3RNJA

Crystal structure of the sh3 domain from irsp53 (baiap2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Brain-specific angiogenesis inhibitor 1-associated protein 2
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rnjA00
1GCPA 1AOJA 2FRYA 4LE9A 2LQWA 2LP5A 2KT8A 2ENMA 2G6FX 2K6DA 2W0ZA 1KFZA 2YT6A 1JXOA 2DILA 3REBB 2A37A 4AFUC 1PKSA 4ORZA 4RTXA 1SPKA 4OMLA 2FPDA 2KRSA 4Y92A 1NYGA 1SHGA 3SHWA 4LUDA 1M8MA 4F17A 2VVKA 1B3QA 2YUPA 1WXBA 1UG1A 1AWXA 4F16A 3I35A 2O9VA 3H0HA 3LH5A 2LJ3A 3H0IA 4CC3A 1JO8A 2LX7A 1AZGB 2HEQA 2GBQA 3JV3A 2ESWA 1TUCA 1G83A 2EKHA 4J9DA 4D8KA 4GLMA 2KE9A 1A0NB 1RLQC 1WYXA 4RTTA 1PWTA 4HVUA 1M30A 1K4US 1H8KA 1GBQA 1GCQA 2FPEA 1K0XA 1X27A 2AK5A 4ESRA 2AKLA 1OV3A 2GGRA 1UECA 2VKNA 2YSQA 1GL5A 1MV3A 3M0TA 2HDAA 1H92A 2A36A 3O5ZA 2H8HA 1QKWA 2FEIA 1UHCA 2DE0X 4RTVA 1MV0B 2DLPA 1VYTA 2X3XD 2DA9A 3EHRA 2YUOA 2CDTA 1U06A 2O88A 4RTWA 2KGTA 3THKA 3NPFA 4CC7A 1E6GA 1SHFA 1ZLMA 2RQUA 3I5RA 1PNJA 1ZBJA 3VS7A 2BZ8A 1WA7A 1E6HA 2F2WA 1GRIA 1NLPC 2K79A 1WLPB 2OAWA 2L3PA 3UATA 4M4ZA 1KJWA 1AEYA 2EYYA 1K1ZA 1OOTA 2RQVA 1WXUA 2L3SA 1JEGA 1M27C 2IIMA 4K11A 3NHNA 4IIMA 4EIKA 4F14A 1PKTA 2MCNA 1SEMA 2RNAA 1WDXA 2EGCA 4A63B 3EG0A 1M3AA 1V1CA 1GFCA 2BZYA 5IHIA 4J9GA 4AFZC 2CH4W 2QDLA 2JMAA 2LZ6B 1QWFA 1JQQA 4AFSC 2CSQA 2F2VA 2CUDA 1TG0A 3EG1A 4JJBA 2MOXA 4LNPA 1W6XA 1NYFA 1WI7A 1SRMA 1RLPC 2EBPA 2KR3A 2O2OA 3M0UA 3VRZA 4WCIA 1BK2A 2DL3A 2J6FA 2YUQA 1S1NA 1HJDA 2J6OA 3VS5A 2RQRA 4AG1C 4HXJA 2SRCA 4OMNA 3TSWA 2DMOA 2DL7A 3ULRB 3SEMA 4RTUA 1OPKA 1AWJA 3PVLA 1UHFA 2CREA 2A28A 4JJCA 3IQLA 2FPFA 2ROLA 3FJ5A 1AD5A 1RI9A 3H0FA 1X6GA 2FO0A 1AZEA 2HBWA 3M0QA 4Z88A 1Z9ZA 1WFWA 3UA7A 1AWOA 2PZ1A 5FW9A 2KYBA 2W10A 2GNCA 4CC2A 2C0OA 2K2MA 1YN8A 2EGEA 1BB9A 1WXTA 1I1JA 2C0IA 1ABOA 4X1VA 3CQTA 1Y57A 4JPBW 2B86A 3M0SA 4OMOA 2BTTA 2VWFA 1YP5A 2KXDA 2ED0A 2JW4A 1PRLC 4AFQC 2JTEA 1OEBA 2AKKA 2J6KA 2RN8A 4HCKA 1ZSGA 2F2XA 1M3BA 1UFFA 2SEMA 1AVZC 2DL5A 2DNUA 5FWBA 2LJ1A 1K0SA 4LUEA 2RQWA 2A08A 2KXCA 1X6BA 2LNHB 4OMMA 3U23A 3VS2A 1YWPA 2RQTA 2L3QA 1ZUYA 2GQIA 1KIKA 2DJQA 5IXBA 2JS0A 2KRMA 1T0HA 2EYXA 2GTJA 1K9AA 3EG3A 5IHKA 4OMQA 2EVRA 1GFDA 2ECZA 1JU5C 4LN2A 1GCQC 1YWOA 2JXBA 1ZUKA 1PHTA 1T0JA 2L0AA 1UDLA 1GBRA 2V1QA 1T3SA 4DEYA 1X43A 3EHQA 2DL4A 2LMJA 2JMCA 4KRTA 1OPLA 2EGAA 2PNIA 3VS4A 2KEAA 1EFNA 2FG0A 1UGVA 1SRLA 4RTYA 1X2KA 1X2QA 2OI3A 4JZ3A 2AZVA 2KYMA 1U5SA 2DBKA 4J9HA 5L23A 2CH4A 2K3BA 2AZSA 1MUZA 3QWYA 4J9BA 2YUNA 4FSSA 2M51A 2OJ2A 2JM9A 1CKAA 2LCSA 1Y0MA 2DYBA 1CKBA 2ED1A 1ARKA 5IXFA 1VYVA 1KSWA 2LJ0A 5I22A 4HVWA 1FYNA 2JS2A 4J9CA 1QCFA 1TUDA 1VYUA 2EYZA 2MIOA 3EGUA 3RBBB 2M0YA 4HVVA 2K9GA 1XOVA 2D1XA 2DBMA 2X3WD 3UA6A 1PRMC 3M0RA 3REAB 2K7AA 2J7IA 3PE0A 2I0NA 2RMOA 4RUGA 2DM1A 1NEBA 2EYWA 4D8DA 3C0CA 3TSZA 3I5SA 2FRWA 2CT4A 1JXMA 4R0KA 2BZXA 5GJWB 2CSIA 2HCKA 5HCKA 2KRNA 1VA7A 1YCSB 5EC7A 2KBTA 1UJ0A 4RTZA 2O31A 4J9IA 1LCKA 2DVJA 1YNZA 4GBQA 2XMFA 1NEGA 3PVQA 2CUBA 1FMKA 3EG2A 3M0PA 2JT4A 2DX1A 1Z9QA 2PTKA 1H3HA 4DEXA 1M3CA 4AG2C 2RF0A 1RUWA 3NGPA 3VS6A 3ZL7C 1K76A 1W70A 1SSHA 1J3TA 1I07A 3TVTA 1N5ZA 3GBQA 1WX6A 4E6RA 1ABQA 3NMZC 1QLYA 2NWMA 1HSQA 3H41A 3I9QA 1T3LA 2J05A 2V1RA 2C0TA 2GTOA 5I11A 5ECAA 4JJDA 1NLOC 2D8HA 4JZ4A 2O9SA 4OMPA 1WIEA 4QT7A 1G2BA 5IH2A 4Z89A 5IHNA 2ABLA 1UUEA 2DF6A 1BU1A 2E5KA 1QKXA 2DRKA 3QWXX 2L2PA 3UF4A 4J9FA 4CC4B 1UE9A 2J06A 3A98A 1B07A 1I0CA 1UJYA 1IO6A 1ZX6A 2ROTA 2EW3A 3VRYA 2CT3A 2LQNA 1X69A 2NUZA 2KROA 2JM8A 2RPNA 2D8JA 3R6NA 1U3OA 3VS3A 2HSPA 5GJVB 1NM7A 2EPDA 2YDLA 1UTIA 1ZUUA 1W1FA 1HD3A 3RNJA 2KT1A 1BBZA 1NG2A 2DL8A 3VS0A 2EQIA 1E7OA 1QWEA 4J9EA 2D0NA 3KFVA 4IIOA 5FWCA 2KNBB 2P4RA 1AWWA 2DRMA 4Z8AA 4ZNXA 3VS1A 1CSKA
chains in the Genus database with same CATH superfamily
2EAYA 1VQNA 4M7AF 2RI3A 3CD6A 4LE9A 1KHCA 3JCMV 2DJZA 3X25B 1Q7YC 2E70A 1KFZA 4RG2A 1BI3A 4ORZA 5HK0A 1QVFA 4BUGA 2FPDA 2KRSA 1NYGA 4BACA 1MGQA 3G6EQ 4BI8B 2VVKA 1AWXA 4IKFA 5D6WA 5LJ5d 1KHIA 3CBPA 3H0HA 3EAEA 4M77D 3H0IA 1XQHA 5GAN4 1AZGB 1RAIB 3JV3A 3HFOA 5CO7A 4J9DA 3CPWS 4GLMA 1A0NB 1PWTA 4E47A 3VKIA 3HTRA 3S6WA 1H8KA 1NJIR 1GCQA 3CCRA 2EJGA 4J6YA 3CC4T 1M1GA 4ME7A 5A0GA 1IZ6A 1M1KC 1VQKA 1MV3A 2JOYA 2HDAA 1RAFB 1KC8R 1H92A 4PJMA 2D6FA 5LJ5g 2YRCA 2X35A 2LT4A 1AT1B 2YUOA 3EHRA 4GLKA 2COYA 1U06A 2VASA 3CCRQ 2RI5A 3L2WA 3P8HA 1SHFA 3I5RA 1PNJA 3VS7A 2BZ8A 1WA7A 2O01E 1E6HA 2F2WA 4KT0E 2OAWA 1M2VA 2L3PA 1KJWA 2AHJB 4PK4A 3S3NA 2L3SA 1JEGA 1M27C 4K11A 4FW1A 3QG1A 2A0FB 4F14A 4HT8A 2MWOA 2CZ6B 2JZ2A 3AT1B 4FYXB 5D6YA 2DZCA 5IHIA 4J9GA 3S3MA 1Q82U 4EMKA 2LZ6B 3VYGA 1PG5B 1M1KR 1PSEA 2CSQA 1N27A 1TG0A 2DD4A 5A0LA 5GAOp 2V8IA 1WI7A 1SRMA 3OMGA 4JUVA 4C8QE 1BK2A 5GANh 1VQLA 1VQOT 3INZA 2YUQA 5L8RE 4AG1C 5GMKe 1NPRA 3TSWA 2Y4YA 2AT1B 1OYXA 4M7AE 3PTAA 5GAMg 1OPKA 3FJPA 4AT1B 1UHFA 4KBMB 1IB8A 2A28A 1WZOA 1KC8C 2R58A 4JJCA 1RI9A 1X6GA 1S72A 4M77F 1YIJA 1Z9ZA 3JRZA 5HKCA 3UA7A 3M4YA 2A7YA 4C92G 3CCMT 2L89A 1YN8A 1QVFP 2KSSA 4C92E 1ABOA 3CQTA 4JPBW 3EFSA 3M0SA 3AHUA 3X28B 4MZPA 4LDXA 1B34A 1YJ9A 3JB9F 1YJWA 2AKKA 5GAOm 2J6KA 1R0CB 1PCXA 2ZPIB 1UFFA 2RK1A 2XI9A 3EGDB 1X01A 4HCCA 3EFRA 3CCVQ 3NTKA 3NFCA 4C5EA 2DL5A 4JS5A 2YLBA 5FU6B 4BY6C 3L2ZA 1X6BA 2DYIA 1G3YA 2RQTA 2GQIA 1B34B 3PMTA 1T0HA 5GAMj 3EG3A 4E7IA 4OMQA 2ECZA 4DQ2A 1JU5C 3A5ZB 4MMLA 2QQBA 1YWOA 4ZGJB 3TREA 3OB9A 3CCLQ 4R56A 1GBRA 1N6AA 1QVGP 3VUBA 4E7JA 3JB9D 2KMTA 2BE7D 2WSCE 3QO3A 4RKUE 2EGAA 3JB9G 3UT1A 1UEBA 2DIGA 1EFNA 1QP3A 2C06A 1MMGA 1UGVA 5CVIA 4HT9A 1MHNA 1EIFA 2EJFA 1X2KA 4X9CA 1NPPA 1U5SA 2F5KA 2MWPA 2DBKA 2LCLA 4J9HA 5L23A 2CH4A 4EDUA 4M7AC 3CCEQ 5CK9A 1MUZA 2KDSA 4J9BA 2EFIA 2M0OA 2M51A 2JM9A 1ZA2B 1M90C 4M78F 5C0MA 2ED1A 4HKEA 3CMEQ 4RMOA 1KSWA 5LJ5h 2LJ0A 5I22A 2RJDA 1G3WA 2EYZA 1VYUA 2M0YA 1RADB 5FU7B 2K9GA 2D1XA 1VQOA 4FT4A 3UA6A 1D3BA 1PRMC 2RH2A 4OB2B 3UDCA 2EYWA 4D8DA 3OSVA 1YJNA 1BI0A 4RCBA 4R0KA 3JCMd 4EMGA 2LQKA 3PNWC 1Q86U 2BZXA 5GJWB 2HCKA 5KCOA 2KRNA 2XU8A 2HBPA 3RDVA 2DEQA 3MKDA 1NEGA 4M7DF 2CUBA 1N9SA 2E3IA 4JRKA 3L2VA 4EPCA 4C5GA 3VYHB 1YHQQ 2HMAA 2JT4A 1R0BG 4F7UF 1WJQA 2DX1A 2M1HA 2YRVA 1AHJB 1VOMA 3JAME 2RHZA 4LXCA 3JCMf 3ZL7C 1SSHA 3TVTA 3GBQA 1M90R 1VQPT 2JUFA 4JDSA 5KYNA 1Q7YU 4M75F 1YJ9Q 5KYXB 4KUDK 3QSUA 3JCMh 1C1AA 2DXBA 5GAN7 3FEOA 3S3OA 1QVPA 3EH1A 4B6MA 2V1RA 4ZGEB 2HD0A 2C0TA 5I21A 5C6SA 1NLOC 1JJ2A 3CCJA 4MZTA 1VQ7A 5DY9A 2FZKB 2ABLA 1UUEA 1VQ5A 1DJ7B 1QKXA 2EQJA 3CCMA 3QWXX 2L2PA 4XTVA 2QA4T 1PD0A 1BCMA 4CC4B 2J06A 1B07A 4HCBA 1WHKA 2KQWA 4KH1B 3EG9A 1VUBA 4A4EA 3V8KA 2LDMA 4Y28E 2LQNA 1RAHB 1G3TA 2HSEB 2L3RA 2HSPA 5GJVB 2E6NA 1W1FA 1BBZA 4E7LA 3BE3A 2MAMA 4OVAA 2D9TA 3RMQA 3KFVA 1SSFA 3DKMA 2OTLA 4IIOA 3JCMP 5GAOr 1KD1U 1YFNA 1I8FA 1VQLQ 4N0AA 1GCPA 3OA6A 2FRYA 3LGFA 1VQ8T 5KYUA 1YCYA 3RKWA 2ENMA 2CP6A 3NTIA 4UC4A 5GAN6 2VGNA 5GAMf 1G8XA 3REBB 1VQLT 4OMLA 1M8MA 4F17A 1LVKA 1B3QA 1WXBA 5LJ3e 3CCSQ 2F1LA 3ZFJA 4FYYB 3RR6A 2CP7A 3M55A 3CMAQ 2V8KA 1BI1A 2H3JA 3EGXA 3OBYA 5KE3A 4A4HA 2LX7A 2X4WA 2HEQA 1LNXA 4PLIA 4M77A 4D8KA 2EKHA 1D09B 2VUBA 2PU9B 1RLQC 1WYXA 3N5BB 4ELYC 5KYWA 3GOXA 3CMAT 3OYYA 1D3BB 1VQ7T 5GAOn 2XDDA 3MJXA 2FPEA 3C4SA 2K4YA 1X27A 4XTWA 4A4FA 5DLOA 2QA4A 3I56A 2DIQA 2OAUA 3M0TA 1XJWB 1X75C 2E5QA 3O5ZA 1VYTA 2RJFA 4HCZA 4C8QC 1MNEA 4A4KA 1VQ9A 3QBYA 1S72Q 2CDTA 4NOYA 2O88A 3THKA 2K3YA 2DXCA 3OQ5A 1ZLMA 1D0YA 2JJ9A 1ZBJA 2ZAEA 2VGMA 2RK2A 2QGFB 1JJ2P 3OYGA 1GRIA 1M2VB 1U8RA 3CEYA 1NJIC 3UATA 4II1A 2RQVA 4DBFA 2ATCB 3DB4A 4IIMA 3JCMc 2MCNA 1SEMA 3QJYA 4ZN3A 4QQDA 2PVOB 2KVQG 1KQ1A 2EGCA 2DO3A 4A63B 3EG0A 7AT1B 4ATOA 1GFCA 2JNGA 2CH4W 1QWFA 4IUQA 4AFSC 3OW2S 1B7TA 2NLUA 2DAQA 2ZGWA 3J81E 2Z0WA 4JJBA 1LJOA 3MEWA 1RLPC 2O2OA 1M1KU 3VRZA 4XU0A 2J6FA 3QYGB 1S1NA 3OS2A 1HJDA 2J6OA 4OMNA 3QDRB 2VV5A 5AT1B 4E7ZA 3CXCS 2EYQA 4KUIA 3E9FA 3CCST 4BI4A 1YBYA 4C8QA 2CREA 1H641 3IQLA 2FPFA 2NUTA 2ROLA 3FB9A 3CC4Q 4E2FB 4WF2A 3P8DA 2ZPGB 5IN1A 3OYLA 1WFWA 1AWOA 2PZ1A 1VQ6T 1UGRB 2M16A 2C0OA 1QQJA 3A8LB 4IURA 1WXTA 1I1JA 4M7DE 4OMOA 4BB7A 2QEXQ 3EFOB 2KXDA 2JTEA 1IGUA 3SFMA 3RESA 1ZSGA 4QVCA 3CMEA 3H9NA 2GFAA 4C8QG 2JN0A 2V8JA 4XU1A 3CPFA 2RQWA 3CCQT 2QEXT 3I55A 2LNHB 4OMMA 5EG2A 3VJPA 3VS2A 1N8RC 1YWPA 3MCAB 1ZUYA 3V8JA 2DJQA 1ZSZC 5IXBA 1RL2A 4C0ZA 1D0XA 4IUVA 3WXMB 2EYXA 2GTJA 5CQYA 2EVRA 1GFDA 2FYKA 2MMPA 1Y71A 4LN2A 4J83A 4DBQA 4FT2A 1PHTA 1T0JA 4L59A 4M78E 2V1QA 2LQ8A 1T3SA 4OGCA 3CCJQ 2A3LA 4EMKB 4X9DA 4MZMA 3QJ6A 1N9RA 4R55A 1PM3A 2DL4A 2LMJA 4Z02A 2EJ9A 1K73R 2JMCA 3D7SB 1OPLA 3OYAA 2WSFE 2LT1A 3VS4A 1YITT 4C92D 1FXXA 2K3XA 4IUTA 3M4GA 4F7UB 2DKGA 1VQ5Q 4C8QF 1O75A 1EX4A 1XTDA 4MDXA 3JCMX 2EWNA 2K3BA 1M2OA 4OB0B 4M7AA 4FSSA 4M75E 1VQ5T 1Y0MA 1UGSB 1QVGS 2RHYA 1W2BP 1VYVA 3OYMA 3OBWA 4HVWA 2JS2A 4M77E 4M75A 1QCFA 1MMNA 1TUDA 1VQ6Q 3RBBB 3EGUA 1TU0B 4HVVA 5AYFA 2X4YA 4M78C 1ZBXA 4FW2A 3M0RA 3CC7A 1OZ2A 2J7IA 5FU6C 3KUFA 2I0NA 2RMOA 4BY6B 3QPHA 1IHWA 2OTJA 2DM1A 4BE0A 3C0CA 1X6OA 3TSZA 2O4XA 3I5SA 2FRWA 2K5IA 1K8AR 1OZ3A 1TUGB 2CSIA 4JRQA 2XIDA 1UJ0A 3MEUA 1QCNA 1LCKA 3M56A 2XMFA 3PVQA 4JJNK 1VQ9Q 3MEAA 3WVDB 3EG2A 1Y96B 3SWNB 3MP8A 5GAMd 1JB0E 3CD6Q 1Y96A 1YJ9T 3HRUA 5FROA 4AG2C 4M75C 3CC2T 4J6XA 3TQ7P 2FL7A 1W70A 5LJ3j 2YLCA 1I07A 4YTLA 1MMAA 4XK8E 1WX6A 2R57A 3KBGA 4E6RA 3CC4A 3NMZC 2OTJT 4A54A 1TWBA 1VQKT 1JRIA 4B9XA 2MF2A 4PNOA 2H3EB 1T3LA 4QQ6A 3H8ZA 5GANj 5CKHA 2QA4Q 2D8HA 1TTHB 2O9SA 3OYFA 4OMPA 4C0DC 3MPUB 1VQ4T 2K57A 1N8RU 2F5TX 4PJOB 1GXIE 1N8RR 2GCXA 3I56T 2E5KA 3GF5A 4C92C 3UF4A 3MO8A 4M7DG 5CKFA 1IHVA 4M7AD 1UE9A 3FLGA 4ELZC 2M02A 3OY9A 2ROTA 5GMKl 4FIBA 1TXQA 3G4ST 4FYVB 4KGVB 2NUZA 2KROA 2JM8A 2D8JA 3R6NA 4PJJA 4C92A 2FVUA 3HRTA 2ZCFB 3RNJA 2KT1A 4FU6A 2FB7A 3PFSA 3VS0A 2DFUA 4J9EA 3G7ZA 2D0NA 3LW5E 4M78A 5FWCA 2P4RA 2YXYA 1AWWA 2DRMA 1V29B 3CCQQ 2PQWA 1TS9A 1U1SA 3BY7A 2RM4A 2LX9A 5GAMh 2YT6A 1JXOA 2DILA 3UPUA 1PKSA 3JB9J 2DXUA 1K8AU 4C92F 2BIVA 1WJRA 2YRDA 1SPKA 1ZA1B 3CC2Q 4Y92A 3SHWA 4LUDA 3CCLT 5KE2A 2YUPA 5GMKh 2EQMA 3QZ9B 3M53A 4F16A 3G71A 1TOVA 2COZA 3HKSA 3OYEA 8AT1B 4M7DA 1JO8A 2GBQA 4F04B 2E41A 1G83A 1VQ4A 3QXEB 5LL6S 4BD3A 2DZ9A 2DTOA 2CZ0B 3CPWP 1D0ZA 1M30A 1K4US 2CGHA 4J8OA 1K0XA 2AK5A 4ESRA 2AKLA 3TU4K 4B9WA 4DOVA 1OV3A 1UECA 3I56Q 2NUTB 4VUBA 2LCCA 2X4JA 4J7FA 1WJSA 1QKWA 2FEIA 3SB2A 1UHCA 4RTVA 3JB9I 4F7UE 1MV0B 2DLPA 1NE8A 2DA9A 3OYNA 2CYZB 2LVMA 3QHSA 4RTWA 1Q81C 3E9GA 2RA2A 2R5AA 1WHMA 3DLMA 3CCUA 2P0KA 4X34A 1K73U 3TEEA 3RKYA 1NLPC 1WLPB 4M4ZA 2I2LA 1WXUA 2RJCA 3FIFA 2BKDN 4EIKA 1PKTA 4KH0B 1FMWA 2RNAA 4CI0C 4V2SA 1M3AA 1V1CA 3CCUQ 2QTXA 2CP5A 3HSBA 2FZGB 1JQQA 4PJOD 3A8GB 2F2VA 2HL5C 3R6OA 4F7UG 3HRSA 1K9MU 2CS7A 1QVFS 1W6XA 1NYFA 2FZCB 4NL3A 2EBPA 2KR3A 3M0UA 2IVWA 2X9HA 4JLIA 1WQ7A 3C12A 2XICA 4WCIA 1ACMB 1VQ8A 2ZPHB 4QKUA 2BUDA 3M58A 4BE2A 4HXJA 5CCAA 3CCQA 1RAGB 5GAN5 3ULRB 1R8OB 3SEMA 4RTUA 1AWJA 3PVLA 2PVGB 2XHCA 3HP9A 3LWHA 1VQ7Q 3RKXA 2QAZA 4JLGA 1AZEA 2HBWA 3M59A 4E7KA 4NL2A 3KXTA 5FW9A 2KYBA 1D1CA 1Q81R 2GNCA 4CC2A 4LD9K 1OX8A 3URGA 1QP2A 3PIPA 6AT1B 2E6ZA 2ZPFB 4J5YA 2E1HA 3CMET 4KGZB 4M77B 1S72T 2VWFA 5LJ5f 2EKOA 1UB4A 3H6ZA 1YP5A 1K8AC 2JW4A 1PRLC 3LLRA 3L2QA 2DEUA 1OEBA 2EIFA 2RN8A 8ATCB 1M8VA 2F2XA 1M3BA 2F69A 2SEMA 5KH6A 2DNUA 4PJOG 2LJ1A 1G5VA 1D1BA 1K0SA 4LUEA 2A08A 3LGLA 2KXCA 4FYWB 4C0FA 3CMAA 2L3QA 2L8DA 1KIKA 3A1PA 2RD1A 1UGPB 2K2VA 3QKJA 1IXDA 2KRMA 3QZ5B 2E4HA 4TVRA 1KQSP 3GLXA 5IHKA 2QYZA 1R77A 4LDYA 1ZSZB 1GCQC 1ZHIA 1Q95G 3SDZA 3L2UA 1VQMQ 3LWIA 1YHQT 1UDLA 4JS4A 3A8MB 2DK3A 5M9OA 1X43A 4ANJA 4OP0A 1YIJQ 4KRTA 5FRNA 2PNIA 1VQ8Q 2OTLT 2KEAA 2HL3A 2FG0A 2VC8A 5GANd 4ZTFA 2AZVA 2KYMA 5CIUA 1KD1C 3OW2P 2FHDA 2YUNA 2P0PA 2OJ2A 2V26A 1Q86C 2LCSA 4N0AC 1RAAB 1WHHA 4RCCA 1ARKA 3E1SA 4QW2A 5A0DA 2XDBA 3CC7T 1FYNA 3CCRT 1K73C 2MYSA 2MIOA 1HYOA 5CAIA 5GAOq 1XOVA 2X4XA 5GAN2 1IGQA 3REAB 2GFUA 4MMKA 3PE0A 1ZQ1A 2RB6A 4PJOF 1KQ2A 1WQWA 4M7DB 1C0MA 1JXMA 5KYYB 3CD6T 4PJOC 1FWZA 2PUOB 5HCKA 1UGQB 2E3HA 1VA7A 1YCSB 2KBTA 4LD6A 3VV0A 1W2BA 1YJNT 1RAEB 2Y4XA 3FDRA 3ME9A 1W2BS 4C5IA 1M1FA 5HK3A 4IUUA 1OI1A 2E65A 2PTKA 2RO0A 3CCJT 5I2SA 1KD1R 2OTJQ 4M75B 4C8QD 5KYWB 1M3CA 4M7DC 4M77C 3NGPA 3G71Q 3VS6A 2KY9A 1K76A 3MEVA 1J3TA 1N5ZA 4JRPA 1OQKA 1ABQA 1U1TA 2HAXA 2WACA 2NWMA 2O4XB 4HA8A 1HSQA 3CPWA 3SWNC 4L6V5 3I9QA 2LTOA 2JTFA 4DBHA 3G6ET 2J05A 4A4GA 1O9SA 4IUPA 2DD5A 5I11A 5ECAA 1I4K1 2KK4A 4XTXA 4JZ4A 1EZZB 4C92B 4F7UA 1WIEA 4QT7A 1VQNQ 2HKNA 4BDZA 1G2BA 2CZ7B 4LDVA 4DA4A 1TSFA 4Z89A 2RHXA 1YI2Q 4LDWA 3V8LA 3G4SQ 1BU1A 4C0DB 2DRKA 2PUKB 4J9FA 3TCJA 1YI2A 4PJNA 3OYKA 4D6WA 1RACB 3CCVT 3A98A 3V7CA 3E2UA 3BDLA 4QVZA 1UJYA 1NZ9A 4PJOA 5DLQE 3O8VA 1WGSA 3LH0A 5GANe 2CT3A 5CQXA 2KI7A 4XU3A 3OYIA 1U3OA 5D6XA 1Q7YR 1NM7A 2EPDA 2YDLA 1UTIA 2YWWA 3OYCA 1KQSA 2DETA 1M90U 3L42A 2DL8A 2QQ9A 2RI2A 3C94A 4OB3B 2QQSA 1QWEA 2DTHA 4E7SA 2AIRB 3X26B 3HL8A 3VS1A 1CSKA 3DB3A 1LPLA 1I5OB 3UWNA 1C6VX 3X20B 3QUIA 1AOJA 4M78G 3JCMb 3EFOA 4PFZA 5KCHA 2PVDB 3M54A 5FLXE 1YHQA 2LQWA 3ASKA 4A53A 2LP5A 2KT8A 5D7UA 3M5AA 2VXFA 1VIFA 2G6FX 3OSSC 2K6DA 2W0ZA 3CCLA 1VQPQ 1Q86R 2A37A 4AFUC 2QEXA 4RTXA 4EMHA 3E19A 1FMVA 2P4TA 2CP0A 3G71T 1SHGA 2YHTA 2L5QA 3CCET 3OS5A 2RJEA 4PJLA 5HY6A 2HZYA 1XNIA 3ZBDA 2QASA 1UG1A 3JCMe 2G3RA 1Q82C 5KYXA 3EGDA 3I35A 5KYYA 2O9VA 1K9MC 3LH5A 1VQKQ 2LJ3A 4PKCC 4CC3A 1YITQ 4XTZA 2OTLQ 1JJ2S 1SF9A 2ESWA 1KG1A 1TUCA 3HHTB 2KE9A 4RTTA 1M9SA 4HVUA 2DVEA 1VQ4Q 3MP6A 1GBQA 1VQNT 4BE1A 3SWNA 5LJ3g 1D1AA 1YI2T 2QTVA 2GGRA 2VKNA 2YSQA 4XTUA 1GL5A 5CKDA 3DLLA 4RG8A 2A36A 2H8HA 2VB6A 4BDYA 2DE0X 3GNGA 2X3XD 1QCOA 4PFOA 1Q81U 4NS5A 2KGTA 3CC7Q 3NPFA 4CC7A 4M7AB 1E6GA 2RQUA 4N4GA 3ZEHA 1F1BB 1TH7A 1OX9A 2K79A 3CBMA 1AEYA 3NTHA 2EYYA 3LYIA 1K1ZA 1OOTA 2JVVA 1YITA 3V7RA 3CBOA 2IIMA 2QQRA 3NHNA 4C0GA 3C95A 3F70A 1WDXA 4PLLA 3CCSA 4XU2A 1MNDA 2BZYA 4AFZC 2QDLA 2JMAA 3VUZA 4OMFB 3G4SA 4BI3A 3JCMQ 2LNVA 1KK7A 1IREB 2CUDA 1WHLA 3PMIA 1K9MR 3J7AF 3EG1A 3OW2A 2MOXA 4LNPA 1QMCA 1HK9A 1ZSZA 2K5LA 1Y07A 2DL3A 3L1AA 3ER0A 3BDUA 2DXTA 3VS5A 2RQRA 2MK5A 3MHXA 5LJ3h 2IG0A 1JBMA 2KAFA 2SRCA 2WSEE 3CXCP 3JB9H 1PSFA 2DMOA 3M9QA 2DL7A 1I5LA 4FSXA 1NBEB 4MDWA 1VQ6A 4FM4B 1RI0A 2HQXA 3GP8A 1VQOQ 2M9UA 5LJ3f 3FJ5A 4Y91A 1AD5A 3H0FA 2FO0A 3SD4A 3M0QA 4Z88A 3OS0A 1BCOA 2LC4A 2GQVA 2W10A 4ZGDB 1PD1A 2K2MA 3HPWA 2EGEA 3META 1BB9A 2C0IA 2QXFA 4X1VA 2XD0A 1Y57A 2B86A 2BTTA 4M77G 3CCEA 2HQEA 2ED0A 4XTYA 4AFQC 3I55T 3CXCA 2VXEA 5LJ3d 4HCKA 3EGXB 4L5GA 5J39A 3CCMQ 2OX7A 3T9NA 1AVZC 2K5FA 2XKOC 5FWBA 1YJWT 2VYTA 3I55Q 2COWA 4J6WA 3U23A 5FRMA 3A8OB 5FU7C 2QI2A 2E12A 1VIEA 4GY5A 2JS0A 2RHIA 2EQUA 3CCUT 1K9AA 1Q82R 1WHJA 3PGGA 3OMCA 3CC2A 1QW1A 3OYBA 1RABB 3VU3C 1YIJT 2P84A 1BYMA 1VQ9T 2JXBA 4FCYA 3OYDA 1ZUKA 3BW1A 5GMKi 2L0AA 4J7IA 1MMDA 3OYHA 5CR2A 4M75G 2CZ1B 2QGGA 4OF1A 4DEYA 3A8HB 2QK0A 4XQ3A 1I81A 2X51A 3EHQA 4M75D 3PT9A 4C8QB 2DERA 4AMCA 3Q1JA 2QDYB 2RHUA 2HNIA 1WPYA 1BIAA 1SKUB 1SRLA 2CP2A 4M7AG 4RTYA 3OYJA 4OGEA 1X2QA 4JZ3A 2OI3A 3P8BB 1KC8U 4Q5WA 4FL6A 4P5NA 2AZSA 5GMKj 3QWYA 5I2MA 3LX7A 2QG9B 3RUXA 2XK0A 1BI2A 1CKAA 3QIIA 3QYHB 1NJIU 2D0QB 5GAOl 4KULA 3X24B 1VQMA 2DYBA 3CCVA 1CKBA 5IXFA 4ZTJA 1LOJA 1WHGA 2MI6A 5A2QE 4J9CA 4C5HA 2E64A 9ATCB 3JCMJ 2DBMA 2NYSA 3QDFA 2X3WD 3MP1A 2K7AA 2HKQB 3BFMA 3RIRA 4RUGA 1NEBA 4CRIA 3EH2A 2E10A 2HQHA 1YJNQ 2B8AA 2Y90A 3G6EA 2CT4A 5J3BA 4O5VA 2IPOB 4M7DD 2NUPA 1QVGA 3FRNA 5GMKm 5LJ5j 1YJWQ 5EC7A 4RTZA 1SG5A 2MPXC 2O31A 4N4IA 4J9IA 2DVJA 1YNZA 4GBQA 3V7SA 4KGXB 2ZPEB 5LJ5e 1VQMT 1FMKA 1BKBA 1PC0A 3M0PA 1HXDA 1Z9QA 5GANf 3GPLA 1H3HA 4DEXA 3PIOA 2RF0A 1RUWA 3JSCA 1V76A 1OULA 1BIBA 3L2RA 1IRXA 2NUPB 1M4ZA 3J80E 1FX7A 4N4HA 3M57A 1KQSS 1QLYA 4QVDA 3H41A 2P0QA 4M78B 1VQPA 4M78D 5IT9E 1OU8A 2XG8D 2GTOA 5DM7R 3JCMg 4JJDA 2LRQA 4ZN1A 2XDPA 4WTOB 4DOWA 2EQKA 4PFPA 5GAMe 3OS1A 3G1JA 5CKBA 5IH2A 1Y7XA 4LDUA 2GF7A 5IHNA 4PL6A 5KYUB 2CKKA 2DF6A 1P92A 1WNLA 2QQAA 2CP3A 1I0CA 2ZPBB 1W4SA 1IO6A 1ZX6A 4DBRA 4E7HA 2R5MA 1G3SA 2JTMA 3RERA 1M5Q1 3GIBA 2EW3A 4XAXB 4JRIA 3VRYA 3HFNA 1X69A 1OU9A 2RPNA 4QQGA 4O6JA 4EMKC 3VS3A 3RMSA 3GNFB 4OB1B 1ZUUA 5GAN8 1HD3A 5CKEA 5IAYA 5GAN3 1NG2A 3JCMW 2DPPB 4PJOE 2EQIA 1E7OA 3EG9B 2BE9B 1H3ZA 2DTIA 3FC3A 2KNBB 2ZZDA 5GANg 4Z8AA 4ZNXA 3WVEB 5J26A
chains in the Genus database with same CATH topology
1GCPA 1AOJA 2FRYA 4LE9A 2LQWA 2LP5A 2KT8A 2ENMA 2G6FX 2K6DA 2W0ZA 1KFZA 2YT6A 1JXOA 2DILA 3REBB 2A37A 4AFUC 1PKSA 4ORZA 4RTXA 1SPKA 4OMLA 2FPDA 2KRSA 4Y92A 1NYGA 1SHGA 3SHWA 4LUDA 1M8MA 4F17A 2VVKA 1B3QA 2YUPA 1WXBA 1UG1A 1AWXA 4F16A 3I35A 2O9VA 3H0HA 3LH5A 2LJ3A 3H0IA 4CC3A 1JO8A 2LX7A 1AZGB 2HEQA 2GBQA 3JV3A 2ESWA 1TUCA 1G83A 2EKHA 4J9DA 4D8KA 4GLMA 2KE9A 1A0NB 1RLQC 1WYXA 4RTTA 1PWTA 4HVUA 1M30A 1K4US 1H8KA 1GBQA 1GCQA 2FPEA 1K0XA 1X27A 2AK5A 4ESRA 2AKLA 1OV3A 2GGRA 1UECA 2VKNA 2YSQA 1GL5A 1MV3A 3M0TA 2HDAA 1H92A 2A36A 3O5ZA 2H8HA 1QKWA 2FEIA 1UHCA 2DE0X 4RTVA 1MV0B 2DLPA 1VYTA 2X3XD 2DA9A 3EHRA 2YUOA 2CDTA 1U06A 2O88A 4RTWA 2KGTA 3THKA 3NPFA 4CC7A 1E6GA 1SHFA 1ZLMA 2RQUA 3I5RA 1PNJA 1ZBJA 3VS7A 2BZ8A 1WA7A 1E6HA 2F2WA 1GRIA 1NLPC 2K79A 1WLPB 2OAWA 2L3PA 3UATA 4M4ZA 1KJWA 1AEYA 2EYYA 1K1ZA 1OOTA 2RQVA 1WXUA 2L3SA 1JEGA 1M27C 2IIMA 4K11A 3NHNA 4IIMA 4EIKA 4F14A 1PKTA 2MCNA 1SEMA 2RNAA 1WDXA 2EGCA 4A63B 3EG0A 1M3AA 1V1CA 1GFCA 2BZYA 5IHIA 4J9GA 4AFZC 2CH4W 2QDLA 2JMAA 2LZ6B 1QWFA 1JQQA 4AFSC 2CSQA 2F2VA 2CUDA 1TG0A 3EG1A 4JJBA 2MOXA 4LNPA 1W6XA 1NYFA 1WI7A 1SRMA 1RLPC 2EBPA 2KR3A 2O2OA 3M0UA 3VRZA 4WCIA 1BK2A 2DL3A 2J6FA 2YUQA 1S1NA 1HJDA 2J6OA 3VS5A 2RQRA 4AG1C 4HXJA 2SRCA 4OMNA 3TSWA 2DMOA 2DL7A 3ULRB 3SEMA 4RTUA 1OPKA 1AWJA 3PVLA 1UHFA 2CREA 2A28A 4JJCA 3IQLA 2FPFA 2ROLA 3FJ5A 1AD5A 1RI9A 3H0FA 1X6GA 2FO0A 1AZEA 2HBWA 3M0QA 4Z88A 1Z9ZA 1WFWA 3UA7A 1AWOA 2PZ1A 5FW9A 2KYBA 2W10A 2GNCA 4CC2A 2C0OA 2K2MA 1YN8A 2EGEA 1BB9A 1WXTA 1I1JA 2C0IA 1ABOA 4X1VA 3CQTA 1Y57A 4JPBW 2B86A 3M0SA 4OMOA 2BTTA 2VWFA 1YP5A 2KXDA 2ED0A 2JW4A 1PRLC 4AFQC 2JTEA 1OEBA 2AKKA 2J6KA 2RN8A 4HCKA 1ZSGA 2F2XA 1M3BA 1UFFA 2SEMA 1AVZC 2DL5A 2DNUA 5FWBA 2LJ1A 1K0SA 4LUEA 2RQWA 2A08A 2KXCA 1X6BA 2LNHB 4OMMA 3U23A 3VS2A 1YWPA 2RQTA 2L3QA 1ZUYA 2GQIA 1KIKA 2DJQA 5IXBA 2JS0A 2KRMA 1T0HA 2EYXA 2GTJA 1K9AA 3EG3A 5IHKA 4OMQA 2EVRA 1GFDA 2ECZA 1JU5C 4LN2A 1GCQC 1YWOA 2JXBA 1ZUKA 1PHTA 1T0JA 2L0AA 1UDLA 1GBRA 2V1QA 1T3SA 4DEYA 1X43A 3EHQA 2DL4A 2LMJA 2JMCA 4KRTA 1OPLA 2EGAA 2PNIA 3VS4A 2KEAA 1EFNA 2FG0A 1UGVA 1SRLA 4RTYA 1X2KA 1X2QA 2OI3A 4JZ3A 2AZVA 2KYMA 1U5SA 2DBKA 4J9HA 5L23A 2CH4A 2K3BA 2AZSA 1MUZA 3QWYA 4J9BA 2YUNA 4FSSA 2M51A 2OJ2A 2JM9A 1CKAA 2LCSA 1Y0MA 2DYBA 1CKBA 2ED1A 1ARKA 5IXFA 1VYVA 1KSWA 2LJ0A 5I22A 4HVWA 1FYNA 2JS2A 4J9CA 1QCFA 1TUDA 1VYUA 2EYZA 2MIOA 3EGUA 3RBBB 2M0YA 4HVVA 2K9GA 1XOVA 2D1XA 2DBMA 2X3WD 3UA6A 1PRMC 3M0RA 3REAB 2K7AA 2J7IA 3PE0A 2I0NA 2RMOA 4RUGA 2DM1A 1NEBA 2EYWA 4D8DA 3C0CA 3TSZA 3I5SA 2FRWA 2CT4A 1JXMA 4R0KA 2BZXA 5GJWB 2CSIA 2HCKA 5HCKA 2KRNA 1VA7A 1YCSB 5EC7A 2KBTA 1UJ0A 4RTZA 2O31A 4J9IA 1LCKA 2DVJA 1YNZA 4GBQA 2XMFA 1NEGA 3PVQA 2CUBA 1FMKA 3EG2A 3M0PA 2JT4A 2DX1A 1Z9QA 2PTKA 1H3HA 4DEXA 1M3CA 4AG2C 2RF0A 1RUWA 3NGPA 3VS6A 3ZL7C 1K76A 1W70A 1SSHA 1J3TA 1I07A 3TVTA 1N5ZA 3GBQA 1WX6A 4E6RA 1ABQA 3NMZC 1QLYA 2NWMA 1HSQA 3H41A 3I9QA 1T3LA 2J05A 2V1RA 2C0TA 2GTOA 5I11A 5ECAA 4JJDA 1NLOC 2D8HA 4JZ4A 2O9SA 4OMPA 1WIEA 4QT7A 1G2BA 5IH2A 4Z89A 5IHNA 2ABLA 1UUEA 2DF6A 1BU1A 2E5KA 1QKXA 2DRKA 3QWXX 2L2PA 3UF4A 4J9FA 4CC4B 1UE9A 2J06A 3A98A 1B07A 1I0CA 1UJYA 1IO6A 1ZX6A 2ROTA 2EW3A 3VRYA 2CT3A 2LQNA 1X69A 2NUZA 2KROA 2JM8A 2RPNA 2D8JA 3R6NA 1U3OA 3VS3A 2HSPA 5GJVB 1NM7A 2EPDA 2YDLA 1UTIA 1ZUUA 1W1FA 1HD3A 3RNJA 2KT1A 1BBZA 1NG2A 2DL8A 3VS0A 2EQIA 1E7OA 1QWEA 4J9EA 2D0NA 3KFVA 4IIOA 5FWCA 2KNBB 2P4RA 1AWWA 2DRMA 4Z8AA 4ZNXA 3VS1A 1CSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCP A;  1AOJ A;  2FRY A;  4LE9 A;  2LQW A;  2LP5 A;  2KT8 A;  2ENM A;  2G6F X;  2K6D A;  2W0Z A;  1KFZ A;  2YT6 A;  1JXO A;  2DIL A;  3REB B;  2A37 A;  4AFU C;  1PKS A;  4ORZ A;  4RTX A;  1SPK A;  4OML A;  2FPD A;  2KRS A;  4Y92 A;  1NYG A;  1SHG A;  3SHW A;  4LUD A;  1M8M A;  4F17 A;  2VVK A;  1B3Q A;  2YUP A;  1WXB A;  1UG1 A;  1AWX A;  4F16 A;  3I35 A;  2O9V A;  3H0H A;  3LH5 A;  2LJ3 A;  3H0I A;  4CC3 A;  1JO8 A;  2LX7 A;  1AZG B;  2HEQ A;  2GBQ A;  3JV3 A;  2ESW A;  1TUC A;  1G83 A;  2EKH A;  4J9D A;  4D8K A;  4GLM A;  2KE9 A;  1A0N B;  1RLQ C;  1WYX A;  4RTT A;  1PWT A;  4HVU A;  1M30 A;  1K4U S;  1H8K A;  1GBQ A;  1GCQ A;  2FPE A;  1K0X A;  1X27 A;  2AK5 A;  4ESR A;  2AKL A;  1OV3 A;  2GGR A;  1UEC A;  2VKN A;  2YSQ A;  1GL5 A;  1MV3 A;  3M0T A;  2HDA A;  1H92 A;  2A36 A;  3O5Z A;  2H8H A;  1QKW A;  2FEI A;  1UHC A;  2DE0 X;  4RTV A;  1MV0 B;  2DLP A;  1VYT A;  2X3X D;  2DA9 A;  3EHR A;  2YUO A;  2CDT A;  1U06 A;  2O88 A;  4RTW A;  2KGT A;  3THK A;  3NPF A;  4CC7 A;  1E6G A;  1SHF A;  1ZLM A;  2RQU A;  3I5R A;  1PNJ A;  1ZBJ A;  3VS7 A;  2BZ8 A;  1WA7 A;  1E6H A;  2F2W A;  1GRI A;  1NLP C;  2K79 A;  1WLP B;  2OAW A;  2L3P A;  3UAT A;  4M4Z A;  1KJW A;  1AEY A;  2EYY A;  1K1Z A;  1OOT A;  2RQV A;  1WXU A;  2L3S A;  1JEG A;  1M27 C;  2IIM A;  4K11 A;  3NHN A;  4IIM A;  4EIK A;  4F14 A;  1PKT A;  2MCN A;  1SEM A;  2RNA A;  1WDX A;  2EGC A;  4A63 B;  3EG0 A;  1M3A A;  1V1C A;  1GFC A;  2BZY A;  5IHI A;  4J9G A;  4AFZ C;  2CH4 W;  2QDL A;  2JMA A;  2LZ6 B;  1QWF A;  1JQQ A;  4AFS C;  2CSQ A;  2F2V A;  2CUD A;  1TG0 A;  3EG1 A;  4JJB A;  2MOX A;  4LNP A;  1W6X A;  1NYF A;  1WI7 A;  1SRM A;  1RLP C;  2EBP A;  2KR3 A;  2O2O A;  3M0U A;  3VRZ A;  4WCI A;  1BK2 A;  2DL3 A;  2J6F A;  2YUQ A;  1S1N A;  1HJD A;  2J6O A;  3VS5 A;  2RQR A;  4AG1 C;  4HXJ A;  2SRC A;  4OMN A;  3TSW A;  2DMO A;  2DL7 A;  3ULR B;  3SEM A;  4RTU A;  1OPK A;  1AWJ A;  3PVL A;  1UHF A;  2CRE A;  2A28 A;  4JJC A;  3IQL A;  2FPF A;  2ROL A;  3FJ5 A;  1AD5 A;  1RI9 A;  3H0F A;  1X6G A;  2FO0 A;  1AZE A;  2HBW A;  3M0Q A;  4Z88 A;  1Z9Z A;  1WFW A;  3UA7 A;  1AWO A;  2PZ1 A;  5FW9 A;  2KYB A;  2W10 A;  2GNC A;  4CC2 A;  2C0O A;  2K2M A;  1YN8 A;  2EGE A;  1BB9 A;  1WXT A;  1I1J A;  2C0I A;  1ABO A;  4X1V A;  3CQT A;  1Y57 A;  4JPB W;  2B86 A;  3M0S A;  4OMO A;  2BTT A;  2VWF A;  1YP5 A;  2KXD A;  2ED0 A;  2JW4 A;  1PRL C;  4AFQ C;  2JTE A;  1OEB A;  2AKK A;  2J6K A;  2RN8 A;  4HCK A;  1ZSG A;  2F2X A;  1M3B A;  1UFF A;  2SEM A;  1AVZ C;  2DL5 A;  2DNU A;  5FWB A;  2LJ1 A;  1K0S A;  4LUE A;  2RQW A;  2A08 A;  2KXC A;  1X6B A;  2LNH B;  4OMM A;  3U23 A;  3VS2 A;  1YWP A;  2RQT A;  2L3Q A;  1ZUY A;  2GQI A;  1KIK A;  2DJQ A;  5IXB A;  2JS0 A;  2KRM A;  1T0H A;  2EYX A;  2GTJ A;  1K9A A;  3EG3 A;  5IHK A;  4OMQ A;  2EVR A;  1GFD A;  2ECZ A;  1JU5 C;  4LN2 A;  1GCQ C;  1YWO A;  2JXB A;  1ZUK A;  1PHT A;  1T0J A;  2L0A A;  1UDL A;  1GBR A;  2V1Q A;  1T3S A;  4DEY A;  1X43 A;  3EHQ A;  2DL4 A;  2LMJ A;  2JMC A;  4KRT A;  1OPL A;  2EGA A;  2PNI A;  3VS4 A;  2KEA A;  1EFN A;  2FG0 A;  1UGV A;  1SRL A;  4RTY A;  1X2K A;  1X2Q A;  2OI3 A;  4JZ3 A;  2AZV A;  2KYM A;  1U5S A;  2DBK A;  4J9H A;  5L23 A;  2CH4 A;  2K3B A;  2AZS A;  1MUZ A;  3QWY A;  4J9B A;  2YUN A;  4FSS A;  2M51 A;  2OJ2 A;  2JM9 A;  1CKA A;  2LCS A;  1Y0M A;  2DYB A;  1CKB A;  2ED1 A;  1ARK A;  5IXF A;  1VYV A;  1KSW A;  2LJ0 A;  5I22 A;  4HVW A;  1FYN A;  2JS2 A;  4J9C A;  1QCF A;  1TUD A;  1VYU A;  2EYZ A;  2MIO A;  3EGU A;  3RBB B;  2M0Y A;  4HVV A;  2K9G A;  1XOV A;  2D1X A;  2DBM A;  2X3W D;  3UA6 A;  1PRM C;  3M0R A;  3REA B;  2K7A A;  2J7I A;  3PE0 A;  2I0N A;  2RMO A;  4RUG A;  2DM1 A;  1NEB A;  2EYW A;  4D8D A;  3C0C A;  3TSZ A;  3I5S A;  2FRW A;  2CT4 A;  1JXM A;  4R0K A;  2BZX A;  5GJW B;  2CSI A;  2HCK A;  5HCK A;  2KRN A;  1VA7 A;  1YCS B;  5EC7 A;  2KBT A;  1UJ0 A;  4RTZ A;  2O31 A;  4J9I A;  1LCK A;  2DVJ A;  1YNZ A;  4GBQ A;  2XMF A;  1NEG A;  3PVQ A;  2CUB A;  1FMK A;  3EG2 A;  3M0P A;  2JT4 A;  2DX1 A;  1Z9Q A;  2PTK A;  1H3H A;  4DEX A;  1M3C A;  4AG2 C;  2RF0 A;  1RUW A;  3NGP A;  3VS6 A;  3ZL7 C;  1K76 A;  1W70 A;  1SSH A;  1J3T A;  1I07 A;  3TVT A;  1N5Z A;  3GBQ A;  1WX6 A;  4E6R A;  1ABQ A;  3NMZ C;  1QLY A;  2NWM A;  1HSQ A;  3H41 A;  3I9Q A;  1T3L A;  2J05 A;  2V1R A;  2C0T A;  2GTO A;  5I11 A;  5ECA A;  4JJD A;  1NLO C;  2D8H A;  4JZ4 A;  2O9S A;  4OMP A;  1WIE A;  4QT7 A;  1G2B A;  5IH2 A;  4Z89 A;  5IHN A;  2ABL A;  1UUE A;  2DF6 A;  1BU1 A;  2E5K A;  1QKX A;  2DRK A;  3QWX X;  2L2P A;  3UF4 A;  4J9F A;  4CC4 B;  1UE9 A;  2J06 A;  3A98 A;  1B07 A;  1I0C A;  1UJY A;  1IO6 A;  1ZX6 A;  2ROT A;  2EW3 A;  3VRY A;  2CT3 A;  2LQN A;  1X69 A;  2NUZ A;  2KRO A;  2JM8 A;  2RPN A;  2D8J A;  3R6N A;  1U3O A;  3VS3 A;  2HSP A;  5GJV B;  1NM7 A;  2EPD A;  2YDL A;  1UTI A;  1ZUU A;  1W1F A;  1HD3 A;  3RNJ A;  2KT1 A;  1BBZ A;  1NG2 A;  2DL8 A;  3VS0 A;  2EQI A;  1E7O A;  1QWE A;  4J9E A;  2D0N A;  3KFV A;  4IIO A;  5FWC A;  2KNB B;  2P4R A;  1AWW A;  2DRM A;  4Z8A A;  4ZNX A;  3VS1 A;  1CSK A; 
#chains in the Genus database with same CATH topology
 2EAY A;  1VQN A;  4M7A F;  2RI3 A;  3CD6 A;  4LE9 A;  1KHC A;  3JCM V;  2DJZ A;  3X25 B;  1Q7Y C;  2E70 A;  1KFZ A;  4RG2 A;  1BI3 A;  4ORZ A;  5HK0 A;  1QVF A;  4BUG A;  2FPD A;  2KRS A;  1NYG A;  4BAC A;  1MGQ A;  3G6E Q;  4BI8 B;  2VVK A;  1AWX A;  4IKF A;  5D6W A;  5LJ5 d;  1KHI A;  3CBP A;  3H0H A;  3EAE A;  4M77 D;  3H0I A;  1XQH A;  5GAN 4;  1AZG B;  1RAI B;  3JV3 A;  3HFO A;  5CO7 A;  4J9D A;  3CPW S;  4GLM A;  1A0N B;  1PWT A;  4E47 A;  3VKI A;  3HTR A;  3S6W A;  1H8K A;  1NJI R;  1GCQ A;  3CCR A;  2EJG A;  4J6Y A;  3CC4 T;  1M1G A;  4ME7 A;  5A0G A;  1IZ6 A;  1M1K C;  1VQK A;  1MV3 A;  2JOY A;  2HDA A;  1RAF B;  1KC8 R;  1H92 A;  4PJM A;  2D6F A;  5LJ5 g;  2YRC A;  2X35 A;  2LT4 A;  1AT1 B;  2YUO A;  3EHR A;  4GLK A;  2COY A;  1U06 A;  2VAS A;  3CCR Q;  2RI5 A;  3L2W A;  3P8H A;  1SHF A;  3I5R A;  1PNJ A;  3VS7 A;  2BZ8 A;  1WA7 A;  2O01 E;  1E6H A;  2F2W A;  4KT0 E;  2OAW A;  1M2V A;  2L3P A;  1KJW A;  2AHJ B;  4PK4 A;  3S3N A;  2L3S A;  1JEG A;  1M27 C;  4K11 A;  4FW1 A;  3QG1 A;  2A0F B;  4F14 A;  4HT8 A;  2MWO A;  2CZ6 B;  2JZ2 A;  3AT1 B;  4FYX B;  5D6Y A;  2DZC A;  5IHI A;  4J9G A;  3S3M A;  1Q82 U;  4EMK A;  2LZ6 B;  3VYG A;  1PG5 B;  1M1K R;  1PSE A;  2CSQ A;  1N27 A;  1TG0 A;  2DD4 A;  5A0L A;  5GAO p;  2V8I A;  1WI7 A;  1SRM A;  3OMG A;  4JUV A;  4C8Q E;  1BK2 A;  5GAN h;  1VQL A;  1VQO T;  3INZ A;  2YUQ A;  5L8R E;  4AG1 C;  5GMK e;  1NPR A;  3TSW A;  2Y4Y A;  2AT1 B;  1OYX A;  4M7A E;  3PTA A;  5GAM g;  1OPK A;  3FJP A;  4AT1 B;  1UHF A;  4KBM B;  1IB8 A;  2A28 A;  1WZO A;  1KC8 C;  2R58 A;  4JJC A;  1RI9 A;  1X6G A;  1S72 A;  4M77 F;  1YIJ A;  1Z9Z A;  3JRZ A;  5HKC A;  3UA7 A;  3M4Y A;  2A7Y A;  4C92 G;  3CCM T;  2L89 A;  1YN8 A;  1QVF P;  2KSS A;  4C92 E;  1ABO A;  3CQT A;  4JPB W;  3EFS A;  3M0S A;  3AHU A;  3X28 B;  4MZP A;  4LDX A;  1B34 A;  1YJ9 A;  3JB9 F;  1YJW A;  2AKK A;  5GAO m;  2J6K A;  1R0C B;  1PCX A;  2ZPI B;  1UFF A;  2RK1 A;  2XI9 A;  3EGD B;  1X01 A;  4HCC A;  3EFR A;  3CCV Q;  3NTK A;  3NFC A;  4C5E A;  2DL5 A;  4JS5 A;  2YLB A;  5FU6 B;  4BY6 C;  3L2Z A;  1X6B A;  2DYI A;  1G3Y A;  2RQT A;  2GQI A;  1B34 B;  3PMT A;  1T0H A;  5GAM j;  3EG3 A;  4E7I A;  4OMQ A;  2ECZ A;  4DQ2 A;  1JU5 C;  3A5Z B;  4MML A;  2QQB A;  1YWO A;  4ZGJ B;  3TRE A;  3OB9 A;  3CCL Q;  4R56 A;  1GBR A;  1N6A A;  1QVG P;  3VUB A;  4E7J A;  3JB9 D;  2KMT A;  2BE7 D;  2WSC E;  3QO3 A;  4RKU E;  2EGA A;  3JB9 G;  3UT1 A;  1UEB A;  2DIG A;  1EFN A;  1QP3 A;  2C06 A;  1MMG A;  1UGV A;  5CVI A;  4HT9 A;  1MHN A;  1EIF A;  2EJF A;  1X2K A;  4X9C A;  1NPP A;  1U5S A;  2F5K A;  2MWP A;  2DBK A;  2LCL A;  4J9H A;  5L23 A;  2CH4 A;  4EDU A;  4M7A C;  3CCE Q;  5CK9 A;  1MUZ A;  2KDS A;  4J9B A;  2EFI A;  2M0O A;  2M51 A;  2JM9 A;  1ZA2 B;  1M90 C;  4M78 F;  5C0M A;  2ED1 A;  4HKE A;  3CME Q;  4RMO A;  1KSW A;  5LJ5 h;  2LJ0 A;  5I22 A;  2RJD A;  1G3W A;  2EYZ A;  1VYU A;  2M0Y A;  1RAD B;  5FU7 B;  2K9G A;  2D1X A;  1VQO A;  4FT4 A;  3UA6 A;  1D3B A;  1PRM C;  2RH2 A;  4OB2 B;  3UDC A;  2EYW A;  4D8D A;  3OSV A;  1YJN A;  1BI0 A;  4RCB A;  4R0K A;  3JCM d;  4EMG A;  2LQK A;  3PNW C;  1Q86 U;  2BZX A;  5GJW B;  2HCK A;  5KCO A;  2KRN A;  2XU8 A;  2HBP A;  3RDV A;  2DEQ A;  3MKD A;  1NEG A;  4M7D F;  2CUB A;  1N9S A;  2E3I A;  4JRK A;  3L2V A;  4EPC A;  4C5G A;  3VYH B;  1YHQ Q;  2HMA A;  2JT4 A;  1R0B G;  4F7U F;  1WJQ A;  2DX1 A;  2M1H A;  2YRV A;  1AHJ B;  1VOM A;  3JAM E;  2RHZ A;  4LXC A;  3JCM f;  3ZL7 C;  1SSH A;  3TVT A;  3GBQ A;  1M90 R;  1VQP T;  2JUF A;  4JDS A;  5KYN A;  1Q7Y U;  4M75 F;  1YJ9 Q;  5KYX B;  4KUD K;  3QSU A;  3JCM h;  1C1A A;  2DXB A;  5GAN 7;  3FEO A;  3S3O A;  1QVP A;  3EH1 A;  4B6M A;  2V1R A;  4ZGE B;  2HD0 A;  2C0T A;  5I21 A;  5C6S A;  1NLO C;  1JJ2 A;  3CCJ A;  4MZT A;  1VQ7 A;  5DY9 A;  2FZK B;  2ABL A;  1UUE A;  1VQ5 A;  1DJ7 B;  1QKX A;  2EQJ A;  3CCM A;  3QWX X;  2L2P A;  4XTV A;  2QA4 T;  1PD0 A;  1BCM A;  4CC4 B;  2J06 A;  1B07 A;  4HCB A;  1WHK A;  2KQW A;  4KH1 B;  3EG9 A;  1VUB A;  4A4E A;  3V8K A;  2LDM A;  4Y28 E;  2LQN A;  1RAH B;  1G3T A;  2HSE B;  2L3R A;  2HSP A;  5GJV B;  2E6N A;  1W1F A;  1BBZ A;  4E7L A;  3BE3 A;  2MAM A;  4OVA A;  2D9T A;  3RMQ A;  3KFV A;  1SSF A;  3DKM A;  2OTL A;  4IIO A;  3JCM P;  5GAO r;  1KD1 U;  1YFN A;  1I8F A;  1VQL Q;  4N0A A;  1GCP A;  3OA6 A;  2FRY A;  3LGF A;  1VQ8 T;  5KYU A;  1YCY A;  3RKW A;  2ENM A;  2CP6 A;  3NTI A;  4UC4 A;  5GAN 6;  2VGN A;  5GAM f;  1G8X A;  3REB B;  1VQL T;  4OML A;  1M8M A;  4F17 A;  1LVK A;  1B3Q A;  1WXB A;  5LJ3 e;  3CCS Q;  2F1L A;  3ZFJ A;  4FYY B;  3RR6 A;  2CP7 A;  3M55 A;  3CMA Q;  2V8K A;  1BI1 A;  2H3J A;  3EGX A;  3OBY A;  5KE3 A;  4A4H A;  2LX7 A;  2X4W A;  2HEQ A;  1LNX A;  4PLI A;  4M77 A;  4D8K A;  2EKH A;  1D09 B;  2VUB A;  2PU9 B;  1RLQ C;  1WYX A;  3N5B B;  4ELY C;  5KYW A;  3GOX A;  3CMA T;  3OYY A;  1D3B B;  1VQ7 T;  5GAO n;  2XDD A;  3MJX A;  2FPE A;  3C4S A;  2K4Y A;  1X27 A;  4XTW A;  4A4F A;  5DLO A;  2QA4 A;  3I56 A;  2DIQ A;  2OAU A;  3M0T A;  1XJW B;  1X75 C;  2E5Q A;  3O5Z A;  1VYT A;  2RJF A;  4HCZ A;  4C8Q C;  1MNE A;  4A4K A;  1VQ9 A;  3QBY A;  1S72 Q;  2CDT A;  4NOY A;  2O88 A;  3THK A;  2K3Y A;  2DXC A;  3OQ5 A;  1ZLM A;  1D0Y A;  2JJ9 A;  1ZBJ A;  2ZAE A;  2VGM A;  2RK2 A;  2QGF B;  1JJ2 P;  3OYG A;  1GRI A;  1M2V B;  1U8R A;  3CEY A;  1NJI C;  3UAT A;  4II1 A;  2RQV A;  4DBF A;  2ATC B;  3DB4 A;  4IIM A;  3JCM c;  2MCN A;  1SEM A;  3QJY A;  4ZN3 A;  4QQD A;  2PVO B;  2KVQ G;  1KQ1 A;  2EGC A;  2DO3 A;  4A63 B;  3EG0 A;  7AT1 B;  4ATO A;  1GFC A;  2JNG A;  2CH4 W;  1QWF A;  4IUQ A;  4AFS C;  3OW2 S;  1B7T A;  2NLU A;  2DAQ A;  2ZGW A;  3J81 E;  2Z0W A;  4JJB A;  1LJO A;  3MEW A;  1RLP C;  2O2O A;  1M1K U;  3VRZ A;  4XU0 A;  2J6F A;  3QYG B;  1S1N A;  3OS2 A;  1HJD A;  2J6O A;  4OMN A;  3QDR B;  2VV5 A;  5AT1 B;  4E7Z A;  3CXC S;  2EYQ A;  4KUI A;  3E9F A;  3CCS T;  4BI4 A;  1YBY A;  4C8Q A;  2CRE A;  1H64 1;  3IQL A;  2FPF A;  2NUT A;  2ROL A;  3FB9 A;  3CC4 Q;  4E2F B;  4WF2 A;  3P8D A;  2ZPG B;  5IN1 A;  3OYL A;  1WFW A;  1AWO A;  2PZ1 A;  1VQ6 T;  1UGR B;  2M16 A;  2C0O A;  1QQJ A;  3A8L B;  4IUR A;  1WXT A;  1I1J A;  4M7D E;  4OMO A;  4BB7 A;  2QEX Q;  3EFO B;  2KXD A;  2JTE A;  1IGU A;  3SFM A;  3RES A;  1ZSG A;  4QVC A;  3CME A;  3H9N A;  2GFA A;  4C8Q G;  2JN0 A;  2V8J A;  4XU1 A;  3CPF A;  2RQW A;  3CCQ T;  2QEX T;  3I55 A;  2LNH B;  4OMM A;  5EG2 A;  3VJP A;  3VS2 A;  1N8R C;  1YWP A;  3MCA B;  1ZUY A;  3V8J A;  2DJQ A;  1ZSZ C;  5IXB A;  1RL2 A;  4C0Z A;  1D0X A;  4IUV A;  3WXM B;  2EYX A;  2GTJ A;  5CQY A;  2EVR A;  1GFD A;  2FYK A;  2MMP A;  1Y71 A;  4LN2 A;  4J83 A;  4DBQ A;  4FT2 A;  1PHT A;  1T0J A;  4L59 A;  4M78 E;  2V1Q A;  2LQ8 A;  1T3S A;  4OGC A;  3CCJ Q;  2A3L A;  4EMK B;  4X9D A;  4MZM A;  3QJ6 A;  1N9R A;  4R55 A;  1PM3 A;  2DL4 A;  2LMJ A;  4Z02 A;  2EJ9 A;  1K73 R;  2JMC A;  3D7S B;  1OPL A;  3OYA A;  2WSF E;  2LT1 A;  3VS4 A;  1YIT T;  4C92 D;  1FXX A;  2K3X A;  4IUT A;  3M4G A;  4F7U B;  2DKG A;  1VQ5 Q;  4C8Q F;  1O75 A;  1EX4 A;  1XTD A;  4MDX A;  3JCM X;  2EWN A;  2K3B A;  1M2O A;  4OB0 B;  4M7A A;  4FSS A;  4M75 E;  1VQ5 T;  1Y0M A;  1UGS B;  1QVG S;  2RHY A;  1W2B P;  1VYV A;  3OYM A;  3OBW A;  4HVW A;  2JS2 A;  4M77 E;  4M75 A;  1QCF A;  1MMN A;  1TUD A;  1VQ6 Q;  3RBB B;  3EGU A;  1TU0 B;  4HVV A;  5AYF A;  2X4Y A;  4M78 C;  1ZBX A;  4FW2 A;  3M0R A;  3CC7 A;  1OZ2 A;  2J7I A;  5FU6 C;  3KUF A;  2I0N A;  2RMO A;  4BY6 B;  3QPH A;  1IHW A;  2OTJ A;  2DM1 A;  4BE0 A;  3C0C A;  1X6O A;  3TSZ A;  2O4X A;  3I5S A;  2FRW A;  2K5I A;  1K8A R;  1OZ3 A;  1TUG B;  2CSI A;  4JRQ A;  2XID A;  1UJ0 A;  3MEU A;  1QCN A;  1LCK A;  3M56 A;  2XMF A;  3PVQ A;  4JJN K;  1VQ9 Q;  3MEA A;  3WVD B;  3EG2 A;  1Y96 B;  3SWN B;  3MP8 A;  5GAM d;  1JB0 E;  3CD6 Q;  1Y96 A;  1YJ9 T;  3HRU A;  5FRO A;  4AG2 C;  4M75 C;  3CC2 T;  4J6X A;  3TQ7 P;  2FL7 A;  1W70 A;  5LJ3 j;  2YLC A;  1I07 A;  4YTL A;  1MMA A;  4XK8 E;  1WX6 A;  2R57 A;  3KBG A;  4E6R A;  3CC4 A;  3NMZ C;  2OTJ T;  4A54 A;  1TWB A;  1VQK T;  1JRI A;  4B9X A;  2MF2 A;  4PNO A;  2H3E B;  1T3L A;  4QQ6 A;  3H8Z A;  5GAN j;  5CKH A;  2QA4 Q;  2D8H A;  1TTH B;  2O9S A;  3OYF A;  4OMP A;  4C0D C;  3MPU B;  1VQ4 T;  2K57 A;  1N8R U;  2F5T X;  4PJO B;  1GXI E;  1N8R R;  2GCX A;  3I56 T;  2E5K A;  3GF5 A;  4C92 C;  3UF4 A;  3MO8 A;  4M7D G;  5CKF A;  1IHV A;  4M7A D;  1UE9 A;  3FLG A;  4ELZ C;  2M02 A;  3OY9 A;  2ROT A;  5GMK l;  4FIB A;  1TXQ A;  3G4S T;  4FYV B;  4KGV B;  2NUZ A;  2KRO A;  2JM8 A;  2D8J A;  3R6N A;  4PJJ A;  4C92 A;  2FVU A;  3HRT A;  2ZCF B;  3RNJ A;  2KT1 A;  4FU6 A;  2FB7 A;  3PFS A;  3VS0 A;  2DFU A;  4J9E A;  3G7Z A;  2D0N A;  3LW5 E;  4M78 A;  5FWC A;  2P4R A;  2YXY A;  1AWW A;  2DRM A;  1V29 B;  3CCQ Q;  2PQW A;  1TS9 A;  1U1S A;  3BY7 A;  2RM4 A;  2LX9 A;  5GAM h;  2YT6 A;  1JXO A;  2DIL A;  3UPU A;  1PKS A;  3JB9 J;  2DXU A;  1K8A U;  4C92 F;  2BIV A;  1WJR A;  2YRD A;  1SPK A;  1ZA1 B;  3CC2 Q;  4Y92 A;  3SHW A;  4LUD A;  3CCL T;  5KE2 A;  2YUP A;  5GMK h;  2EQM A;  3QZ9 B;  3M53 A;  4F16 A;  3G71 A;  1TOV A;  2COZ A;  3HKS A;  3OYE A;  8AT1 B;  4M7D A;  1JO8 A;  2GBQ A;  4F04 B;  2E41 A;  1G83 A;  1VQ4 A;  3QXE B;  5LL6 S;  4BD3 A;  2DZ9 A;  2DTO A;  2CZ0 B;  3CPW P;  1D0Z A;  1M30 A;  1K4U S;  2CGH A;  4J8O A;  1K0X A;  2AK5 A;  4ESR A;  2AKL A;  3TU4 K;  4B9W A;  4DOV A;  1OV3 A;  1UEC A;  3I56 Q;  2NUT B;  4VUB A;  2LCC A;  2X4J A;  4J7F A;  1WJS A;  1QKW A;  2FEI A;  3SB2 A;  1UHC A;  4RTV A;  3JB9 I;  4F7U E;  1MV0 B;  2DLP A;  1NE8 A;  2DA9 A;  3OYN A;  2CYZ B;  2LVM A;  3QHS A;  4RTW A;  1Q81 C;  3E9G A;  2RA2 A;  2R5A A;  1WHM A;  3DLM A;  3CCU A;  2P0K A;  4X34 A;  1K73 U;  3TEE A;  3RKY A;  1NLP C;  1WLP B;  4M4Z A;  2I2L A;  1WXU A;  2RJC A;  3FIF A;  2BKD N;  4EIK A;  1PKT A;  4KH0 B;  1FMW A;  2RNA A;  4CI0 C;  4V2S A;  1M3A A;  1V1C A;  3CCU Q;  2QTX A;  2CP5 A;  3HSB A;  2FZG B;  1JQQ A;  4PJO D;  3A8G B;  2F2V A;  2HL5 C;  3R6O A;  4F7U G;  3HRS A;  1K9M U;  2CS7 A;  1QVF S;  1W6X A;  1NYF A;  2FZC B;  4NL3 A;  2EBP A;  2KR3 A;  3M0U A;  2IVW A;  2X9H A;  4JLI A;  1WQ7 A;  3C12 A;  2XIC A;  4WCI A;  1ACM B;  1VQ8 A;  2ZPH B;  4QKU A;  2BUD A;  3M58 A;  4BE2 A;  4HXJ A;  5CCA A;  3CCQ A;  1RAG B;  5GAN 5;  3ULR B;  1R8O B;  3SEM A;  4RTU A;  1AWJ A;  3PVL A;  2PVG B;  2XHC A;  3HP9 A;  3LWH A;  1VQ7 Q;  3RKX A;  2QAZ A;  4JLG A;  1AZE A;  2HBW A;  3M59 A;  4E7K A;  4NL2 A;  3KXT A;  5FW9 A;  2KYB A;  1D1C A;  1Q81 R;  2GNC A;  4CC2 A;  4LD9 K;  1OX8 A;  3URG A;  1QP2 A;  3PIP A;  6AT1 B;  2E6Z A;  2ZPF B;  4J5Y A;  2E1H A;  3CME T;  4KGZ B;  4M77 B;  1S72 T;  2VWF A;  5LJ5 f;  2EKO A;  1UB4 A;  3H6Z A;  1YP5 A;  1K8A C;  2JW4 A;  1PRL C;  3LLR A;  3L2Q A;  2DEU A;  1OEB A;  2EIF A;  2RN8 A;  8ATC B;  1M8V A;  2F2X A;  1M3B A;  2F69 A;  2SEM A;  5KH6 A;  2DNU A;  4PJO G;  2LJ1 A;  1G5V A;  1D1B A;  1K0S A;  4LUE A;  2A08 A;  3LGL A;  2KXC A;  4FYW B;  4C0F A;  3CMA A;  2L3Q A;  2L8D A;  1KIK A;  3A1P A;  2RD1 A;  1UGP B;  2K2V A;  3QKJ A;  1IXD A;  2KRM A;  3QZ5 B;  2E4H A;  4TVR A;  1KQS P;  3GLX A;  5IHK A;  2QYZ A;  1R77 A;  4LDY A;  1ZSZ B;  1GCQ C;  1ZHI A;  1Q95 G;  3SDZ A;  3L2U A;  1VQM Q;  3LWI A;  1YHQ T;  1UDL A;  4JS4 A;  3A8M B;  2DK3 A;  5M9O A;  1X43 A;  4ANJ A;  4OP0 A;  1YIJ Q;  4KRT A;  5FRN A;  2PNI A;  1VQ8 Q;  2OTL T;  2KEA A;  2HL3 A;  2FG0 A;  2VC8 A;  5GAN d;  4ZTF A;  2AZV A;  2KYM A;  5CIU A;  1KD1 C;  3OW2 P;  2FHD A;  2YUN A;  2P0P A;  2OJ2 A;  2V26 A;  1Q86 C;  2LCS A;  4N0A C;  1RAA B;  1WHH A;  4RCC A;  1ARK A;  3E1S A;  4QW2 A;  5A0D A;  2XDB A;  3CC7 T;  1FYN A;  3CCR T;  1K73 C;  2MYS A;  2MIO A;  1HYO A;  5CAI A;  5GAO q;  1XOV A;  2X4X A;  5GAN 2;  1IGQ A;  3REA B;  2GFU A;  4MMK A;  3PE0 A;  1ZQ1 A;  2RB6 A;  4PJO F;  1KQ2 A;  1WQW A;  4M7D B;  1C0M A;  1JXM A;  5KYY B;  3CD6 T;  4PJO C;  1FWZ A;  2PUO B;  5HCK A;  1UGQ B;  2E3H A;  1VA7 A;  1YCS B;  2KBT A;  4LD6 A;  3VV0 A;  1W2B A;  1YJN T;  1RAE B;  2Y4X A;  3FDR A;  3ME9 A;  1W2B S;  4C5I A;  1M1F A;  5HK3 A;  4IUU A;  1OI1 A;  2E65 A;  2PTK A;  2RO0 A;  3CCJ T;  5I2S A;  1KD1 R;  2OTJ Q;  4M75 B;  4C8Q D;  5KYW B;  1M3C A;  4M7D C;  4M77 C;  3NGP A;  3G71 Q;  3VS6 A;  2KY9 A;  1K76 A;  3MEV A;  1J3T A;  1N5Z A;  4JRP A;  1OQK A;  1ABQ A;  1U1T A;  2HAX A;  2WAC A;  2NWM A;  2O4X B;  4HA8 A;  1HSQ A;  3CPW A;  3SWN C;  4L6V 5;  3I9Q A;  2LTO A;  2JTF A;  4DBH A;  3G6E T;  2J05 A;  4A4G A;  1O9S A;  4IUP A;  2DD5 A;  5I11 A;  5ECA A;  1I4K 1;  2KK4 A;  4XTX A;  4JZ4 A;  1EZZ B;  4C92 B;  4F7U A;  1WIE A;  4QT7 A;  1VQN Q;  2HKN A;  4BDZ A;  1G2B A;  2CZ7 B;  4LDV A;  4DA4 A;  1TSF A;  4Z89 A;  2RHX A;  1YI2 Q;  4LDW A;  3V8L A;  3G4S Q;  1BU1 A;  4C0D B;  2DRK A;  2PUK B;  4J9F A;  3TCJ A;  1YI2 A;  4PJN A;  3OYK A;  4D6W A;  1RAC B;  3CCV T;  3A98 A;  3V7C A;  3E2U A;  3BDL A;  4QVZ A;  1UJY A;  1NZ9 A;  4PJO A;  5DLQ E;  3O8V A;  1WGS A;  3LH0 A;  5GAN e;  2CT3 A;  5CQX A;  2KI7 A;  4XU3 A;  3OYI A;  1U3O A;  5D6X A;  1Q7Y R;  1NM7 A;  2EPD A;  2YDL A;  1UTI A;  2YWW A;  3OYC A;  1KQS A;  2DET A;  1M90 U;  3L42 A;  2DL8 A;  2QQ9 A;  2RI2 A;  3C94 A;  4OB3 B;  2QQS A;  1QWE A;  2DTH A;  4E7S A;  2AIR B;  3X26 B;  3HL8 A;  3VS1 A;  1CSK A;  3DB3 A;  1LPL A;  1I5O B;  3UWN A;  1C6V X;  3X20 B;  3QUI A;  1AOJ A;  4M78 G;  3JCM b;  3EFO A;  4PFZ A;  5KCH A;  2PVD B;  3M54 A;  5FLX E;  1YHQ A;  2LQW A;  3ASK A;  4A53 A;  2LP5 A;  2KT8 A;  5D7U A;  3M5A A;  2VXF A;  1VIF A;  2G6F X;  3OSS C;  2K6D A;  2W0Z A;  3CCL A;  1VQP Q;  1Q86 R;  2A37 A;  4AFU C;  2QEX A;  4RTX A;  4EMH A;  3E19 A;  1FMV A;  2P4T A;  2CP0 A;  3G71 T;  1SHG A;  2YHT A;  2L5Q A;  3CCE T;  3OS5 A;  2RJE A;  4PJL A;  5HY6 A;  2HZY A;  1XNI A;  3ZBD A;  2QAS A;  1UG1 A;  3JCM e;  2G3R A;  1Q82 C;  5KYX A;  3EGD A;  3I35 A;  5KYY A;  2O9V A;  1K9M C;  3LH5 A;  1VQK Q;  2LJ3 A;  4PKC C;  4CC3 A;  1YIT Q;  4XTZ A;  2OTL Q;  1JJ2 S;  1SF9 A;  2ESW A;  1KG1 A;  1TUC A;  3HHT B;  2KE9 A;  4RTT A;  1M9S A;  4HVU A;  2DVE A;  1VQ4 Q;  3MP6 A;  1GBQ A;  1VQN T;  4BE1 A;  3SWN A;  5LJ3 g;  1D1A A;  1YI2 T;  2QTV A;  2GGR A;  2VKN A;  2YSQ A;  4XTU A;  1GL5 A;  5CKD A;  3DLL A;  4RG8 A;  2A36 A;  2H8H A;  2VB6 A;  4BDY A;  2DE0 X;  3GNG A;  2X3X D;  1QCO A;  4PFO A;  1Q81 U;  4NS5 A;  2KGT A;  3CC7 Q;  3NPF A;  4CC7 A;  4M7A B;  1E6G A;  2RQU A;  4N4G A;  3ZEH A;  1F1B B;  1TH7 A;  1OX9 A;  2K79 A;  3CBM A;  1AEY A;  3NTH A;  2EYY A;  3LYI A;  1K1Z A;  1OOT A;  2JVV A;  1YIT A;  3V7R A;  3CBO A;  2IIM A;  2QQR A;  3NHN A;  4C0G A;  3C95 A;  3F70 A;  1WDX A;  4PLL A;  3CCS A;  4XU2 A;  1MND A;  2BZY A;  4AFZ C;  2QDL A;  2JMA A;  3VUZ A;  4OMF B;  3G4S A;  4BI3 A;  3JCM Q;  2LNV A;  1KK7 A;  1IRE B;  2CUD A;  1WHL A;  3PMI A;  1K9M R;  3J7A F;  3EG1 A;  3OW2 A;  2MOX A;  4LNP A;  1QMC A;  1HK9 A;  1ZSZ A;  2K5L A;  1Y07 A;  2DL3 A;  3L1A A;  3ER0 A;  3BDU A;  2DXT A;  3VS5 A;  2RQR A;  2MK5 A;  3MHX A;  5LJ3 h;  2IG0 A;  1JBM A;  2KAF A;  2SRC A;  2WSE E;  3CXC P;  3JB9 H;  1PSF A;  2DMO A;  3M9Q A;  2DL7 A;  1I5L A;  4FSX A;  1NBE B;  4MDW A;  1VQ6 A;  4FM4 B;  1RI0 A;  2HQX A;  3GP8 A;  1VQO Q;  2M9U A;  5LJ3 f;  3FJ5 A;  4Y91 A;  1AD5 A;  3H0F A;  2FO0 A;  3SD4 A;  3M0Q A;  4Z88 A;  3OS0 A;  1BCO A;  2LC4 A;  2GQV A;  2W10 A;  4ZGD B;  1PD1 A;  2K2M A;  3HPW A;  2EGE A;  3MET A;  1BB9 A;  2C0I A;  2QXF A;  4X1V A;  2XD0 A;  1Y57 A;  2B86 A;  2BTT A;  4M77 G;  3CCE A;  2HQE A;  2ED0 A;  4XTY A;  4AFQ C;  3I55 T;  3CXC A;  2VXE A;  5LJ3 d;  4HCK A;  3EGX B;  4L5G A;  5J39 A;  3CCM Q;  2OX7 A;  3T9N A;  1AVZ C;  2K5F A;  2XKO C;  5FWB A;  1YJW T;  2VYT A;  3I55 Q;  2COW A;  4J6W A;  3U23 A;  5FRM A;  3A8O B;  5FU7 C;  2QI2 A;  2E12 A;  1VIE A;  4GY5 A;  2JS0 A;  2RHI A;  2EQU A;  3CCU T;  1K9A A;  1Q82 R;  1WHJ A;  3PGG A;  3OMC A;  3CC2 A;  1QW1 A;  3OYB A;  1RAB B;  3VU3 C;  1YIJ T;  2P84 A;  1BYM A;  1VQ9 T;  2JXB A;  4FCY A;  3OYD A;  1ZUK A;  3BW1 A;  5GMK i;  2L0A A;  4J7I A;  1MMD A;  3OYH A;  5CR2 A;  4M75 G;  2CZ1 B;  2QGG A;  4OF1 A;  4DEY A;  3A8H B;  2QK0 A;  4XQ3 A;  1I81 A;  2X51 A;  3EHQ A;  4M75 D;  3PT9 A;  4C8Q B;  2DER A;  4AMC A;  3Q1J A;  2QDY B;  2RHU A;  2HNI A;  1WPY A;  1BIA A;  1SKU B;  1SRL A;  2CP2 A;  4M7A G;  4RTY A;  3OYJ A;  4OGE A;  1X2Q A;  4JZ3 A;  2OI3 A;  3P8B B;  1KC8 U;  4Q5W A;  4FL6 A;  4P5N A;  2AZS A;  5GMK j;  3QWY A;  5I2M A;  3LX7 A;  2QG9 B;  3RUX A;  2XK0 A;  1BI2 A;  1CKA A;  3QII A;  3QYH B;  1NJI U;  2D0Q B;  5GAO l;  4KUL A;  3X24 B;  1VQM A;  2DYB A;  3CCV A;  1CKB A;  5IXF A;  4ZTJ A;  1LOJ A;  1WHG A;  2MI6 A;  5A2Q E;  4J9C A;  4C5H A;  2E64 A;  9ATC B;  3JCM J;  2DBM A;  2NYS A;  3QDF A;  2X3W D;  3MP1 A;  2K7A A;  2HKQ B;  3BFM A;  3RIR A;  4RUG A;  1NEB A;  4CRI A;  3EH2 A;  2E10 A;  2HQH A;  1YJN Q;  2B8A A;  2Y90 A;  3G6E A;  2CT4 A;  5J3B A;  4O5V A;  2IPO B;  4M7D D;  2NUP A;  1QVG A;  3FRN A;  5GMK m;  5LJ5 j;  1YJW Q;  5EC7 A;  4RTZ A;  1SG5 A;  2MPX C;  2O31 A;  4N4I A;  4J9I A;  2DVJ A;  1YNZ A;  4GBQ A;  3V7S A;  4KGX B;  2ZPE B;  5LJ5 e;  1VQM T;  1FMK A;  1BKB A;  1PC0 A;  3M0P A;  1HXD A;  1Z9Q A;  5GAN f;  3GPL A;  1H3H A;  4DEX A;  3PIO A;  2RF0 A;  1RUW A;  3JSC A;  1V76 A;  1OUL A;  1BIB A;  3L2R A;  1IRX A;  2NUP B;  1M4Z A;  3J80 E;  1FX7 A;  4N4H A;  3M57 A;  1KQS S;  1QLY A;  4QVD A;  3H41 A;  2P0Q A;  4M78 B;  1VQP A;  4M78 D;  5IT9 E;  1OU8 A;  2XG8 D;  2GTO A;  5DM7 R;  3JCM g;  4JJD A;  2LRQ A;  4ZN1 A;  2XDP A;  4WTO B;  4DOW A;  2EQK A;  4PFP A;  5GAM e;  3OS1 A;  3G1J A;  5CKB A;  5IH2 A;  1Y7X A;  4LDU A;  2GF7 A;  5IHN A;  4PL6 A;  5KYU B;  2CKK A;  2DF6 A;  1P92 A;  1WNL A;  2QQA A;  2CP3 A;  1I0C A;  2ZPB B;  1W4S A;  1IO6 A;  1ZX6 A;  4DBR A;  4E7H A;  2R5M A;  1G3S A;  2JTM A;  3RER A;  1M5Q 1;  3GIB A;  2EW3 A;  4XAX B;  4JRI A;  3VRY A;  3HFN A;  1X69 A;  1OU9 A;  2RPN A;  4QQG A;  4O6J A;  4EMK C;  3VS3 A;  3RMS A;  3GNF B;  4OB1 B;  1ZUU A;  5GAN 8;  1HD3 A;  5CKE A;  5IAY A;  5GAN 3;  1NG2 A;  3JCM W;  2DPP B;  4PJO E;  2EQI A;  1E7O A;  3EG9 B;  2BE9 B;  1H3Z A;  2DTI A;  3FC3 A;  2KNB B;  2ZZD A;  5GAN g;  4Z8A A;  4ZNX A;  3WVE B;  5J26 A; 
#chains in the Genus database with same CATH homology
 1GCP A;  1AOJ A;  2FRY A;  4LE9 A;  2LQW A;  2LP5 A;  2KT8 A;  2ENM A;  2G6F X;  2K6D A;  2W0Z A;  1KFZ A;  2YT6 A;  1JXO A;  2DIL A;  3REB B;  2A37 A;  4AFU C;  1PKS A;  4ORZ A;  4RTX A;  1SPK A;  4OML A;  2FPD A;  2KRS A;  4Y92 A;  1NYG A;  1SHG A;  3SHW A;  4LUD A;  1M8M A;  4F17 A;  2VVK A;  1B3Q A;  2YUP A;  1WXB A;  1UG1 A;  1AWX A;  4F16 A;  3I35 A;  2O9V A;  3H0H A;  3LH5 A;  2LJ3 A;  3H0I A;  4CC3 A;  1JO8 A;  2LX7 A;  1AZG B;  2HEQ A;  2GBQ A;  3JV3 A;  2ESW A;  1TUC A;  1G83 A;  2EKH A;  4J9D A;  4D8K A;  4GLM A;  2KE9 A;  1A0N B;  1RLQ C;  1WYX A;  4RTT A;  1PWT A;  4HVU A;  1M30 A;  1K4U S;  1H8K A;  1GBQ A;  1GCQ A;  2FPE A;  1K0X A;  1X27 A;  2AK5 A;  4ESR A;  2AKL A;  1OV3 A;  2GGR A;  1UEC A;  2VKN A;  2YSQ A;  1GL5 A;  1MV3 A;  3M0T A;  2HDA A;  1H92 A;  2A36 A;  3O5Z A;  2H8H A;  1QKW A;  2FEI A;  1UHC A;  2DE0 X;  4RTV A;  1MV0 B;  2DLP A;  1VYT A;  2X3X D;  2DA9 A;  3EHR A;  2YUO A;  2CDT A;  1U06 A;  2O88 A;  4RTW A;  2KGT A;  3THK A;  3NPF A;  4CC7 A;  1E6G A;  1SHF A;  1ZLM A;  2RQU A;  3I5R A;  1PNJ A;  1ZBJ A;  3VS7 A;  2BZ8 A;  1WA7 A;  1E6H A;  2F2W A;  1GRI A;  1NLP C;  2K79 A;  1WLP B;  2OAW A;  2L3P A;  3UAT A;  4M4Z A;  1KJW A;  1AEY A;  2EYY A;  1K1Z A;  1OOT A;  2RQV A;  1WXU A;  2L3S A;  1JEG A;  1M27 C;  2IIM A;  4K11 A;  3NHN A;  4IIM A;  4EIK A;  4F14 A;  1PKT A;  2MCN A;  1SEM A;  2RNA A;  1WDX A;  2EGC A;  4A63 B;  3EG0 A;  1M3A A;  1V1C A;  1GFC A;  2BZY A;  5IHI A;  4J9G A;  4AFZ C;  2CH4 W;  2QDL A;  2JMA A;  2LZ6 B;  1QWF A;  1JQQ A;  4AFS C;  2CSQ A;  2F2V A;  2CUD A;  1TG0 A;  3EG1 A;  4JJB A;  2MOX A;  4LNP A;  1W6X A;  1NYF A;  1WI7 A;  1SRM A;  1RLP C;  2EBP A;  2KR3 A;  2O2O A;  3M0U A;  3VRZ A;  4WCI A;  1BK2 A;  2DL3 A;  2J6F A;  2YUQ A;  1S1N A;  1HJD A;  2J6O A;  3VS5 A;  2RQR A;  4AG1 C;  4HXJ A;  2SRC A;  4OMN A;  3TSW A;  2DMO A;  2DL7 A;  3ULR B;  3SEM A;  4RTU A;  1OPK A;  1AWJ A;  3PVL A;  1UHF A;  2CRE A;  2A28 A;  4JJC A;  3IQL A;  2FPF A;  2ROL A;  3FJ5 A;  1AD5 A;  1RI9 A;  3H0F A;  1X6G A;  2FO0 A;  1AZE A;  2HBW A;  3M0Q A;  4Z88 A;  1Z9Z A;  1WFW A;  3UA7 A;  1AWO A;  2PZ1 A;  5FW9 A;  2KYB A;  2W10 A;  2GNC A;  4CC2 A;  2C0O A;  2K2M A;  1YN8 A;  2EGE A;  1BB9 A;  1WXT A;  1I1J A;  2C0I A;  1ABO A;  4X1V A;  3CQT A;  1Y57 A;  4JPB W;  2B86 A;  3M0S A;  4OMO A;  2BTT A;  2VWF A;  1YP5 A;  2KXD A;  2ED0 A;  2JW4 A;  1PRL C;  4AFQ C;  2JTE A;  1OEB A;  2AKK A;  2J6K A;  2RN8 A;  4HCK A;  1ZSG A;  2F2X A;  1M3B A;  1UFF A;  2SEM A;  1AVZ C;  2DL5 A;  2DNU A;  5FWB A;  2LJ1 A;  1K0S A;  4LUE A;  2RQW A;  2A08 A;  2KXC A;  1X6B A;  2LNH B;  4OMM A;  3U23 A;  3VS2 A;  1YWP A;  2RQT A;  2L3Q A;  1ZUY A;  2GQI A;  1KIK A;  2DJQ A;  5IXB A;  2JS0 A;  2KRM A;  1T0H A;  2EYX A;  2GTJ A;  1K9A A;  3EG3 A;  5IHK A;  4OMQ A;  2EVR A;  1GFD A;  2ECZ A;  1JU5 C;  4LN2 A;  1GCQ C;  1YWO A;  2JXB A;  1ZUK A;  1PHT A;  1T0J A;  2L0A A;  1UDL A;  1GBR A;  2V1Q A;  1T3S A;  4DEY A;  1X43 A;  3EHQ A;  2DL4 A;  2LMJ A;  2JMC A;  4KRT A;  1OPL A;  2EGA A;  2PNI A;  3VS4 A;  2KEA A;  1EFN A;  2FG0 A;  1UGV A;  1SRL A;  4RTY A;  1X2K A;  1X2Q A;  2OI3 A;  4JZ3 A;  2AZV A;  2KYM A;  1U5S A;  2DBK A;  4J9H A;  5L23 A;  2CH4 A;  2K3B A;  2AZS A;  1MUZ A;  3QWY A;  4J9B A;  2YUN A;  4FSS A;  2M51 A;  2OJ2 A;  2JM9 A;  1CKA A;  2LCS A;  1Y0M A;  2DYB A;  1CKB A;  2ED1 A;  1ARK A;  5IXF A;  1VYV A;  1KSW A;  2LJ0 A;  5I22 A;  4HVW A;  1FYN A;  2JS2 A;  4J9C A;  1QCF A;  1TUD A;  1VYU A;  2EYZ A;  2MIO A;  3EGU A;  3RBB B;  2M0Y A;  4HVV A;  2K9G A;  1XOV A;  2D1X A;  2DBM A;  2X3W D;  3UA6 A;  1PRM C;  3M0R A;  3REA B;  2K7A A;  2J7I A;  3PE0 A;  2I0N A;  2RMO A;  4RUG A;  2DM1 A;  1NEB A;  2EYW A;  4D8D A;  3C0C A;  3TSZ A;  3I5S A;  2FRW A;  2CT4 A;  1JXM A;  4R0K A;  2BZX A;  5GJW B;  2CSI A;  2HCK A;  5HCK A;  2KRN A;  1VA7 A;  1YCS B;  5EC7 A;  2KBT A;  1UJ0 A;  4RTZ A;  2O31 A;  4J9I A;  1LCK A;  2DVJ A;  1YNZ A;  4GBQ A;  2XMF A;  1NEG A;  3PVQ A;  2CUB A;  1FMK A;  3EG2 A;  3M0P A;  2JT4 A;  2DX1 A;  1Z9Q A;  2PTK A;  1H3H A;  4DEX A;  1M3C A;  4AG2 C;  2RF0 A;  1RUW A;  3NGP A;  3VS6 A;  3ZL7 C;  1K76 A;  1W70 A;  1SSH A;  1J3T A;  1I07 A;  3TVT A;  1N5Z A;  3GBQ A;  1WX6 A;  4E6R A;  1ABQ A;  3NMZ C;  1QLY A;  2NWM A;  1HSQ A;  3H41 A;  3I9Q A;  1T3L A;  2J05 A;  2V1R A;  2C0T A;  2GTO A;  5I11 A;  5ECA A;  4JJD A;  1NLO C;  2D8H A;  4JZ4 A;  2O9S A;  4OMP A;  1WIE A;  4QT7 A;  1G2B A;  5IH2 A;  4Z89 A;  5IHN A;  2ABL A;  1UUE A;  2DF6 A;  1BU1 A;  2E5K A;  1QKX A;  2DRK A;  3QWX X;  2L2P A;  3UF4 A;  4J9F A;  4CC4 B;  1UE9 A;  2J06 A;  3A98 A;  1B07 A;  1I0C A;  1UJY A;  1IO6 A;  1ZX6 A;  2ROT A;  2EW3 A;  3VRY A;  2CT3 A;  2LQN A;  1X69 A;  2NUZ A;  2KRO A;  2JM8 A;  2RPN A;  2D8J A;  3R6N A;  1U3O A;  3VS3 A;  2HSP A;  5GJV B;  1NM7 A;  2EPD A;  2YDL A;  1UTI A;  1ZUU A;  1W1F A;  1HD3 A;  3RNJ A;  2KT1 A;  1BBZ A;  1NG2 A;  2DL8 A;  3VS0 A;  2EQI A;  1E7O A;  1QWE A;  4J9E A;  2D0N A;  3KFV A;  4IIO A;  5FWC A;  2KNB B;  2P4R A;  1AWW A;  2DRM A;  4Z8A A;  4ZNX A;  3VS1 A;  1CSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...