V8L A;  2DZ9 A;  2PUK B;  3CCQ A;  3PTA A;  4C8Q G;  1WPY A;  3CCS T;  3LGF A;  4C92 D;  2RI5 A;  2EIF A;  3NFC A;  5GAM j;  2KAF A;  3OYC A;  1Y71 A;  4ZTF A;  3G4S T;  3JCM P;  5GMK l;  1LJO A;  3CCV T;  3L2Q A;  3QZ5 B;  4A4K A;  5GAM f;  1WJQ A;  4MZM A;  3CBM A;  4LDW A;  2PQW A;  3OQ5 A;  5FU7 C;  2KK4 A;  3QPH A;  4N0A A;  1BIA A;  4OB0 B;  4M75 A;  3OW2 S;  4M78 D;  3FJP A;  3CPF A;  2FB7 A;  2GFA A;  1H64 1;  4C0F A;  3CCU A;  4XU0 A;  3SD4 A;  3JB9 D;  4KT0 E;  4JRQ A;  3DB3 A;  4MML A;  4JUV A;  2DXT A;  3G4S A;  1X01 A;  3LGL A;  4EDU A;  3DKM A;  1UEB A;  3CC4 T;  3L42 A;  2CYZ B;  5LJ5 h;  3CCJ A;  2XG8 D;  3WXM B;  1Q81 U;  2YHT A;  3FB9 A;  3HP9 A;  1M9S A;  3M55 A;  4IUV A;  3RMQ A;  3VYG A;  4EMK C;  4QVC A;  5CAI A;  5M9O A;  5GAN f;  3I56 T;  4BI8 B;  2JNG A;  4OF1 A;  2V8K A;  4PJO F;  1WQW A;  1YJN A;  5GMK i;  3RUX A;  4X9D A;  4IUU A;  1Q82 C;  2ZPE B;  2H3J A;  1VQL T;  2DKG A;  3C12 A;  1NZ9 A;  3UDC A;  1NE8 A;  2EQM A;  4E7H A;  1BI1 A;  2XKO C;  1BKB A;  2XHC A;  3A8G B;  3P8B B;  3OMC A;  2YRV A;  4JDS A;  3CXC A;  4J6Y A;  4OB3 B;  1AHJ B;  1K73 C;  3F70 A;  3G7Z A;  4M77 E;  1Q81 C;  3V8J A;  2RK1 A;  3FRN A;  2X4J A;  5KCH A;  1KQ2 A;  3S3M A;  3M4Y A;  4ZTJ A;  4M77 G;  1NJI U;  2AHJ B;  4J83 A;  4M75 B;  5LJ3 j;  2XDP A;  3M57 A;  2LCL A;  5GAN 5;  2GCX A;  1N8R C;  4L59 A;  4M77 B;  3BDL A;  3QJ6 A;  3A8H B;  4XTX A;  2C06 A;  4HA8 A;  3CME T;  2Y4X A;  5I2M A;  3QO3 A;  3RMS A;  3CC2 T;  2PU9 B;  4M75 D;  4FIB A;  5DLO A;  2VV5 A;  3EFR A;  2R58 A;  4KUD K;  4C5H A;  5C0M A;  1W2B A;  1YIT A;  1D3B B;  5DLQ E;  3FC3 A;  3KXT A;  2QQB A;  3G71 A;  3JCM h;  2RHU A;  3JCM W;  1I8F A;  5GAN 2;  1YJ9 A;  1KC8 C;  2G3R A;  4EMK B;  5KE2 A;  4C92 F;  1VQK T;  2M9U A;  4PJO E;  3ASK A;  3HRU A;  4J7I A;  4PJO A;  1O75 A;  2ZZD A;  4PNO A;  4M7A C;  3VUB A;  1BI2 A;  3GLX A;  1KHC A;  2KY9 A;  2V8J A;  3JCM d;  2IVW A;  1VQ4 T;  2QQS A;  1Y96 A;  2A3L A;  3RES A;  4RMO A;  2VC8 A;  1G3Y A;  3SWN A;  3V7R A;  3CD6 T;  4EMH A;  3UPU A;  3CCR T;  1NJI C;  5IAY A;  3X28 B;  4L5G A;  4NS5 A;  4XQ3 A;  4F7U F;  3GNG A;  4E7L A;  4BI4 A;  3OYF A;  4J5Y A;  1JRI A;  3OYB A;  5GAM d;  3CMA A;  3VJP A;  5LJ5 d;  2JUF A;  4M75 E;  4Y28 E;  5FU7 B;  3J7A F;  4XTU A;  1PSF A;  1B34 B;  2Y90 A;  4M75 F;  3X25 B;  5DM7 R;  3CXC S;  5J3B A;  1H3Z A;  5CQY A;  3G6E T;  2LNV A;  3DLL A;  3JCM Q;  5L8R E;  2M1H A;  5CKH A;  1VQ9 A;  1O9S A;  5CVI A;  5LJ5 e;  1LOJ A;  4M77 A;  2DXU A;  3RIR A;  3SDZ A;  3CCR A;  5FLX E;  4LDY A;  1WJR A;  3MEU A;  3VKI A;  2K57 A;  1S72 A;  2OTL A;  4V2S A;  4PJO D;  3PT9 A;  1BIB A;  2VGM A;  3JCM V;  3JCM e;  2QXF A;  1QVG A;  3VU3 C;  3L1A A;  5FU6 B;  2ZPI B;  2LVM A;  2E64 A;  4IUT A;  2PVG B;  1XOV A;  3KUF A;  2HNI A;  2D6F A;  3OY9 A;  3R6O A;  4JS4 A;  3L2V A;  1VQ5 A;  4LDU A;  2WSF E;  2DJZ A;  3C95 A;  3TEE A;  3G71 T;  5CKB A;  2RJC A;  4J6X A;  3Q1J A;  4FU6 A;  1G5V A;  3VV0 A;  5GAM g;  3OYM A;  4DA4 A;  1W2B S;  1N8R U;  4F7U E;  3FLG A;  4M7D A;  2IG0 A;  5GAN d;  1JJ2 A;  4C5G A;  4O5V A;  4OB2 B;  3MEA A;  1VQ6 A;  3TU4 K;  5I21 A;  2D9T A;  1FX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...