3RN0D

Crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn0D00
3PVWB 2IUQA 3OKYA 3MKQA 3DM0A 1N6EA 3EG6A 4QT8A 2EBSA 3OKYB 2UZXB 4JSNC 3UVLA 2H6KA 4A11B 3J81g 5AFU3 4K3JB 5TF2A 3FM0A 5HE0B 4PBZA 2AGLA 2PM7B 3AH8B 5CYKA 3E0CA 4A0BA 4IMMA 5FKQA 3NVXA 4GQ2P 4QL1A 3ULEC 5EM2A 3SWSD 2Z2PA 2I0SA 3PSCB 4Z8LA 5EMJB 2H9LA 4L9OA 4ERQA 2H68A 4A0BB 4A09B 4LG9A 1GOTB 3OKWA 1PBYB 2B5NA 5IT9g 4O1QD 5EARA 3V5WB 4Y7RA 1GP2B 3J80g 4IA9A 5TEFA 3KRXB 3PSLA 3SN6B 4FAND 1MG3A 2OJYA 3FRXA 4GM8A 2OIZA 3MMYA 3C9CA 3PXTD 3I7KA 2W18A 5GMKn 4GM3A 3JPXA 2P9IC 3SBRA 3BG0A 3I7HA 5FQDA 3W15A 4L3HD 4JSPC 2HJBA 2IWKA 2PM9B 3UVOA 1OMWB 3RFGA 2J56H 3DWLC 4QQEA 3UVMA 3B7FA 2P9NC 4GM9A 3CFVA 4AOWA 4D6VA 5B4WA 3K27A 4FA4D 2IUPA 4JD2C 2CNXA 4E54A 3IJ0A 2H13A 2YBAA 4TZ4A 5HE1B 3SBQA 4FA5D 1JJUB 1PGUA 3RSEC 3GREA 3F3FA 4Y5RD 4E54B 3U4YA 5IC7A 4CC9A 3DSMA 5FKTA 4CZVA 3SHFA 3UR4A 3EI4B 3MZKA 2AGWA 2P9UC 2H9NA 5C2VB 1SQ9A 3IIYA 4PSXB 3JROA 5C2WB 5CXCB 1NEXB 2PM6B 1ERJA 4J0WA 3VGZA 2XYIA 4CI8A 4AEZA 1QNIA 4A2LA 2MTAH 4J87A 2J57G 3IIWA 3JRPA 3L4OD 5AMSA 4OZUA 3C75H 4PNKB 2OVPB 4CI3A 3EI2A 1RI6A 4PC0A 4ERYA 2G9AA 2IAAA 1N6DA 2I0TA 4J8BA 3V7DB 4J81A 4JT5C 5EAPA 3I7OA 4A0AA 2H47A 4CI2A 1S4UX 2QXVA 1MG2A 3EI2B 2G99A 3UKRC 4O3UB 1TYQC 4LGNA 2XU7A 4J86A 4GQ1A 5CYKB 2Q7QA 2HYEA 5EM2B 3I8CA 4GMBA 2YMUA 1GG2B 2O9KA 3I89A 3RFHA 4O45A 3AL8A 4GGAA 2P9LC 3OL2A 2HXCA 4G56B 3I7NA 3EU7A 4OWRA 2H9MA 5TDHB 3SXTD 3EWEA 4D0KA 3SBPA 5HYNB 1B9XA 3AL8B 4HDJA 1NR0A 4CY1A 4H5JA 3KRWB 3OL2B 4GQBB 4FA9D 5EALA 5SXMA 1PI6A 3ORVD 4X61B 3SFZA 2CN2A 3I8EA 2AQ5A 4J78A 3MXXA 2CN3A 4XYHA 2I0RA 1PEVA 5IGQA 2Z2OA 3DXMC 5KDOB 2OVRB 3I7LA 5FKSA 4MK0B 2H6NA 3EMHA 5HE3B 2I3SA 1GXRA 2H9PA 2IURA 4A2MA 1XHMA 2Z2NA 4ES0A 5FA5B 3SJLD 4JXMA 1N6FA 1FWXA 3C99A 2AGYA 4CI1A 4JT6C 2CE8A 4CZYA 4J0XA 5H1MA 4FAVD 5FLXg 3JAMg 4X63B 2HKMA 3BWSA 3I7PA 4CZXA 1VYHC 4U1EI 4XYIA 3C5MA 1L0QA 4GGDA 4X60B 3F3PA 5H14A 4CY5A 2B5LA 2BCJB 2XL2A 4ZOYA 4E5ZA 3OKTA 4J73A 5I5IA 2UZYB 5CXBA 3RN0D 4NSXA 1K32A 3PXWD 1XKSA 2GC7A 2H3XA 5H17A 2BBKH 4H5IA 4CY2A 2H14A 4ZOVA 2B5MA 3UKUC 3HFQA 1JMXB 1U4CA 3BG1A 1SQJA 3N0DA 4GZ8A 3NVQA 3AL9A 5A2Qg 5EMMB 4L1QD 3NVNA 3VH0A 2OK6A 1JMZB 4CY3A 4FHLA 3OW8A 5EMKB 5TEEA 4JSVC 4BL0A 4J79A 2QC5A 3K26A 3UVKA 5GSAA 2GC4A 3RRMC 4O3TB 5GXHA 2CO0C 3RN1D 5I5MA 4A08A 1A0RB 3CIKB 3SLED 4A11A 2TRCB 4L3GD 2OVQB 1XIPA 1Q47A 2IUVA 3AFCA 1YFQA 3PVUB 4A08B 4YVDA 5IJ8E 3RLMD 4FA1D 3JB9L 5HQGA 3L4MD 4A0AB 4UI9R 1U2VC 4U7AA 5IJ7E 2I3TA 4ERZA 4ESGA 2B4EA 3DXKC 1K8KC 2XL3A 5JWZA 4A09A 3I2NA 2CO0A 4ZN4A 4J77A 2YNOA 4LG8A 3PXSD 1SHYB 2HJ4A 3OTTA 4R7AB 5FKRA 4KFMB 3SMRA 3IKOA 4QRJA 2CE9A 3JZNA 4BH6A 5I5JA 2J55H 2HESX 4K3ID 1JOFA 4FWWA 2AGXA 4ZOXA 5EMLB 5HE2B 3RMZD 4J8GA 1OLZA 3MKSB 4J84A 3SVWD 2PM9A 2P9PC 2P9SC 3P4FA 5IGOA 4PSWB 2IWFA 4ZOZA 4N14A 1MDAH 1P22A 4PBYA 3JZGA 5EAMA 3EI3A 1TBGA 4EWRA 2AH0A 3MZLA 4O9DA 3ODTA 5C9ZB 5K19A 4XEIC 3F3GA 2OK4A 3EI3B 2YNPA 3EI1A 4I79A 5K1CC 3N0EA 4J82A 3A0FA 4PXWA 3JZHA 2H6QA 5GXIA 3VA6A 1R5MA 3V9FA 3EI1B 3EI4A 2HKRA 4A7JA 4E5ZB 5THAA 2P9KC 2PBIB 3GFCA 4X3EA 4FB1D 2AGZA 5CXBB 3CFSB 3IJCA 3FGBA 2GNQA 5AJAA 2AH1A 3UVNA 5CXCA 1B9YA 4JSXC 4GGCA 5FXYA 3ZWLB 3IJ1A 3SCYA 4BUJC 2YNNA 2YB8B 3PE7A
chains in the Genus database with same CATH superfamily
3PVWB 2IUQA 3OKYA 3EQ8A 4JHNA 3MKQA 3DM0A 5FFOA 1N6EA 3EG6A 4QT8A 2EBSA 3OKYB 2UZXB 4JSNC 3UVLA 2H6KA 4NBMA 4RE5A 4A11B 1H2XA 3J81g 5AFU3 4K3JB 5TF2A 3FM0A 5HE0B 5FFGA 4PBZA 2AGLA 2PM7B 3AH8B 4NC4A 2VDRA 5CYKA 3E0CA 4A0BA 4IMMA 5FKQA 3NVXA 4GQ2P 4QL1A 3ULEC 5EM2A 4BP8A 2EIEA 3SWSD 2Z2PA 1O6FA 1UOQA 3KCIA 2I0SA 3PSCB 4Z8LA 5EMJB 2H9LA 4L9OA 4ERQA 5HDBA 2H68A 4A0BB 3ZDYA 4A09B 4LG9A 1GOTB 3OKWA 1PBYB 2B5NA 5IT9g 4O1QD 5EARA 3MUNA 3V5WB 4Y7RA 1GP2B 3J80g 4IA9A 5TEFA 3KRXB 3PSLA 4Z7QA 4AN0A 3SN6B 4FAND 1MG3A 2OJYA 4AMZA 4BCCA 4WK4A 3FRXA 4GM8A 2OIZA 3MMYA 4IRZA 3C9CA 3PXTD 3I7KA 2W18A 3IULA 5GMKn 4GM3A 3JPXA 2P9IC 5E6SA 3SBRA 3BG0A 3I7HA 1YR2A 4WK0A 5FQDA 4UM9A 3W15A 5E6UA 4L3HD 4G1MA 1VZ3A 2HJBA 2IWKA 4JSPC 2PM9B 3UVOA 1OMWB 3RFGA 2VDNA 2J56H 3DWLC 4QQEA 1VZ2A 3UVMA 3B7FA 4BCDA 4BCBA 2P9NC 4GM9A 1E5TA 3CFVA 2XZGA 4AOWA 1O6GA 4D6VA 5B4WA 3K27A 2XDWA 4FA4D 2IUPA 4JD2C 2CNXA 4E54A 4UM8A 3IJ0A 2H13A 3QHYB 3K71A 2YBAA 4TZ4A 5HE1B 3K72A 3SBQA 1BPOA 4FA5D 1JJUB 1PGUA 3RSEC 3GREA 3F3FA 4Y5RD 4E54B 3U4YA 5IC7A 4CC9A 3DSMA 5FKTA 4CZVA 3SHFA 3UR4A 1H2YA 4AN1A 3IUMA 3EI4B 3MZKA 1UOOA 2AGWA 3IVMA 2P9UC 2H9NA 5C2VB 1SQ9A 3IIYA 4PSXB 3JROA 3ZDZA 5C2WB 5CXCB 1NEXB 2PM6B 1ERJA 4J0WA 2HU5A 2VZ3A 4MMZA 3ZE0A 3VGZA 2VDKA 2XYIA 3O4HA 4AEZA 4CI8A 1I2MB 1QNIA 1UOPA 4A2LA 3QI0A 5M5RA 2MTAH 4J87A 2J57G 3IIWA 3JRPA 3L4OD 1GOGA 1M1XA 4OZUA 5AMSA 1VE7A 3C75H 4WJKA 4PNKB 2OVPB 4CI3A 3EI2A 1RI6A 4PC0A 4ERYA 2G9AA 2IAAA 1N6DA 2I0TA 4DNVA 4J8BA 3V7DB 4J81A 4JT5C 5EAPA 3I7OA 4A0AA 2XE4A 2H47A 4CI2A 3T3PA 3IUJA 1S4UX 2QXVA 1MG2A 3EI2B 2G99A 3UKRC 1H2WA 1TYQC 4LGNA 4O3UB 2XU7A 3GD1I 1K3IA 4J86A 4GQ1A 5CYKB 4BP9A 2Q7QA 3GC3B 2HYEA 4Z7NA 5EM2B 3I8CA 4GMBA 2YMUA 1GG2B 2O9KA 3I89A 3ZE1A 3RFHA 4O45A 3AL8A 1E8MA 4AMYA 4GGAA 1TYEA 2P9LC 3OL2A 2HXCA 2VDMA 4G56B 3I7NA 3EU7A 4OWRA 2H9MA 5TDHB 3SXTD 3EWEA 4D0KA 3IUNA 3SBPA 3OF7A 4NAAA 5HYNB 1B9XA 3AL8B 4HDJA 1NR0A 2VDLA 4CY1A 1VE6A 4H5JA 3KRWB 3OL2B 4GQBB 4FA9D 5EALA 2EIBA 5SXMA 1PI6A 3ORVD 4X61B 3SFZA 2CN2A 3I8EA 1H2ZA 2AQ5A 5E6RA 4J78A 3MXXA 2CN3A 4XYHA 2I0RA 1PEVA 5IGQA 2Z2OA 3DXMC 5KDOB 2OVRB 3I7LA 5FKSA 4MK0B 2H6NA 3EMHA 5HE3B 2I3SA 1GXRA 2H9PA 5M5SA 2IURA 4A2MA 1XHMA 2Z2NA 4ES0A 5FA5B 3SJLD 4JXMA 2WQ8A 1N6FA 1FWXA 3C99A 2BKLA 5C92A 2AGYA 3IJEA 4CI1A 4JT6C 2CE8A 4CZYA 4J0XA 5H1MA 4FAVD 4Z7OA 5FLXg 5M5TA 3JAMg 4X63B 2HKMA 3BWSA 3I7PA 4CZXA 1VYHC 4U1EI 4XYIA 1GOHA 3C5MA 1L0QA 4GGDA 4X60B 3F3PA 5H14A 4CY5A 2B5LA 3EQ9A 4NENA 2BCJB 2XL2A 4ZOYA 4E5ZA 3OKTA 4J73A 5I5IA 2UZYB 5CXBA 3RN0D 1C9LA 1K32A 3PXWD 4NSXA 1XKSA 2GC7A 2H3XA 3IURA 1UTCA 5H17A 4G55A 2BBKH 4RE6A 4H5IA 4QAMA 1JV2A 4MMXA 4CY2A 2H14A 4ZOVA 2B5MA 3UKUC 3HFQA 3ZDXA 1JMXB 1U4CA 4AX4A 3BG1A 1SQJA 3N0DA 4GZ8A 3NVQA 3AL9A 5A2Qg 5EMMB 4L1QD 3NVNA 3VH0A 2OK6A 1JTDB 1JMZB 4CY3A 4FHLA 1C9IA 1GOFA 3OW8A 5EMKB 5TEEA 4JSVC 4BL0A 4J79A 2QC5A 3K26A 3UVKA 5GSAA 2GC4A 3RRMC 4O3TB 4O02A 2QR5A 5GXHA 2CO0C 3RN1D 5I5MA 1QFMA 4A08A 3NIGA 1A0RB 4JHPC 3CIKB 3SLED 4A11A 3MVDK 3ZE2A 2TRCB 4L3GD 2OVQB 1XIPA 1Q47A 4DNUA 3NIFA 2IUVA 3EQ7A 3AFCA 1YFQA 3PVUB 4A08B 4YVDA 5IJ8E 3RLMD 4FA1D 3JB9L 5HQGA 3L4MD 4A0AB 4UI9R 1U2VC 4U7AA 5IJ7E 2I3TA 4ERZA 4ESGA 5M61A 2B4EA 3DXKC 1K8KC 3V4VA 2XL3A 5JWZA 4A09A 3I2NA 4L1MA 3NIDA 2CO0A 3FCSA 4ZN4A 4J77A 2EICA 2YNOA 1E8NA 3MUOA 4DNWA 4LG8A 3PXSD 1SHYB 2HJ4A 5M5VA 3OTTA 4R7AB 5FKRA 4KFMB 3SMRA 3IKOA 2VDQA 4QRJA 2CE9A 3JZNA 3VI3A 4BH6A 5I5JA 2JKXA 2J55H 2HESX 4K3ID 1JOFA 5C86A 4FWWA 4WK2A 2AGXA 4ZOXA 5EMLB 2VDOA 5HE2B 4MMYA 3RMZD 4J8GA 1L5GA 3O4GA 1OLZA 3MKSB 4J84A 3SVWD 2PM9A 4O2WA 2P9PC 2P9SC 3P4FA 3T3MA 5IGOA 4PSWB 2IWFA 4ZOZA 4N14A 1MDAH 1P22A 4PBYA 1A12A 5M5UA 4G1EA 3JZGA 5EAMA 3EI3A 1TBGA 3FCUA 3DDUA 4EWRA 2AH0A 3MZLA 4O9DA 3ODTA 4D9SA 5C9ZB 5K19A 4XEIC 3F3GA 2QZPA 2OK4A 3EI3B 3V4PA 2YNPA 3EI1A 3K6SA 4I79A 5K1CC 2VZ1A 3N0EA 4J82A 3A0FA 4PXWA 3JZHA 2H6QA 5GXIA 3VA6A 3O4JA 1T2XA 3O4IA 1R5MA 3V9FA 3EI1B 2VC2A 3EI4A 2HKRA 3VI4A 4A7JA 4E5ZB 2EIDA 5THAA 2P9KC 2PBIB 3GFCA 4X3EA 4FB1D 2AGZA 5CXBB 3CFSB 1QFSA 3IJCA 1U8CA 2GNQA 3FGBA 2AH1A 3IUQA 5AJAA 3UVNA 5CXCA 1B9YA 4JSXC 4GGCA 2VDPA 5FXYA 2HU8A 3ZWLB 3IJ1A 3SCYA 4BUJC 2YNNA 2YB8B 3PE7A 2HU7A
chains in the Genus database with same CATH topology
3PVWB 2IUQA 3OKYA 3MKQA 3DM0A 1N6EA 3EG6A 4QT8A 2EBSA 3OKYB 2UZXB 4JSNC 3UVLA 2H6KA 4A11B 3J81g 5AFU3 4K3JB 5TF2A 3FM0A 5HE0B 4PBZA 2AGLA 2PM7B 3AH8B 5CYKA 3E0CA 4A0BA 4IMMA 5FKQA 3NVXA 4GQ2P 4QL1A 3ULEC 5EM2A 3SWSD 2Z2PA 2I0SA 3PSCB 4Z8LA 5EMJB 2H9LA 4L9OA 4ERQA 2H68A 4A0BB 4A09B 4LG9A 1GOTB 3OKWA 1PBYB 2B5NA 5IT9g 4O1QD 5EARA 3V5WB 4Y7RA 1GP2B 3J80g 4IA9A 5TEFA 3KRXB 3PSLA 3SN6B 4FAND 1MG3A 2OJYA 3FRXA 4GM8A 2OIZA 3MMYA 3C9CA 3PXTD 3I7KA 2W18A 5GMKn 4GM3A 3JPXA 2P9IC 3SBRA 3BG0A 3I7HA 5FQDA 3W15A 4L3HD 4JSPC 2HJBA 2IWKA 2PM9B 3UVOA 1OMWB 3RFGA 2J56H 3DWLC 4QQEA 3UVMA 3B7FA 2P9NC 4GM9A 3CFVA 4AOWA 4D6VA 5B4WA 3K27A 4FA4D 2IUPA 4JD2C 2CNXA 4E54A 3IJ0A 2H13A 2YBAA 4TZ4A 5HE1B 3SBQA 4FA5D 1JJUB 1PGUA 3RSEC 3GREA 3F3FA 4Y5RD 4E54B 3U4YA 5IC7A 4CC9A 3DSMA 5FKTA 4CZVA 3SHFA 3UR4A 3EI4B 3MZKA 2AGWA 2P9UC 2H9NA 5C2VB 1SQ9A 3IIYA 4PSXB 3JROA 5C2WB 5CXCB 1NEXB 2PM6B 1ERJA 4J0WA 3VGZA 2XYIA 4CI8A 4AEZA 1QNIA 4A2LA 2MTAH 4J87A 2J57G 3IIWA 3JRPA 3L4OD 5AMSA 4OZUA 3C75H 4PNKB 2OVPB 4CI3A 3EI2A 1RI6A 4PC0A 4ERYA 2G9AA 2IAAA 1N6DA 2I0TA 4J8BA 3V7DB 4J81A 4JT5C 5EAPA 3I7OA 4A0AA 2H47A 4CI2A 1S4UX 2QXVA 1MG2A 3EI2B 2G99A 3UKRC 4O3UB 1TYQC 4LGNA 2XU7A 4J86A 4GQ1A 5CYKB 2Q7QA 2HYEA 5EM2B 3I8CA 4GMBA 2YMUA 1GG2B 2O9KA 3I89A 3RFHA 4O45A 3AL8A 4GGAA 2P9LC 3OL2A 2HXCA 4G56B 3I7NA 3EU7A 4OWRA 2H9MA 5TDHB 3SXTD 3EWEA 4D0KA 3SBPA 5HYNB 1B9XA 3AL8B 4HDJA 1NR0A 4CY1A 4H5JA 3KRWB 3OL2B 4GQBB 4FA9D 5EALA 5SXMA 1PI6A 3ORVD 4X61B 3SFZA 2CN2A 3I8EA 2AQ5A 4J78A 3MXXA 2CN3A 4XYHA 2I0RA 1PEVA 5IGQA 2Z2OA 3DXMC 5KDOB 2OVRB 3I7LA 5FKSA 4MK0B 2H6NA 3EMHA 5HE3B 2I3SA 1GXRA 2H9PA 2IURA 4A2MA 1XHMA 2Z2NA 4ES0A 5FA5B 3SJLD 4JXMA 1N6FA 1FWXA 3C99A 2AGYA 4CI1A 4JT6C 2CE8A 4CZYA 4J0XA 5H1MA 4FAVD 5FLXg 3JAMg 4X63B 2HKMA 3BWSA 3I7PA 4CZXA 1VYHC 4U1EI 4XYIA 3C5MA 1L0QA 4GGDA 4X60B 3F3PA 5H14A 4CY5A 2B5LA 2BCJB 2XL2A 4ZOYA 4E5ZA 3OKTA 4J73A 5I5IA 2UZYB 5CXBA 3RN0D 4NSXA 1K32A 3PXWD 1XKSA 2GC7A 2H3XA 5H17A 2BBKH 4H5IA 4CY2A 2H14A 4ZOVA 2B5MA 3UKUC 3HFQA 1JMXB 1U4CA 3BG1A 1SQJA 3N0DA 4GZ8A 3NVQA 3AL9A 5A2Qg 5EMMB 4L1QD 3NVNA 3VH0A 2OK6A 1JMZB 4CY3A 4FHLA 3OW8A 5EMKB 5TEEA 4JSVC 4BL0A 4J79A 2QC5A 3K26A 3UVKA 5GSAA 2GC4A 3RRMC 4O3TB 5GXHA 2CO0C 3RN1D 5I5MA 4A08A 1A0RB 3CIKB 3SLED 4A11A 2TRCB 4L3GD 2OVQB 1XIPA 1Q47A 2IUVA 3AFCA 1YFQA 3PVUB 4A08B 4YVDA 5IJ8E 3RLMD 4FA1D 3JB9L 5HQGA 3L4MD 4A0AB 4UI9R 1U2VC 4U7AA 5IJ7E 2I3TA 4ERZA 4ESGA 2B4EA 3DXKC 1K8KC 2XL3A 5JWZA 4A09A 3I2NA 2CO0A 4ZN4A 4J77A 2YNOA 4LG8A 3PXSD 1SHYB 2HJ4A 3OTTA 4R7AB 5FKRA 4KFMB 3SMRA 3IKOA 4QRJA 2CE9A 3JZNA 4BH6A 5I5JA 2J55H 2HESX 4K3ID 1JOFA 4FWWA 2AGXA 4ZOXA 5EMLB 5HE2B 3RMZD 4J8GA 1OLZA 3MKSB 4J84A 3SVWD 2PM9A 2P9PC 2P9SC 3P4FA 5IGOA 4PSWB 2IWFA 4ZOZA 4N14A 1MDAH 1P22A 4PBYA 3JZGA 5EAMA 3EI3A 1TBGA 4EWRA 2AH0A 3MZLA 4O9DA 3ODTA 5C9ZB 5K19A 4XEIC 3F3GA 2OK4A 3EI3B 2YNPA 3EI1A 4I79A 5K1CC 3N0EA 4J82A 3A0FA 4PXWA 3JZHA 2H6QA 5GXIA 3VA6A 1R5MA 3V9FA 3EI1B 3EI4A 2HKRA 4A7JA 4E5ZB 5THAA 2P9KC 2PBIB 3GFCA 4X3EA 4FB1D 2AGZA 5CXBB 3CFSB 3IJCA 3FGBA 2GNQA 5AJAA 2AH1A 3UVNA 5CXCA 1B9YA 4JSXC 4GGCA 5FXYA 3ZWLB 3IJ1A 3SCYA 4BUJC 2YNNA 2YB8B 3PE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVW B;  2IUQ A;  3OKY A;  3MKQ A;  3DM0 A;  1N6E A;  3EG6 A;  4QT8 A;  2EBS A;  3OKY B;  2UZX B;  4JSN C;  3UVL A;  2H6K A;  4A11 B;  3J81 g;  5AFU 3;  4K3J B;  5TF2 A;  3FM0 A;  5HE0 B;  4PBZ A;  2AGL A;  2PM7 B;  3AH8 B;  5CYK A;  3E0C A;  4A0B A;  4IMM A;  5FKQ A;  3NVX A;  4GQ2 P;  4QL1 A;  3ULE C;  5EM2 A;  3SWS D;  2Z2P A;  2I0S A;  3PSC B;  4Z8L A;  5EMJ B;  2H9L A;  4L9O A;  4ERQ A;  2H68 A;  4A0B B;  4A09 B;  4LG9 A;  1GOT B;  3OKW A;  1PBY B;  2B5N A;  5IT9 g;  4O1Q D;  5EAR A;  3V5W B;  4Y7R A;  1GP2 B;  3J80 g;  4IA9 A;  5TEF A;  3KRX B;  3PSL A;  3SN6 B;  4FAN D;  1MG3 A;  2OJY A;  3FRX A;  4GM8 A;  2OIZ A;  3MMY A;  3C9C A;  3PXT D;  3I7K A;  2W18 A;  5GMK n;  4GM3 A;  3JPX A;  2P9I C;  3SBR A;  3BG0 A;  3I7H A;  5FQD A;  3W15 A;  4L3H D;  4JSP C;  2HJB A;  2IWK A;  2PM9 B;  3UVO A;  1OMW B;  3RFG A;  2J56 H;  3DWL C;  4QQE A;  3UVM A;  3B7F A;  2P9N C;  4GM9 A;  3CFV A;  4AOW A;  4D6V A;  5B4W A;  3K27 A;  4FA4 D;  2IUP A;  4JD2 C;  2CNX A;  4E54 A;  3IJ0 A;  2H13 A;  2YBA A;  4TZ4 A;  5HE1 B;  3SBQ A;  4FA5 D;  1JJU B;  1PGU A;  3RSE C;  3GRE A;  3F3F A;  4Y5R D;  4E54 B;  3U4Y A;  5IC7 A;  4CC9 A;  3DSM A;  5FKT A;  4CZV A;  3SHF A;  3UR4 A;  3EI4 B;  3MZK A;  2AGW A;  2P9U C;  2H9N A;  5C2V B;  1SQ9 A;  3IIY A;  4PSX B;  3JRO A;  5C2W B;  5CXC B;  1NEX B;  2PM6 B;  1ERJ A;  4J0W A;  3VGZ A;  2XYI A;  4CI8 A;  4AEZ A;  1QNI A;  4A2L A;  2MTA H;  4J87 A;  2J57 G;  3IIW A;  3JRP A;  3L4O D;  5AMS A;  4OZU A;  3C75 H;  4PNK B;  2OVP B;  4CI3 A;  3EI2 A;  1RI6 A;  4PC0 A;  4ERY A;  2G9A A;  2IAA A;  1N6D A;  2I0T A;  4J8B A;  3V7D B;  4J81 A;  4JT5 C;  5EAP A;  3I7O A;  4A0A A;  2H47 A;  4CI2 A;  1S4U X;  2QXV A;  1MG2 A;  3EI2 B;  2G99 A;  3UKR C;  4O3U B;  1TYQ C;  4LGN A;  2XU7 A;  4J86 A;  4GQ1 A;  5CYK B;  2Q7Q A;  2HYE A;  5EM2 B;  3I8C A;  4GMB A;  2YMU A;  1GG2 B;  2O9K A;  3I89 A;  3RFH A;  4O45 A;  3AL8 A;  4GGA A;  2P9L C;  3OL2 A;  2HXC A;  4G56 B;  3I7N A;  3EU7 A;  4OWR A;  2H9M A;  5TDH B;  3SXT D;  3EWE A;  4D0K A;  3SBP A;  5HYN B;  1B9X A;  3AL8 B;  4HDJ A;  1NR0 A;  4CY1 A;  4H5J A;  3KRW B;  3OL2 B;  4GQB B;  4FA9 D;  5EAL A;  5SXM A;  1PI6 A;  3ORV D;  4X61 B;  3SFZ A;  2CN2 A;  3I8E A;  2AQ5 A;  4J78 A;  3MXX A;  2CN3 A;  4XYH A;  2I0R A;  1PEV A;  5IGQ A;  2Z2O A;  3DXM C;  5KDO B;  2OVR B;  3I7L A;  5FKS A;  4MK0 B;  2H6N A;  3EMH A;  5HE3 B;  2I3S A;  1GXR A;  2H9P A;  2IUR A;  4A2M A;  1XHM A;  2Z2N A;  4ES0 A;  5FA5 B;  3SJL D;  4JXM A;  1N6F A;  1FWX A;  3C99 A;  2AGY A;  4CI1 A;  4JT6 C;  2CE8 A;  4CZY A;  4J0X A;  5H1M A;  4FAV D;  5FLX g;  3JAM g;  4X63 B;  2HKM A;  3BWS A;  3I7P A;  4CZX A;  1VYH C;  4U1E I;  4XYI A;  3C5M A;  1L0Q A;  4GGD A;  4X60 B;  3F3P A;  5H14 A;  4CY5 A;  2B5L A;  2BCJ B;  2XL2 A;  4ZOY A;  4E5Z A;  3OKT A;  4J73 A;  5I5I A;  2UZY B;  5CXB A;  3RN0 D;  4NSX A;  1K32 A;  3PXW D;  1XKS A;  2GC7 A;  2H3X A;  5H17 A;  2BBK H;  4H5I A;  4CY2 A;  2H14 A;  4ZOV A;  2B5M A;  3UKU C;  3HFQ A;  1JMX B;  1U4C A;  3BG1 A;  1SQJ A;  3N0D A;  4GZ8 A;  3NVQ A;  3AL9 A;  5A2Q g;  5EMM B;  4L1Q D;  3NVN A;  3VH0 A;  2OK6 A;  1JMZ B;  4CY3 A;  4FHL A;  3OW8 A;  5EMK B;  5TEE A;  4JSV C;  4BL0 A;  4J79 A;  2QC5 A;  3K26 A;  3UVK A;  5GSA A;  2GC4 A;  3RRM C;  4O3T B;  5GXH A;  2CO0 C;  3RN1 D;  5I5M A;  4A08 A;  1A0R B;  3CIK B;  3SLE D;  4A11 A;  2TRC B;  4L3G D;  2OVQ B;  1XIP A;  1Q47 A;  2IUV A;  3AFC A;  1YFQ A;  3PVU B;  4A08 B;  4YVD A;  5IJ8 E;  3RLM D;  4FA1 D;  3JB9 L;  5HQG A;  3L4M D;  4A0A B;  4UI9 R;  1U2V C;  4U7A A;  5IJ7 E;  2I3T A;  4ERZ A;  4ESG A;  2B4E A;  3DXK C;  1K8K C;  2XL3 A;  5JWZ A;  4A09 A;  3I2N A;  2CO0 A;  4ZN4 A;  4J77 A;  2YNO A;  4LG8 A;  3PXS D;  1SHY B;  2HJ4 A;  3OTT A;  4R7A B;  5FKR A;  4KFM B;  3SMR A;  3IKO A;  4QRJ A;  2CE9 A;  3JZN A;  4BH6 A;  5I5J A;  2J55 H;  2HES X;  4K3I D;  1JOF A;  4FWW A;  2AGX A;  4ZOX A;  5EML B;  5HE2 B;  3RMZ D;  4J8G A;  1OLZ A;  3MKS B;  4J84 A;  3SVW D;  2PM9 A;  2P9P C;  2P9S C;  3P4F A;  5IGO A;  4PSW B;  2IWF A;  4ZOZ A;  4N14 A;  1MDA H;  1P22 A;  4PBY A;  3JZG A;  5EAM A;  3EI3 A;  1TBG A;  4EWR A;  2AH0 A;  3MZL A;  4O9D A;  3ODT A;  5C9Z B;  5K19 A;  4XEI C;  3F3G A;  2OK4 A;  3EI3 B;  2YNP A;  3EI1 A;  4I79 A;  5K1C C;  3N0E A;  4J82 A;  3A0F A;  4PXW A;  3JZH A;  2H6Q A;  5GXI A;  3VA6 A;  1R5M A;  3V9F A;  3EI1 B;  3EI4 A;  2HKR A;  4A7J A;  4E5Z B;  5THA A;  2P9K C;  2PBI B;  3GFC A;  4X3E A;  4FB1 D;  2AGZ A;  5CXB B;  3CFS B;  3IJC A;  3FGB A;  2GNQ A;  5AJA A;  2AH1 A;  3UVN A;  5CXC A;  1B9Y A;  4JSX C;  4GGC A;  5FXY A;  3ZWL B;  3IJ1 A;  3SCY A;  4BUJ C;  2YNN A;  2YB8 B;  3PE7 A; 
#chains in the Genus database with same CATH topology
 3PVW B;  2IUQ A;  3OKY A;  3EQ8 A;  4JHN A;  3MKQ A;  3DM0 A;  5FFO A;  1N6E A;  3EG6 A;  4QT8 A;  2EBS A;  3OKY B;  2UZX B;  4JSN C;  3UVL A;  2H6K A;  4NBM A;  4RE5 A;  4A11 B;  1H2X A;  3J81 g;  5AFU 3;  4K3J B;  5TF2 A;  3FM0 A;  5HE0 B;  5FFG A;  4PBZ A;  2AGL A;  2PM7 B;  3AH8 B;  4NC4 A;  2VDR A;  5CYK A;  3E0C A;  4A0B A;  4IMM A;  5FKQ A;  3NVX A;  4GQ2 P;  4QL1 A;  3ULE C;  5EM2 A;  4BP8 A;  2EIE A;  3SWS D;  2Z2P A;  1O6F A;  1UOQ A;  3KCI A;  2I0S A;  3PSC B;  4Z8L A;  5EMJ B;  2H9L A;  4L9O A;  4ERQ A;  5HDB A;  2H68 A;  4A0B B;  3ZDY A;  4A09 B;  4LG9 A;  1GOT B;  3OKW A;  1PBY B;  2B5N A;  5IT9 g;  4O1Q D;  5EAR A;  3MUN A;  3V5W B;  4Y7R A;  1GP2 B;  3J80 g;  4IA9 A;  5TEF A;  3KRX B;  3PSL A;  4Z7Q A;  4AN0 A;  3SN6 B;  4FAN D;  1MG3 A;  2OJY A;  4AMZ A;  4BCC A;  4WK4 A;  3FRX A;  4GM8 A;  2OIZ A;  3MMY A;  4IRZ A;  3C9C A;  3PXT D;  3I7K A;  2W18 A;  3IUL A;  5GMK n;  4GM3 A;  3JPX A;  2P9I C;  5E6S A;  3SBR A;  3BG0 A;  3I7H A;  1YR2 A;  4WK0 A;  5FQD A;  4UM9 A;  3W15 A;  5E6U A;  4L3H D;  4G1M A;  1VZ3 A;  2HJB A;  2IWK A;  4JSP C;  2PM9 B;  3UVO A;  1OMW B;  3RFG A;  2VDN A;  2J56 H;  3DWL C;  4QQE A;  1VZ2 A;  3UVM A;  3B7F A;  4BCD A;  4BCB A;  2P9N C;  4GM9 A;  1E5T A;  3CFV A;  2XZG A;  4AOW A;  1O6G A;  4D6V A;  5B4W A;  3K27 A;  2XDW A;  4FA4 D;  2IUP A;  4JD2 C;  2CNX A;  4E54 A;  4UM8 A;  3IJ0 A;  2H13 A;  3QHY B;  3K71 A;  2YBA A;  4TZ4 A;  5HE1 B;  3K72 A;  3SBQ A;  1BPO A;  4FA5 D;  1JJU B;  1PGU A;  3RSE C;  3GRE A;  3F3F A;  4Y5R D;  4E54 B;  3U4Y A;  5IC7 A;  4CC9 A;  3DSM A;  5FKT A;  4CZV A;  3SHF A;  3UR4 A;  1H2Y A;  4AN1 A;  3IUM A;  3EI4 B;  3MZK A;  1UOO A;  2AGW A;  3IVM A;  2P9U C;  2H9N A;  5C2V B;  1SQ9 A;  3IIY A;  4PSX B;  3JRO A;  3ZDZ A;  5C2W B;  5CXC B;  1NEX B;  2PM6 B;  1ERJ A;  4J0W A;  2HU5 A;  2VZ3 A;  4MMZ A;  3ZE0 A;  3VGZ A;  2VDK A;  2XYI A;  3O4H A;  4AEZ A;  4CI8 A;  1I2M B;  1QNI A;  1UOP A;  4A2L A;  3QI0 A;  5M5R A;  2MTA H;  4J87 A;  2J57 G;  3IIW A;  3JRP A;  3L4O D;  1GOG A;  1M1X A;  4OZU A;  5AMS A;  1VE7 A;  3C75 H;  4WJK A;  4PNK B;  2OVP B;  4CI3 A;  3EI2 A;  1RI6 A;  4PC0 A;  4ERY A;  2G9A A;  2IAA A;  1N6D A;  2I0T A;  4DNV A;  4J8B A;  3V7D B;  4J81 A;  4JT5 C;  5EAP A;  3I7O A;  4A0A A;  2XE4 A;  2H47 A;  4CI2 A;  3T3P A;  3IUJ A;  1S4U X;  2QXV A;  1MG2 A;  3EI2 B;  2G99 A;  3UKR C;  1H2W A;  1TYQ C;  4LGN A;  4O3U B;  2XU7 A;  3GD1 I;  1K3I A;  4J86 A;  4GQ1 A;  5CYK B;  4BP9 A;  2Q7Q A;  3GC3 B;  2HYE A;  4Z7N A;  5EM2 B;  3I8C A;  4GMB A;  2YMU A;  1GG2 B;  2O9K A;  3I89 A;  3ZE1 A;  3RFH A;  4O45 A;  3AL8 A;  1E8M A;  4AMY A;  4GGA A;  1TYE A;  2P9L C;  3OL2 A;  2HXC A;  2VDM A;  4G56 B;  3I7N A;  3EU7 A;  4OWR A;  2H9M A;  5TDH B;  3SXT D;  3EWE A;  4D0K A;  3IUN A;  3SBP A;  3OF7 A;  4NAA A;  5HYN B;  1B9X A;  3AL8 B;  4HDJ A;  1NR0 A;  2VDL A;  4CY1 A;  1VE6 A;  4H5J A;  3KRW B;  3OL2 B;  4GQB B;  4FA9 D;  5EAL A;  2EIB A;  5SXM A;  1PI6 A;  3ORV D;  4X61 B;  3SFZ A;  2CN2 A;  3I8E A;  1H2Z A;  2AQ5 A;  5E6R A;  4J78 A;  3MXX A;  2CN3 A;  4XYH A;  2I0R A;  1PEV A;  5IGQ A;  2Z2O A;  3DXM C;  5KDO B;  2OVR B;  3I7L A;  5FKS A;  4MK0 B;  2H6N A;  3EMH A;  5HE3 B;  2I3S A;  1GXR A;  2H9P A;  5M5S A;  2IUR A;  4A2M A;  1XHM A;  2Z2N A;  4ES0 A;  5FA5 B;  3SJL D;  4JXM A;  2WQ8 A;  1N6F A;  1FWX A;  3C99 A;  2BKL A;  5C92 A;  2AGY A;  3IJE A;  4CI1 A;  4JT6 C;  2CE8 A;  4CZY A;  4J0X A;  5H1M A;  4FAV D;  4Z7O A;  5FLX g;  5M5T A;  3JAM g;  4X63 B;  2HKM A;  3BWS A;  3I7P A;  4CZX A;  1VYH C;  4U1E I;  4XYI A;  1GOH A;  3C5M A;  1L0Q A;  4GGD A;  4X60 B;  3F3P A;  5H14 A;  4CY5 A;  2B5L A;  3EQ9 A;  4NEN A;  2BCJ B;  2XL2 A;  4ZOY A;  4E5Z A;  3OKT A;  4J73 A;  5I5I A;  2UZY B;  5CXB A;  3RN0 D;  1C9L A;  1K32 A;  3PXW D;  4NSX A;  1XKS A;  2GC7 A;  2H3X A;  3IUR A;  1UTC A;  5H17 A;  4G55 A;  2BBK H;  4RE6 A;  4H5I A;  4QAM A;  1JV2 A;  4MMX A;  4CY2 A;  2H14 A;  4ZOV A;  2B5M A;  3UKU C;  3HFQ A;  3ZDX A;  1JMX B;  1U4C A;  4AX4 A;  3BG1 A;  1SQJ A;  3N0D A;  4GZ8 A;  3NVQ A;  3AL9 A;  5A2Q g;  5EMM B;  4L1Q D;  3NVN A;  3VH0 A;  2OK6 A;  1JTD B;  1JMZ B;  4CY3 A;  4FHL A;  1C9I A;  1GOF A;  3OW8 A;  5EMK B;  5TEE A;  4JSV C;  4BL0 A;  4J79 A;  2QC5 A;  3K26 A;  3UVK A;  5GSA A;  2GC4 A;  3RRM C;  4O3T B;  4O02 A;  2QR5 A;  5GXH A;  2CO0 C;  3RN1 D;  5I5M A;  1QFM A;  4A08 A;  3NIG A;  1A0R B;  4JHP C;  3CIK B;  3SLE D;  4A11 A;  3MVD K;  3ZE2 A;  2TRC B;  4L3G D;  2OVQ B;  1XIP A;  1Q47 A;  4DNU A;  3NIF A;  2IUV A;  3EQ7 A;  3AFC A;  1YFQ A;  3PVU B;  4A08 B;  4YVD A;  5IJ8 E;  3RLM D;  4FA1 D;  3JB9 L;  5HQG A;  3L4M D;  4A0A B;  4UI9 R;  1U2V C;  4U7A A;  5IJ7 E;  2I3T A;  4ERZ A;  4ESG A;  5M61 A;  2B4E A;  3DXK C;  1K8K C;  3V4V A;  2XL3 A;  5JWZ A;  4A09 A;  3I2N A;  4L1M A;  3NID A;  2CO0 A;  3FCS A;  4ZN4 A;  4J77 A;  2EIC A;  2YNO A;  1E8N A;  3MUO A;  4DNW A;  4LG8 A;  3PXS D;  1SHY B;  2HJ4 A;  5M5V A;  3OTT A;  4R7A B;  5FKR A;  4KFM B;  3SMR A;  3IKO A;  2VDQ A;  4QRJ A;  2CE9 A;  3JZN A;  3VI3 A;  4BH6 A;  5I5J A;  2JKX A;  2J55 H;  2HES X;  4K3I D;  1JOF A;  5C86 A;  4FWW A;  4WK2 A;  2AGX A;  4ZOX A;  5EML B;  2VDO A;  5HE2 B;  4MMY A;  3RMZ D;  4J8G A;  1L5G A;  3O4G A;  1OLZ A;  3MKS B;  4J84 A;  3SVW D;  2PM9 A;  4O2W A;  2P9P C;  2P9S C;  3P4F A;  3T3M A;  5IGO A;  4PSW B;  2IWF A;  4ZOZ A;  4N14 A;  1MDA H;  1P22 A;  4PBY A;  1A12 A;  5M5U A;  4G1E A;  3JZG A;  5EAM A;  3EI3 A;  1TBG A;  3FCU A;  3DDU A;  4EWR A;  2AH0 A;  3MZL A;  4O9D A;  3ODT A;  4D9S A;  5C9Z B;  5K19 A;  4XEI C;  3F3G A;  2QZP A;  2OK4 A;  3EI3 B;  3V4P A;  2YNP A;  3EI1 A;  3K6S A;  4I79 A;  5K1C C;  2VZ1 A;  3N0E A;  4J82 A;  3A0F A;  4PXW A;  3JZH A;  2H6Q A;  5GXI A;  3VA6 A;  3O4J A;  1T2X A;  3O4I A;  1R5M A;  3V9F A;  3EI1 B;  2VC2 A;  3EI4 A;  2HKR A;  3VI4 A;  4A7J A;  4E5Z B;  2EID A;  5THA A;  2P9K C;  2PBI B;  3GFC A;  4X3E A;  4FB1 D;  2AGZ A;  5CXB B;  3CFS B;  1QFS A;  3IJC A;  1U8C A;  2GNQ A;  3FGB A;  2AH1 A;  3IUQ A;  5AJA A;  3UVN A;  5CXC A;  1B9Y A;  4JSX C;  4GGC A;  2VDP A;  5FXY A;  2HU8 A;  3ZWL B;  3IJ1 A;  3SCY A;  4BUJ C;  2YNN A;  2YB8 B;  3PE7 A;  2HU7 A; 
#chains in the Genus database with same CATH homology
 3PVW B;  2IUQ A;  3OKY A;  3MKQ A;  3DM0 A;  1N6E A;  3EG6 A;  4QT8 A;  2EBS A;  3OKY B;  2UZX B;  4JSN C;  3UVL A;  2H6K A;  4A11 B;  3J81 g;  5AFU 3;  4K3J B;  5TF2 A;  3FM0 A;  5HE0 B;  4PBZ A;  2AGL A;  2PM7 B;  3AH8 B;  5CYK A;  3E0C A;  4A0B A;  4IMM A;  5FKQ A;  3NVX A;  4GQ2 P;  4QL1 A;  3ULE C;  5EM2 A;  3SWS D;  2Z2P A;  2I0S A;  3PSC B;  4Z8L A;  5EMJ B;  2H9L A;  4L9O A;  4ERQ A;  2H68 A;  4A0B B;  4A09 B;  4LG9 A;  1GOT B;  3OKW A;  1PBY B;  2B5N A;  5IT9 g;  4O1Q D;  5EAR A;  3V5W B;  4Y7R A;  1GP2 B;  3J80 g;  4IA9 A;  5TEF A;  3KRX B;  3PSL A;  3SN6 B;  4FAN D;  1MG3 A;  2OJY A;  3FRX A;  4GM8 A;  2OIZ A;  3MMY A;  3C9C A;  3PXT D;  3I7K A;  2W18 A;  5GMK n;  4GM3 A;  3JPX A;  2P9I C;  3SBR A;  3BG0 A;  3I7H A;  5FQD A;  3W15 A;  4L3H D;  4JSP C;  2HJB A;  2IWK A;  2PM9 B;  3UVO A;  1OMW B;  3RFG A;  2J56 H;  3DWL C;  4QQE A;  3UVM A;  3B7F A;  2P9N C;  4GM9 A;  3CFV A;  4AOW A;  4D6V A;  5B4W A;  3K27 A;  4FA4 D;  2IUP A;  4JD2 C;  2CNX A;  4E54 A;  3IJ0 A;  2H13 A;  2YBA A;  4TZ4 A;  5HE1 B;  3SBQ A;  4FA5 D;  1JJU B;  1PGU A;  3RSE C;  3GRE A;  3F3F A;  4Y5R D;  4E54 B;  3U4Y A;  5IC7 A;  4CC9 A;  3DSM A;  5FKT A;  4CZV A;  3SHF A;  3UR4 A;  3EI4 B;  3MZK A;  2AGW A;  2P9U C;  2H9N A;  5C2V B;  1SQ9 A;  3IIY A;  4PSX B;  3JRO A;  5C2W B;  5CXC B;  1NEX B;  2PM6 B;  1ERJ A;  4J0W A;  3VGZ A;  2XYI A;  4CI8 A;  4AEZ A;  1QNI A;  4A2L A;  2MTA H;  4J87 A;  2J57 G;  3IIW A;  3JRP A;  3L4O D;  5AMS A;  4OZU A;  3C75 H;  4PNK B;  2OVP B;  4CI3 A;  3EI2 A;  1RI6 A;  4PC0 A;  4ERY A;  2G9A A;  2IAA A;  1N6D A;  2I0T A;  4J8B A;  3V7D B;  4J81 A;  4JT5 C;  5EAP A;  3I7O A;  4A0A A;  2H47 A;  4CI2 A;  1S4U X;  2QXV A;  1MG2 A;  3EI2 B;  2G99 A;  3UKR C;  4O3U B;  1TYQ C;  4LGN A;  2XU7 A;  4J86 A;  4GQ1 A;  5CYK B;  2Q7Q A;  2HYE A;  5EM2 B;  3I8C A;  4GMB A;  2YMU A;  1GG2 B;  2O9K A;  3I89 A;  3RFH A;  4O45 A;  3AL8 A;  4GGA A;  2P9L C;  3OL2 A;  2HXC A;  4G56 B;  3I7N A;  3EU7 A;  4OWR A;  2H9M A;  5TDH B;  3SXT D;  3EWE A;  4D0K A;  3SBP A;  5HYN B;  1B9X A;  3AL8 B;  4HDJ A;  1NR0 A;  4CY1 A;  4H5J A;  3KRW B;  3OL2 B;  4GQB B;  4FA9 D;  5EAL A;  5SXM A;  1PI6 A;  3ORV D;  4X61 B;  3SFZ A;  2CN2 A;  3I8E A;  2AQ5 A;  4J78 A;  3MXX A;  2CN3 A;  4XYH A;  2I0R A;  1PEV A;  5IGQ A;  2Z2O A;  3DXM C;  5KDO B;  2OVR B;  3I7L A;  5FKS A;  4MK0 B;  2H6N A;  3EMH A;  5HE3 B;  2I3S A;  1GXR A;  2H9P A;  2IUR A;  4A2M A;  1XHM A;  2Z2N A;  4ES0 A;  5FA5 B;  3SJL D;  4JXM A;  1N6F A;  1FWX A;  3C99 A;  2AGY A;  4CI1 A;  4JT6 C;  2CE8 A;  4CZY A;  4J0X A;  5H1M A;  4FAV D;  5FLX g;  3JAM g;  4X63 B;  2HKM A;  3BWS A;  3I7P A;  4CZX A;  1VYH C;  4U1E I;  4XYI A;  3C5M A;  1L0Q A;  4GGD A;  4X60 B;  3F3P A;  5H14 A;  4CY5 A;  2B5L A;  2BCJ B;  2XL2 A;  4ZOY A;  4E5Z A;  3OKT A;  4J73 A;  5I5I A;  2UZY B;  5CXB A;  3RN0 D;  4NSX A;  1K32 A;  3PXW D;  1XKS A;  2GC7 A;  2H3X A;  5H17 A;  2BBK H;  4H5I A;  4CY2 A;  2H14 A;  4ZOV A;  2B5M A;  3UKU C;  3HFQ A;  1JMX B;  1U4C A;  3BG1 A;  1SQJ A;  3N0D A;  4GZ8 A;  3NVQ A;  3AL9 A;  5A2Q g;  5EMM B;  4L1Q D;  3NVN A;  3VH0 A;  2OK6 A;  1JMZ B;  4CY3 A;  4FHL A;  3OW8 A;  5EMK B;  5TEE A;  4JSV C;  4BL0 A;  4J79 A;  2QC5 A;  3K26 A;  3UVK A;  5GSA A;  2GC4 A;  3RRM C;  4O3T B;  5GXH A;  2CO0 C;  3RN1 D;  5I5M A;  4A08 A;  1A0R B;  3CIK B;  3SLE D;  4A11 A;  2TRC B;  4L3G D;  2OVQ B;  1XIP A;  1Q47 A;  2IUV A;  3AFC A;  1YFQ A;  3PVU B;  4A08 B;  4YVD A;  5IJ8 E;  3RLM D;  4FA1 D;  3JB9 L;  5HQG A;  3L4M D;  4A0A B;  4UI9 R;  1U2V C;  4U7A A;  5IJ7 E;  2I3T A;  4ERZ A;  4ESG A;  2B4E A;  3DXK C;  1K8K C;  2XL3 A;  5JWZ A;  4A09 A;  3I2N A;  2CO0 A;  4ZN4 A;  4J77 A;  2YNO A;  4LG8 A;  3PXS D;  1SHY B;  2HJ4 A;  3OTT A;  4R7A B;  5FKR A;  4KFM B;  3SMR A;  3IKO A;  4QRJ A;  2CE9 A;  3JZN A;  4BH6 A;  5I5J A;  2J55 H;  2HES X;  4K3I D;  1JOF A;  4FWW A;  2AGX A;  4ZOX A;  5EML B;  5HE2 B;  3RMZ D;  4J8G A;  1OLZ A;  3MKS B;  4J84 A;  3SVW D;  2PM9 A;  2P9P C;  2P9S C;  3P4F A;  5IGO A;  4PSW B;  2IWF A;  4ZOZ A;  4N14 A;  1MDA H;  1P22 A;  4PBY A;  3JZG A;  5EAM A;  3EI3 A;  1TBG A;  4EWR A;  2AH0 A;  3MZL A;  4O9D A;  3ODT A;  5C9Z B;  5K19 A;  4XEI C;  3F3G A;  2OK4 A;  3EI3 B;  2YNP A;  3EI1 A;  4I79 A;  5K1C C;  3N0E A;  4J82 A;  3A0F A;  4PXW A;  3JZH A;  2H6Q A;  5GXI A;  3VA6 A;  1R5M A;  3V9F A;  3EI1 B;  3EI4 A;  2HKR A;  4A7J A;  4E5Z B;  5THA A;  2P9K C;  2PBI B;  3GFC A;  4X3E A;  4FB1 D;  2AGZ A;  5CXB B;  3CFS B;  3IJC A;  3FGB A;  2GNQ A;  5AJA A;  2AH1 A;  3UVN A;  5CXC A;  1B9Y A;  4JSX C;  4GGC A;  5FXY A;  3ZWL B;  3IJ1 A;  3SCY A;  4BUJ C;  2YNN A;  2YB8 B;  3PE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...