3RN0D

Crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn0D00
3JZGA 3PXWD 4GGAA 5C9ZB 3P4FA 4H5IA 3SBQA 3DXMC 5GXIA 2J55H 3V9FA 3EWEA 2YNOA 4OWRA 4FA9D 3I7PA 5FQDA 1OMWB 5CXCB 1XKSA 5IGOA 5AMSA 2UZYB 2H9MA 3I7LA 4G56B 2H14A 4XYHA 4CZVA 3EI2B 2P9LC 3AL8B 4OZUA 3HFQA 4PBYA 5THAA 2UZXB 2H6QA 5H1MA 3PXSD 3I7OA 2AH0A 2AGYA 4A0BA 5EM2B 4A11B 2AQ5A 3L4MD 4CY3A 4JXMA 5FKRA 4AEZA 3C75H 4GM8A 2G99A 2H13A 3RLMD 2H9PA 5TF2A 4D6VA 2I0TA 3GFCA 1XHMA 4A09A 2CE9A 2Q7QA 4GGDA 2IAAA 3KRWB 4FWWA 4FA4D 3RRMC 1RI6A 1SQ9A 3IIYA 3JZNA 2AGZA 2PM9A 3C9CA 1U2VC 2J57G 3F3GA 3ODTA 3I89A 3PSLA 3UVNA 1PGUA 4ZOYA 3F3PA 3NVXA 4J82A 3IKOA 3OKWA 2H6NA 4X61B 3UKUC 3I8CA 3UVLA 3PSCB 2IUQA 2PBIB 3I7HA 3OKTA 5K19A 4XEIC 2PM7B 3BWSA 4AOWA 3CIKB 4LGNA 3EU7A 2I0SA 1JMZB 3NVQA 4BL0A 5C2VB 4E5ZB 3A0FA 3VH0A 1MDAH 4NSXA 2H6KA 5JWZA 3IJ1A 4IA9A 3SBRA 2YNNA 3AL8A 3E0CA 5HE0B 4J0XA 4A09B 3AFCA 1FWXA 5TDHB 3OKYB 1GP2B 5FA5B 3EI4A 3K26A 5FKSA 1L0QA 4PXWA 3I7KA 3I7NA 4Z8LA 4A11A 4GQ1A 2OK4A 5HE1B 3OTTA 4J86A 3L4OD 1JJUB 4ZOVA 1MG2A 4MK0B 5IC7A 1P22A 1XIPA 4FA5D 1NR0A 2AGXA 2YBAA 3FM0A 3RFHA 2AGLA 4L9OA 4L3GD 2YB8B 2TRCB 3UKRC 3OL2B 5B4WA 4J84A 2B5NA 3F3FA 4N14A 3J81g 4X60B 1N6FA 3SBPA 5FXYA 2HJ4A 1JOFA 2HYEA 4GM9A 4LG8A 3N0EA 3SCYA 3MMYA 2IWKA 3UVOA 5IJ7E 4J8BA 4A08A 3EI4B 4J81A 3V5WB 4E5ZA 5HE3B 4L3HD 3FGBA 3PE7A 2HJBA 4J87A 4PNKB 4HDJA 2B4EA 3V7DB 1GXRA 4EWRA 2IWFA 4CI3A 2B5LA 3SXTD 4JT6C 5H14A 5GXHA 3UVMA 4R7AB 3OKYA 4ERYA 4JT5C 1QNIA 2IURA 4L1QD 2CO0C 1YFQA 1OLZA 4J78A 4GZ8A 4J77A 2P9NC 1PEVA 3DM0A 3MKQA 4ERQA 1GOTB 4J73A 4BH6A 2Z2PA 4E54B 5GSAA 1R5MA 4CI8A 3RN0D 2XU7A 4JSXC 5CYKA 5EALA 5GMKn 4A08B 4K3JB 4GQ2P 3OL2A 4JSPC 2QC5A 3MXXA 3I8EA 4ZOXA 5CXBB 2OJYA 4O1QD 3AL9A 4QT8A 4CI1A 3W15A 4Y7RA 2MTAH 5EAPA 3SWSD 5I5IA 4JSNC 5AJAA 4PSXB 3CFSB 3MKSB 1PBYB 3ULEC 4X3EA 5EMJB 3MZLA 5H17A 2HKMA 5EARA 3EI3A 3IJ0A 4A0AA 5TEEA 3BG1A 4LG9A 4JSVC 1SQJA 2OIZA 4GM3A 1B9YA 5SXMA 3NVNA 4J0WA 4PSWB 5EAMA 5CYKB 3SJLD 1NEXB 3FRXA 4CZXA 4IMMA 3SMRA 1Q47A 5I5MA 3C99A 3ZWLB 2G9AA 1N6EA 4CI2A 4ZOZA 2IUPA 2H9NA 3J80g 4J79A 3JAMg 3RFGA 4E54A 3SN6B 3DXKC 2HESX 1N6DA 4FHLA 3JPXA 1S4UX 1PI6A 3SHFA 2XL2A 3RSEC 3MZKA 2P9PC 2Z2NA 4H5JA 2YMUA 2H68A 3N0DA 5IGQA 4CY1A 2CE8A 1MG3A 5C2WB 2GC7A 3EI3B 5CXBA 4D0KA 3IJCA 4A0AB 5I5JA 4PBZA 3DWLC 2I3SA 1SHYB 5FKTA 2GC4A 2P9KC 3UVKA 5A2Qg 4GQBB 3BG0A 5FKQA 1K32A 5HE2B 2CN2A 2HKRA 4ES0A 4CY2A 2XYIA 3C5MA 1TBGA 4A2MA 3RMZD 3SLED 3GREA 2QXVA 3I2NA 4A2LA 4XYIA 3VGZA 5HYNB 3EI1B 4QL1A 4I79A 2OVQB 4GGCA 4O45A 4FAVD 4JD2C 2I0RA 4ERZA 5FLXg 1VYHC 4CY5A 1U4CA 4GMBA 2OVRB 1K8KC 2HXCA 1TYQC 2CNXA 2PM6B 5KDOB 4J8GA 2XL3A 4ESGA 2EBSA 3SFZA 1B9XA 2W18A 4Y5RD 4K3ID 2BCJB 3UR4A 4FB1D 3VA6A 3AH8B 2AH1A 2P9SC 5HQGA 4U7AA 3JRPA 3PVUB 5EMMB 4FAND 4O3UB 2P9UC 2B5MA 1GG2B 4A0BB 4CZYA 3JZHA 5IJ8E 3PXTD 4BUJC 3K27A 5EMKB 2GNQA 2P9IC 3CFVA 3ORVD 5CXCA 4U1EI 4ZN4A 2J56H 2YNPA 2AGWA 4UI9R 4O3TB 3EG6A 3EI2A 2BBKH 2H3XA 1JMXB 4FA1D 3SVWD 5TEFA 1A0RB 2H9LA 3KRXB 2CO0A 5K1CC 3JROA 3OW8A 3IIWA 5EM2A 4X63B 2OK6A 4QQEA 2PM9B 3PVWB 4KFMB 3DSMA 4O9DA 4TZ4A 4YVDA 5EMLB 2OVPB 3EMHA 2O9KA 2H47A 3RN1D 4CC9A 4PC0A 2CN3A 1ERJA 2I3TA 3B7FA 4QRJA 2IUVA 3EI1A 2Z2OA 5IT9g 4A7JA 3JB9L 3U4YA 5AFU3
chains in the Genus database with same CATH superfamily
2VDKA 3V4VA 3JZGA 3PXWD 4GGAA 5C9ZB 3P4FA 4H5IA 3SBQA 3DXMC 4IRZA 4RE6A 5GXIA 2J55H 3V9FA 3EWEA 2YNOA 4OWRA 4FA9D 5E6SA 2BKLA 3I7PA 5FQDA 1OMWB 5CXCB 5FFGA 1XKSA 5IGOA 2EIBA 5AMSA 2UZYB 2H9MA 3I7LA 4G56B 2EICA 2H14A 4XYHA 2VDMA 4MMZA 3ZE1A 4CZVA 3EI2B 2P9LC 3AL8B 4OZUA 3HFQA 4PBYA 5THAA 2UZXB 1UOQA 2H6QA 5FFOA 5H1MA 1TYEA 3PXSD 3I7OA 3ZE2A 2AH0A 2AGYA 4A0BA 5EM2B 3MUNA 1UOOA 4BCBA 4A11B 2AQ5A 3L4MD 3O4IA 4CY3A 3V4PA 4JXMA 5FKRA 4AEZA 1C9LA 3C75H 4GM8A 2G99A 2H13A 3RLMD 2H9PA 5TF2A 4D6VA 2I0TA 3GFCA 4Z7OA 1XHMA 4WK0A 4A09A 2VZ1A 2CE9A 2Q7QA 4GGDA 2IAAA 3KRWB 4FWWA 2VDLA 4FA4D 3RRMC 1RI6A 1SQ9A 3IIYA 3JZNA 2AGZA 2PM9A 3C9CA 1C9IA 1U2VC 2J57G 3F3GA 4AX4A 3FCUA 3ODTA 3I89A 3PSLA 4UM9A 3UVNA 1PGUA 3VI4A 4ZOYA 3F3PA 3NVXA 3EQ7A 4J82A 3IKOA 3OKWA 2H6NA 4X61B 3UKUC 3I8CA 3UVLA 3PSCB 2IUQA 5E6UA 2PBIB 3I7HA 3OKTA 5K19A 4XEIC 2PM7B 3BWSA 4AOWA 3CIKB 4LGNA 3EU7A 2I0SA 1JMZB 3NVQA 4BL0A 5C2VB 4NENA 3A0FA 4E5ZB 3VH0A 1MDAH 4NSXA 2H6KA 1H2XA 3ZDXA 5JWZA 4NC4A 3IJ1A 4IA9A 2EIEA 3SBRA 3ZDYA 2YNNA 3AL8A 3E0CA 5HE0B 4J0XA 4A09B 3AFCA 1FWXA 5TDHB 3OKYB 1GP2B 5FA5B 3EI4A 3K26A 5FKSA 1E8MA 3U4YA 1L0QA 3KCIA 4PXWA 3I7KA 3I7NA 4Z8LA 4A11A 4GQ1A 2OK4A 5HE1B 3OTTA 1GOFA 4J86A 3L4OD 1JJUB 4ZOVA 1MG2A 1T2XA 4MK0B 5IC7A 1P22A 2VDPA 1XIPA 4FA5D 1NR0A 2AGXA 1E5TA 2YBAA 3FM0A 3K72A 3RFHA 2AGLA 4L9OA 4L3GD 2YB8B 2TRCB 5E6RA 3UKRC 3OL2B 5B4WA 1BPOA 2B5NA 3EQ9A 4J84A 5M5TA 3F3FA 4N14A 3J81g 4X60B 1N6FA 3SBPA 5FXYA 2HJ4A 1JOFA 1H2WA 1O6FA 1UTCA 2HYEA 4GM9A 4L1MA 4LG8A 3O4HA 3N0EA 3SCYA 3NIFA 3MMYA 4DNUA 2IWKA 3UVOA 5IJ7E 4J8BA 4A08A 3EI4B 4J81A 3ZDZA 5M5RA 4G1EA 3V5WB 3IUNA 4E5ZA 3T3PA 2VDRA 5HE3B 4L3HD 3FGBA 3NIGA 3PE7A 2HJBA 4J87A 4PNKB 4HDJA 2B4EA 3IUQA 3V7DB 1GXRA 4EWRA 1VE7A 2IWFA 1O6GA 4CI3A 2B5LA 2VDNA 2QR5A 3SXTD 4JT6C 2HU5A 5H14A 5GXHA 3UVMA 4R7AB 3OKYA 4ERYA 4JT5C 1H2YA 1QNIA 2IURA 4L1QD 2CO0C 1YFQA 5C86A 1OLZA 4J78A 1UOPA 4GZ8A 4J77A 2P9NC 1PEVA 3DM0A 3MKQA 4ERQA 4O2WA 1GOTB 4J73A 4AMZA 4BH6A 2Z2PA 4E54B 5GSAA 3NIDA 1R5MA 4CI8A 1E8NA 2JKXA 2XU7A 4JSXC 3RN0D 5CYKA 5C92A 5EALA 5GMKn 2XZGA 4A08B 4K3JB 4MMXA 4GQ2P 3OL2A 2QC5A 3MXXA 1I2MB 4JSPC 1GOHA 3I8EA 4ZOXA 5CXBB 2OJYA 1YR2A 3AL9A 2HU7A 4O1QD 4QT8A 4BCDA 4CI1A 3W15A 4Y7RA 4AN0A 2MTAH 1JTDB 4O02A 3MVDK 4NAAA 4DNWA 5EAPA 5M61A 4G55A 3SWSD 4MMYA 3IUJA 3ZE0A 3EQ8A 5I5IA 4JSNC 5AJAA 4PSXB 3CFSB 2VZ3A 3MKSB 3O4GA 1PBYB 3ULEC 4X3EA 5EMJB 3MZLA 5H17A 2HKMA 3K71A 5EARA 3EI3A 4Z7QA 3IJ0A 4A0AA 5TEEA 3IUMA 3BG1A 4LG9A 4JSVC 1SQJA 5M5UA 3T3MA 3IVMA 2OIZA 2XDWA 4GM3A 1B9YA 5SXMA 3NVNA 4J0WA 4PSWB 5EAMA 5CYKB 3SJLD 1NEXB 3FRXA 4WJKA 4JHNA 4CZXA 4IMMA 4QAMA 3K6SA 3SMRA 1Q47A 5I5MA 4RE5A 3C99A 3ZWLB 2G9AA 1N6EA 4CI2A 4ZOZA 2IUPA 2H9NA 3J80g 4J79A 3JAMg 3RFGA 4E54A 3SN6B 3DXKC 2HESX 3O4JA 1N6DA 4FHLA 3JPXA 1QFSA 1S4UX 1PI6A 3SHFA 2XL2A 3RSEC 3MZKA 4NBMA 1U8CA 1JV2A 2P9PC 4UM8A 3QI0A 2Z2NA 4H5JA 5M5SA 2YMUA 2H68A 3N0DA 5IGQA 4CY1A 2CE8A 1MG3A 5C2WB 2GC7A 4AN1A 3EI3B 3IULA 5CXBA 4D0KA 3IJCA 4A0AB 5I5JA 4PBZA 1A12A 3DWLC 2I3SA 1SHYB 5FKTA 2GC4A 3GD1I 2P9KC 5HDBA 3UVKA 5A2Qg 4GQBB 3BG0A 1VE6A 5FKQA 2HU8A 1K32A 5HE2B 2CN2A 2HKRA 1GOGA 4ES0A 4CY2A 1VZ3A 2XYIA 3C5MA 1TBGA 4A2MA 3RMZD 1M1XA 3GREA 3SLED 3FCSA 2QXVA 3I2NA 3VI3A 4A2LA 4XYIA 3VGZA 5HYNB 3EI1B 4QL1A 4I79A 2OVQB 4GGCA 4JHPC 4O45A 2VDOA 4G1MA 4JD2C 4D9SA 4FAVD 2I0RA 4ERZA 5FLXg 1VYHC 4CY5A 1U4CA 4GMBA 2OVRB 1K8KC 2HXCA 1TYQC 2CNXA 2PM6B 5KDOB 4J8GA 2XL3A 3GC3B 4ESGA 2EBSA 3SFZA 1B9XA 2W18A 4Y5RD 4K3ID 3DDUA 2BCJB 3UR4A 4FB1D 3VA6A 3AH8B 4BP9A 2AH1A 2P9SC 5HQGA 4U7AA 3JRPA 3PVUB 5EMMB 4FAND 2EIDA 3OF7A 4O3UB 2P9UC 3MUOA 2B5MA 1GG2B 4A0BB 4CZYA 3JZHA 5IJ8E 4BP8A 3PXTD 4BUJC 3K27A 3QHYB 5EMKB 1L5GA 3IJEA 2GNQA 2P9IC 3CFVA 3ORVD 5CXCA 4U1EI 4ZN4A 2J56H 2YNPA 2AGWA 4UI9R 5M5VA 3IURA 4O3TB 3EG6A 2VC2A 2VDQA 3EI2A 1QFMA 2BBKH 2H3XA 1K3IA 1JMXB 4FA1D 3SVWD 1VZ2A 4WK2A 5TEFA 1A0RB 2H9LA 3KRXB 2CO0A 5K1CC 2QZPA 4WK4A 3JROA 3OW8A 3IIWA 5EM2A 4X63B 2OK6A 4QQEA 4Z7NA 2PM9B 3PVWB 4KFMB 3DSMA 4O9DA 4TZ4A 2WQ8A 4YVDA 5EMLB 2OVPB 3EMHA 2O9KA 2H47A 3RN1D 4CC9A 4PC0A 1H2ZA 2CN3A 1ERJA 2I3TA 4DNVA 3B7FA 4QRJA 2IUVA 3EI1A 2Z2OA 5IT9g 4A7JA 3JB9L 4AMYA 4BCCA 5AFU3 2XE4A
chains in the Genus database with same CATH topology
3JZGA 3PXWD 4GGAA 5C9ZB 3P4FA 4H5IA 3SBQA 3DXMC 5GXIA 2J55H 3V9FA 3EWEA 2YNOA 4OWRA 4FA9D 3I7PA 5FQDA 1OMWB 5CXCB 1XKSA 5IGOA 5AMSA 2UZYB 2H9MA 3I7LA 4G56B 2H14A 4XYHA 4CZVA 3EI2B 2P9LC 3AL8B 4OZUA 3HFQA 4PBYA 5THAA 2UZXB 2H6QA 5H1MA 3PXSD 3I7OA 2AH0A 2AGYA 4A0BA 5EM2B 4A11B 2AQ5A 3L4MD 4CY3A 4JXMA 5FKRA 4AEZA 3C75H 4GM8A 2G99A 2H13A 3RLMD 2H9PA 5TF2A 4D6VA 2I0TA 3GFCA 1XHMA 4A09A 2CE9A 2Q7QA 4GGDA 2IAAA 3KRWB 4FWWA 4FA4D 3RRMC 1RI6A 1SQ9A 3IIYA 3JZNA 2AGZA 2PM9A 3C9CA 1U2VC 2J57G 3F3GA 3ODTA 3I89A 3PSLA 3UVNA 1PGUA 4ZOYA 3F3PA 3NVXA 4J82A 3IKOA 3OKWA 2H6NA 4X61B 3UKUC 3I8CA 3UVLA 3PSCB 2IUQA 2PBIB 3I7HA 3OKTA 5K19A 4XEIC 2PM7B 3BWSA 4AOWA 3CIKB 4LGNA 3EU7A 2I0SA 1JMZB 3NVQA 4BL0A 5C2VB 4E5ZB 3A0FA 3VH0A 1MDAH 4NSXA 2H6KA 5JWZA 3IJ1A 4IA9A 3SBRA 2YNNA 3AL8A 3E0CA 5HE0B 4J0XA 4A09B 3AFCA 1FWXA 5TDHB 3OKYB 1GP2B 5FA5B 3EI4A 3K26A 5FKSA 1L0QA 4PXWA 3I7KA 3I7NA 4Z8LA 4A11A 4GQ1A 2OK4A 5HE1B 3OTTA 4J86A 3L4OD 1JJUB 4ZOVA 1MG2A 4MK0B 5IC7A 1P22A 1XIPA 4FA5D 1NR0A 2AGXA 2YBAA 3FM0A 3RFHA 2AGLA 4L9OA 4L3GD 2YB8B 2TRCB 3UKRC 3OL2B 5B4WA 4J84A 2B5NA 3F3FA 4N14A 3J81g 4X60B 1N6FA 3SBPA 5FXYA 2HJ4A 1JOFA 2HYEA 4GM9A 4LG8A 3N0EA 3SCYA 3MMYA 2IWKA 3UVOA 5IJ7E 4J8BA 4A08A 3EI4B 4J81A 3V5WB 4E5ZA 5HE3B 4L3HD 3FGBA 3PE7A 2HJBA 4J87A 4PNKB 4HDJA 2B4EA 3V7DB 1GXRA 4EWRA 2IWFA 4CI3A 2B5LA 3SXTD 4JT6C 5H14A 5GXHA 3UVMA 4R7AB 3OKYA 4ERYA 4JT5C 1QNIA 2IURA 4L1QD 2CO0C 1YFQA 1OLZA 4J78A 4GZ8A 4J77A 2P9NC 1PEVA 3DM0A 3MKQA 4ERQA 1GOTB 4J73A 4BH6A 2Z2PA 4E54B 5GSAA 1R5MA 4CI8A 3RN0D 2XU7A 4JSXC 5CYKA 5EALA 5GMKn 4A08B 4K3JB 4GQ2P 3OL2A 4JSPC 2QC5A 3MXXA 3I8EA 4ZOXA 5CXBB 2OJYA 4O1QD 3AL9A 4QT8A 4CI1A 3W15A 4Y7RA 2MTAH 5EAPA 3SWSD 5I5IA 4JSNC 5AJAA 4PSXB 3CFSB 3MKSB 1PBYB 3ULEC 4X3EA 5EMJB 3MZLA 5H17A 2HKMA 5EARA 3EI3A 3IJ0A 4A0AA 5TEEA 3BG1A 4LG9A 4JSVC 1SQJA 2OIZA 4GM3A 1B9YA 5SXMA 3NVNA 4J0WA 4PSWB 5EAMA 5CYKB 3SJLD 1NEXB 3FRXA 4CZXA 4IMMA 3SMRA 1Q47A 5I5MA 3C99A 3ZWLB 2G9AA 1N6EA 4CI2A 4ZOZA 2IUPA 2H9NA 3J80g 4J79A 3JAMg 3RFGA 4E54A 3SN6B 3DXKC 2HESX 1N6DA 4FHLA 3JPXA 1S4UX 1PI6A 3SHFA 2XL2A 3RSEC 3MZKA 2P9PC 2Z2NA 4H5JA 2YMUA 2H68A 3N0DA 5IGQA 4CY1A 2CE8A 1MG3A 5C2WB 2GC7A 3EI3B 5CXBA 4D0KA 3IJCA 4A0AB 5I5JA 4PBZA 3DWLC 2I3SA 1SHYB 5FKTA 2GC4A 2P9KC 3UVKA 5A2Qg 4GQBB 3BG0A 5FKQA 1K32A 5HE2B 2CN2A 2HKRA 4ES0A 4CY2A 2XYIA 3C5MA 1TBGA 4A2MA 3RMZD 3SLED 3GREA 2QXVA 3I2NA 4A2LA 4XYIA 3VGZA 5HYNB 3EI1B 4QL1A 4I79A 2OVQB 4GGCA 4O45A 4FAVD 4JD2C 2I0RA 4ERZA 5FLXg 1VYHC 4CY5A 1U4CA 4GMBA 2OVRB 1K8KC 2HXCA 1TYQC 2CNXA 2PM6B 5KDOB 4J8GA 2XL3A 4ESGA 2EBSA 3SFZA 1B9XA 2W18A 4Y5RD 4K3ID 2BCJB 3UR4A 4FB1D 3VA6A 3AH8B 2AH1A 2P9SC 5HQGA 4U7AA 3JRPA 3PVUB 5EMMB 4FAND 4O3UB 2P9UC 2B5MA 1GG2B 4A0BB 4CZYA 3JZHA 5IJ8E 3PXTD 4BUJC 3K27A 5EMKB 2GNQA 2P9IC 3CFVA 3ORVD 5CXCA 4U1EI 4ZN4A 2J56H 2YNPA 2AGWA 4UI9R 4O3TB 3EG6A 3EI2A 2BBKH 2H3XA 1JMXB 4FA1D 3SVWD 5TEFA 1A0RB 2H9LA 3KRXB 2CO0A 5K1CC 3JROA 3OW8A 3IIWA 5EM2A 4X63B 2OK6A 4QQEA 2PM9B 3PVWB 4KFMB 3DSMA 4O9DA 4TZ4A 4YVDA 5EMLB 2OVPB 3EMHA 2O9KA 2H47A 3RN1D 4CC9A 4PC0A 2CN3A 1ERJA 2I3TA 3B7FA 4QRJA 2IUVA 3EI1A 2Z2OA 5IT9g 4A7JA 3JB9L 3U4YA 5AFU3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZG A;  3PXW D;  4GGA A;  5C9Z B;  3P4F A;  4H5I A;  3SBQ A;  3DXM C;  5GXI A;  2J55 H;  3V9F A;  3EWE A;  2YNO A;  4OWR A;  4FA9 D;  3I7P A;  5FQD A;  1OMW B;  5CXC B;  1XKS A;  5IGO A;  5AMS A;  2UZY B;  2H9M A;  3I7L A;  4G56 B;  2H14 A;  4XYH A;  4CZV A;  3EI2 B;  2P9L C;  3AL8 B;  4OZU A;  3HFQ A;  4PBY A;  5THA A;  2UZX B;  2H6Q A;  5H1M A;  3PXS D;  3I7O A;  2AH0 A;  2AGY A;  4A0B A;  5EM2 B;  4A11 B;  2AQ5 A;  3L4M D;  4CY3 A;  4JXM A;  5FKR A;  4AEZ A;  3C75 H;  4GM8 A;  2G99 A;  2H13 A;  3RLM D;  2H9P A;  5TF2 A;  4D6V A;  2I0T A;  3GFC A;  1XHM A;  4A09 A;  2CE9 A;  2Q7Q A;  4GGD A;  2IAA A;  3KRW B;  4FWW A;  4FA4 D;  3RRM C;  1RI6 A;  1SQ9 A;  3IIY A;  3JZN A;  2AGZ A;  2PM9 A;  3C9C A;  1U2V C;  2J57 G;  3F3G A;  3ODT A;  3I89 A;  3PSL A;  3UVN A;  1PGU A;  4ZOY A;  3F3P A;  3NVX A;  4J82 A;  3IKO A;  3OKW A;  2H6N A;  4X61 B;  3UKU C;  3I8C A;  3UVL A;  3PSC B;  2IUQ A;  2PBI B;  3I7H A;  3OKT A;  5K19 A;  4XEI C;  2PM7 B;  3BWS A;  4AOW A;  3CIK B;  4LGN A;  3EU7 A;  2I0S A;  1JMZ B;  3NVQ A;  4BL0 A;  5C2V B;  4E5Z B;  3A0F A;  3VH0 A;  1MDA H;  4NSX A;  2H6K A;  5JWZ A;  3IJ1 A;  4IA9 A;  3SBR A;  2YNN A;  3AL8 A;  3E0C A;  5HE0 B;  4J0X A;  4A09 B;  3AFC A;  1FWX A;  5TDH B;  3OKY B;  1GP2 B;  5FA5 B;  3EI4 A;  3K26 A;  5FKS A;  1L0Q A;  4PXW A;  3I7K A;  3I7N A;  4Z8L A;  4A11 A;  4GQ1 A;  2OK4 A;  5HE1 B;  3OTT A;  4J86 A;  3L4O D;  1JJU B;  4ZOV A;  1MG2 A;  4MK0 B;  5IC7 A;  1P22 A;  1XIP A;  4FA5 D;  1NR0 A;  2AGX A;  2YBA A;  3FM0 A;  3RFH A;  2AGL A;  4L9O A;  4L3G D;  2YB8 B;  2TRC B;  3UKR C;  3OL2 B;  5B4W A;  4J84 A;  2B5N A;  3F3F A;  4N14 A;  3J81 g;  4X60 B;  1N6F A;  3SBP A;  5FXY A;  2HJ4 A;  1JOF A;  2HYE A;  4GM9 A;  4LG8 A;  3N0E A;  3SCY A;  3MMY A;  2IWK A;  3UVO A;  5IJ7 E;  4J8B A;  4A08 A;  3EI4 B;  4J81 A;  3V5W B;  4E5Z A;  5HE3 B;  4L3H D;  3FGB A;  3PE7 A;  2HJB A;  4J87 A;  4PNK B;  4HDJ A;  2B4E A;  3V7D B;  1GXR A;  4EWR A;  2IWF A;  4CI3 A;  2B5L A;  3SXT D;  4JT6 C;  5H14 A;  5GXH A;  3UVM A;  4R7A B;  3OKY A;  4ERY A;  4JT5 C;  1QNI A;  2IUR A;  4L1Q D;  2CO0 C;  1YFQ A;  1OLZ A;  4J78 A;  4GZ8 A;  4J77 A;  2P9N C;  1PEV A;  3DM0 A;  3MKQ A;  4ERQ A;  1GOT B;  4J73 A;  4BH6 A;  2Z2P A;  4E54 B;  5GSA A;  1R5M A;  4CI8 A;  3RN0 D;  2XU7 A;  4JSX C;  5CYK A;  5EAL A;  5GMK n;  4A08 B;  4K3J B;  4GQ2 P;  3OL2 A;  4JSP C;  2QC5 A;  3MXX A;  3I8E A;  4ZOX A;  5CXB B;  2OJY A;  4O1Q D;  3AL9 A;  4QT8 A;  4CI1 A;  3W15 A;  4Y7R A;  2MTA H;  5EAP A;  3SWS D;  5I5I A;  4JSN C;  5AJA A;  4PSX B;  3CFS B;  3MKS B;  1PBY B;  3ULE C;  4X3E A;  5EMJ B;  3MZL A;  5H17 A;  2HKM A;  5EAR A;  3EI3 A;  3IJ0 A;  4A0A A;  5TEE A;  3BG1 A;  4LG9 A;  4JSV C;  1SQJ A;  2OIZ A;  4GM3 A;  1B9Y A;  5SXM A;  3NVN A;  4J0W A;  4PSW B;  5EAM A;  5CYK B;  3SJL D;  1NEX B;  3FRX A;  4CZX A;  4IMM A;  3SMR A;  1Q47 A;  5I5M A;  3C99 A;  3ZWL B;  2G9A A;  1N6E A;  4CI2 A;  4ZOZ A;  2IUP A;  2H9N A;  3J80 g;  4J79 A;  3JAM g;  3RFG A;  4E54 A;  3SN6 B;  3DXK C;  2HES X;  1N6D A;  4FHL A;  3JPX A;  1S4U X;  1PI6 A;  3SHF A;  2XL2 A;  3RSE C;  3MZK A;  2P9P C;  2Z2N A;  4H5J A;  2YMU A;  2H68 A;  3N0D A;  5IGQ A;  4CY1 A;  2CE8 A;  1MG3 A;  5C2W B;  2GC7 A;  3EI3 B;  5CXB A;  4D0K A;  3IJC A;  4A0A B;  5I5J A;  4PBZ A;  3DWL C;  2I3S A;  1SHY B;  5FKT A;  2GC4 A;  2P9K C;  3UVK A;  5A2Q g;  4GQB B;  3BG0 A;  5FKQ A;  1K32 A;  5HE2 B;  2CN2 A;  2HKR A;  4ES0 A;  4CY2 A;  2XYI A;  3C5M A;  1TBG A;  4A2M A;  3RMZ D;  3SLE D;  3GRE A;  2QXV A;  3I2N A;  4A2L A;  4XYI A;  3VGZ A;  5HYN B;  3EI1 B;  4QL1 A;  4I79 A;  2OVQ B;  4GGC A;  4O45 A;  4FAV D;  4JD2 C;  2I0R A;  4ERZ A;  5FLX g;  1VYH C;  4CY5 A;  1U4C A;  4GMB A;  2OVR B;  1K8K C;  2HXC A;  1TYQ C;  2CNX A;  2PM6 B;  5KDO B;  4J8G A;  2XL3 A;  4ESG A;  2EBS A;  3SFZ A;  1B9X A;  2W18 A;  4Y5R D;  4K3I D;  2BCJ B;  3UR4 A;  4FB1 D;  3VA6 A;  3AH8 B;  2AH1 A;  2P9S C;  5HQG A;  4U7A A;  3JRP A;  3PVU B;  5EMM B;  4FAN D;  4O3U B;  2P9U C;  2B5M A;  1GG2 B;  4A0B B;  4CZY A;  3JZH A;  5IJ8 E;  3PXT D;  4BUJ C;  3K27 A;  5EMK B;  2GNQ A;  2P9I C;  3CFV A;  3ORV D;  5CXC A;  4U1E I;  4ZN4 A;  2J56 H;  2YNP A;  2AGW A;  4UI9 R;  4O3T B;  3EG6 A;  3EI2 A;  2BBK H;  2H3X A;  1JMX B;  4FA1 D;  3SVW D;  5TEF A;  1A0R B;  2H9L A;  3KRX B;  2CO0 A;  5K1C C;  3JRO A;  3OW8 A;  3IIW A;  5EM2 A;  4X63 B;  2OK6 A;  4QQE A;  2PM9 B;  3PVW B;  4KFM B;  3DSM A;  4O9D A;  4TZ4 A;  4YVD A;  5EML B;  2OVP B;  3EMH A;  2O9K A;  2H47 A;  3RN1 D;  4CC9 A;  4PC0 A;  2CN3 A;  1ERJ A;  2I3T A;  3B7F A;  4QRJ A;  2IUV A;  3EI1 A;  2Z2O A;  5IT9 g;  4A7J A;  3JB9 L;  3U4Y A;  5AFU 3; 
#chains in the Genus database with same CATH topology
 2VDK A;  3V4V A;  3JZG A;  3PXW D;  4GGA A;  5C9Z B;  3P4F A;  4H5I A;  3SBQ A;  3DXM C;  4IRZ A;  4RE6 A;  5GXI A;  2J55 H;  3V9F A;  3EWE A;  2YNO A;  4OWR A;  4FA9 D;  5E6S A;  2BKL A;  3I7P A;  5FQD A;  1OMW B;  5CXC B;  5FFG A;  1XKS A;  5IGO A;  2EIB A;  5AMS A;  2UZY B;  2H9M A;  3I7L A;  4G56 B;  2EIC A;  2H14 A;  4XYH A;  2VDM A;  4MMZ A;  3ZE1 A;  4CZV A;  3EI2 B;  2P9L C;  3AL8 B;  4OZU A;  3HFQ A;  4PBY A;  5THA A;  2UZX B;  1UOQ A;  2H6Q A;  5FFO A;  5H1M A;  1TYE A;  3PXS D;  3I7O A;  3ZE2 A;  2AH0 A;  2AGY A;  4A0B A;  5EM2 B;  3MUN A;  1UOO A;  4BCB A;  4A11 B;  2AQ5 A;  3L4M D;  3O4I A;  4CY3 A;  3V4P A;  4JXM A;  5FKR A;  4AEZ A;  1C9L A;  3C75 H;  4GM8 A;  2G99 A;  2H13 A;  3RLM D;  2H9P A;  5TF2 A;  4D6V A;  2I0T A;  3GFC A;  4Z7O A;  1XHM A;  4WK0 A;  4A09 A;  2VZ1 A;  2CE9 A;  2Q7Q A;  4GGD A;  2IAA A;  3KRW B;  4FWW A;  2VDL A;  4FA4 D;  3RRM C;  1RI6 A;  1SQ9 A;  3IIY A;  3JZN A;  2AGZ A;  2PM9 A;  3C9C A;  1C9I A;  1U2V C;  2J57 G;  3F3G A;  4AX4 A;  3FCU A;  3ODT A;  3I89 A;  3PSL A;  4UM9 A;  3UVN A;  1PGU A;  3VI4 A;  4ZOY A;  3F3P A;  3NVX A;  3EQ7 A;  4J82 A;  3IKO A;  3OKW A;  2H6N A;  4X61 B;  3UKU C;  3I8C A;  3UVL A;  3PSC B;  2IUQ A;  5E6U A;  2PBI B;  3I7H A;  3OKT A;  5K19 A;  4XEI C;  2PM7 B;  3BWS A;  4AOW A;  3CIK B;  4LGN A;  3EU7 A;  2I0S A;  1JMZ B;  3NVQ A;  4BL0 A;  5C2V B;  4NEN A;  3A0F A;  4E5Z B;  3VH0 A;  1MDA H;  4NSX A;  2H6K A;  1H2X A;  3ZDX A;  5JWZ A;  4NC4 A;  3IJ1 A;  4IA9 A;  2EIE A;  3SBR A;  3ZDY A;  2YNN A;  3AL8 A;  3E0C A;  5HE0 B;  4J0X A;  4A09 B;  3AFC A;  1FWX A;  5TDH B;  3OKY B;  1GP2 B;  5FA5 B;  3EI4 A;  3K26 A;  5FKS A;  1E8M A;  3U4Y A;  1L0Q A;  3KCI A;  4PXW A;  3I7K A;  3I7N A;  4Z8L A;  4A11 A;  4GQ1 A;  2OK4 A;  5HE1 B;  3OTT A;  1GOF A;  4J86 A;  3L4O D;  1JJU B;  4ZOV A;  1MG2 A;  1T2X A;  4MK0 B;  5IC7 A;  1P22 A;  2VDP A;  1XIP A;  4FA5 D;  1NR0 A;  2AGX A;  1E5T A;  2YBA A;  3FM0 A;  3K72 A;  3RFH A;  2AGL A;  4L9O A;  4L3G D;  2YB8 B;  2TRC B;  5E6R A;  3UKR C;  3OL2 B;  5B4W A;  1BPO A;  2B5N A;  3EQ9 A;  4J84 A;  5M5T A;  3F3F A;  4N14 A;  3J81 g;  4X60 B;  1N6F A;  3SBP A;  5FXY A;  2HJ4 A;  1JOF A;  1H2W A;  1O6F A;  1UTC A;  2HYE A;  4GM9 A;  4L1M A;  4LG8 A;  3O4H A;  3N0E A;  3SCY A;  3NIF A;  3MMY A;  4DNU A;  2IWK A;  3UVO A;  5IJ7 E;  4J8B A;  4A08 A;  3EI4 B;  4J81 A;  3ZDZ A;  5M5R A;  4G1E A;  3V5W B;  3IUN A;  4E5Z A;  3T3P A;  2VDR A;  5HE3 B;  4L3H D;  3FGB A;  3NIG A;  3PE7 A;  2HJB A;  4J87 A;  4PNK B;  4HDJ A;  2B4E A;  3IUQ A;  3V7D B;  1GXR A;  4EWR A;  1VE7 A;  2IWF A;  1O6G A;  4CI3 A;  2B5L A;  2VDN A;  2QR5 A;  3SXT D;  4JT6 C;  2HU5 A;  5H14 A;  5GXH A;  3UVM A;  4R7A B;  3OKY A;  4ERY A;  4JT5 C;  1H2Y A;  1QNI A;  2IUR A;  4L1Q D;  2CO0 C;  1YFQ A;  5C86 A;  1OLZ A;  4J78 A;  1UOP A;  4GZ8 A;  4J77 A;  2P9N C;  1PEV A;  3DM0 A;  3MKQ A;  4ERQ A;  4O2W A;  1GOT B;  4J73 A;  4AMZ A;  4BH6 A;  2Z2P A;  4E54 B;  5GSA A;  3NID A;  1R5M A;  4CI8 A;  1E8N A;  2JKX A;  2XU7 A;  4JSX C;  3RN0 D;  5CYK A;  5C92 A;  5EAL A;  5GMK n;  2XZG A;  4A08 B;  4K3J B;  4MMX A;  4GQ2 P;  3OL2 A;  2QC5 A;  3MXX A;  1I2M B;  4JSP C;  1GOH A;  3I8E A;  4ZOX A;  5CXB B;  2OJY A;  1YR2 A;  3AL9 A;  2HU7 A;  4O1Q D;  4QT8 A;  4BCD A;  4CI1 A;  3W15 A;  4Y7R A;  4AN0 A;  2MTA H;  1JTD B;  4O02 A;  3MVD K;  4NAA A;  4DNW A;  5EAP A;  5M61 A;  4G55 A;  3SWS D;  4MMY A;  3IUJ A;  3ZE0 A;  3EQ8 A;  5I5I A;  4JSN C;  5AJA A;  4PSX B;  3CFS B;  2VZ3 A;  3MKS B;  3O4G A;  1PBY B;  3ULE C;  4X3E A;  5EMJ B;  3MZL A;  5H17 A;  2HKM A;  3K71 A;  5EAR A;  3EI3 A;  4Z7Q A;  3IJ0 A;  4A0A A;  5TEE A;  3IUM A;  3BG1 A;  4LG9 A;  4JSV C;  1SQJ A;  5M5U A;  3T3M A;  3IVM A;  2OIZ A;  2XDW A;  4GM3 A;  1B9Y A;  5SXM A;  3NVN A;  4J0W A;  4PSW B;  5EAM A;  5CYK B;  3SJL D;  1NEX B;  3FRX A;  4WJK A;  4JHN A;  4CZX A;  4IMM A;  4QAM A;  3K6S A;  3SMR A;  1Q47 A;  5I5M A;  4RE5 A;  3C99 A;  3ZWL B;  2G9A A;  1N6E A;  4CI2 A;  4ZOZ A;  2IUP A;  2H9N A;  3J80 g;  4J79 A;  3JAM g;  3RFG A;  4E54 A;  3SN6 B;  3DXK C;  2HES X;  3O4J A;  1N6D A;  4FHL A;  3JPX A;  1QFS A;  1S4U X;  1PI6 A;  3SHF A;  2XL2 A;  3RSE C;  3MZK A;  4NBM A;  1U8C A;  1JV2 A;  2P9P C;  4UM8 A;  3QI0 A;  2Z2N A;  4H5J A;  5M5S A;  2YMU A;  2H68 A;  3N0D A;  5IGQ A;  4CY1 A;  2CE8 A;  1MG3 A;  5C2W B;  2GC7 A;  4AN1 A;  3EI3 B;  3IUL A;  5CXB A;  4D0K A;  3IJC A;  4A0A B;  5I5J A;  4PBZ A;  1A12 A;  3DWL C;  2I3S A;  1SHY B;  5FKT A;  2GC4 A;  3GD1 I;  2P9K C;  5HDB A;  3UVK A;  5A2Q g;  4GQB B;  3BG0 A;  1VE6 A;  5FKQ A;  2HU8 A;  1K32 A;  5HE2 B;  2CN2 A;  2HKR A;  1GOG A;  4ES0 A;  4CY2 A;  1VZ3 A;  2XYI A;  3C5M A;  1TBG A;  4A2M A;  3RMZ D;  1M1X A;  3GRE A;  3SLE D;  3FCS A;  2QXV A;  3I2N A;  3VI3 A;  4A2L A;  4XYI A;  3VGZ A;  5HYN B;  3EI1 B;  4QL1 A;  4I79 A;  2OVQ B;  4GGC A;  4JHP C;  4O45 A;  2VDO A;  4G1M A;  4JD2 C;  4D9S A;  4FAV D;  2I0R A;  4ERZ A;  5FLX g;  1VYH C;  4CY5 A;  1U4C A;  4GMB A;  2OVR B;  1K8K C;  2HXC A;  1TYQ C;  2CNX A;  2PM6 B;  5KDO B;  4J8G A;  2XL3 A;  3GC3 B;  4ESG A;  2EBS A;  3SFZ A;  1B9X A;  2W18 A;  4Y5R D;  4K3I D;  3DDU A;  2BCJ B;  3UR4 A;  4FB1 D;  3VA6 A;  3AH8 B;  4BP9 A;  2AH1 A;  2P9S C;  5HQG A;  4U7A A;  3JRP A;  3PVU B;  5EMM B;  4FAN D;  2EID A;  3OF7 A;  4O3U B;  2P9U C;  3MUO A;  2B5M A;  1GG2 B;  4A0B B;  4CZY A;  3JZH A;  5IJ8 E;  4BP8 A;  3PXT D;  4BUJ C;  3K27 A;  3QHY B;  5EMK B;  1L5G A;  3IJE A;  2GNQ A;  2P9I C;  3CFV A;  3ORV D;  5CXC A;  4U1E I;  4ZN4 A;  2J56 H;  2YNP A;  2AGW A;  4UI9 R;  5M5V A;  3IUR A;  4O3T B;  3EG6 A;  2VC2 A;  2VDQ A;  3EI2 A;  1QFM A;  2BBK H;  2H3X A;  1K3I A;  1JMX B;  4FA1 D;  3SVW D;  1VZ2 A;  4WK2 A;  5TEF A;  1A0R B;  2H9L A;  3KRX B;  2CO0 A;  5K1C C;  2QZP A;  4WK4 A;  3JRO A;  3OW8 A;  3IIW A;  5EM2 A;  4X63 B;  2OK6 A;  4QQE A;  4Z7N A;  2PM9 B;  3PVW B;  4KFM B;  3DSM A;  4O9D A;  4TZ4 A;  2WQ8 A;  4YVD A;  5EML B;  2OVP B;  3EMH A;  2O9K A;  2H47 A;  3RN1 D;  4CC9 A;  4PC0 A;  1H2Z A;  2CN3 A;  1ERJ A;  2I3T A;  4DNV A;  3B7F A;  4QRJ A;  2IUV A;  3EI1 A;  2Z2O A;  5IT9 g;  4A7J A;  3JB9 L;  4AMY A;  4BCC A;  5AFU 3;  2XE4 A; 
#chains in the Genus database with same CATH homology
 3JZG A;  3PXW D;  4GGA A;  5C9Z B;  3P4F A;  4H5I A;  3SBQ A;  3DXM C;  5GXI A;  2J55 H;  3V9F A;  3EWE A;  2YNO A;  4OWR A;  4FA9 D;  3I7P A;  5FQD A;  1OMW B;  5CXC B;  1XKS A;  5IGO A;  5AMS A;  2UZY B;  2H9M A;  3I7L A;  4G56 B;  2H14 A;  4XYH A;  4CZV A;  3EI2 B;  2P9L C;  3AL8 B;  4OZU A;  3HFQ A;  4PBY A;  5THA A;  2UZX B;  2H6Q A;  5H1M A;  3PXS D;  3I7O A;  2AH0 A;  2AGY A;  4A0B A;  5EM2 B;  4A11 B;  2AQ5 A;  3L4M D;  4CY3 A;  4JXM A;  5FKR A;  4AEZ A;  3C75 H;  4GM8 A;  2G99 A;  2H13 A;  3RLM D;  2H9P A;  5TF2 A;  4D6V A;  2I0T A;  3GFC A;  1XHM A;  4A09 A;  2CE9 A;  2Q7Q A;  4GGD A;  2IAA A;  3KRW B;  4FWW A;  4FA4 D;  3RRM C;  1RI6 A;  1SQ9 A;  3IIY A;  3JZN A;  2AGZ A;  2PM9 A;  3C9C A;  1U2V C;  2J57 G;  3F3G A;  3ODT A;  3I89 A;  3PSL A;  3UVN A;  1PGU A;  4ZOY A;  3F3P A;  3NVX A;  4J82 A;  3IKO A;  3OKW A;  2H6N A;  4X61 B;  3UKU C;  3I8C A;  3UVL A;  3PSC B;  2IUQ A;  2PBI B;  3I7H A;  3OKT A;  5K19 A;  4XEI C;  2PM7 B;  3BWS A;  4AOW A;  3CIK B;  4LGN A;  3EU7 A;  2I0S A;  1JMZ B;  3NVQ A;  4BL0 A;  5C2V B;  4E5Z B;  3A0F A;  3VH0 A;  1MDA H;  4NSX A;  2H6K A;  5JWZ A;  3IJ1 A;  4IA9 A;  3SBR A;  2YNN A;  3AL8 A;  3E0C A;  5HE0 B;  4J0X A;  4A09 B;  3AFC A;  1FWX A;  5TDH B;  3OKY B;  1GP2 B;  5FA5 B;  3EI4 A;  3K26 A;  5FKS A;  1L0Q A;  4PXW A;  3I7K A;  3I7N A;  4Z8L A;  4A11 A;  4GQ1 A;  2OK4 A;  5HE1 B;  3OTT A;  4J86 A;  3L4O D;  1JJU B;  4ZOV A;  1MG2 A;  4MK0 B;  5IC7 A;  1P22 A;  1XIP A;  4FA5 D;  1NR0 A;  2AGX A;  2YBA A;  3FM0 A;  3RFH A;  2AGL A;  4L9O A;  4L3G D;  2YB8 B;  2TRC B;  3UKR C;  3OL2 B;  5B4W A;  4J84 A;  2B5N A;  3F3F A;  4N14 A;  3J81 g;  4X60 B;  1N6F A;  3SBP A;  5FXY A;  2HJ4 A;  1JOF A;  2HYE A;  4GM9 A;  4LG8 A;  3N0E A;  3SCY A;  3MMY A;  2IWK A;  3UVO A;  5IJ7 E;  4J8B A;  4A08 A;  3EI4 B;  4J81 A;  3V5W B;  4E5Z A;  5HE3 B;  4L3H D;  3FGB A;  3PE7 A;  2HJB A;  4J87 A;  4PNK B;  4HDJ A;  2B4E A;  3V7D B;  1GXR A;  4EWR A;  2IWF A;  4CI3 A;  2B5L A;  3SXT D;  4JT6 C;  5H14 A;  5GXH A;  3UVM A;  4R7A B;  3OKY A;  4ERY A;  4JT5 C;  1QNI A;  2IUR A;  4L1Q D;  2CO0 C;  1YFQ A;  1OLZ A;  4J78 A;  4GZ8 A;  4J77 A;  2P9N C;  1PEV A;  3DM0 A;  3MKQ A;  4ERQ A;  1GOT B;  4J73 A;  4BH6 A;  2Z2P A;  4E54 B;  5GSA A;  1R5M A;  4CI8 A;  3RN0 D;  2XU7 A;  4JSX C;  5CYK A;  5EAL A;  5GMK n;  4A08 B;  4K3J B;  4GQ2 P;  3OL2 A;  4JSP C;  2QC5 A;  3MXX A;  3I8E A;  4ZOX A;  5CXB B;  2OJY A;  4O1Q D;  3AL9 A;  4QT8 A;  4CI1 A;  3W15 A;  4Y7R A;  2MTA H;  5EAP A;  3SWS D;  5I5I A;  4JSN C;  5AJA A;  4PSX B;  3CFS B;  3MKS B;  1PBY B;  3ULE C;  4X3E A;  5EMJ B;  3MZL A;  5H17 A;  2HKM A;  5EAR A;  3EI3 A;  3IJ0 A;  4A0A A;  5TEE A;  3BG1 A;  4LG9 A;  4JSV C;  1SQJ A;  2OIZ A;  4GM3 A;  1B9Y A;  5SXM A;  3NVN A;  4J0W A;  4PSW B;  5EAM A;  5CYK B;  3SJL D;  1NEX B;  3FRX A;  4CZX A;  4IMM A;  3SMR A;  1Q47 A;  5I5M A;  3C99 A;  3ZWL B;  2G9A A;  1N6E A;  4CI2 A;  4ZOZ A;  2IUP A;  2H9N A;  3J80 g;  4J79 A;  3JAM g;  3RFG A;  4E54 A;  3SN6 B;  3DXK C;  2HES X;  1N6D A;  4FHL A;  3JPX A;  1S4U X;  1PI6 A;  3SHF A;  2XL2 A;  3RSE C;  3MZK A;  2P9P C;  2Z2N A;  4H5J A;  2YMU A;  2H68 A;  3N0D A;  5IGQ A;  4CY1 A;  2CE8 A;  1MG3 A;  5C2W B;  2GC7 A;  3EI3 B;  5CXB A;  4D0K A;  3IJC A;  4A0A B;  5I5J A;  4PBZ A;  3DWL C;  2I3S A;  1SHY B;  5FKT A;  2GC4 A;  2P9K C;  3UVK A;  5A2Q g;  4GQB B;  3BG0 A;  5FKQ A;  1K32 A;  5HE2 B;  2CN2 A;  2HKR A;  4ES0 A;  4CY2 A;  2XYI A;  3C5M A;  1TBG A;  4A2M A;  3RMZ D;  3SLE D;  3GRE A;  2QXV A;  3I2N A;  4A2L A;  4XYI A;  3VGZ A;  5HYN B;  3EI1 B;  4QL1 A;  4I79 A;  2OVQ B;  4GGC A;  4O45 A;  4FAV D;  4JD2 C;  2I0R A;  4ERZ A;  5FLX g;  1VYH C;  4CY5 A;  1U4C A;  4GMB A;  2OVR B;  1K8K C;  2HXC A;  1TYQ C;  2CNX A;  2PM6 B;  5KDO B;  4J8G A;  2XL3 A;  4ESG A;  2EBS A;  3SFZ A;  1B9X A;  2W18 A;  4Y5R D;  4K3I D;  2BCJ B;  3UR4 A;  4FB1 D;  3VA6 A;  3AH8 B;  2AH1 A;  2P9S C;  5HQG A;  4U7A A;  3JRP A;  3PVU B;  5EMM B;  4FAN D;  4O3U B;  2P9U C;  2B5M A;  1GG2 B;  4A0B B;  4CZY A;  3JZH A;  5IJ8 E;  3PXT D;  4BUJ C;  3K27 A;  5EMK B;  2GNQ A;  2P9I C;  3CFV A;  3ORV D;  5CXC A;  4U1E I;  4ZN4 A;  2J56 H;  2YNP A;  2AGW A;  4UI9 R;  4O3T B;  3EG6 A;  3EI2 A;  2BBK H;  2H3X A;  1JMX B;  4FA1 D;  3SVW D;  5TEF A;  1A0R B;  2H9L A;  3KRX B;  2CO0 A;  5K1C C;  3JRO A;  3OW8 A;  3IIW A;  5EM2 A;  4X63 B;  2OK6 A;  4QQE A;  2PM9 B;  3PVW B;  4KFM B;  3DSM A;  4O9D A;  4TZ4 A;  4YVD A;  5EML B;  2OVP B;  3EMH A;  2O9K A;  2H47 A;  3RN1 D;  4CC9 A;  4PC0 A;  2CN3 A;  1ERJ A;  2I3T A;  3B7F A;  4QRJ A;  2IUV A;  3EI1 A;  2Z2O A;  5IT9 g;  4A7J A;  3JB9 L;  3U4Y A;  5AFU 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...