3RNAC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i100w double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rnaC00
2RDBC 3GE3C 3DHGC 3DHIC 4P1BC 2INDC 3I63C 3Q14C 3GE8C 2INCC 3RNBC 3RMKC 3RNFC 1T0RC 3RNEC 1T0QC 3Q3OC 3N1XC 3Q3NC 3RNGC 3RN9C 3I5JC 4P1CC 3Q2AC 1T0SC 3N1ZC 3DHHC 3RI7C 3N20C 3RNCC 3RNAC 3N1YC 3Q3MC
chains in the Genus database with same CATH superfamily
2XNAC 3AB5A 1V80A 3Q69A 3PREA 4GN1A 3HVDA 4KKJA 4MGYE 2J0MA 3DBRI 1IGDA 3N1XC 2BQQA 4ARIA 4MGIE 4FJYA 1UGMA 1FFVA 1E6EB 1GNUA 1DYQA 1WH3A 4BFRA 3PRMB 4BAXA 5BYSA 1WX7A 3GZNB 1C79A 1NYRA 3B0AA 3P42A 5D6JB 3RZWC 2XK5B 4EFOA 3H7PB 3PPAA 2MBQA 2K3UA 2INPE 3Q6BA 2JXTA 1YN5A 2ZJDA 1IPGA 1MPEA 2BB6A 4MJSA 2L83A 2NVUI 4NAMA 1FRDA 1OFFA 4LNFA 3ETRA 3VFKA 3AE2B 2J0JA 3N30A 5D2MB 5IP4D 3AECB 4HPMB 2GMIC 3Q8AA 4LNKA 3L08A 1WFYA 3B9JA 1DOYA 3ECIA 1LXDA 2DZJA 3IXSA 4GDKA 2VH2A 2CU1A 4HROA 2OHFA 3ZNHB 3DQVA 1WM2A 2X8XX 2AYOB 2B3AA 2KN4A 2X38A 4IWOA 3R7QA 2RMMA 2D3CA 2IY0B 3PT2B 5CTRC 1C4AA 1WXSA 1N6ZA 2ZZPB 1T0QC 2RR9A 2NTTA 2YLMA 2JT4B 3BK1A 4TV3A 2ONQA 4II2B 4DXFA 4YTNB 2PW9A 3X23A 3HK0A 3AE3B 2LD9A 3BVGA 4A9AA 4KGTA 1V1OA 5AZHA 1P7EA 4ZYNA 2LGDA 3I63C 1XO3A 1E10A 3K9PB 3A33B 1XLNA 2PLPA 4MGKE 1VZ7A 3UIPB 1GUAB 1WE6A 1Q10A 4KSLC 3R7RA 2L1AA 1L0XB 1V8CA 3CWIA 3EUB2 1EWYC 2G45B 4EE2A 1TKGA 2PKOA 5JH5C 2WXGA 4Q2JA 3LB8C 2K8BA 3RNEC 4RFBA 2N9XA 4RH6A 1A5RA 3VTVA 3PZ7A 2WXRA 1GC6A 1NEKB 4FULA 2GBKA 5G5HA 2D07B 1HA5A 3U30A 2MLBA 1E7PB 2FCQA 1SJHD 4HKQA 3ZJUA 4QAYA 2JRHA 1N61A 2ZVOA 3B08A 4TMAB 3ZNZB 3MTNB 2SEBD 3QAQA 1WGYA 2J52A 4OVUA 2FUG1 2ZNVC 4MEMA 3IVFA 4R3DA 4PK1A 3P4SB 3SFDB 3AE7B 2O6VB 1QOFA 1AWDA 1OQYA 3DVNU 4MJSB 4DXAB 2CHWA 2JF5A 1KH0A 3TSSA 5C1ZA 4B6WA 1OEYA 3DOWA 4YSXB 4OZBA 2JUOA 5KHQA 3SDLC 1CZPA 2JVCA 2JZPA 1D5XC 1WR6E 2LI5A 3FC4A 5JXVA 2KLCA 2V3SA 3ZJVA 2N7JA 1T0RC 1QT9A 1TIFA 3SR6A 2NR2A 2KWUB 1T6BX 1V5TA 1HZ6A 2AQ2B 3HM3A 2RPVA 4FJVB 1VDVA 1FNVA 3UIOB 5GMVA 4B9KA 1WGHA 1ACCA 3LXFA 4MT5A 4DHJB 2M0XA 1ZXHA 1FD6A 1I7HA 2G4SA 2HJ1A 4NJ6A 4EOYA 3CMMB 4PS7A 3MC0B 2EMTA 4MGZE 1WF9A 5C3JB 2MHJA 2WXOA 1ISNA 4YTPB 1MG4A 2ZVNA 1SSNA 1VRAB 4TUUA 4W9GA 1ET6A 3IAS1 3ZNGC 4BZAA 2RDGA 4LNOA 4K81A 5CX3A 4P16A 1WXVA 1D5ZC 3ZLZA 2N9LA 3URYA 4W9JA 2OEDA 5DCNA 1J7CA 2EMSA 4X57B 3UF8A 2A4ZA 4HKZE 2DX5B 1GOZA 3M95A 1BUIC 3B2FA 4WWPA 5DPRA 3A4RA 4I6NB 4RMAA 2DAJA 3IG3A 3GS2A 4BKSA 2RSUA 2Z59B 2KYWA 4G3XB 4AWJA 3B1LX 3O65B 2GOWA 1KLUD 2DZIA 2N1VA 3Q3MC 1FRRA 4LNNA 2LJ5A 1IP9A 3W5UB 5D94A 4XGAB 1D6EC 2NBVB 3NY5A 4BKGA 2RGFA 4BKTA 3TBLD 3HIZA 5IOIA 2BBCA 2ON8A 1I4RA 4LDTD 2LASA 2PEAA 4E3CA 1JROA 3QX1A 2I38A 4JLCA 4MACA 3U8ZA 2KJ6A 2DHZA 4AOFA 1FNWA 1NVID 2KVRA 3EFCA 4CO7A 3DWMA 3MJWA 2M19A 2IGDA 4C80A 3PGEA 3DVGX 1IYFA 2IO3B 4XX5A 1RM6C 2Y5BB 4W9IA 4BKSD 1WWTA 3ZW3A 1EWCA 4A55A 3T8MA 2BGFA 1RYJA 3BYTB 3RULA 3Q8FA 2ZCBA 1FM0D 2RD0A 2BKRB 3C19A 3OLMD 2KQSA 2QCZA 4BOSC 4IWPA 1V49A 4EUTA 1E8ZA 1JCKB 5MPOA 4M01A 1ZOYB 1KOTA 4ANUA 4JX1C 4XWTA 3Q3JA 3L0WB 1C9FA 2DWQA 2BVCA 3TEZA 2MJDA 1F1HA 2G4DB 3P63A 1N62A 2KFKB 3SEBA 4W9DA 3IT6B 1R4MB 3PHWB 3U7DA 1JQ4A 2KDIA 1NDDA 1E7VA 1FMAD 2QEJC 1GC7A 4JWSC 1WGDA 4D2KA 4IM3A 3AN1A 2BYFA 1VZ8A 1WRDB 2C7HA 1UZXB 2B76B 3RNGC 5FR3A 1R4NB 1SIJA 2M56B 4HDOA 4JE3B 2AX5A 2N7EA 5AZGA 3RNAC 1TS5A 4DQOC 4ANWA 4ANXA 5D3IB 2XK5A 5EE0A 2KFJA 1WGGA 3DVNV 1MVKA 2AL3A 3EC8A 5AZFA 3KUDB 3Q3FA 5DPTA 2Q5WD 1WY8A 3P4PB 1Q5WB 2DNFA 2HTME 2LUEA 4O1NA 2KQ4X 1ZXIA 1WJ4A 3QARA 2L0TA 4FJZA 5CHFA 1AN8A 1FIQA 1F2RI 3NZSA 2MW5A 3ENEA 4ZDVA 4YTMB 2K39A 4HRSA 4KIKA 2ACZB 4DHZE 1WXAA 2MBOA 3ZRCA 2KWVB 4K3BA 4M00A 2GB1A 2WDQB 3AEGB 2N1WA 4WIPA 4ITKA 1SE9A 3ALBA 1L6VA 3WANA 1TS2A 2GBRA 2Y5PA 5FK9C 3JW0X 4HPLB 3U52E 2NCNA 3E56A 3I3TB 2CR5A 3N1YC 1IBXA 2VZKD 3EA6A 1J0GA 3NRZA 1YJ1A 4K7WA 1I4GA 3LJ3A 4A8XC 2LWPA 1N5XA 3WAMA 1ENFA 1HE8A 2GI9A 3P4RB 2TSSA 2ZEQA 4BOZB 4YSYB 1TTNA 4LJPB 2V0GA 1MG8A 2K0PA 3VUWA 1QKZA 2PPHA 2L52A 2LVQA 1J19A 4FN2A 2YVCA 4GDLB 4M8MA 3WCQA 3PVLA 1ZGUB 4S17A 1Q0WB 1NI2A 1SEBD 4IKGA 2QIEB 2RDBC 2H88B 2WDTB 2IBIB 4EZJA 3DVGY 3Q14C 4OHJA 2LJIA 3BIID 1WX8A 1PGAA 1I42A 3DBSA 2QC8A 4M02A 2KC2A 2LVOA 2K6QA 2Z8LA 4ANVA 1M94A 2O6VA 1IGCA 2R61A 1RRBA 4RGNA 3RCZA 1EU4A 1K8RB 4UDUC 2VZKB 1TKEA 4RNAA 3TUOA 3PS6A 1WZ0A 4W9CA 2KKCA 1F0ZA 4NY0A 2BTEA 4P1CC 3QC8B 4YT0B 4KIKB 1KRHA 1HEZE 4MSQB 2V3PA 3H8HA 5IN7A 1SJED 1FXTB 2INNE 1JRPA 3GZNI 2ASQA 1K53A 3AE1B 2V3NA 3E9SA 1TY0A 2Z0DB 2MX2A 2EKEC 2HJ8A 1GB4A 1CMXB 3GP7A 3DBHB 3NJTA 1AARA 2WXMA 1P1AA 1SGHA 3PTFC 1MJDA 2IDYA 2L7RA 2K8CA 1QOAA 3AULA 3UQAA 2O6VD 4LNIA 3TJPA 1YJJA 1MFWA 1XLPA 4HJKA 1IBXB 4WJPA 2L05A 2WU2B 3RN9C 3ZDMC 1ZDXA 3ZKJC 2JYTA 4TQ1A 1XLOA 1WZ3A 2FIDA 3V6CB 5C2TB 5J18A 4C4VB 2VH1A 5BMHA 2HE7A 1LQBA 1ET9A 1J8CA 2N9EB 2C60A 1L2NA 4ZYSA 4NNJB 1UD7A 3Q3NC 2JU6X 3N32A 4HEA1 2FCSA 1EF5A 3AEFB 4GLSC 1Y56A 4FBJB 1Z2MA 2KX3A 2VRRB 3IHPC 4HCPB 3DBLB 1XCTL 4MH8A 2GBNA 5GXGB 3Q8EA 2W82A 4DHJD 2KNBA 1DGJA 1EU3A 4PS3A 2JYEA 4YL8A 1NBFC 4WAFA 4AUQC 3QA8A 3QHTA 2PJHA 4RGOS 4XDDA 4DXGA 4GSWA 1H4RA 2WX0A 3VTUA 2QJLA 1G6JA 2MA9B 4BBNF 2FIFA 3RFZB 2KX0A 4W9EA 3IAM1 5FR6A 4BBNC 1S1QB 3WAOA 2MP2B 4WQMA 4KGSA 1N63A 3HUIA 3MP9A 4ZHOA 4NZLB 3QWZB 2K6DB 3AEDB 5EE3A 2LRWA 1L0YB 1N60A 2AL6A 4DWFA 1D4BA 3VAWA 1GB1A 1UBQA 3DBLI 1T5XD 4RGMA 5LNK1 3ZXVA 3AEEB 4N9F4 3DHGC 3R66C 5L83A 4XYCA 3R2IA 2BB5A 2IO2B 3KW5B 3OAWA 1XCQL 2WXFA 3VQIA 3W1SA 2L32A 3NVWA 3A9KA 1YNTE 1K51A 1PGBA 1I4HA 1WX9A 2QSDA 4RCOA 4C56C 1OQRA 1YX6B 2WXQA 3L10B 4A3PA 5LLIA 2N9PC 3KH0A 5IKCM 4AQ7A 2AEHA 3SFEB 2J53A 2BW2A 4NQLB 3GB1A 3C8YA 5AUKA 3NG0A 4WJOA 3OG5A 2KFKA 3N9YC 2LGSA 3AEBB 3T3NA 3FAHA 1YX5B 3RMKC 4G0NB 1HZ5A 4WWMA 1WSPA 4HJGE 4XE0A 2KANA 2GBJA 4FA6A 2BS3B 4YXDB 4LCDE 2DENB 2LZ6A 5G2NA 1TT5B 1PUTA 3FILA 1YN3A 2JRIB 2AWTA 3NS1A 5G55A 3VTWA 1XF5L 2PTLA 1FFUA 3OJ4B 4US8A 2QILA 1P3QU 1PFDA 3W1SC 5LXIB 1LGRA 4GU2A 4PS8A 4MSMB 1XT9B 3RD2A 3CF6E 3SU8X 3PLVA 1JW9D 2WXHA 2FAZA 4EZLA 1BXTA 2WWZA 3BVMA 1C3TA 1TZ1A 1L7YA 1SB3C 3L16A 2WU5B 4IOIE 1P7FA 3V6EB 4NJCA 2K8HA 3VR9B 2WQYB 3VHTC 1MHXA 4G50A 4C00A 1EM7A 2MEKA 2YEPB 2KD0A 2MJEA 5E6JA 2C5LC 1EF1A 4GXBA 1AW7A 1FXAA 1L6UA 2WYQA 3W9CB 5BMGA 5EDSA 2WNMA 3HVZA 3M63B 5HKHA 3ONSA 1WYGA 4K1RB 2JZ3B 3RZFA 3T9LA 5BYRA 1WGKA 2QDFA 4ASWC 3VDZA 2ICIA 3A9KB 3NZ3A 3MHZA 1HTOA 2WXPA 2QMTA 1YJIA 2LUMA 5JZEB 3T3OA 4TQ0A 3MJ5A 4K7UA 3UI3A 1E8WA 1YQ4B 1TJEA 1E8YA 2KWCA 4B95A 3QJZA 2NBUA 1ZUD2 2KMAA 4PT5A 1VZ6A 4AS1A 2CU3A 1SE3A 3DPDA 1Q1OA 4MH0E 1C1YB 2G9HD 3VRAB 2DZMA 1C78A 3JSVA 2FE8A 5IAAC 3L4PA 3W2DA 2L0FA 4GDLA 1V9JA 1XD3B 4L2YA 3A4SC 4ZOHC 1IUEA 1F77A 5D3DA 2FUHB 1XQQA 2RPQA 2L00B 4ARCA 4LTUA 4AJWA 3U4EG 3FILB 3ZRFA 2GRIA 2DLBA 2M17A 2LRUA 1X1MA 4URKA 2W54A 3DCGA 1TGZB 4J3OD 3RYTA 1PQSA 3IBEA 3I57A 4IG7B 4W9HA 3EECA 2WXJA 2EKIA 1GAQB 3EFUA 1JWSD 2I1JA 4H2AA 2JY6A 4AJYB 1P9DU 3UGBB 4GMVA 1QOGA 4L1BA 4MM3A 2LMCA 1NYQA 3QIJA 5C23A 1R4MI 4NPNA 2NTSA 1ZDVA 4KDIC 1C4CA 2DBYA 4F1SA 2M0AA 2PIAA 1BT0A 4IW0A 3AE5B 3BYYB 4WH4A 1V81A 4NAWA 5EE9A 1FPYA 1VD2A 3VH3B 2C7NB 3MC9A 1WM3A 1R4NI 1T0SC 2C7MB 3ZTDA 3DHHC 5E6NA 3KWVA 3KYCD 2V9HA 1KF6B 3GE3C 4EZKA 1YD8U 4F7ZA 5TR5A 2KDEB 3HRDD 3P1MA 2BF8B 1DOXA 1XEEA 1TZOA 4XC2A 1UWXA 3KWLA 3LYYA 3ZNID 1VR9A 3EGRA 4ICUA 2ZPNA 2H89B 2KJHB 4RGTA 4JGHB 2PMVA 3L17A 2D3BA 4W9LA 1E0ZA 2K25A 5I4DA 2KTFA 2ZW0A 2DAFA 2V1YA 1MHHE 1SIFA 3AXCA 2KLGA 4B0MA 1MI0A 3DBRB 3PHXB 2BKFA 2LFIA 3JYUA 5D7GA 2DYBA 1OEYJ 4HPPA 2KO3A 2W3SA 2EELA 4C4VA 1XLQA 5AEKB 4P6VF 4GB9A 1B1ZA 1T3QA 4K3CA 2CJNA 2KZRA 2LEKA 4GIVA 4E71A 1TS3A 2WXLA 3JSVB 2MH7A 4ZRJA 1JWUD 3VXWA 3H9DA 1P0RA 3V3XA 1QQRA 1WR1A 4OZCA 3V62A 4WAAA 4WQOB 3TIXA 2W55A 4ZRQA 4OZAA 3C0RB 4K7SA 3AM9A 4AP4C 3J9CA 3PSEB 2JZZA 4IDIA 1FEHA 3HHMA 2WS3B 1UNSA 1SF0A 4GGQA 4P7IA 1RFKA 2DZKA 3A1QB 2MBEA 1L4ZB 3ML8A 3H1UA 2BWES 4HWIB 1WE7A 4DDGD 2NS5A 4BVUC 2M8SA 1E7UA 2J4XA 4MM3B 2MP2A 3MFGA 2MCNB 5HI1A 2LGIA 2OJRA 2W9NA 4NQKE 3ZO5B 4IC7B 3K9OB 2IGGA 4A20A 2G3QB 1Z5SB 2LGYA 3AU5A 1TS4A 4I6PA 2IO1B 5HG2A 3AU4A 2WLBA 1ZE3D 1UH6A 3R3MA 3DDCB 3O13A 2GLSA 4NAWB 1QLBB 1I35A 3APFA 1JWBD 3NS8A 4HDQA 1GJZA 1YOVB 1A70A 2N9KA 4ACFA 1UBIA 2R2OA 3KLSX 3V05A 2PE6B 5J2RA 3TCAA 4JPSA 1WRIA 1OTRB 2SAKA 3BWUD 2O2VB 2XBBC 1M4VA 4REZA 3N3KB 1UWMA 2D10A 4A90A 2J0KA 3PRZA 3R8BA 3ZGZA 4KKIA 4RF0A 3ABVB 3GOEA 2WGSA 3EHVA 1JMLA 2MQJA 3GE8C 2L3ZA 2ZW1A 1J7AA 4L23A 2BS4B 4LJOB 2KMCA 2BYVE 3TMPB 4CHKA 3TEYA 3P4QB 1UUPA 4M0WA 2MWSB 5FKAC 2UU7A 3NVZA 2BT6A 3U7ZA 4IWQA 1ESFA 3AMZA 2LVPA 1V1PB 4MDKE 4EKUA 2FNJB 2CJOA 5IO9A 2IYDB 3M62B 3CIRB 4HXDA 4FXCA 4LLGM 3Q3OC 3DBHI 1UGJA 3I5JC 2FCNA 1VLBA 2KWDA 2LHDA 5IA7A 1QF6A 2KXJA 3P2BA 4RM9A 3AEAB 3QK0A 2JWUA 2WXNA 3CSFA 1WJUA 4XWWA 2MRPA 1ZKHA 1WMHB 3JVZX 3WA0A 4FHJA 1F9JA 3Q2AC 3ZIMA 3NHEB 1ZPSA 3U2SC 2AQ3B 4HVBA 3VR8B 1HXYD 4KZCA 1I4QA 2HDEA 3AH7A 1P98A 2ZPYA 1YQ3B 2IY1B 1UELA 2UYZB 1WXMA 3MHSD 2PVOD 4JWUC 4HCNB 2GBMA 1WGRA 2HD5B 2JXXA 1V86A 2C9WB 1SXTA 3WALA 4KZ0A 2N4FA 1I4XA 2KQ7A 1V97A 4PYZA 3ML9A 2LGXA 3TEXA 3AE8B 1JWAD 2J42A 2KK8A 4CYEA 1LO5D 1TKYA 2WDVB 3APCA 4DBGA 2NBWB 1I4PA 4ZHPA 2L76A 1KLVA 5T8IA 4KV2A 4WURA 2N0SB 2WHIA 4GDKB 1V5OA 4M8NA 3PRPB 2KTRA 3BY4B 1QOBA 3PO0A 3Q8BA 3UINB 2D3AA 1L5PA 4WJQA 4DDID 1V2YA 4KDLB 2G1EA 1GG3A 5E6OA 2MBHA 1WXQA 4JL9A 3SHQA 4HLEA 5DPWA 2BPSA 1STEA 2Z0EB 1RLFA 4DK5A 5BYQA 4P1BC 3BK2A 2BYEA 4M0WB 2INDC 5H8YE 3R2TA 2YEPF 4S0RA 2BWFA 3V61A 1EO6A 2ZNVB 4IM0A 4ZRPA 2AQ1B 2N7DA 3BINA 1HTQA 4KGRA 1VJKA 4KSKC 3NVYA 4WWOA 1PYWD 1KLGD 2D11A 3AI5A 3DHIC 2K5PA 1V6EA 4MELA 2WX1A 1C4PA 2UWQA 3VH4B 3PZDA 3DWGC 4XDCA 2RDHA 3VVWB 3N1ZC 2CHXA 2IO0B 5HFYA 3OJ3A 1JRUA 4KVGB 1HQRD 3BZDB 4A3OA 1TYGB 1RWSA 1FNUA 3RNFC 4C7YA 1BMLC 1WJ6A 1H8CA 4YSZB 5J17A 4PYUA 3A9JA 2R2QA 3M3JA 1SBBB 1KFYB 4W9KA 3APDA 4LK0M 1K50A 3SD5A 5BMIA 1PGXA 1U4AA 3KQ4A 4N59A 4ZRKA 2JPHA 2KN5A 1KM7A 4F8CB 3KYDD 2K1FA 3PZ8A 1LFDA 4XZ4A 4J6IA 4YWGG 3NZUA 4ZRIA 1GPXA 3NVVA 3IT4B 1K52A 5BO4B 3AE4B 4JQWC 1ZP0B 4A6QA 3KVFB 2KDMA 5DPSA 1EUVB 2D3GA 4N58A 2KAJA 1PDXA 2CKHB 3AE6B 3BVZA 2XN9C 4OVZA 4TKNA 2INCC 1YN4A 1E8XA 4G11A 4DHZB 1CQVA 1CJEA 1F2RC 2KTRB 3WAPA 1QZEA 2I1KA 2E3TA 3CSTA 1WIAA 2V4IB 4GOCA 3PV1A 2KOXA 4IUMB 5EE1A 2D5GA 4EEWA 3I9V1 2OOBB 3QCAA 3VUYA 1ZW7A 1FXIA 1YIWA 1YQBA 1CK1A 1NI3A 1D3ZA 4FHKA 2CHZA 3Q8CA 2KT7A 2MSED 3IFWB 2XEWA 2NMQA 5G5GA 3ZJTA 2KVZA 3H7SA 1FCCC 2QHOA 1XXGA 4WWNA 2KDBA 4US9A 2NPTA 4WJNA 1S3SG 2BYTA 3RT3B 4KX6B 1J7BA 3KUCB 1RFAA 1TY2A 2DYOA 1AYFA 2Y5CA 2KC1A 2KHWB 4E74A 2KJRA 1FCLA 3RUIB 2Y3AA 2M1MA 2ZCCA 3W5VB 2KDFB 4CQNA 1OQQA 4LDTB 3A1QA 4C7ZA 2E6XA 2OJWA 5HHDG 4FLHA 4TSSA 1E9MA 3S2AA 4W9FA 3QQ8B 5JHAA 3LDZE 1N5WA 4NJ7A 2J7QB 1E90A 2M4NA 3ZXRA 2IPKD 1ROEA 2IZVB 2I2YA 1C77A 3ZYYX 3OWEB 2K22A 3W1YA 2CS4A 3NOBA 3A9JB 2JQRB 4FADA 1KJTA 3AV8A 3MC8A 3H7PA 1VCBA 2WXKA 4B0EA 1SE4A 5CHVC 4RF1A 1WJNA 4IM2A 5TSSA 1T0YA 1B9RA 5KHOA 3WIMA 2REXA 2MJ3A 1WYWB 2IJ0A 3TEWA 1SE2A 2WP9B 5LXHA 2MBBB 3RNCC 4II3B 1L4DB 4I6LB 1QILA 3V60A 1Y8RC 1JWMD 3L54A 1F52A 2DYMA 2V4LA 4OW0A 2FBWB 3VUXA 3X0WA 2O2VA 1RAXA 4OVVA 3RNBC 3ZQ4A 4ICVA 4HK2A 3RPFC 3ZDTA 1LM8B 3AE9B 1C76A 3HM6X 1UF0A 3FKYA 4N6EB 2FCMA 3VRBB 1WI0A 1JALA 1R7SA 2JWZA 1YMHE 2KACA 2A5UA 2HTHA 3L13A 2LXAA 4USAA 2L8JA 4RM8A 2IGHA 3ZTCA 1D5MC 1KTKA 1V1PA 2LHEA 3B2GA 3RI7C 3ZVVA 2LXCA 3N20C 2K9XA 5CHWA 4JIOU 3UQBA 2JSVX 2D2QA 3KUZA 3NUHB 2PE9A 5L95C 2W3RA 2JX5A 1L0VB 3TL5A 1FO4A 3PLUA 1E5WA 3H6NA 2NPTB 3D32A 1NENB 2WXIA 5JHBA 2BS2B 2WDRB 5E6PA 1OGWA 1TBEA 5AUIA 2PVGC 2KMMA 1WMHA 1DOIA 5H92C 3ZUNA
chains in the Genus database with same CATH topology
2RDBC 3GE3C 3DHGC 3DHIC 4P1BC 2INDC 3I63C 3Q14C 3GE8C 2INCC 3RNBC 3RMKC 3RNFC 1T0RC 3RNEC 1T0QC 3Q3OC 3N1XC 3Q3NC 3RNGC 3RN9C 3I5JC 4P1CC 3Q2AC 1T0SC 3N1ZC 3DHHC 3RI7C 3N20C 3RNCC 3RNAC 3N1YC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDB C;  3GE3 C;  3DHG C;  3DHI C;  4P1B C;  2IND C;  3I63 C;  3Q14 C;  3GE8 C;  2INC C;  3RNB C;  3RMK C;  3RNF C;  1T0R C;  3RNE C;  1T0Q C;  3Q3O C;  3N1X C;  3Q3N C;  3RNG C;  3RN9 C;  3I5J C;  4P1C C;  3Q2A C;  1T0S C;  3N1Z C;  3DHH C;  3RI7 C;  3N20 C;  3RNC C;  3RNA C;  3N1Y C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 2XNA C;  3AB5 A;  1V80 A;  3Q69 A;  3PRE A;  4GN1 A;  3HVD A;  4KKJ A;  4MGY E;  2J0M A;  3DBR I;  1IGD A;  3N1X C;  2BQQ A;  4ARI A;  4MGI E;  4FJY A;  1UGM A;  1FFV A;  1E6E B;  1GNU A;  1DYQ A;  1WH3 A;  4BFR A;  3PRM B;  4BAX A;  5BYS A;  1WX7 A;  3GZN B;  1C79 A;  1NYR A;  3B0A A;  3P42 A;  5D6J B;  3RZW C;  2XK5 B;  4EFO A;  3H7P B;  3PPA A;  2MBQ A;  2K3U A;  2INP E;  3Q6B A;  2JXT A;  1YN5 A;  2ZJD A;  1IPG A;  1MPE A;  2BB6 A;  4MJS A;  2L83 A;  2NVU I;  4NAM A;  1FRD A;  1OFF A;  4LNF A;  3ETR A;  3VFK A;  3AE2 B;  2J0J A;  3N30 A;  5D2M B;  5IP4 D;  3AEC B;  4HPM B;  2GMI C;  3Q8A A;  4LNK A;  3L08 A;  1WFY A;  3B9J A;  1DOY A;  3ECI A;  1LXD A;  2DZJ A;  3IXS A;  4GDK A;  2VH2 A;  2CU1 A;  4HRO A;  2OHF A;  3ZNH B;  3DQV A;  1WM2 A;  2X8X X;  2AYO B;  2B3A A;  2KN4 A;  2X38 A;  4IWO A;  3R7Q A;  2RMM A;  2D3C A;  2IY0 B;  3PT2 B;  5CTR C;  1C4A A;  1WXS A;  1N6Z A;  2ZZP B;  1T0Q C;  2RR9 A;  2NTT A;  2YLM A;  2JT4 B;  3BK1 A;  4TV3 A;  2ONQ A;  4II2 B;  4DXF A;  4YTN B;  2PW9 A;  3X23 A;  3HK0 A;  3AE3 B;  2LD9 A;  3BVG A;  4A9A A;  4KGT A;  1V1O A;  5AZH A;  1P7E A;  4ZYN A;  2LGD A;  3I63 C;  1XO3 A;  1E10 A;  3K9P B;  3A33 B;  1XLN A;  2PLP A;  4MGK E;  1VZ7 A;  3UIP B;  1GUA B;  1WE6 A;  1Q10 A;  4KSL C;  3R7R A;  2L1A A;  1L0X B;  1V8C A;  3CWI A;  3EUB 2;  1EWY C;  2G45 B;  4EE2 A;  1TKG A;  2PKO A;  5JH5 C;  2WXG A;  4Q2J A;  3LB8 C;  2K8B A;  3RNE C;  4RFB A;  2N9X A;  4RH6 A;  1A5R A;  3VTV A;  3PZ7 A;  2WXR A;  1GC6 A;  1NEK B;  4FUL A;  2GBK A;  5G5H A;  2D07 B;  1HA5 A;  3U30 A;  2MLB A;  1E7P B;  2FCQ A;  1SJH D;  4HKQ A;  3ZJU A;  4QAY A;  2JRH A;  1N61 A;  2ZVO A;  3B08 A;  4TMA B;  3ZNZ B;  3MTN B;  2SEB D;  3QAQ A;  1WGY A;  2J52 A;  4OVU A;  2FUG 1;  2ZNV C;  4MEM A;  3IVF A;  4R3D A;  4PK1 A;  3P4S B;  3SFD B;  3AE7 B;  2O6V B;  1QOF A;  1AWD A;  1OQY A;  3DVN U;  4MJS B;  4DXA B;  2CHW A;  2JF5 A;  1KH0 A;  3TSS A;  5C1Z A;  4B6W A;  1OEY A;  3DOW A;  4YSX B;  4OZB A;  2JUO A;  5KHQ A;  3SDL C;  1CZP A;  2JVC A;  2JZP A;  1D5X C;  1WR6 E;  2LI5 A;  3FC4 A;  5JXV A;  2KLC A;  2V3S A;  3ZJV A;  2N7J A;  1T0R C;  1QT9 A;  1TIF A;  3SR6 A;  2NR2 A;  2KWU B;  1T6B X;  1V5T A;  1HZ6 A;  2AQ2 B;  3HM3 A;  2RPV A;  4FJV B;  1VDV A;  1FNV A;  3UIO B;  5GMV A;  4B9K A;  1WGH A;  1ACC A;  3LXF A;  4MT5 A;  4DHJ B;  2M0X A;  1ZXH A;  1FD6 A;  1I7H A;  2G4S A;  2HJ1 A;  4NJ6 A;  4EOY A;  3CMM B;  4PS7 A;  3MC0 B;  2EMT A;  4MGZ E;  1WF9 A;  5C3J B;  2MHJ A;  2WXO A;  1ISN A;  4YTP B;  1MG4 A;  2ZVN A;  1SSN A;  1VRA B;  4TUU A;  4W9G A;  1ET6 A;  3IAS 1;  3ZNG C;  4BZA A;  2RDG A;  4LNO A;  4K81 A;  5CX3 A;  4P16 A;  1WXV A;  1D5Z C;  3ZLZ A;  2N9L A;  3URY A;  4W9J A;  2OED A;  5DCN A;  1J7C A;  2EMS A;  4X57 B;  3UF8 A;  2A4Z A;  4HKZ E;  2DX5 B;  1GOZ A;  3M95 A;  1BUI C;  3B2F A;  4WWP A;  5DPR A;  3A4R A;  4I6N B;  4RMA A;  2DAJ A;  3IG3 A;  3GS2 A;  4BKS A;  2RSU A;  2Z59 B;  2KYW A;  4G3X B;  4AWJ A;  3B1L X;  3O65 B;  2GOW A;  1KLU D;  2DZI A;  2N1V A;  3Q3M C;  1FRR A;  4LNN A;  2LJ5 A;  1IP9 A;  3W5U B;  5D94 A;  4XGA B;  1D6E C;  2NBV B;  3NY5 A;  4BKG A;  2RGF A;  4BKT A;  3TBL D;  3HIZ A;  5IOI A;  2BBC A;  2ON8 A;  1I4R A;  4LDT D;  2LAS A;  2PEA A;  4E3C A;  1JRO A;  3QX1 A;  2I38 A;  4JLC A;  4MAC A;  3U8Z A;  2KJ6 A;  2DHZ A;  4AOF A;  1FNW A;  1NVI D;  2KVR A;  3EFC A;  4CO7 A;  3DWM A;  3MJW A;  2M19 A;  2IGD A;  4C80 A;  3PGE A;  3DVG X;  1IYF A;  2IO3 B;  4XX5 A;  1RM6 C;  2Y5B B;  4W9I A;  4BKS D;  1WWT A;  3ZW3 A;  1EWC A;  4A55 A;  3T8M A;  2BGF A;  1RYJ A;  3BYT B;  3RUL A;  3Q8F A;  2ZCB A;  1FM0 D;  2RD0 A;  2BKR B;  3C19 A;  3OLM D;  2KQS A;  2QCZ A;  4BOS C;  4IWP A;  1V49 A;  4EUT A;  1E8Z A;  1JCK B;  5MPO A;  4M01 A;  1ZOY B;  1KOT A;  4ANU A;  4JX1 C;  4XWT A;  3Q3J A;  3L0W B;  1C9F A;  2DWQ A;  2BVC A;  3TEZ A;  2MJD A;  1F1H A;  2G4D B;  3P63 A;  1N62 A;  2KFK B;  3SEB A;  4W9D A;  3IT6 B;  1R4M B;  3PHW B;  3U7D A;  1JQ4 A;  2KDI A;  1NDD A;  1E7V A;  1FMA D;  2QEJ C;  1GC7 A;  4JWS C;  1WGD A;  4D2K A;  4IM3 A;  3AN1 A;  2BYF A;  1VZ8 A;  1WRD B;  2C7H A;  1UZX B;  2B76 B;  3RNG C;  5FR3 A;  1R4N B;  1SIJ A;  2M56 B;  4HDO A;  4JE3 B;  2AX5 A;  2N7E A;  5AZG A;  3RNA C;  1TS5 A;  4DQO C;  4ANW A;  4ANX A;  5D3I B;  2XK5 A;  5EE0 A;  2KFJ A;  1WGG A;  3DVN V;  1MVK A;  2AL3 A;  3EC8 A;  5AZF A;  3KUD B;  3Q3F A;  5DPT A;  2Q5W D;  1WY8 A;  3P4P B;  1Q5W B;  2DNF A;  2HTM E;  2LUE A;  4O1N A;  2KQ4 X;  1ZXI A;  1WJ4 A;  3QAR A;  2L0T A;  4FJZ A;  5CHF A;  1AN8 A;  1FIQ A;  1F2R I;  3NZS A;  2MW5 A;  3ENE A;  4ZDV A;  4YTM B;  2K39 A;  4HRS A;  4KIK A;  2ACZ B;  4DHZ E;  1WXA A;  2MBO A;  3ZRC A;  2KWV B;  4K3B A;  4M00 A;  2GB1 A;  2WDQ B;  3AEG B;  2N1W A;  4WIP A;  4ITK A;  1SE9 A;  3ALB A;  1L6V A;  3WAN A;  1TS2 A;  2GBR A;  2Y5P A;  5FK9 C;  3JW0 X;  4HPL B;  3U52 E;  2NCN A;  3E56 A;  3I3T B;  2CR5 A;  3N1Y C;  1IBX A;  2VZK D;  3EA6 A;  1J0G A;  3NRZ A;  1YJ1 A;  4K7W A;  1I4G A;  3LJ3 A;  4A8X C;  2LWP A;  1N5X A;  3WAM A;  1ENF A;  1HE8 A;  2GI9 A;  3P4R B;  2TSS A;  2ZEQ A;  4BOZ B;  4YSY B;  1TTN A;  4LJP B;  2V0G A;  1MG8 A;  2K0P A;  3VUW A;  1QKZ A;  2PPH A;  2L52 A;  2LVQ A;  1J19 A;  4FN2 A;  2YVC A;  4GDL B;  4M8M A;  3WCQ A;  3PVL A;  1ZGU B;  4S17 A;  1Q0W B;  1NI2 A;  1SEB D;  4IKG A;  2QIE B;  2RDB C;  2H88 B;  2WDT B;  2IBI B;  4EZJ A;  3DVG Y;  3Q14 C;  4OHJ A;  2LJI A;  3BII D;  1WX8 A;  1PGA A;  1I42 A;  3DBS A;  2QC8 A;  4M02 A;  2KC2 A;  2LVO A;  2K6Q A;  2Z8L A;  4ANV A;  1M94 A;  2O6V A;  1IGC A;  2R61 A;  1RRB A;  4RGN A;  3RCZ A;  1EU4 A;  1K8R B;  4UDU C;  2VZK B;  1TKE A;  4RNA A;  3TUO A;  3PS6 A;  1WZ0 A;  4W9C A;  2KKC A;  1F0Z A;  4NY0 A;  2BTE A;  4P1C C;  3QC8 B;  4YT0 B;  4KIK B;  1KRH A;  1HEZ E;  4MSQ B;  2V3P A;  3H8H A;  5IN7 A;  1SJE D;  1FXT B;  2INN E;  1JRP A;  3GZN I;  2ASQ A;  1K53 A;  3AE1 B;  2V3N A;  3E9S A;  1TY0 A;  2Z0D B;  2MX2 A;  2EKE C;  2HJ8 A;  1GB4 A;  1CMX B;  3GP7 A;  3DBH B;  3NJT A;  1AAR A;  2WXM A;  1P1A A;  1SGH A;  3PTF C;  1MJD A;  2IDY A;  2L7R A;  2K8C A;  1QOA A;  3AUL A;  3UQA A;  2O6V D;  4LNI A;  3TJP A;  1YJJ A;  1MFW A;  1XLP A;  4HJK A;  1IBX B;  4WJP A;  2L05 A;  2WU2 B;  3RN9 C;  3ZDM C;  1ZDX A;  3ZKJ C;  2JYT A;  4TQ1 A;  1XLO A;  1WZ3 A;  2FID A;  3V6C B;  5C2T B;  5J18 A;  4C4V B;  2VH1 A;  5BMH A;  2HE7 A;  1LQB A;  1ET9 A;  1J8C A;  2N9E B;  2C60 A;  1L2N A;  4ZYS A;  4NNJ B;  1UD7 A;  3Q3N C;  2JU6 X;  3N32 A;  4HEA 1;  2FCS A;  1EF5 A;  3AEF B;  4GLS C;  1Y56 A;  4FBJ B;  1Z2M A;  2KX3 A;  2VRR B;  3IHP C;  4HCP B;  3DBL B;  1XCT L;  4MH8 A;  2GBN A;  5GXG B;  3Q8E A;  2W82 A;  4DHJ D;  2KNB A;  1DGJ A;  1EU3 A;  4PS3 A;  2JYE A;  4YL8 A;  1NBF C;  4WAF A;  4AUQ C;  3QA8 A;  3QHT A;  2PJH A;  4RGO S;  4XDD A;  4DXG A;  4GSW A;  1H4R A;  2WX0 A;  3VTU A;  2QJL A;  1G6J A;  2MA9 B;  4BBN F;  2FIF A;  3RFZ B;  2KX0 A;  4W9E A;  3IAM 1;  5FR6 A;  4BBN C;  1S1Q B;  3WAO A;  2MP2 B;  4WQM A;  4KGS A;  1N63 A;  3HUI A;  3MP9 A;  4ZHO A;  4NZL B;  3QWZ B;  2K6D B;  3AED B;  5EE3 A;  2LRW A;  1L0Y B;  1N60 A;  2AL6 A;  4DWF A;  1D4B A;  3VAW A;  1GB1 A;  1UBQ A;  3DBL I;  1T5X D;  4RGM A;  5LNK 1;  3ZXV A;  3AEE B;  4N9F 4;  3DHG C;  3R66 C;  5L83 A;  4XYC A;  3R2I A;  2BB5 A;  2IO2 B;  3KW5 B;  3OAW A;  1XCQ L;  2WXF A;  3VQI A;  3W1S A;  2L32 A;  3NVW A;  3A9K A;  1YNT E;  1K51 A;  1PGB A;  1I4H A;  1WX9 A;  2QSD A;  4RCO A;  4C56 C;  1OQR A;  1YX6 B;  2WXQ A;  3L10 B;  4A3P A;  5LLI A;  2N9P C;  3KH0 A;  5IKC M;  4AQ7 A;  2AEH A;  3SFE B;  2J53 A;  2BW2 A;  4NQL B;  3GB1 A;  3C8Y A;  5AUK A;  3NG0 A;  4WJO A;  3OG5 A;  2KFK A;  3N9Y C;  2LGS A;  3AEB B;  3T3N A;  3FAH A;  1YX5 B;  3RMK C;  4G0N B;  1HZ5 A;  4WWM A;  1WSP A;  4HJG E;  4XE0 A;  2KAN A;  2GBJ A;  4FA6 A;  2BS3 B;  4YXD B;  4LCD E;  2DEN B;  2LZ6 A;  5G2N A;  1TT5 B;  1PUT A;  3FIL A;  1YN3 A;  2JRI B;  2AWT A;  3NS1 A;  5G55 A;  3VTW A;  1XF5 L;  2PTL A;  1FFU A;  3OJ4 B;  4US8 A;  2QIL A;  1P3Q U;  1PFD A;  3W1S C;  5LXI B;  1LGR A;  4GU2 A;  4PS8 A;  4MSM B;  1XT9 B;  3RD2 A;  3CF6 E;  3SU8 X;  3PLV A;  1JW9 D;  2WXH A;  2FAZ A;  4EZL A;  1BXT A;  2WWZ A;  3BVM A;  1C3T A;  1TZ1 A;  1L7Y A;  1SB3 C;  3L16 A;  2WU5 B;  4IOI E;  1P7F A;  3V6E B;  4NJC A;  2K8H A;  3VR9 B;  2WQY B;  3VHT C;  1MHX A;  4G50 A;  4C00 A;  1EM7 A;  2MEK A;  2YEP B;  2KD0 A;  2MJE A;  5E6J A;  2C5L C;  1EF1 A;  4GXB A;  1AW7 A;  1FXA A;  1L6U A;  2WYQ A;  3W9C B;  5BMG A;  5EDS A;  2WNM A;  3HVZ A;  3M63 B;  5HKH A;  3ONS A;  1WYG A;  4K1R B;  2JZ3 B;  3RZF A;  3T9L A;  5BYR A;  1WGK A;  2QDF A;  4ASW C;  3VDZ A;  2ICI A;  3A9K B;  3NZ3 A;  3MHZ A;  1HTO A;  2WXP A;  2QMT A;  1YJI A;  2LUM A;  5JZE B;  3T3O A;  4TQ0 A;  3MJ5 A;  4K7U A;  3UI3 A;  1E8W A;  1YQ4 B;  1TJE A;  1E8Y A;  2KWC A;  4B95 A;  3QJZ A;  2NBU A;  1ZUD 2;  2KMA A;  4PT5 A;  1VZ6 A;  4AS1 A;  2CU3 A;  1SE3 A;  3DPD A;  1Q1O A;  4MH0 E;  1C1Y B;  2G9H D;  3VRA B;  2DZM A;  1C78 A;  3JSV A;  2FE8 A;  5IAA C;  3L4P A;  3W2D A;  2L0F A;  4GDL A;  1V9J A;  1XD3 B;  4L2Y A;  3A4S C;  4ZOH C;  1IUE A;  1F77 A;  5D3D A;  2FUH B;  1XQQ A;  2RPQ A;  2L00 B;  4ARC A;  4LTU A;  4AJW A;  3U4E G;  3FIL B;  3ZRF A;  2GRI A;  2DLB A;  2M17 A;  2LRU A;  1X1M A;  4URK A;  2W54 A;  3DCG A;  1TGZ B;  4J3O D;  3RYT A;  1PQS A;  3IBE A;  3I57 A;  4IG7 B;  4W9H A;  3EEC A;  2WXJ A;  2EKI A;  1GAQ B;  3EFU A;  1JWS D;  2I1J A;  4H2A A;  2JY6 A;  4AJY B;  1P9D U;  3UGB B;  4GMV A;  1QOG A;  4L1B A;  4MM3 A;  2LMC A;  1NYQ A;  3QIJ A;  5C23 A;  1R4M I;  4NPN A;  2NTS A;  1ZDV A;  4KDI C;  1C4C A;  2DBY A;  4F1S A;  2M0A A;  2PIA A;  1BT0 A;  4IW0 A;  3AE5 B;  3BYY B;  4WH4 A;  1V81 A;  4NAW A;  5EE9 A;  1FPY A;  1VD2 A;  3VH3 B;  2C7N B;  3MC9 A;  1WM3 A;  1R4N I;  1T0S C;  2C7M B;  3ZTD A;  3DHH C;  5E6N A;  3KWV A;  3KYC D;  2V9H A;  1KF6 B;  3GE3 C;  4EZK A;  1YD8 U;  4F7Z A;  5TR5 A;  2KDE B;  3HRD D;  3P1M A;  2BF8 B;  1DOX A;  1XEE A;  1TZO A;  4XC2 A;  1UWX A;  3KWL A;  3LYY A;  3ZNI D;  1VR9 A;  3EGR A;  4ICU A;  2ZPN A;  2H89 B;  2KJH B;  4RGT A;  4JGH B;  2PMV A;  3L17 A;  2D3B A;  4W9L A;  1E0Z A;  2K25 A;  5I4D A;  2KTF A;  2ZW0 A;  2DAF A;  2V1Y A;  1MHH E;  1SIF A;  3AXC A;  2KLG A;  4B0M A;  1MI0 A;  3DBR B;  3PHX B;  2BKF A;  2LFI A;  3JYU A;  5D7G A;  2DYB A;  1OEY J;  4HPP A;  2KO3 A;  2W3S A;  2EEL A;  4C4V A;  1XLQ A;  5AEK B;  4P6V F;  4GB9 A;  1B1Z A;  1T3Q A;  4K3C A;  2CJN A;  2KZR A;  2LEK A;  4GIV A;  4E71 A;  1TS3 A;  2WXL A;  3JSV B;  2MH7 A;  4ZRJ A;  1JWU D;  3VXW A;  3H9D A;  1P0R A;  3V3X A;  1QQR A;  1WR1 A;  4OZC A;  3V62 A;  4WAA A;  4WQO B;  3TIX A;  2W55 A;  4ZRQ A;  4OZA A;  3C0R B;  4K7S A;  3AM9 A;  4AP4 C;  3J9C A;  3PSE B;  2JZZ A;  4IDI A;  1FEH A;  3HHM A;  2WS3 B;  1UNS A;  1SF0 A;  4GGQ A;  4P7I A;  1RFK A;  2DZK A;  3A1Q B;  2MBE A;  1L4Z B;  3ML8 A;  3H1U A;  2BWE S;  4HWI B;  1WE7 A;  4DDG D;  2NS5 A;  4BVU C;  2M8S A;  1E7U A;  2J4X A;  4MM3 B;  2MP2 A;  3MFG A;  2MCN B;  5HI1 A;  2LGI A;  2OJR A;  2W9N A;  4NQK E;  3ZO5 B;  4IC7 B;  3K9O B;  2IGG A;  4A20 A;  2G3Q B;  1Z5S B;  2LGY A;  3AU5 A;  1TS4 A;  4I6P A;  2IO1 B;  5HG2 A;  3AU4 A;  2WLB A;  1ZE3 D;  1UH6 A;  3R3M A;  3DDC B;  3O13 A;  2GLS A;  4NAW B;  1QLB B;  1I35 A;  3APF A;  1JWB D;  3NS8 A;  4HDQ A;  1GJZ A;  1YOV B;  1A70 A;  2N9K A;  4ACF A;  1UBI A;  2R2O A;  3KLS X;  3V05 A;  2PE6 B;  5J2R A;  3TCA A;  4JPS A;  1WRI A;  1OTR B;  2SAK A;  3BWU D;  2O2V B;  2XBB C;  1M4V A;  4REZ A;  3N3K B;  1UWM A;  2D10 A;  4A90 A;  2J0K A;  3PRZ A;  3R8B A;  3ZGZ A;  4KKI A;  4RF0 A;  3ABV B;  3GOE A;  2WGS A;  3EHV A;  1JML A;  2MQJ A;  3GE8 C;  2L3Z A;  2ZW1 A;  1J7A A;  4L23 A;  2BS4 B;  4LJO B;  2KMC A;  2BYV E;  3TMP B;  4CHK A;  3TEY A;  3P4Q B;  1UUP A;  4M0W A;  2MWS B;  5FKA C;  2UU7 A;  3NVZ A;  2BT6 A;  3U7Z A;  4IWQ A;  1ESF A;  3AMZ A;  2LVP A;  1V1P B;  4MDK E;  4EKU A;  2FNJ B;  2CJO A;  5IO9 A;  2IYD B;  3M62 B;  3CIR B;  4HXD A;  4FXC A;  4LLG M;  3Q3O C;  3DBH I;  1UGJ A;  3I5J C;  2FCN A;  1VLB A;  2KWD A;  2LHD A;  5IA7 A;  1QF6 A;  2KXJ A;  3P2B A;  4RM9 A;  3AEA B;  3QK0 A;  2JWU A;  2WXN A;  3CSF A;  1WJU A;  4XWW A;  2MRP A;  1ZKH A;  1WMH B;  3JVZ X;  3WA0 A;  4FHJ A;  1F9J A;  3Q2A C;  3ZIM A;  3NHE B;  1ZPS A;  3U2S C;  2AQ3 B;  4HVB A;  3VR8 B;  1HXY D;  4KZC A;  1I4Q A;  2HDE A;  3AH7 A;  1P98 A;  2ZPY A;  1YQ3 B;  2IY1 B;  1UEL A;  2UYZ B;  1WXM A;  3MHS D;  2PVO D;  4JWU C;  4HCN B;  2GBM A;  1WGR A;  2HD5 B;  2JXX A;  1V86 A;  2C9W B;  1SXT A;  3WAL A;  4KZ0 A;  2N4F A;  1I4X A;  2KQ7 A;  1V97 A;  4PYZ A;  3ML9 A;  2LGX A;  3TEX A;  3AE8 B;  1JWA D;  2J42 A;  2KK8 A;  4CYE A;  1LO5 D;  1TKY A;  2WDV B;  3APC A;  4DBG A;  2NBW B;  1I4P A;  4ZHP A;  2L76 A;  1KLV A;  5T8I A;  4KV2 A;  4WUR A;  2N0S B;  2WHI A;  4GDK B;  1V5O A;  4M8N A;  3PRP B;  2KTR A;  3BY4 B;  1QOB A;  3PO0 A;  3Q8B A;  3UIN B;  2D3A A;  1L5P A;  4WJQ A;  4DDI D;  1V2Y A;  4KDL B;  2G1E A;  1GG3 A;  5E6O A;  2MBH A;  1WXQ A;  4JL9 A;  3SHQ A;  4HLE A;  5DPW A;  2BPS A;  1STE A;  2Z0E B;  1RLF A;  4DK5 A;  5BYQ A;  4P1B C;  3BK2 A;  2BYE A;  4M0W B;  2IND C;  5H8Y E;  3R2T A;  2YEP F;  4S0R A;  2BWF A;  3V61 A;  1EO6 A;  2ZNV B;  4IM0 A;  4ZRP A;  2AQ1 B;  2N7D A;  3BIN A;  1HTQ A;  4KGR A;  1VJK A;  4KSK C;  3NVY A;  4WWO A;  1PYW D;  1KLG D;  2D11 A;  3AI5 A;  3DHI C;  2K5P A;  1V6E A;  4MEL A;  2WX1 A;  1C4P A;  2UWQ A;  3VH4 B;  3PZD A;  3DWG C;  4XDC A;  2RDH A;  3VVW B;  3N1Z C;  2CHX A;  2IO0 B;  5HFY A;  3OJ3 A;  1JRU A;  4KVG B;  1HQR D;  3BZD B;  4A3O A;  1TYG B;  1RWS A;  1FNU A;  3RNF C;  4C7Y A;  1BML C;  1WJ6 A;  1H8C A;  4YSZ B;  5J17 A;  4PYU A;  3A9J A;  2R2Q A;  3M3J A;  1SBB B;  1KFY B;  4W9K A;  3APD A;  4LK0 M;  1K50 A;  3SD5 A;  5BMI A;  1PGX A;  1U4A A;  3KQ4 A;  4N59 A;  4ZRK A;  2JPH A;  2KN5 A;  1KM7 A;  4F8C B;  3KYD D;  2K1F A;  3PZ8 A;  1LFD A;  4XZ4 A;  4J6I A;  4YWG G;  3NZU A;  4ZRI A;  1GPX A;  3NVV A;  3IT4 B;  1K52 A;  5BO4 B;  3AE4 B;  4JQW C;  1ZP0 B;  4A6Q A;  3KVF B;  2KDM A;  5DPS A;  1EUV B;  2D3G A;  4N58 A;  2KAJ A;  1PDX A;  2CKH B;  3AE6 B;  3BVZ A;  2XN9 C;  4OVZ A;  4TKN A;  2INC C;  1YN4 A;  1E8X A;  4G11 A;  4DHZ B;  1CQV A;  1CJE A;  1F2R C;  2KTR B;  3WAP A;  1QZE A;  2I1K A;  2E3T A;  3CST A;  1WIA A;  2V4I B;  4GOC A;  3PV1 A;  2KOX A;  4IUM B;  5EE1 A;  2D5G A;  4EEW A;  3I9V 1;  2OOB B;  3QCA A;  3VUY A;  1ZW7 A;  1FXI A;  1YIW A;  1YQB A;  1CK1 A;  1NI3 A;  1D3Z A;  4FHK A;  2CHZ A;  3Q8C A;  2KT7 A;  2MSE D;  3IFW B;  2XEW A;  2NMQ A;  5G5G A;  3ZJT A;  2KVZ A;  3H7S A;  1FCC C;  2QHO A;  1XXG A;  4WWN A;  2KDB A;  4US9 A;  2NPT A;  4WJN A;  1S3S G;  2BYT A;  3RT3 B;  4KX6 B;  1J7B A;  3KUC B;  1RFA A;  1TY2 A;  2DYO A;  1AYF A;  2Y5C A;  2KC1 A;  2KHW B;  4E74 A;  2KJR A;  1FCL A;  3RUI B;  2Y3A A;  2M1M A;  2ZCC A;  3W5V B;  2KDF B;  4CQN A;  1OQQ A;  4LDT B;  3A1Q A;  4C7Z A;  2E6X A;  2OJW A;  5HHD G;  4FLH A;  4TSS A;  1E9M A;  3S2A A;  4W9F A;  3QQ8 B;  5JHA A;  3LDZ E;  1N5W A;  4NJ7 A;  2J7Q B;  1E90 A;  2M4N A;  3ZXR A;  2IPK D;  1ROE A;  2IZV B;  2I2Y A;  1C77 A;  3ZYY X;  3OWE B;  2K22 A;  3W1Y A;  2CS4 A;  3NOB A;  3A9J B;  2JQR B;  4FAD A;  1KJT A;  3AV8 A;  3MC8 A;  3H7P A;  1VCB A;  2WXK A;  4B0E A;  1SE4 A;  5CHV C;  4RF1 A;  1WJN A;  4IM2 A;  5TSS A;  1T0Y A;  1B9R A;  5KHO A;  3WIM A;  2REX A;  2MJ3 A;  1WYW B;  2IJ0 A;  3TEW A;  1SE2 A;  2WP9 B;  5LXH A;  2MBB B;  3RNC C;  4II3 B;  1L4D B;  4I6L B;  1QIL A;  3V60 A;  1Y8R C;  1JWM D;  3L54 A;  1F52 A;  2DYM A;  2V4L A;  4OW0 A;  2FBW B;  3VUX A;  3X0W A;  2O2V A;  1RAX A;  4OVV A;  3RNB C;  3ZQ4 A;  4ICV A;  4HK2 A;  3RPF C;  3ZDT A;  1LM8 B;  3AE9 B;  1C76 A;  3HM6 X;  1UF0 A;  3FKY A;  4N6E B;  2FCM A;  3VRB B;  1WI0 A;  1JAL A;  1R7S A;  2JWZ A;  1YMH E;  2KAC A;  2A5U A;  2HTH A;  3L13 A;  2LXA A;  4USA A;  2L8J A;  4RM8 A;  2IGH A;  3ZTC A;  1D5M C;  1KTK A;  1V1P A;  2LHE A;  3B2G A;  3RI7 C;  3ZVV A;  2LXC A;  3N20 C;  2K9X A;  5CHW A;  4JIO U;  3UQB A;  2JSV X;  2D2Q A;  3KUZ A;  3NUH B;  2PE9 A;  5L95 C;  2W3R A;  2JX5 A;  1L0V B;  3TL5 A;  1FO4 A;  3PLU A;  1E5W A;  3H6N A;  2NPT B;  3D32 A;  1NEN B;  2WXI A;  5JHB A;  2BS2 B;  2WDR B;  5E6P A;  1OGW A;  1TBE A;  5AUI A;  2PVG C;  2KMM A;  1WMH A;  1DOI A;  5H92 C;  3ZUN A; 
#chains in the Genus database with same CATH homology
 2RDB C;  3GE3 C;  3DHG C;  3DHI C;  4P1B C;  2IND C;  3I63 C;  3Q14 C;  3GE8 C;  2INC C;  3RNB C;  3RMK C;  3RNF C;  1T0R C;  3RNE C;  1T0Q C;  3Q3O C;  3N1X C;  3Q3N C;  3RNG C;  3RN9 C;  3I5J C;  4P1C C;  3Q2A C;  1T0S C;  3N1Z C;  3DHH C;  3RI7 C;  3N20 C;  3RNC C;  3RNA C;  3N1Y C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...