3RN0D

Crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
total genus 92
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn0D00
5H1MA 2AH1A 3PVUB 4ZOZA 2AGLA 5EAPA 4PXWA 1YFQA 3I7HA 4A0BB 2H6QA 2YBAA 3DXMC 4GQBB 2YNNA 5B4WA 3UVLA 4PBYA 3SBRA 3DM0A 3MKQA 3VGZA 4HDJA 2G9AA 4E5ZA 2OK6A 4JT5C 3I2NA 4J78A 4A0BA 1U2VC 1GOTB 3FM0A 3AL8A 4U1EI 5K1CC 1PBYB 5FQDA 4JT6C 4ZOXA 4J77A 3A0FA 1RI6A 2QXVA 3EI3A 2IWFA 2Z2NA 5FA5B 4GQ2P 3KRXB 3F3FA 1JJUB 2P9IC 3SVWD 3OKTA 5FKRA 4A09A 2I0SA 4O3TB 2P9LC 4J0XA 1OLZA 4U7AA 1SHYB 2OVRB 5IGOA 2PM9B 1JOFA 1Q47A 4K3ID 1N6DA 1GXRA 3PSLA 2OVPB 4CZXA 5AMSA 5EALA 5IT9g 4A11B 3EI4A 4CC9A 4A0AB 2P9NC 2QC5A 4GGDA 3OTTA 3J80g 3RFGA 4O3UB 4R7AB 3CFSB 4UI9R 3BWSA 2XYIA 5FKQA 3NVXA 1QNIA 4JSXC 4JSNC 4ZOYA 2MTAH 4O1QD 2H6NA 4J86A 1MDAH 4TZ4A 2H13A 4J8BA 2Q7QA 4A11A 3OL2A 5FKTA 3K26A 2H3XA 3ZWLB 2J56H 2XL2A 4CZVA 3J81g 3JPXA 2PM6B 2HYEA 2GC7A 4X3EA 2H9LA 5EARA 3JRPA 5H17A 2HXCA 2H6KA 5C2WB 5FKSA 3IJ0A 4CY3A 4E5ZB 4QT8A 2CNXA 3AL8B 4J82A 5FXYA 4J73A 4XYHA 4IMMA 5TDHB 4ERZA 1NEXB 2OIZA 4L1QD 2P9KC 3EG6A 3CIKB 5GMKn 1S4UX 2CE8A 5EMMB 4E54B 3P4FA 4GM9A 4O45A 2UZXB 3F3GA 1K8KC 1XKSA 2YNPA 5KDOB 5SXMA 1N6FA 3BG0A 3I89A 3JZHA 3SFZA 1U4CA 4A7JA 5K19A 4LG8A 4K3JB 2W18A 5AFU3 3PXTD 2H14A 2Z2PA 3DSMA 2IURA 3RSEC 4A2MA 3RN1D 4PSXB 2B4EA 3I7PA 2IWKA 3C99A 2AH0A 2P9UC 5CXCB 3UVNA 3B7FA 4ERYA 4OWRA 3OL2B 4GMBA 3PVWB 4JSVC 4XEIC 3AH8B 2B5LA 2AGWA 2I3SA 3F3PA 2PBIB 4KFMB 3EI2B 2OK4A 3PXSD 1MG2A 3EI4B 1N6EA 3UVOA 3VH0A 1K32A 4J81A 1JMZB 3AL9A 4GM8A 4QRJA 4ESGA 5EAMA 4AOWA 3JB9L 3EI2A 3PSCB 5C2VB 4JXMA 4CY5A 4N14A 4JSPC 3EI1A 3BG1A 3JZGA 3JAMg 4CY1A 3SBQA 4ZOVA 5GXHA 2I0TA 3AFCA 3I7KA 2HKRA 3JROA 3N0EA 3IJCA 4H5IA 5H14A 3EI1B 1JMXB 4JD2C 3SCYA 3CFVA 3N0DA 4D6VA 2IUPA 5EM2A 1GP2B 3SHFA 4CY2A 2OJYA 4FWWA 3SJLD 4OZUA 1L0QA 4ERQA 5TEEA 1B9XA 2CE9A 2OVQB 4O9DA 1PEVA 2CO0A 5JWZA 4A08A 2I0RA 3SWSD 2IUVA 5C9ZB 4AEZA 3OKYA 4Y5RD 5EM2B 2CN2A 4LG9A 3IIYA 4E54A 4BL0A 1ERJA 3UVKA 1PGUA 3EI3B 2YMUA 3VA6A 4A08B 4H5JA 4Y7RA 5HE0B 5GXIA 3OKYB 4L3HD 3V9FA 4FA9D 4L9OA 2GC4A 2B5MA 2P9PC 3IIWA 4YVDA 3MKSB 2B5NA 3PXWD 3I8CA 3DXKC 2YNOA 3MMYA 2HJ4A 4J0WA 4PBZA 4I79A 5AJAA 5A2Qg 5HYNB 4X61B 2HESX 3DWLC 3MZLA 4G56B 4FAND 3I7OA 2PM9A 1XHMA 5EMKB 3JZNA 2AGZA 3U4YA 2P9SC 3GREA 3L4MD 3RN0D 3L4OD 2IUQA 3GFCA 3NVNA 4FA5D 5I5MA 2Z2OA 2CO0C 4X63B 4A2LA 3I7NA 4PSWB 4GZ8A 3RLMD 4CZYA 3W15A 2UZYB 4Z8LA 1R5MA 3RMZD 2G99A 5HE1B 3ORVD 4MK0B 4FAVD 4FB1D 2J57G 3C9CA 2GNQA 3V5WB 2IAAA 3KRWB 4L3GD 2BBKH 4XYIA 4J87A 2EBSA 3UKRC 2HJBA 4CI1A 3EU7A 1TYQC 3IKOA 3RRMC 4LGNA 3C5MA 1FWXA 3UVMA 2AGYA 1SQ9A 4ES0A 3FGBA 3EWEA 3EMHA 3OW8A 5TEFA 5HE3B 2H9MA 3NVQA 2H47A 5CXBA 4FA1D 2H9PA 3E0CA 2O9KA 4PNKB 5HQGA 4IA9A 5FLXg 2XL3A 4ZN4A 3UKUC 4FA4D 2XU7A 3SLED 3UR4A 2H68A 1SQJA 4CI3A 4QL1A 3ODTA 3PE7A 4FHLA 1P22A 3SXTD 3C75H 1A0RB 3RFHA 5IGQA 4GGCA 2H9NA 3I7LA 5CYKA 4QQEA 3I8EA 3OKWA 3MZKA 4CI2A 5CXCA 2PM7B 5HE2B 5I5JA 1TBGA 4J84A 3K27A 3SBPA 1PI6A 2J55H 5CYKB 2AGXA 4PC0A 4BUJC 4A0AA 2BCJB 2AQ5A 2TRCB 1MG3A 3HFQA 3SMRA 1XIPA 2CN3A 4GQ1A 5IC7A 5I5IA 2HKMA 1GG2B 4GGAA 4A09B 1B9YA 5EMLB 3FRXA 5IJ7E 1NR0A 4D0KA 2I3TA 3ULEC 5THAA 3MXXA 4CI8A 5TF2A 4BH6A 5EMJB 1OMWB 3V7DB 5CXBB 5GSAA 3SN6B 5IJ8E 4NSXA 4J8GA 4GM3A 4J79A 2YB8B 4EWRA 3IJ1A 4X60B 1VYHC
chains in the Genus database with same CATH superfamily
2QR5A 5H1MA 2AH1A 3PVUB 4ZOZA 2AGLA 5EAPA 4PXWA 1YFQA 3I7HA 4A0BB 2H6QA 2YBAA 3DXMC 4GQBB 1A12A 2YNNA 1UTCA 5B4WA 3IJEA 3UVLA 4JHNA 4PBYA 3SBRA 4NC4A 3DM0A 3MKQA 3VGZA 3VI3A 3FCSA 4HDJA 2G9AA 4E5ZA 2OK6A 4JT5C 3I2NA 4J78A 4A0BA 1U2VC 4BCBA 1GOTB 3FM0A 3AL8A 4U1EI 5K1CC 1PBYB 5FQDA 3IUJA 4JT6C 4ZOXA 4J77A 3A0FA 4G55A 1RI6A 3MUOA 4AX4A 2JKXA 2QXVA 3EI3A 1K3IA 3NIDA 2IWFA 2Z2NA 5FA5B 5HDBA 4GQ2P 2VDPA 3KRXB 3F3FA 1JJUB 2P9IC 2BKLA 3K71A 3QHYB 3SVWD 3OKTA 5C86A 5C92A 5FKRA 4A09A 2I0SA 5M61A 4O3TB 4AMZA 2P9LC 4J0XA 1OLZA 4U7AA 1SHYB 3IURA 3O4HA 2OVRB 4WK4A 5IGOA 1I2MB 2PM9B 3IULA 1JOFA 1Q47A 2HU5A 5M5VA 1H2ZA 1N6DA 1GXRA 3KCIA 3PSLA 2OVPB 4K3ID 5AMSA 5EALA 4CZXA 5IT9g 4A11B 3EI4A 4CC9A 4A0AB 2P9NC 2QC5A 1C9IA 3OTTA 4GGDA 5M5RA 3J80g 3RFGA 4NENA 4O3UB 4R7AB 3CFSB 4UI9R 3BWSA 2XYIA 5FKQA 1VZ2A 3NVXA 1QNIA 4JSXC 4JSNC 4MMZA 4ZOYA 2MTAH 4O1QD 2H6NA 2VDNA 4J86A 1MDAH 1UOPA 4TZ4A 2H13A 4J8BA 3NIFA 2Q7QA 4A11A 3OL2A 5FKTA 3K26A 1GOHA 2H3XA 3ZWLB 2J56H 1E8MA 4NBMA 2XL2A 4CZVA 3J81g 5M5SA 1TYEA 3JPXA 2PM6B 2HYEA 2GC7A 5E6UA 4X3EA 2H9LA 5EARA 3JRPA 5H17A 2HXCA 2H6KA 5C2WB 3NIGA 5FKSA 3IJ0A 4CY3A 5FFOA 4E5ZB 4QT8A 2CNXA 3AL8B 4J82A 5FXYA 3GC3B 2VDRA 4J73A 4XYHA 4IMMA 5TDHB 4ERZA 3EQ9A 1NEXB 2OIZA 3IUMA 4L1QD 3EQ7A 4L1MA 3ZE2A 2P9KC 3EG6A 3CIKB 5GMKn 1VZ3A 2HU8A 1S4UX 2CE8A 5EMMB 4E54B 5M5TA 3P4FA 4GM9A 4O45A 2UZXB 3F3GA 1K8KC 1XKSA 2YNPA 1H2YA 5KDOB 3DDUA 4QAMA 5SXMA 4WK0A 1N6FA 3BG0A 3I89A 2EIEA 3JZHA 3SFZA 1U4CA 4A7JA 5K19A 4LG8A 4K3JB 2W18A 5AFU3 2XZGA 3PXTD 2H14A 2Z2PA 3DSMA 2IURA 3RSEC 4A2MA 3RN1D 4PSXB 1T2XA 2B4EA 3QI0A 3I7PA 4G1MA 2IWKA 3C99A 2AH0A 2P9UC 2VDMA 5CXCB 3UVNA 3B7FA 4ERYA 4OWRA 3GD1I 3OL2B 4GMBA 3PVWB 4JSVC 4XEIC 3AH8B 2B5LA 2AGWA 2I3SA 2VDLA 3F3PA 2PBIB 4KFMB 3EI2B 3PXSD 2OK4A 1MG2A 1E8NA 3EI4B 2EIBA 1N6EA 3UVOA 3VH0A 1U8CA 4DNUA 2EIDA 4AN1A 1K32A 4J81A 4O02A 3K72A 3O4IA 4BP9A 1JMZB 3AL9A 4GM8A 3O4GA 4JHPC 4QRJA 4ESGA 5EAMA 4AOWA 3JB9L 3EI2A 3PSCB 5C2VB 4JXMA 4CY5A 4N14A 4JSPC 4BP8A 3EI1A 3BG1A 3JZGA 3JAMg 1VE7A 5E6SA 1VE6A 4CY1A 3SBQA 4ZOVA 5GXHA 2I0TA 3AFCA 3I7KA 2HKRA 3JROA 2VDKA 3N0EA 3IJCA 4H5IA 4WK2A 5H14A 3EI1B 3T3PA 1JMXB 4JD2C 4WJKA 3SCYA 3CFVA 3N0DA 4D6VA 2IUPA 5EM2A 1GP2B 3SHFA 4CY2A 2OJYA 4FWWA 3SJLD 4G1EA 1L0QA 4OZUA 4ERQA 5TEEA 1B9XA 2CE9A 2OVQB 4O9DA 1PEVA 1UOQA 2CO0A 5JWZA 4A08A 2I0RA 3SWSD 2IUVA 5C9ZB 1O6FA 4AEZA 3OKYA 4Y5RD 5EM2B 2CN2A 3IUNA 2VC2A 3IIYA 4LG9A 3ZE0A 4E54A 4AN0A 1QFMA 1GOGA 4BL0A 1BPOA 1ERJA 3UVKA 1PGUA 3EI3B 2YMUA 3VA6A 4UM8A 3ZE1A 4A08B 4H5JA 4O2WA 4Y7RA 1H2WA 5HE0B 5GXIA 3OKYB 4L3HD 5M5UA 3V9FA 3IUQA 4FA9D 4L9OA 4AMYA 2GC4A 2B5MA 2P9PC 3IIWA 4YVDA 3MKSB 2HU7A 2B5NA 3PXWD 3I8CA 3DXKC 4MMXA 2YNOA 3MMYA 3ZDXA 2HJ4A 4J0WA 4PBZA 4RE6A 1L5GA 4I79A 5AJAA 3ZDZA 5A2Qg 5HYNB 2HESX 4X61B 3DWLC 3MZLA 4G56B 1UOOA 1E5TA 2WQ8A 4FAND 3I7OA 2PM9A 1XHMA 5EMKB 3JZNA 2AGZA 3U4YA 2P9SC 3GREA 3FCUA 3L4MD 3RN0D 3L4OD 2IUQA 3GFCA 3NVNA 4FA5D 5I5MA 2VDOA 2Z2OA 2CO0C 3K6SA 4X63B 4A2LA 3I7NA 4PSWB 2QZPA 4GZ8A 3RLMD 4CZYA 3W15A 2UZYB 3VI4A 4Z8LA 1R5MA 3RMZD 2G99A 5HE1B 4Z7NA 3ORVD 4MK0B 3EQ8A 4IRZA 4FAVD 1GOFA 1YR2A 4FB1D 2J57G 3C9CA 2VZ1A 2GNQA 3MUNA 3V5WB 2IAAA 3KRWB 3OF7A 4L3GD 2BBKH 2VDQA 4XYIA 4J87A 2EBSA 3UKRC 2HJBA 4CI1A 3EU7A 3V4VA 1TYQC 3IKOA 3RRMC 4LGNA 3C5MA 1FWXA 3UVMA 2AGYA 1SQ9A 4NAAA 4ES0A 3FGBA 3EWEA 4UM9A 3EMHA 3OW8A 5TEFA 5HE3B 3V4PA 2H9MA 3NVQA 2H47A 5CXBA 4FA1D 1O6GA 2H9PA 3E0CA 2O9KA 4PNKB 5HQGA 4IA9A 5FLXg 2XL3A 1JTDB 3ZDYA 4ZN4A 3UKUC 4FA4D 2XU7A 3SLED 2XDWA 3UR4A 2H68A 1SQJA 4CI3A 4QL1A 3ODTA 4MMYA 3PE7A 4FHLA 1P22A 4DNWA 3SXTD 3C75H 4Z7QA 1A0RB 1QFSA 3RFHA 5IGQA 4GGCA 2H9NA 3I7LA 5CYKA 2EICA 4RE5A 4QQEA 5E6RA 3I8EA 3OKWA 3MZKA 4CI2A 5CXCA 2PM7B 5HE2B 5I5JA 1TBGA 4J84A 3K27A 3SBPA 1PI6A 2J55H 5CYKB 2AGXA 4PC0A 4BUJC 4A0AA 1M1XA 2BCJB 2AQ5A 2VZ3A 2TRCB 1MG3A 3HFQA 3SMRA 1XIPA 4BCDA 2CN3A 4GQ1A 1JV2A 5IC7A 4BCCA 1C9LA 5I5IA 2HKMA 1GG2B 4GGAA 4Z7OA 4A09B 1B9YA 5EMLB 4DNVA 3FRXA 4D9SA 5IJ7E 1NR0A 4D0KA 2I3TA 3ULEC 5THAA 3MXXA 4CI8A 5FFGA 3MVDK 5TF2A 4BH6A 5EMJB 1OMWB 3V7DB 5CXBB 3T3MA 3O4JA 5GSAA 3SN6B 5IJ8E 4NSXA 3IVMA 4J8GA 4GM3A 1H2XA 4J79A 2YB8B 4EWRA 3IJ1A 4X60B 2XE4A 1VYHC
chains in the Genus database with same CATH topology
5H1MA 2AH1A 3PVUB 4ZOZA 2AGLA 5EAPA 4PXWA 1YFQA 3I7HA 4A0BB 2H6QA 2YBAA 3DXMC 4GQBB 2YNNA 5B4WA 3UVLA 4PBYA 3SBRA 3DM0A 3MKQA 3VGZA 4HDJA 2G9AA 4E5ZA 2OK6A 4JT5C 3I2NA 4J78A 4A0BA 1U2VC 1GOTB 3FM0A 3AL8A 4U1EI 5K1CC 1PBYB 5FQDA 4JT6C 4ZOXA 4J77A 3A0FA 1RI6A 2QXVA 3EI3A 2IWFA 2Z2NA 5FA5B 4GQ2P 3KRXB 3F3FA 1JJUB 2P9IC 3SVWD 3OKTA 5FKRA 4A09A 2I0SA 4O3TB 2P9LC 4J0XA 1OLZA 4U7AA 1SHYB 2OVRB 5IGOA 2PM9B 1JOFA 1Q47A 4K3ID 1N6DA 1GXRA 3PSLA 2OVPB 4CZXA 5AMSA 5EALA 5IT9g 4A11B 3EI4A 4CC9A 4A0AB 2P9NC 2QC5A 4GGDA 3OTTA 3J80g 3RFGA 4O3UB 4R7AB 3CFSB 4UI9R 3BWSA 2XYIA 5FKQA 3NVXA 1QNIA 4JSXC 4JSNC 4ZOYA 2MTAH 4O1QD 2H6NA 4J86A 1MDAH 4TZ4A 2H13A 4J8BA 2Q7QA 4A11A 3OL2A 5FKTA 3K26A 2H3XA 3ZWLB 2J56H 2XL2A 4CZVA 3J81g 3JPXA 2PM6B 2HYEA 2GC7A 4X3EA 2H9LA 5EARA 3JRPA 5H17A 2HXCA 2H6KA 5C2WB 5FKSA 3IJ0A 4CY3A 4E5ZB 4QT8A 2CNXA 3AL8B 4J82A 5FXYA 4J73A 4XYHA 4IMMA 5TDHB 4ERZA 1NEXB 2OIZA 4L1QD 2P9KC 3EG6A 3CIKB 5GMKn 1S4UX 2CE8A 5EMMB 4E54B 3P4FA 4GM9A 4O45A 2UZXB 3F3GA 1K8KC 1XKSA 2YNPA 5KDOB 5SXMA 1N6FA 3BG0A 3I89A 3JZHA 3SFZA 1U4CA 4A7JA 5K19A 4LG8A 4K3JB 2W18A 5AFU3 3PXTD 2H14A 2Z2PA 3DSMA 2IURA 3RSEC 4A2MA 3RN1D 4PSXB 2B4EA 3I7PA 2IWKA 3C99A 2AH0A 2P9UC 5CXCB 3UVNA 3B7FA 4ERYA 4OWRA 3OL2B 4GMBA 3PVWB 4JSVC 4XEIC 3AH8B 2B5LA 2AGWA 2I3SA 3F3PA 2PBIB 4KFMB 3EI2B 2OK4A 3PXSD 1MG2A 3EI4B 1N6EA 3UVOA 3VH0A 1K32A 4J81A 1JMZB 3AL9A 4GM8A 4QRJA 4ESGA 5EAMA 4AOWA 3JB9L 3EI2A 3PSCB 5C2VB 4JXMA 4CY5A 4N14A 4JSPC 3EI1A 3BG1A 3JZGA 3JAMg 4CY1A 3SBQA 4ZOVA 5GXHA 2I0TA 3AFCA 3I7KA 2HKRA 3JROA 3N0EA 3IJCA 4H5IA 5H14A 3EI1B 1JMXB 4JD2C 3SCYA 3CFVA 3N0DA 4D6VA 2IUPA 5EM2A 1GP2B 3SHFA 4CY2A 2OJYA 4FWWA 3SJLD 4OZUA 1L0QA 4ERQA 5TEEA 1B9XA 2CE9A 2OVQB 4O9DA 1PEVA 2CO0A 5JWZA 4A08A 2I0RA 3SWSD 2IUVA 5C9ZB 4AEZA 3OKYA 4Y5RD 5EM2B 2CN2A 4LG9A 3IIYA 4E54A 4BL0A 1ERJA 3UVKA 1PGUA 3EI3B 2YMUA 3VA6A 4A08B 4H5JA 4Y7RA 5HE0B 5GXIA 3OKYB 4L3HD 3V9FA 4FA9D 4L9OA 2GC4A 2B5MA 2P9PC 3IIWA 4YVDA 3MKSB 2B5NA 3PXWD 3I8CA 3DXKC 2YNOA 3MMYA 2HJ4A 4J0WA 4PBZA 4I79A 5AJAA 5A2Qg 5HYNB 4X61B 2HESX 3DWLC 3MZLA 4G56B 4FAND 3I7OA 2PM9A 1XHMA 5EMKB 3JZNA 2AGZA 3U4YA 2P9SC 3GREA 3L4MD 3RN0D 3L4OD 2IUQA 3GFCA 3NVNA 4FA5D 5I5MA 2Z2OA 2CO0C 4X63B 4A2LA 3I7NA 4PSWB 4GZ8A 3RLMD 4CZYA 3W15A 2UZYB 4Z8LA 1R5MA 3RMZD 2G99A 5HE1B 3ORVD 4MK0B 4FAVD 4FB1D 2J57G 3C9CA 2GNQA 3V5WB 2IAAA 3KRWB 4L3GD 2BBKH 4XYIA 4J87A 2EBSA 3UKRC 2HJBA 4CI1A 3EU7A 1TYQC 3IKOA 3RRMC 4LGNA 3C5MA 1FWXA 3UVMA 2AGYA 1SQ9A 4ES0A 3FGBA 3EWEA 3EMHA 3OW8A 5TEFA 5HE3B 2H9MA 3NVQA 2H47A 5CXBA 4FA1D 2H9PA 3E0CA 2O9KA 4PNKB 5HQGA 4IA9A 5FLXg 2XL3A 4ZN4A 3UKUC 4FA4D 2XU7A 3SLED 3UR4A 2H68A 1SQJA 4CI3A 4QL1A 3ODTA 3PE7A 4FHLA 1P22A 3SXTD 3C75H 1A0RB 3RFHA 5IGQA 4GGCA 2H9NA 3I7LA 5CYKA 4QQEA 3I8EA 3OKWA 3MZKA 4CI2A 5CXCA 2PM7B 5HE2B 5I5JA 1TBGA 4J84A 3K27A 3SBPA 1PI6A 2J55H 5CYKB 2AGXA 4PC0A 4BUJC 4A0AA 2BCJB 2AQ5A 2TRCB 1MG3A 3HFQA 3SMRA 1XIPA 2CN3A 4GQ1A 5IC7A 5I5IA 2HKMA 1GG2B 4GGAA 4A09B 1B9YA 5EMLB 3FRXA 5IJ7E 1NR0A 4D0KA 2I3TA 3ULEC 5THAA 3MXXA 4CI8A 5TF2A 4BH6A 5EMJB 1OMWB 3V7DB 5CXBB 5GSAA 3SN6B 5IJ8E 4NSXA 4J8GA 4GM3A 4J79A 2YB8B 4EWRA 3IJ1A 4X60B 1VYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1M A;  2AH1 A;  3PVU B;  4ZOZ A;  2AGL A;  5EAP A;  4PXW A;  1YFQ A;  3I7H A;  4A0B B;  2H6Q A;  2YBA A;  3DXM C;  4GQB B;  2YNN A;  5B4W A;  3UVL A;  4PBY A;  3SBR A;  3DM0 A;  3MKQ A;  3VGZ A;  4HDJ A;  2G9A A;  4E5Z A;  2OK6 A;  4JT5 C;  3I2N A;  4J78 A;  4A0B A;  1U2V C;  1GOT B;  3FM0 A;  3AL8 A;  4U1E I;  5K1C C;  1PBY B;  5FQD A;  4JT6 C;  4ZOX A;  4J77 A;  3A0F A;  1RI6 A;  2QXV A;  3EI3 A;  2IWF A;  2Z2N A;  5FA5 B;  4GQ2 P;  3KRX B;  3F3F A;  1JJU B;  2P9I C;  3SVW D;  3OKT A;  5FKR A;  4A09 A;  2I0S A;  4O3T B;  2P9L C;  4J0X A;  1OLZ A;  4U7A A;  1SHY B;  2OVR B;  5IGO A;  2PM9 B;  1JOF A;  1Q47 A;  4K3I D;  1N6D A;  1GXR A;  3PSL A;  2OVP B;  4CZX A;  5AMS A;  5EAL A;  5IT9 g;  4A11 B;  3EI4 A;  4CC9 A;  4A0A B;  2P9N C;  2QC5 A;  4GGD A;  3OTT A;  3J80 g;  3RFG A;  4O3U B;  4R7A B;  3CFS B;  4UI9 R;  3BWS A;  2XYI A;  5FKQ A;  3NVX A;  1QNI A;  4JSX C;  4JSN C;  4ZOY A;  2MTA H;  4O1Q D;  2H6N A;  4J86 A;  1MDA H;  4TZ4 A;  2H13 A;  4J8B A;  2Q7Q A;  4A11 A;  3OL2 A;  5FKT A;  3K26 A;  2H3X A;  3ZWL B;  2J56 H;  2XL2 A;  4CZV A;  3J81 g;  3JPX A;  2PM6 B;  2HYE A;  2GC7 A;  4X3E A;  2H9L A;  5EAR A;  3JRP A;  5H17 A;  2HXC A;  2H6K A;  5C2W B;  5FKS A;  3IJ0 A;  4CY3 A;  4E5Z B;  4QT8 A;  2CNX A;  3AL8 B;  4J82 A;  5FXY A;  4J73 A;  4XYH A;  4IMM A;  5TDH B;  4ERZ A;  1NEX B;  2OIZ A;  4L1Q D;  2P9K C;  3EG6 A;  3CIK B;  5GMK n;  1S4U X;  2CE8 A;  5EMM B;  4E54 B;  3P4F A;  4GM9 A;  4O45 A;  2UZX B;  3F3G A;  1K8K C;  1XKS A;  2YNP A;  5KDO B;  5SXM A;  1N6F A;  3BG0 A;  3I89 A;  3JZH A;  3SFZ A;  1U4C A;  4A7J A;  5K19 A;  4LG8 A;  4K3J B;  2W18 A;  5AFU 3;  3PXT D;  2H14 A;  2Z2P A;  3DSM A;  2IUR A;  3RSE C;  4A2M A;  3RN1 D;  4PSX B;  2B4E A;  3I7P A;  2IWK A;  3C99 A;  2AH0 A;  2P9U C;  5CXC B;  3UVN A;  3B7F A;  4ERY A;  4OWR A;  3OL2 B;  4GMB A;  3PVW B;  4JSV C;  4XEI C;  3AH8 B;  2B5L A;  2AGW A;  2I3S A;  3F3P A;  2PBI B;  4KFM B;  3EI2 B;  2OK4 A;  3PXS D;  1MG2 A;  3EI4 B;  1N6E A;  3UVO A;  3VH0 A;  1K32 A;  4J81 A;  1JMZ B;  3AL9 A;  4GM8 A;  4QRJ A;  4ESG A;  5EAM A;  4AOW A;  3JB9 L;  3EI2 A;  3PSC B;  5C2V B;  4JXM A;  4CY5 A;  4N14 A;  4JSP C;  3EI1 A;  3BG1 A;  3JZG A;  3JAM g;  4CY1 A;  3SBQ A;  4ZOV A;  5GXH A;  2I0T A;  3AFC A;  3I7K A;  2HKR A;  3JRO A;  3N0E A;  3IJC A;  4H5I A;  5H14 A;  3EI1 B;  1JMX B;  4JD2 C;  3SCY A;  3CFV A;  3N0D A;  4D6V A;  2IUP A;  5EM2 A;  1GP2 B;  3SHF A;  4CY2 A;  2OJY A;  4FWW A;  3SJL D;  4OZU A;  1L0Q A;  4ERQ A;  5TEE A;  1B9X A;  2CE9 A;  2OVQ B;  4O9D A;  1PEV A;  2CO0 A;  5JWZ A;  4A08 A;  2I0R A;  3SWS D;  2IUV A;  5C9Z B;  4AEZ A;  3OKY A;  4Y5R D;  5EM2 B;  2CN2 A;  4LG9 A;  3IIY A;  4E54 A;  4BL0 A;  1ERJ A;  3UVK A;  1PGU A;  3EI3 B;  2YMU A;  3VA6 A;  4A08 B;  4H5J A;  4Y7R A;  5HE0 B;  5GXI A;  3OKY B;  4L3H D;  3V9F A;  4FA9 D;  4L9O A;  2GC4 A;  2B5M A;  2P9P C;  3IIW A;  4YVD A;  3MKS B;  2B5N A;  3PXW D;  3I8C A;  3DXK C;  2YNO A;  3MMY A;  2HJ4 A;  4J0W A;  4PBZ A;  4I79 A;  5AJA A;  5A2Q g;  5HYN B;  4X61 B;  2HES X;  3DWL C;  3MZL A;  4G56 B;  4FAN D;  3I7O A;  2PM9 A;  1XHM A;  5EMK B;  3JZN A;  2AGZ A;  3U4Y A;  2P9S C;  3GRE A;  3L4M D;  3RN0 D;  3L4O D;  2IUQ A;  3GFC A;  3NVN A;  4FA5 D;  5I5M A;  2Z2O A;  2CO0 C;  4X63 B;  4A2L A;  3I7N A;  4PSW B;  4GZ8 A;  3RLM D;  4CZY A;  3W15 A;  2UZY B;  4Z8L A;  1R5M A;  3RMZ D;  2G99 A;  5HE1 B;  3ORV D;  4MK0 B;  4FAV D;  4FB1 D;  2J57 G;  3C9C A;  2GNQ A;  3V5W B;  2IAA A;  3KRW B;  4L3G D;  2BBK H;  4XYI A;  4J87 A;  2EBS A;  3UKR C;  2HJB A;  4CI1 A;  3EU7 A;  1TYQ C;  3IKO A;  3RRM C;  4LGN A;  3C5M A;  1FWX A;  3UVM A;  2AGY A;  1SQ9 A;  4ES0 A;  3FGB A;  3EWE A;  3EMH A;  3OW8 A;  5TEF A;  5HE3 B;  2H9M A;  3NVQ A;  2H47 A;  5CXB A;  4FA1 D;  2H9P A;  3E0C A;  2O9K A;  4PNK B;  5HQG A;  4IA9 A;  5FLX g;  2XL3 A;  4ZN4 A;  3UKU C;  4FA4 D;  2XU7 A;  3SLE D;  3UR4 A;  2H68 A;  1SQJ A;  4CI3 A;  4QL1 A;  3ODT A;  3PE7 A;  4FHL A;  1P22 A;  3SXT D;  3C75 H;  1A0R B;  3RFH A;  5IGQ A;  4GGC A;  2H9N A;  3I7L A;  5CYK A;  4QQE A;  3I8E A;  3OKW A;  3MZK A;  4CI2 A;  5CXC A;  2PM7 B;  5HE2 B;  5I5J A;  1TBG A;  4J84 A;  3K27 A;  3SBP A;  1PI6 A;  2J55 H;  5CYK B;  2AGX A;  4PC0 A;  4BUJ C;  4A0A A;  2BCJ B;  2AQ5 A;  2TRC B;  1MG3 A;  3HFQ A;  3SMR A;  1XIP A;  2CN3 A;  4GQ1 A;  5IC7 A;  5I5I A;  2HKM A;  1GG2 B;  4GGA A;  4A09 B;  1B9Y A;  5EML B;  3FRX A;  5IJ7 E;  1NR0 A;  4D0K A;  2I3T A;  3ULE C;  5THA A;  3MXX A;  4CI8 A;  5TF2 A;  4BH6 A;  5EMJ B;  1OMW B;  3V7D B;  5CXB B;  5GSA A;  3SN6 B;  5IJ8 E;  4NSX A;  4J8G A;  4GM3 A;  4J79 A;  2YB8 B;  4EWR A;  3IJ1 A;  4X60 B;  1VYH C; 
#chains in the Genus database with same CATH topology
 2QR5 A;  5H1M A;  2AH1 A;  3PVU B;  4ZOZ A;  2AGL A;  5EAP A;  4PXW A;  1YFQ A;  3I7H A;  4A0B B;  2H6Q A;  2YBA A;  3DXM C;  4GQB B;  1A12 A;  2YNN A;  1UTC A;  5B4W A;  3IJE A;  3UVL A;  4JHN A;  4PBY A;  3SBR A;  4NC4 A;  3DM0 A;  3MKQ A;  3VGZ A;  3VI3 A;  3FCS A;  4HDJ A;  2G9A A;  4E5Z A;  2OK6 A;  4JT5 C;  3I2N A;  4J78 A;  4A0B A;  1U2V C;  4BCB A;  1GOT B;  3FM0 A;  3AL8 A;  4U1E I;  5K1C C;  1PBY B;  5FQD A;  3IUJ A;  4JT6 C;  4ZOX A;  4J77 A;  3A0F A;  4G55 A;  1RI6 A;  3MUO A;  4AX4 A;  2JKX A;  2QXV A;  3EI3 A;  1K3I A;  3NID A;  2IWF A;  2Z2N A;  5FA5 B;  5HDB A;  4GQ2 P;  2VDP A;  3KRX B;  3F3F A;  1JJU B;  2P9I C;  2BKL A;  3K71 A;  3QHY B;  3SVW D;  3OKT A;  5C86 A;  5C92 A;  5FKR A;  4A09 A;  2I0S A;  5M61 A;  4O3T B;  4AMZ A;  2P9L C;  4J0X A;  1OLZ A;  4U7A A;  1SHY B;  3IUR A;  3O4H A;  2OVR B;  4WK4 A;  5IGO A;  1I2M B;  2PM9 B;  3IUL A;  1JOF A;  1Q47 A;  2HU5 A;  5M5V A;  1H2Z A;  1N6D A;  1GXR A;  3KCI A;  3PSL A;  2OVP B;  4K3I D;  5AMS A;  5EAL A;  4CZX A;  5IT9 g;  4A11 B;  3EI4 A;  4CC9 A;  4A0A B;  2P9N C;  2QC5 A;  1C9I A;  3OTT A;  4GGD A;  5M5R A;  3J80 g;  3RFG A;  4NEN A;  4O3U B;  4R7A B;  3CFS B;  4UI9 R;  3BWS A;  2XYI A;  5FKQ A;  1VZ2 A;  3NVX A;  1QNI A;  4JSX C;  4JSN C;  4MMZ A;  4ZOY A;  2MTA H;  4O1Q D;  2H6N A;  2VDN A;  4J86 A;  1MDA H;  1UOP A;  4TZ4 A;  2H13 A;  4J8B A;  3NIF A;  2Q7Q A;  4A11 A;  3OL2 A;  5FKT A;  3K26 A;  1GOH A;  2H3X A;  3ZWL B;  2J56 H;  1E8M A;  4NBM A;  2XL2 A;  4CZV A;  3J81 g;  5M5S A;  1TYE A;  3JPX A;  2PM6 B;  2HYE A;  2GC7 A;  5E6U A;  4X3E A;  2H9L A;  5EAR A;  3JRP A;  5H17 A;  2HXC A;  2H6K A;  5C2W B;  3NIG A;  5FKS A;  3IJ0 A;  4CY3 A;  5FFO A;  4E5Z B;  4QT8 A;  2CNX A;  3AL8 B;  4J82 A;  5FXY A;  3GC3 B;  2VDR A;  4J73 A;  4XYH A;  4IMM A;  5TDH B;  4ERZ A;  3EQ9 A;  1NEX B;  2OIZ A;  3IUM A;  4L1Q D;  3EQ7 A;  4L1M A;  3ZE2 A;  2P9K C;  3EG6 A;  3CIK B;  5GMK n;  1VZ3 A;  2HU8 A;  1S4U X;  2CE8 A;  5EMM B;  4E54 B;  5M5T A;  3P4F A;  4GM9 A;  4O45 A;  2UZX B;  3F3G A;  1K8K C;  1XKS A;  2YNP A;  1H2Y A;  5KDO B;  3DDU A;  4QAM A;  5SXM A;  4WK0 A;  1N6F A;  3BG0 A;  3I89 A;  2EIE A;  3JZH A;  3SFZ A;  1U4C A;  4A7J A;  5K19 A;  4LG8 A;  4K3J B;  2W18 A;  5AFU 3;  2XZG A;  3PXT D;  2H14 A;  2Z2P A;  3DSM A;  2IUR A;  3RSE C;  4A2M A;  3RN1 D;  4PSX B;  1T2X A;  2B4E A;  3QI0 A;  3I7P A;  4G1M A;  2IWK A;  3C99 A;  2AH0 A;  2P9U C;  2VDM A;  5CXC B;  3UVN A;  3B7F A;  4ERY A;  4OWR A;  3GD1 I;  3OL2 B;  4GMB A;  3PVW B;  4JSV C;  4XEI C;  3AH8 B;  2B5L A;  2AGW A;  2I3S A;  2VDL A;  3F3P A;  2PBI B;  4KFM B;  3EI2 B;  3PXS D;  2OK4 A;  1MG2 A;  1E8N A;  3EI4 B;  2EIB A;  1N6E A;  3UVO A;  3VH0 A;  1U8C A;  4DNU A;  2EID A;  4AN1 A;  1K32 A;  4J81 A;  4O02 A;  3K72 A;  3O4I A;  4BP9 A;  1JMZ B;  3AL9 A;  4GM8 A;  3O4G A;  4JHP C;  4QRJ A;  4ESG A;  5EAM A;  4AOW A;  3JB9 L;  3EI2 A;  3PSC B;  5C2V B;  4JXM A;  4CY5 A;  4N14 A;  4JSP C;  4BP8 A;  3EI1 A;  3BG1 A;  3JZG A;  3JAM g;  1VE7 A;  5E6S A;  1VE6 A;  4CY1 A;  3SBQ A;  4ZOV A;  5GXH A;  2I0T A;  3AFC A;  3I7K A;  2HKR A;  3JRO A;  2VDK A;  3N0E A;  3IJC A;  4H5I A;  4WK2 A;  5H14 A;  3EI1 B;  3T3P A;  1JMX B;  4JD2 C;  4WJK A;  3SCY A;  3CFV A;  3N0D A;  4D6V A;  2IUP A;  5EM2 A;  1GP2 B;  3SHF A;  4CY2 A;  2OJY A;  4FWW A;  3SJL D;  4G1E A;  1L0Q A;  4OZU A;  4ERQ A;  5TEE A;  1B9X A;  2CE9 A;  2OVQ B;  4O9D A;  1PEV A;  1UOQ A;  2CO0 A;  5JWZ A;  4A08 A;  2I0R A;  3SWS D;  2IUV A;  5C9Z B;  1O6F A;  4AEZ A;  3OKY A;  4Y5R D;  5EM2 B;  2CN2 A;  3IUN A;  2VC2 A;  3IIY A;  4LG9 A;  3ZE0 A;  4E54 A;  4AN0 A;  1QFM A;  1GOG A;  4BL0 A;  1BPO A;  1ERJ A;  3UVK A;  1PGU A;  3EI3 B;  2YMU A;  3VA6 A;  4UM8 A;  3ZE1 A;  4A08 B;  4H5J A;  4O2W A;  4Y7R A;  1H2W A;  5HE0 B;  5GXI A;  3OKY B;  4L3H D;  5M5U A;  3V9F A;  3IUQ A;  4FA9 D;  4L9O A;  4AMY A;  2GC4 A;  2B5M A;  2P9P C;  3IIW A;  4YVD A;  3MKS B;  2HU7 A;  2B5N A;  3PXW D;  3I8C A;  3DXK C;  4MMX A;  2YNO A;  3MMY A;  3ZDX A;  2HJ4 A;  4J0W A;  4PBZ A;  4RE6 A;  1L5G A;  4I79 A;  5AJA A;  3ZDZ A;  5A2Q g;  5HYN B;  2HES X;  4X61 B;  3DWL C;  3MZL A;  4G56 B;  1UOO A;  1E5T A;  2WQ8 A;  4FAN D;  3I7O A;  2PM9 A;  1XHM A;  5EMK B;  3JZN A;  2AGZ A;  3U4Y A;  2P9S C;  3GRE A;  3FCU A;  3L4M D;  3RN0 D;  3L4O D;  2IUQ A;  3GFC A;  3NVN A;  4FA5 D;  5I5M A;  2VDO A;  2Z2O A;  2CO0 C;  3K6S A;  4X63 B;  4A2L A;  3I7N A;  4PSW B;  2QZP A;  4GZ8 A;  3RLM D;  4CZY A;  3W15 A;  2UZY B;  3VI4 A;  4Z8L A;  1R5M A;  3RMZ D;  2G99 A;  5HE1 B;  4Z7N A;  3ORV D;  4MK0 B;  3EQ8 A;  4IRZ A;  4FAV D;  1GOF A;  1YR2 A;  4FB1 D;  2J57 G;  3C9C A;  2VZ1 A;  2GNQ A;  3MUN A;  3V5W B;  2IAA A;  3KRW B;  3OF7 A;  4L3G D;  2BBK H;  2VDQ A;  4XYI A;  4J87 A;  2EBS A;  3UKR C;  2HJB A;  4CI1 A;  3EU7 A;  3V4V A;  1TYQ C;  3IKO A;  3RRM C;  4LGN A;  3C5M A;  1FWX A;  3UVM A;  2AGY A;  1SQ9 A;  4NAA A;  4ES0 A;  3FGB A;  3EWE A;  4UM9 A;  3EMH A;  3OW8 A;  5TEF A;  5HE3 B;  3V4P A;  2H9M A;  3NVQ A;  2H47 A;  5CXB A;  4FA1 D;  1O6G A;  2H9P A;  3E0C A;  2O9K A;  4PNK B;  5HQG A;  4IA9 A;  5FLX g;  2XL3 A;  1JTD B;  3ZDY A;  4ZN4 A;  3UKU C;  4FA4 D;  2XU7 A;  3SLE D;  2XDW A;  3UR4 A;  2H68 A;  1SQJ A;  4CI3 A;  4QL1 A;  3ODT A;  4MMY A;  3PE7 A;  4FHL A;  1P22 A;  4DNW A;  3SXT D;  3C75 H;  4Z7Q A;  1A0R B;  1QFS A;  3RFH A;  5IGQ A;  4GGC A;  2H9N A;  3I7L A;  5CYK A;  2EIC A;  4RE5 A;  4QQE A;  5E6R A;  3I8E A;  3OKW A;  3MZK A;  4CI2 A;  5CXC A;  2PM7 B;  5HE2 B;  5I5J A;  1TBG A;  4J84 A;  3K27 A;  3SBP A;  1PI6 A;  2J55 H;  5CYK B;  2AGX A;  4PC0 A;  4BUJ C;  4A0A A;  1M1X A;  2BCJ B;  2AQ5 A;  2VZ3 A;  2TRC B;  1MG3 A;  3HFQ A;  3SMR A;  1XIP A;  4BCD A;  2CN3 A;  4GQ1 A;  1JV2 A;  5IC7 A;  4BCC A;  1C9L A;  5I5I A;  2HKM A;  1GG2 B;  4GGA A;  4Z7O A;  4A09 B;  1B9Y A;  5EML B;  4DNV A;  3FRX A;  4D9S A;  5IJ7 E;  1NR0 A;  4D0K A;  2I3T A;  3ULE C;  5THA A;  3MXX A;  4CI8 A;  5FFG A;  3MVD K;  5TF2 A;  4BH6 A;  5EMJ B;  1OMW B;  3V7D B;  5CXB B;  3T3M A;  3O4J A;  5GSA A;  3SN6 B;  5IJ8 E;  4NSX A;  3IVM A;  4J8G A;  4GM3 A;  1H2X A;  4J79 A;  2YB8 B;  4EWR A;  3IJ1 A;  4X60 B;  2XE4 A;  1VYH C; 
#chains in the Genus database with same CATH homology
 5H1M A;  2AH1 A;  3PVU B;  4ZOZ A;  2AGL A;  5EAP A;  4PXW A;  1YFQ A;  3I7H A;  4A0B B;  2H6Q A;  2YBA A;  3DXM C;  4GQB B;  2YNN A;  5B4W A;  3UVL A;  4PBY A;  3SBR A;  3DM0 A;  3MKQ A;  3VGZ A;  4HDJ A;  2G9A A;  4E5Z A;  2OK6 A;  4JT5 C;  3I2N A;  4J78 A;  4A0B A;  1U2V C;  1GOT B;  3FM0 A;  3AL8 A;  4U1E I;  5K1C C;  1PBY B;  5FQD A;  4JT6 C;  4ZOX A;  4J77 A;  3A0F A;  1RI6 A;  2QXV A;  3EI3 A;  2IWF A;  2Z2N A;  5FA5 B;  4GQ2 P;  3KRX B;  3F3F A;  1JJU B;  2P9I C;  3SVW D;  3OKT A;  5FKR A;  4A09 A;  2I0S A;  4O3T B;  2P9L C;  4J0X A;  1OLZ A;  4U7A A;  1SHY B;  2OVR B;  5IGO A;  2PM9 B;  1JOF A;  1Q47 A;  4K3I D;  1N6D A;  1GXR A;  3PSL A;  2OVP B;  4CZX A;  5AMS A;  5EAL A;  5IT9 g;  4A11 B;  3EI4 A;  4CC9 A;  4A0A B;  2P9N C;  2QC5 A;  4GGD A;  3OTT A;  3J80 g;  3RFG A;  4O3U B;  4R7A B;  3CFS B;  4UI9 R;  3BWS A;  2XYI A;  5FKQ A;  3NVX A;  1QNI A;  4JSX C;  4JSN C;  4ZOY A;  2MTA H;  4O1Q D;  2H6N A;  4J86 A;  1MDA H;  4TZ4 A;  2H13 A;  4J8B A;  2Q7Q A;  4A11 A;  3OL2 A;  5FKT A;  3K26 A;  2H3X A;  3ZWL B;  2J56 H;  2XL2 A;  4CZV A;  3J81 g;  3JPX A;  2PM6 B;  2HYE A;  2GC7 A;  4X3E A;  2H9L A;  5EAR A;  3JRP A;  5H17 A;  2HXC A;  2H6K A;  5C2W B;  5FKS A;  3IJ0 A;  4CY3 A;  4E5Z B;  4QT8 A;  2CNX A;  3AL8 B;  4J82 A;  5FXY A;  4J73 A;  4XYH A;  4IMM A;  5TDH B;  4ERZ A;  1NEX B;  2OIZ A;  4L1Q D;  2P9K C;  3EG6 A;  3CIK B;  5GMK n;  1S4U X;  2CE8 A;  5EMM B;  4E54 B;  3P4F A;  4GM9 A;  4O45 A;  2UZX B;  3F3G A;  1K8K C;  1XKS A;  2YNP A;  5KDO B;  5SXM A;  1N6F A;  3BG0 A;  3I89 A;  3JZH A;  3SFZ A;  1U4C A;  4A7J A;  5K19 A;  4LG8 A;  4K3J B;  2W18 A;  5AFU 3;  3PXT D;  2H14 A;  2Z2P A;  3DSM A;  2IUR A;  3RSE C;  4A2M A;  3RN1 D;  4PSX B;  2B4E A;  3I7P A;  2IWK A;  3C99 A;  2AH0 A;  2P9U C;  5CXC B;  3UVN A;  3B7F A;  4ERY A;  4OWR A;  3OL2 B;  4GMB A;  3PVW B;  4JSV C;  4XEI C;  3AH8 B;  2B5L A;  2AGW A;  2I3S A;  3F3P A;  2PBI B;  4KFM B;  3EI2 B;  2OK4 A;  3PXS D;  1MG2 A;  3EI4 B;  1N6E A;  3UVO A;  3VH0 A;  1K32 A;  4J81 A;  1JMZ B;  3AL9 A;  4GM8 A;  4QRJ A;  4ESG A;  5EAM A;  4AOW A;  3JB9 L;  3EI2 A;  3PSC B;  5C2V B;  4JXM A;  4CY5 A;  4N14 A;  4JSP C;  3EI1 A;  3BG1 A;  3JZG A;  3JAM g;  4CY1 A;  3SBQ A;  4ZOV A;  5GXH A;  2I0T A;  3AFC A;  3I7K A;  2HKR A;  3JRO A;  3N0E A;  3IJC A;  4H5I A;  5H14 A;  3EI1 B;  1JMX B;  4JD2 C;  3SCY A;  3CFV A;  3N0D A;  4D6V A;  2IUP A;  5EM2 A;  1GP2 B;  3SHF A;  4CY2 A;  2OJY A;  4FWW A;  3SJL D;  4OZU A;  1L0Q A;  4ERQ A;  5TEE A;  1B9X A;  2CE9 A;  2OVQ B;  4O9D A;  1PEV A;  2CO0 A;  5JWZ A;  4A08 A;  2I0R A;  3SWS D;  2IUV A;  5C9Z B;  4AEZ A;  3OKY A;  4Y5R D;  5EM2 B;  2CN2 A;  4LG9 A;  3IIY A;  4E54 A;  4BL0 A;  1ERJ A;  3UVK A;  1PGU A;  3EI3 B;  2YMU A;  3VA6 A;  4A08 B;  4H5J A;  4Y7R A;  5HE0 B;  5GXI A;  3OKY B;  4L3H D;  3V9F A;  4FA9 D;  4L9O A;  2GC4 A;  2B5M A;  2P9P C;  3IIW A;  4YVD A;  3MKS B;  2B5N A;  3PXW D;  3I8C A;  3DXK C;  2YNO A;  3MMY A;  2HJ4 A;  4J0W A;  4PBZ A;  4I79 A;  5AJA A;  5A2Q g;  5HYN B;  4X61 B;  2HES X;  3DWL C;  3MZL A;  4G56 B;  4FAN D;  3I7O A;  2PM9 A;  1XHM A;  5EMK B;  3JZN A;  2AGZ A;  3U4Y A;  2P9S C;  3GRE A;  3L4M D;  3RN0 D;  3L4O D;  2IUQ A;  3GFC A;  3NVN A;  4FA5 D;  5I5M A;  2Z2O A;  2CO0 C;  4X63 B;  4A2L A;  3I7N A;  4PSW B;  4GZ8 A;  3RLM D;  4CZY A;  3W15 A;  2UZY B;  4Z8L A;  1R5M A;  3RMZ D;  2G99 A;  5HE1 B;  3ORV D;  4MK0 B;  4FAV D;  4FB1 D;  2J57 G;  3C9C A;  2GNQ A;  3V5W B;  2IAA A;  3KRW B;  4L3G D;  2BBK H;  4XYI A;  4J87 A;  2EBS A;  3UKR C;  2HJB A;  4CI1 A;  3EU7 A;  1TYQ C;  3IKO A;  3RRM C;  4LGN A;  3C5M A;  1FWX A;  3UVM A;  2AGY A;  1SQ9 A;  4ES0 A;  3FGB A;  3EWE A;  3EMH A;  3OW8 A;  5TEF A;  5HE3 B;  2H9M A;  3NVQ A;  2H47 A;  5CXB A;  4FA1 D;  2H9P A;  3E0C A;  2O9K A;  4PNK B;  5HQG A;  4IA9 A;  5FLX g;  2XL3 A;  4ZN4 A;  3UKU C;  4FA4 D;  2XU7 A;  3SLE D;  3UR4 A;  2H68 A;  1SQJ A;  4CI3 A;  4QL1 A;  3ODT A;  3PE7 A;  4FHL A;  1P22 A;  3SXT D;  3C75 H;  1A0R B;  3RFH A;  5IGQ A;  4GGC A;  2H9N A;  3I7L A;  5CYK A;  4QQE A;  3I8E A;  3OKW A;  3MZK A;  4CI2 A;  5CXC A;  2PM7 B;  5HE2 B;  5I5J A;  1TBG A;  4J84 A;  3K27 A;  3SBP A;  1PI6 A;  2J55 H;  5CYK B;  2AGX A;  4PC0 A;  4BUJ C;  4A0A A;  2BCJ B;  2AQ5 A;  2TRC B;  1MG3 A;  3HFQ A;  3SMR A;  1XIP A;  2CN3 A;  4GQ1 A;  5IC7 A;  5I5I A;  2HKM A;  1GG2 B;  4GGA A;  4A09 B;  1B9Y A;  5EML B;  3FRX A;  5IJ7 E;  1NR0 A;  4D0K A;  2I3T A;  3ULE C;  5THA A;  3MXX A;  4CI8 A;  5TF2 A;  4BH6 A;  5EMJ B;  1OMW B;  3V7D B;  5CXB B;  5GSA A;  3SN6 B;  5IJ8 E;  4NSX A;  4J8G A;  4GM3 A;  4J79 A;  2YB8 B;  4EWR A;  3IJ1 A;  4X60 B;  1VYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...