3RNJA

Crystal structure of the sh3 domain from irsp53 (baiap2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Brain-specific angiogenesis inhibitor 1-associated protein 2
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rnjA00
4DEXA 1J3TA 1UG1A 1WI7A 1UHFA 2YUPA 1HD3A 3THKA 4JPBW 2KYMA 1BB9A 3EG2A 4J9GA 1ZX6A 1GL5A 1I0CA 2ROLA 3TSWA 1QLYA 1UGVA 1VYUA 4HXJA 3LH5A 4JZ3A 4ESRA 1OPKA 2EQIA 2MCNA 2CH4W 1NYGA 1V1CA 2JM9A 1Z9ZA 1BBZA 1VYVA 2DL5A 2LJ3A 1QWFA 4RTVA 2MIOA 1B3QA 2KROA 2QDLA 2KNBB 2DVJA 1K1ZA 2JS0A 3VRYA 3VS0A 1NLPC 2V1QA 3I5SA 2JMAA 4F17A 2JS2A 1WXUA 5FWBA 5HCKA 2M51A 1CSKA 2AKLA 1CKAA 3M0TA 2DLPA 1YCSB 1HSQA 1UFFA 2FRYA 2K3BA 3I35A 1I1JA 2DJQA 1X2QA 5I22A 4OMOA 2HBWA 1FMKA 1UJ0A 2K79A 2CSIA 2EYZA 3VS6A 5ECAA 3GBQA 1AZGB 1GFCA 1RLPC 1GBQA 2VWFA 2L3PA 1SHFA 2FPEA 3CQTA 1U06A 3PVQA 3EGUA 4HCKA 2KT1A 1X6GA 4JZ4A 1TG0A 2GQIA 1T3LA 4RTTA 5IXBA 2P4RA 1NEGA 1T3SA 2DA9A 1WXBA 3TSZA 2VKNA 2YUOA 2K6DA 4D8KA 1OOTA 4OMNA 1VA7A 2CUDA 2EGCA 4Z89A 3M0RA 1S1NA 2FEIA 1M3CA 1YWPA 1Z9QA 2F2XA 1ARKA 2B86A 2DL3A 2D0NA 2EBPA 2LP5A 3M0UA 1ZBJA 2J6FA 1KFZA 1MV3A 2A08A 1B07A 2G6FX 3REAB 2O9VA 3VS5A 1NEBA 1RUWA 2RQVA 2PNIA 1PKTA 2J7IA 1HJDA 1YP5A 2GNCA 2J6OA 1TUCA 2DRKA 4ORZA 2CREA 1ZUKA 3NPFA 2FG0A 2LJ1A 1ZUUA 4OMLA 1ABQA 3QWYA 1JQQA 1E6HA 2LMJA 1OPLA 3M0PA 2JT4A 1AWWA 1YN8A 2RF0A 2GGRA 2HEQA 2M0YA 1PHTA 1X69A 1H92A 4J9HA 1SHGA 2KEAA 1ZLMA 2V1RA 1IO6A 4DEYA 2L0AA 2LQWA 1OEBA 1AWXA 1ZUYA 3EG1A 4ZNXA 1SRMA 2VVKA 4QT7A 2RQRA 2GTOA 2AK5A 1MUZA 1UUEA 4CC4B 1T0HA 2K9GA 2PTKA 2KGTA 4J9DA 2BTTA 2D8HA 1SSHA 2DRMA 1M30A 2O9SA 1E7OA 2RN8A 4X1VA 2C0OA 4OMPA 2J05A 2JW4A 2OAWA 1H8KA 4OMQA 2ENMA 2C0TA 4GBQA 2LZ6B 4AFUC 2IIMA 4Y92A 4RUGA 2SRCA 1KJWA 2MOXA 2SEMA 3SEMA 2FRWA 3C0CA 1K0XA 4HVUA 2ED1A 4RTYA 2X3XD 3H0IA 1PRLC 2EVRA 2K7AA 4LE9A 4D8DA 3EHRA 1K76A 1X6BA 2FPFA 4EIKA 2JM8A 2AZSA 1QCFA 2ESWA 4FSSA 3NMZC 1SRLA 2BZXA 3VS1A 1SPKA 5FW9A 5GJVB 4AG2C 2K2MA 5IH2A 2NUZA 1JO8A 1YNZA 1TUDA 2EKHA 2LCSA 4HVWA 1WDXA 4AFZC 1UJYA 1Y57A 1UE9A 3QWXX 1M3BA 1W70A 2J6KA 2O88A 2OI3A 3ULRB 2EGAA 1N5ZA 1G83A 2DNUA 4GLMA 5EC7A 1G2BA 2LNHB 1X27A 2X3WD 4RTUA 2CT3A 3ZL7C 2FPDA 2JTEA 1X43A 1MV0B 3I5RA 2L3SA 2C0IA 3VS3A 2RMOA 1WX6A 2I0NA 1JEGA 1KIKA 4IIMA 4J9CA 2A36A 3EG3A 3IQLA 1AWJA 4J9IA 4Z8AA 5IXFA 2D1XA 1AVZC 3VS4A 1GRIA 4RTXA 5IHKA 2RQTA 1FYNA 1UHCA 4K11A 1KSWA 3O5ZA 3U23A 2BZYA 2YDLA 2KBTA 2KRMA 4LUEA 2O31A 2A37A 4RTWA 2ECZA 1A0NB 2LQNA 1ABOA 2YSQA 2CSQA 1PNJA 2F2VA 3H0FA 2YT6A 2DL8A 4JJCA 1AD5A 1WYXA 2DF6A 1UTIA 1NYFA 5I11A 5L23A 2HDAA 2EGEA 4LUDA 3UA7A 3VRZA 1NG2A 2DILA 4KRTA 1AZEA 1RLQC 1VYTA 1BK2A 2KXCA 1PKSA 4AG1C 2CH4A 1XOVA 3UA6A 1WLPB 2H8HA 1JXOA 2DBMA 1U5SA 4M4ZA 2DL4A 1NLOC 2ED0A 4F14A 4OMMA 2D8JA 2DBKA 2FO0A 1CKBA 2A28A 2HSPA 1AEYA 4LNPA 1JXMA 3TVTA 2NWMA 4J9FA 3JV3A 2KRNA 2JXBA 2XMFA 5IHIA 2CUBA 2EYXA 1GCQA 4CC3A 2EYWA 2RQUA 1QWEA 2LJ0A 2EW3A 1WXTA 2EPDA 3NHNA 5GJWB 3R6NA 4LN2A 1RI9A 2E5KA 2BZ8A 5FWCA 2LX7A 4HVVA 1LCKA 5IHNA 2W10A 4F16A 4CC7A 1UECA 3VS2A 1I07A 1K0SA 1GCPA 4A63B 2DMOA 3A98A 2PZ1A 1H3HA 1X2KA 3PVLA 3EHQA 2L2PA 4RTZA 4JJBA 1WA7A 4AFQC 1NM7A 3EG0A 3RBBB 1M8MA 1U3OA 4R0KA 2DM1A 2KYBA 2RQWA 1QKXA 2F2WA 2RPNA 1EFNA 2DX1A 2OJ2A 2YUNA 1E6GA 2AZVA 2CT4A 1AWOA 3H41A 2KR3A 2ROTA 4CC2A 1M27C 2KRSA 2W0ZA 3VS7A 2GBQA 2DE0X 3UF4A 3UATA 1GBRA 3FJ5A 1GCQC 3M0SA 1YWOA 4J9EA 2EYYA 3KFVA 4AFSC 1Y0MA 3SHWA 1T0JA 1SEMA 1K9AA 1ZSGA 1K4US 1PWTA 3PE0A 1GFDA 2DYBA 2JMCA 4JJDA 2KXDA 1UDLA 1W1FA 1M3AA 3I9QA 1AOJA 2O2OA 1W6XA 3NGPA 2HCKA 4Z88A 2DL7A 3RNJA 2L3QA 4WCIA 2KT8A 4IIOA 3REBB 3H0HA 1WFWA 2YUQA 2RNAA 2AKKA 1BU1A 1OV3A 3M0QA 1JU5C 2CDTA 1QKWA 1PRMC 2ABLA 2GTJA 1WIEA 4J9BA 4E6RA 2J06A 2KE9A
chains in the Genus database with same CATH superfamily
1Y71A 3A8HB 3LX7A 2F69A 1WI7A 1VQNT 3FDRA 2QG9B 1TSFA 4E2FB 4M7DG 1UEBA 5LJ3f 4JPBW 1ZBXA 4BDYA 2R57A 2YLCA 2HAXA 2RD1A 2FVUA 1ZX6A 1I0CA 1KHCA 3P8DA 2JJ9A 3PMTA 4MDWA 1BI3A 4HXJA 4Q5WA 4NL2A 1NYGA 4BI3A 1Z9ZA 3GP8A 2WSFE 4RTVA 1G3YA 1JJ2S 4II1A 5D6WA 1YJ9T 2DVJA 2E70A 2JS0A 1KHIA 4M7AD 3VS0A 1V76A 2K3YA 2V1QA 4M78E 1QVGA 2VB6A 2M51A 5KYXA 2AKLA 2H3EB 4Y91A 4OP0A 5LJ5h 3RERA 4FT2A 4DBQA 3JCMc 2K3BA 2OTJA 2VUBA 3JB9F 2VXEA 1BCOA 2HBWA 1UJ0A 2DJZA 4JS4A 2VC8A 4C92B 2FZGB 1Q7YC 2EYZA 3GBQA 1RLPC 1GBQA 2VWFA 3D7SB 2L3PA 1N27A 2XHCA 3CQTA 4M7DA 3G4ST 1YI2A 3M4GA 4M77F 2YWWA 4RTTA 2KVQG 4BE2A 3MEWA 5FU6C 4J7IA 1T3SA 2YUOA 2B8AA 4D8KA 2RHXA 2EGCA 4EPCA 4Z89A 3M0RA 1S1NA 2FEIA 1VQ9A 2PU9B 1Z9QA 2F2XA 4FYYB 3HFNA 2LP5A 1MMNA 2A08A 2O01E 2X35A 3V8JA 2QGGA 1AHJB 2QQAA 1F1BB 1Q81R 2RB6A 1JBMA 1C1AA 4A54A 1VQNA 1HJDA 4FW2A 4FYVB 2DRKA 3Q1JA 4ATOA 3CCUQ 2BE7D 1KD1R 1KQSS 1KD1U 2FG0A 4PFOA 2JNGA 5HKCA 2HQEA 2RA2A 2HL3A 4DQ2A 2MF2A 4WF2A 1YN8A 5KYXB 2HEQA 1PHTA 2DD5A 3CC4Q 4J9HA 1ZLMA 1BKBA 3KUFA 2NUPA 3S3MA 2MWPA 2MWOA 5KYYA 1EZZB 5KE2A 1SRMA 1XNIA 5GAOl 2EQJA 1TTHB 1X01A 3L2UA 2CP3A 1UUEA 4CC4B 2K9GA 2PTKA 1I5LA 2OAUA 1M30A 2O9SA 2RN8A 4X1VA 2C0OA 3QYHB 1VUBA 3CCSQ 1LOJA 3QJYA 2LZ6B 2F1LA 5L8RE 4RUGA 2OTJQ 3V7RA 3CCJA 5GAOr 1YJ9Q 3MP6A 4NL3A 2FRWA 2DAQA 3SDZA 1OX9A 3MCAB 3VU3C 3T9NA 2ED1A 4RTYA 3SWNB 2X3XD 2OTLT 2EVRA 3HP9A 4LE9A 2QEXT 4OGEA 2CP2A 4C8QD 1D09B 4FW1A 5FRNA 1MHNA 3CCQQ 1SRLA 3CC4T 1NZ9A 4XTZA 2K2MA 2V8IA 1VQNQ 4HVWA 1WDXA 2DIGA 1JJ2P 5GAN4 3LGFA 2OI3A 2HNIA 1G83A 4GLMA 1YJNA 2X3WD 5I2MA 2LQKA 2CT3A 1RAHB 2FPDA 2NUPB 2V8JA 3CPFA 2L3SA 1VOMA 5FU7B 4E47A 4X9CA 1VQLT 1KIKA 1IGUA 2A36A 3EG3A 3IQLA 5GAN2 4J9IA 5KYUA 3G6ET 5CKEA 5IN1A 2PVGB 1WJQA 1Q81C 2RQTA 2DYIA 1XQHA 4PJOE 3O5ZA 4MMKA 1SF9A 1WQ7A 4LUEA 4JLGA 2ECZA 1R0CB 3EGXB 1M1FA 1Q82C 2L5QA 3OS5A 3CCRT 2YT6A 2ZZDA 3X24B 1NYFA 5C0MA 4QQDA 3X25B 2XD0A 4J8OA 2ZPGB 2DILA 4KRTA 1OU9A 1RLQC 1VYTA 4XK8E 1JRIA 3UA6A 1WLPB 2EQUA 3UPUA 1U5SA 4PJOD 4OB1B 2LVMA 1ZA2B 1NLOC 3I55T 2ED0A 1YHQT 4OMMA 2DBKA 3CCST 5CAIA 4J6WA 1VQMA 1M8VA 4ZTJA 5GAMd 3QJ6A 1AEYA 1N9SA 1JXMA 5LJ5e 4LDWA 3TVTA 1U8RA 3JRZA 3JV3A 5CCAA 5KYYB 3JCMe 2EJGA 2ZGWA 2RJEA 3UDCA 1PSFA 2EYWA 2RQUA 1GXIE 2DIQA 2QK0A 4C5EA 5GANj 2MI6A 2E6NA 1SG5A 5FWCA 3CCRQ 1WQWA 2NUTA 4HVVA 4KGZB 2NUTB 4CC7A 4M75G 4F16A 2E12A 4BUGA 4A63B 4M7DE 4F7UE 4J5YA 3OYKA 3A98A 1YITT 2PZ1A 4M75E 1KD1C 3SB2A 2E10A 4O6JA 3EHQA 5GAMh 1WHGA 4JJBA 1QMCA 2P0QA 2QQSA 3SD4A 3CC2Q 1HYOA 1QQJA 1U3OA 2KYBA 4KT0E 1YIJQ 1QKXA 1VQLQ 3CMAT 2F2WA 4N4IA 2K5IA 3CCUA 1EFNA 3DLLA 2OJ2A 2YUNA 2AZVA 2K2VA 1AWOA 5FU6B 3OYJA 3CMEQ 2KR3A 2XI9A 4CC2A 2W0ZA 4EMKA 3H8ZA 1GBRA 1R8OB 5CO7A 5CVIA 5GAOp 3CC2T 3KFVA 2FZKB 4AFSC 4M7AC 4L6V5 3RR6A 5LJ5d 1D1CA 1K9AA 1VQ6A 4BD3A 2M1HA 3PE0A 4M7DB 4BACA 2VGNA 1UGQB 3V7SA 2DXBA 2GQVA 2O2OA 3NGPA 2HCKA 2DL7A 2LX9A 2KT8A 4DBRA 4M78B 1K8AU 1BU1A 3LH0A 3M0QA 3SFMA 2CDTA 5HK3A 4BI8B 2K5FA 1N8RC 1WIEA 4J9BA 2ZAEA 2X4YA 2KE9A 3G6EQ 1FXXA 1UG1A 1WHKA 3H9NA 4A4GA 1B34B 1UHFA 1HD3A 2G3RA 4M7DC 3LLRA 1I8FA 1Q82U 1XTDA 3CMET 1KC8R 3EG9A 4BE1A 5CK9A 2PVDB 3EG2A 3F70A 1OULA 3EFOB 2CGHA 1KQSP 2P0PA 1GL5A 5GAMj 3C4SA 3ASKA 3ZFJA 1UGVA 1YBYA 3A5ZB 4M7AA 1MMAA 1OPKA 3QBYA 2MCNA 3RMSA 2CH4W 3HTRA 2JM9A 1UGSB 2DL5A 1QWFA 1QP2A 2FL7A 4XU0A 1B3QA 2LCLA 4HA8A 4E7HA 3E1SA 1VQ8Q 4KH0B 3FJPA 1BCMA 1MMGA 1YJWA 1NJIC 2XKOC 3I5SA 5HCKA 5GAMg 2COYA 1CKAA 2DLPA 1YCSB 2DEUA 3M5AA 3MPUB 1VQ5A 3I35A 3CBOA 2DJQA 3RKYA 1X2QA 4OMOA 3OW2P 2GFAA 2RI5A 2AHJB 2CSIA 5ECAA 2EQMA 1AZGB 1QVFP 1M2VB 2F5TX 1VQ4T 4M7AE 2KK4A 5EG2A 1SHFA 2L89A 4FU6A 4FT4A 1U06A 2OTJT 1RL2A 2KT1A 3CXCS 1K73C 1TG0A 2QEXA 1RADB 1ZA1B 4C92F 2P4RA 1QVGS 1AT1B 2HSEB 2HQHA 1YJNQ 2K6DA 1OOTA 4OMNA 4QQ6A 1RAFB 1VA7A 4PJNA 5GAN7 4RG8A 2PVOB 1VIFA 1YWPA 3QYGB 4F7UG 4XTYA 3E9GA 5C6SA 4M77B 2B86A 2DL3A 4GLKA 1QCNA 3MEAA 4PFPA 1KFZA 3H6ZA 2QI2A 3LW5E 1W2BP 3RESA 3S3NA 2HZYA 1NEBA 1RUWA 2FB7A 2RQVA 2PNIA 3MEVA 2BUDA 4XU3A 2GNCA 1HK9A 1VQOT 3NTIA 2LCCA 1ZUKA 3NPFA 1ZUUA 2K57A 4L59A 2DZ9A 3NTHA 1JQQA 1E6HA 3C94A 4PLLA 4C8QA 1VQ9T 4M75B 5DLOA 3CPWP 2JT4A 2RF0A 2M0YA 1X69A 2KEAA 1Y96A 4DEYA 1VQPT 4AT1B 4M77E 2LQWA 3HSBA 2XDDA 3M57A 1AWXA 3EG1A 1Q7YR 3CCLT 1Q7YU 4QT7A 4LDYA 2GTOA 4JRIA 2AK5A 4XU2A 2RHZA 4C5GA 4LD6A 4ZN3A 1YITQ 1YJWQ 1SSHA 1D3BB 3CC4A 3R6OA 1M90C 2RJCA 3L2WA 2J05A 2JW4A 1NBEB 4FM4B 1VQOA 2ENMA 5CIUA 2C0TA 4GBQA 2QA4A 1VQ5T 3EFSA 4KBMB 1PD1A 2HD0A 2IIMA 4C5IA 4PK4A 4DOWA 2SRCA 3C0CA 3CMAA 3L2QA 2QA4Q 3EGDB 1VQPA 3ME9A 5GAMe 4QQGA 3EHRA 3E19A 1X6BA 4V2SA 1M90U 3VYGA 5GAN3 4ZGEB 2VYTA 4LDUA 3UT1A 2Z0WA 2RHYA 2BZXA 2VGMA 1RAEB 3VS1A 5IT9E 5FW9A 4AG2C 5IH2A 2NUZA 2CZ0B 1JO8A 1TUDA 2LCSA 4AFZC 1UJYA 2DXCA 4JRPA 4M78G 2O88A 3ULRB 4RCCA 3NTKA 1KG1A 1PM3A 2KQWA 1X27A 1LPLA 2JVVA 3ZL7C 2XICA 4M77D 3ZBDA 2RK2A 4JLIA 2FZCB 5D6YA 3A8GB 5A2QE 3I5RA 3G4SQ 3ER0A 3VS3A 2COZA 4PNOA 2K3XA 1IXDA 3L42A 1GRIA 4PLIA 5LJ5j 2KMTA 2V8KA 5IHKA 4K11A 5GMKh 3EGXA 1VQLA 2KRMA 2DEQA 2O31A 4RTWA 2E1HA 1U1SA 3GNGA 3OYIA 2GF7A 3OW2S 3JB9G 2JUFA 4J7FA 2DL8A 4JJCA 3JCMQ 5I11A 1M1KC 3TU4K 3OSSC 2CYZB 3VRZA 5LJ5g 2MYSA 1V29B 1PC0A 1AZEA 4AG1C 3CCRA 1XOVA 5A0GA 2H8HA 1JXOA 4J6YA 1D3BA 3CCEQ 4M4ZA 4X34A 4NS5A 1OQKA 2LNVA 3EH1A 3HKSA 4LXCA 1K9MU 1WJSA 3PMIA 2NWMA 3RDVA 3JCMh 4J9FA 4NOYA 2KRNA 5IAYA 3MP8A 2CUBA 2MAMA 1MNDA 5D6XA 1QWEA 2LJ0A 2O4XB 1VQMQ 4M78A 3X26B 3NHNA 1OZ3A 5GJWB 4QVZA 8AT1B 2DPPB 5GANh 1VQPQ 4BY6B 3QXEB 2P4TA 1I07A 2LRQA 1KC8U 4ELYC 1RABB 3JCMg 4XTXA 4BDZA 3BDLA 1K73R 1H3HA 1X2KA 2R5MA 4C92C 3CCMQ 8ATCB 4CI0C 4N4GA 2L2PA 5LL6S 1WA7A 1M90R 1NM7A 3EG0A 4M7AG 4F04B 2A0FB 3SWNC 3OMGA 4M7AF 3LGLA 1WPYA 4A4FA 1M2OA 5LJ5f 5LJ3j 1YWOA 2EYYA 1X6OA 4IUUA 3SHWA 1T0JA 1SEMA 3DB4A 2JMCA 2KXDA 1VQ6Q 3V8LA 4E7SA 1W1FA 2QGFB 3GPLA 4B6MA 1D0XA 1Y96B 1M5Q1 1QVPA 1W6XA 3NFCA 2K5LA 2QQBA 2E3IA 2P84A 2PUOB 2YRVA 3H0HA 2R5AA 3QHSA 5I2SA 2RO0A 1VQMT 3OS0A 3AT1B 2RNAA 1I4K1 3OYAA 3CMEA 2O4XA 1QKWA 3I55A 1PRMC 2ABLA 1M4ZA 2GTJA 4E6RA 4JJDA 3V8KA 2RJFA 2K4YA 1PCXA 2MK5A 1YIJA 3OSVA 2COWA 3THKA 1R0BG 4ZN1A 2KYMA 3MKDA 3PIPA 4J9GA 4BB7A 2JTMA 2ROLA 1RI0A 1QLYA 1VQ8T 3LH5A 1YJ9A 4JZ3A 4ESRA 3OYNA 1LNXA 1G5VA 3A8OB 3CCSA 3WVEB 1PG5B 2PUKB 3C95A 4BE0A 1Q86U 1K1ZA 3VRYA 1NLPC 2JMAA 2HL5C 5FWBA 1CSKA 3A8LB 3OS1A 1WHJA 4XU1A 1NJIR 4E7ZA 1UFFA 3E2UA 5I22A 1S72Q 2RM4A 2YRCA 1FMKA 1O9SA 4M77C 3QO3A 2K79A 4ZGDB 2DKGA 2DO3A 3L2ZA 1VQ8A 1GFCA 1KQSA 1FMWA 2EAYA 1ZSZA 3JCMP 2FPEA 3PVQA 2CZ7B 1X6GA 4JZ4A 2GQIA 4IUVA 1T3LA 4LDXA 2IVWA 1KQ2A 1NEGA 2M9UA 2QAZA 2ZPEB 4B9XA 2VKNA 2RJDA 3CPWS 1M1GA 4MMLA 4DA4A 4KGXB 1PSEA 9ATCB 2CUDA 3QG1A 1D0ZA 4XQ3A 1M3CA 3QDFA 2FYKA 2EBPA 4EDUA 2J6FA 4DBHA 5GANg 2G6FX 2Y90A 3OYYA 4PJOA 5GMKi 3M54A 3I56Q 3REAB 2O9VA 2DVEA 3VS5A 5KYWB 3HHTB 2A3LA 2CKKA 5HK0A 1PKTA 2J7IA 2E41A 2E65A 1YIJT 1VQ6T 1YP5A 5AYFA 1FWZA 4ORZA 2CREA 2HKNA 4JS5A 2LJ1A 1ABQA 3CC7T 4KUDK 1D1AA 2LDMA 2CS7A 3CCVA 1VQKT 4C92D 4JRQA 2YHTA 1OPLA 1SSFA 2GGRA 1H92A 3JB9J 3C12A 3MO8A 2HBPA 2V1RA 2MPXC 3DB3A 1NE8A 5J3BA 4FCYA 3CD6Q 1Q86C 1I5OB 2KSSA 2L0AA 2RK1A 3LWHA 1YFNA 3CCMA 1TU0B 3TEEA 2DK3A 1W2BA 1LVKA 3OYLA 1QVGP 2RQRA 3E9FA 1ZQ1A 5KYNA 3FB9A 1T0HA 3CCMT 2LC4A 4M77G 3S6WA 4PJOG 4PFZA 2DRMA 3OMCA 4C0GA 4B9WA 2OAWA 1LJOA 2KDSA 3EAEA 4OMQA 1YHQQ 3I55Q 4M78D 3CCVT 1VQKA 4AFUC 1S72A 4YTLA 5GAOn 4C8QE 3OYEA 3M53A 1VQ4Q 2MOXA 1K0XA 2EWNA 2X4WA 3CPWA 3CD6A 1MGQA 2CP5A 5J26A 4C92A 1PRLC 3DLMA 4HT8A 2D6FA 5J39A 4D8DA 1C0MA 2AIRB 4XTWA 1N8RR 1ACMB 4BY6C 5FRMA 2RI2A 1FMVA 5FLXE 1VQ5Q 2LT4A 1DJ7B 3NMZC 5GAN8 5LJ3d 1SPKA 2NLUA 4HT9A 1H3ZA 2ZPIB 2FHDA 1YNZA 2CP6A 2EKHA 1VQKQ 2QTVA 1Y07A 1YJWT 1I81A 1Y57A 1UE9A 2YXYA 1W70A 4J6XA 4PJOC 4C0ZA 2BE9B 2EGAA 3RMQA 4JDSA 1N5ZA 2DNUA 3QKJA 5EC7A 3MHXA 2LNHB 3JAME 3VUZA 1UGRB 3PNWC 3RUXA 4IKFA 2DTIA 2JTEA 1WNLA 1MV0B 1HXDA 3JCMJ 3CXCA 3RKWA 1W2BS 4IIMA 3OS2A 1WHLA 5IXFA 4OF1A 3VS4A 1FYNA 1D0YA 1KSWA 2GCXA 1VQOQ 2KBTA 4OB2B 2VASA 3JCMd 5FU7C 3OYCA 2YSQA 4A4KA 4HKEA 2KI7A 1PNJA 2F2VA 3H0FA 1VQ7T 3A1PA 3M4YA 3GLXA 2I2LA 1AD5A 7AT1B 2DF6A 1UTIA 1NJIU 3FEOA 2MMPA 2HDAA 2EGEA 1NG2A 3DKMA 3UWNA 4XTVA 2IG0A 5A0LA 2KXCA 1M1KR 2CH4A 2RH2A 4ANJA 3BDUA 3PGGA 2DL4A 1D1BA 3CCEA 4F14A 2D8JA 1IREB 1CKBA 3G1JA 2A28A 1NPPA 1OX8A 2XG8D 3PT9A 2WSCE 1YHQA 1RAAB 1X75C 3CMAQ 2ZCFB 2EYXA 3BE3A 4CC3A 3L1AA 2EW3A 2WACA 4F7UB 1WXTA 3R6NA 1G3TA 4N0AA 2BZ8A 3OBYA 5KCOA 1UGPB 5IHNA 4QW2A 4MZMA 1KQ1A 2V26A 1UECA 3VS2A 4HCBA 4ZTFA 4OGCA 4A53A 1WGSA 4RMOA 4E7IA 2QYZA 3EH2A 1K0SA 4PJJA 3QUIA 3QPHA 2DMOA 3LYIA 5CKBA 3PVLA 4RTZA 3CCUT 2HMAA 4MZPA 3G4SA 1YI2T 3EFRA 1FX7A 1Q95G 2L3RA 3HRTA 4R0KA 2RQWA 3CCLQ 3BFMA 2HQXA 2RPNA 3VYHB 2DX1A 1E6GA 2CT4A 4WTOB 4RCBA 1QVFA 1M27C 1QW1A 2KRSA 3VS7A 3UF4A 3UATA 3QZ5B 2PQWA 3RIRA 5M9OA 3M0SA 3PIOA 4J9EA 2YLBA 1N6AA 3KXTA 2KAFA 1K4US 2WSEE 2DYBA 4C8QB 1BI1A 1WHMA 1UDLA 2E6ZA 1AOJA 3JCMW 4ELZC 4E7LA 1TUGB 4IURA 1YCYA 4Z88A 5DY9A 4XTUA 3RNJA 2EFIA 1Q82R 2L3QA 4MZTA 4WCIA 3AHUA 2EKOA 3OYDA 3CEYA 1KC8C 3REBB 2YUQA 2DTOA 3TREA 3KBGA 1K73U 4JRKA 3EGDA 4QVCA 2KY9A 5GMKe 2J06A 4DEXA 4LDVA 1J3TA 4M78C 5LJ3g 4M77A 2YUPA 1YJNT 4ZGJB 1M9SA 1BB9A 3FIFA 5CQYA 1IZ6A 4R55A 3TSWA 5KE3A 2GFUA 1VYUA 6AT1B 3S3OA 3A8MB 4KGVB 2EQIA 3MJXA 4KH1B 3WXMB 1V1CA 1YI2Q 1BBZA 1VYVA 1RAIB 2LJ3A 2EQKA 2X51A 4C92G 2MIOA 2KROA 2QDLA 1M2VA 2KNBB 1Y7XA 2BIVA 1XJWB 2OTLA 4FYWB 1QVFS 3JB9I 5GMKj 4C8QF 4F17A 2JS2A 3CCQT 1WXUA 2QTXA 3FRNA 2L8DA 3PFSA 3OYFA 3M0TA 1VIEA 2DERA 1KK7A 4UC4A 4C92E 3HRUA 1HSQA 2FRYA 4L5GA 1I1JA 2R58A 4OMFB 4PJLA 3O8VA 3P8HA 4M75D 1W4SA 4C0DC 3VS6A 5FROA 5GAN6 3J7AF 4RG2A 4X9DA 2RHIA 2X9HA 4FSXA 3VUBA 1OZ2A 4F7UA 3EGUA 4HCKA 1TH7A 3I56T 5DLQE 4N0AC 1K8AC 2AT1B 2JTFA 3J81E 1BI0A 5IXBA 3V7CA 1WJRA 1OI1A 4HCCA 2E5QA 2DA9A 1WXBA 3TSZA 2Y4XA 2X4JA 2XU8A 3QIIA 1ZHIA 4M75F 2XDBA 4E7KA 1ARKA 2QASA 1B34A 4PJMA 3VJPA 4M75A 2D0NA 4LD9K 3INZA 3M0UA 4JUVA 1JB0E 1ZBJA 2JZ2A 1Q86R 1MV3A 1B07A 5GMKm 4EMKC 4Z02A 2M16A 1N9RA 2J6OA 3GNFB 2QDYB 4A4EA 1TUCA 3JCMV 3MEUA 4OMLA 3QWYA 1ZSZC 1OYXA 4EMHA 2LMJA 3QSUA 3M0PA 5KYWA 1EX4A 1AWWA 4E7JA 3JB9H 4PJOB 2XDPA 4JJNK 4XAXB 2CP7A 4BI4A 1SHGA 1IO6A 2LQ8A 4PKCC 4Y28E 1OEBA 1ZUYA 4EMKB 4ZNXA 2ZPFB 3CBPA 2VVKA 1VQ7A 5GAMf 3OBWA 2EJ9A 3BW1A 4M7DD 1N8RU 1MUZA 3J80E 2XK0A 1TOVA 3JCMb 2KGTA 1IGQA 4J9DA 2BTTA 5LJ3h 2D8HA 1JJ2A 5LJ3e 3OYGA 1E7OA 1IB8A 3OW2A 4OMPA 2LT1A 3TCJA 2M02A 4J83A 1H8KA 4O5VA 4AMCA 3G71A 4Y92A 3CCET 4HCZA 1KJWA 2SEMA 3SEMA 1U1TA 3CC7Q 2DZCA 4DOVA 3JB9D 4QKUA 4HVUA 3OYHA 3H0IA 2K7AA 4FIBA 4IUTA 1S72T 1K76A 4C8QG 3I56A 2FPFA 4EIKA 2JM8A 1WZOA 2AZSA 4EMGA 4R56A 1QCFA 2ESWA 1OU8A 4FSSA 1SKUB 5AT1B 4OB0B 4IUQA 5GJVB 4M7AB 1TS9A 5A0DA 3VKIA 2VV5A 3QWXX 1BIBA 1M3BA 1WHHA 2J6KA 3BY7A 1H641 4DBFA 1BIAA 3G7ZA 2ZPBB 3OB9A 2DXUA 3HPWA 1G2BA 2RHUA 5CQXA 4RTUA 5GANf 1IHWA 4C5HA 2LTOA 2C06A 3ZEHA 3G6EA 4OB3B 4M78F 4C0FA 3M9QA 3HL8A 3CD6T 1X43A 2P0KA 3MP1A 3JCMf 5DM7R 2C0IA 2E4HA 2H3JA 1WX6A 2E3HA 2I0NA 2RMOA 2DXTA 1JEGA 3HFOA 4J9CA 5GANd 2Y4YA 1AWJA 4Z8AA 5CKFA 2D1XA 3M56A 1AVZC 4A4HA 1M1KU 2QXFA 3M59A 4RTXA 2CP0A 3URGA 5GAN5 2DD4A 1UHCA 3QZ9B 4C0DB 3U23A 3TQ7P 2BZYA 2ZPHB 2M0OA 4KUIA 2YDLA 5CKHA 4RKUE 4CRIA 3CCLA 2A37A 1A0NB 2LQNA 2XIDA 3RKXA 1ABOA 1C6VX 2CSQA 3FLGA 2NYSA 1BI2A 4F7UF 5KYUB 1WYXA 4GY5A 1G3SA 4OVAA 3FC3A 5L23A 3X20B 4LUDA 3OA6A 1K9MR 3UA7A 1VQ4A 2DETA 5D7UA 3L2VA 1BK2A 1PKSA 2QQRA 2QA4T 3OYMA 2BKDN 2EJFA 3CCQA 3CXCP 2QQ9A 1EIFA 1G8XA 3M55A 2DBMA 4P5NA 1PD0A 1UB4A 1NPRA 2FO0A 4TVRA 1QP3A 1B7TA 4M75C 2HSPA 4LNPA 1IRXA 3GIBA 1IHVA 5KH6A 2VXFA 2OX7A 2JXBA 3EFOA 2QEXQ 2E64A 2X4XA 4FYXB 2XMFA 1MMDA 5IHIA 3OY9A 1GCQA 2OTLQ 3CCJT 2EPDA 4PL6A 2JOYA 1ZSZB 4LN2A 3L2RA 5GANe 1RI9A 2E5KA 4IUPA 5HY6A 2LX7A 3CCVQ 2ATCB 1LCKA 1R77A 1K9MC 2A7YA 2CZ6B 2W10A 3CC7A 4N4HA 2RI3A 1GCPA 1VQ9Q 3G71Q 3CBMA 2CZ1B 5KCHA 1K8AR 3OYBA 1BYMA 3HRSA 2EYQA 3X28B 4C8QC 2DTHA 3M58A 1G3WA 4AFQC 3WVDB 4QVDA 2JN0A 2F5KA 3RBBB 1M8MA 2DM1A 2D0QB 5GAOm 3LWIA 1QCOA 4VUBA 2DFUA 1VQ7Q 3EG9B 3GF5A 3H41A 3JCMX 2ROTA 4PJOF 5GMKl 2GBQA 2DE0X 1TXQA 2HKQB 3FJ5A 1Q81U 1GCQC 3META 3GOXA 2IPOB 1Y0MA 1YITA 3P8BB 1ZSGA 4FL6A 1PWTA 5CKDA 1GFDA 3VV0A 4MDXA 1RACB 3G71T 1MNEA 3N5BB 1M3AA 3I9QA 3CC2A 5I21A 1O75A 5GAOq 1RAGB 3PTAA 4IIOA 3QDRB 1WFWA 4ME7A 3JSCA 3CCJQ 5CR2A 2D9TA 2AKKA 1OV3A 3SWNA 4D6WA 1JU5C 1P92A 4KULA 1TWBA 2EIFA 4M7DF 3OQ5A 2YRDA
chains in the Genus database with same CATH topology
4DEXA 1J3TA 1UG1A 1WI7A 1UHFA 2YUPA 1HD3A 3THKA 4JPBW 2KYMA 1BB9A 3EG2A 4J9GA 1ZX6A 1GL5A 1I0CA 2ROLA 3TSWA 1QLYA 1UGVA 1VYUA 4HXJA 3LH5A 4JZ3A 4ESRA 1OPKA 2EQIA 2MCNA 2CH4W 1NYGA 1V1CA 2JM9A 1Z9ZA 1BBZA 1VYVA 2DL5A 2LJ3A 1QWFA 4RTVA 2MIOA 1B3QA 2KROA 2QDLA 2KNBB 2DVJA 1K1ZA 2JS0A 3VRYA 3VS0A 1NLPC 2V1QA 3I5SA 2JMAA 4F17A 2JS2A 1WXUA 5FWBA 5HCKA 2M51A 1CSKA 2AKLA 1CKAA 3M0TA 2DLPA 1YCSB 1HSQA 1UFFA 2FRYA 2K3BA 3I35A 1I1JA 2DJQA 1X2QA 5I22A 4OMOA 2HBWA 1FMKA 1UJ0A 2K79A 2CSIA 2EYZA 3VS6A 5ECAA 3GBQA 1AZGB 1GFCA 1RLPC 1GBQA 2VWFA 2L3PA 1SHFA 2FPEA 3CQTA 1U06A 3PVQA 3EGUA 4HCKA 2KT1A 1X6GA 4JZ4A 1TG0A 2GQIA 1T3LA 4RTTA 5IXBA 2P4RA 1NEGA 1T3SA 2DA9A 1WXBA 3TSZA 2VKNA 2YUOA 2K6DA 4D8KA 1OOTA 4OMNA 1VA7A 2CUDA 2EGCA 4Z89A 3M0RA 1S1NA 2FEIA 1M3CA 1YWPA 1Z9QA 2F2XA 1ARKA 2B86A 2DL3A 2D0NA 2EBPA 2LP5A 3M0UA 1ZBJA 2J6FA 1KFZA 1MV3A 2A08A 1B07A 2G6FX 3REAB 2O9VA 3VS5A 1NEBA 1RUWA 2RQVA 2PNIA 1PKTA 2J7IA 1HJDA 1YP5A 2GNCA 2J6OA 1TUCA 2DRKA 4ORZA 2CREA 1ZUKA 3NPFA 2FG0A 2LJ1A 1ZUUA 4OMLA 1ABQA 3QWYA 1JQQA 1E6HA 2LMJA 1OPLA 3M0PA 2JT4A 1AWWA 1YN8A 2RF0A 2GGRA 2HEQA 2M0YA 1PHTA 1X69A 1H92A 4J9HA 1SHGA 2KEAA 1ZLMA 2V1RA 1IO6A 4DEYA 2L0AA 2LQWA 1OEBA 1AWXA 1ZUYA 3EG1A 4ZNXA 1SRMA 2VVKA 4QT7A 2RQRA 2GTOA 2AK5A 1MUZA 1UUEA 4CC4B 1T0HA 2K9GA 2PTKA 2KGTA 4J9DA 2BTTA 2D8HA 1SSHA 2DRMA 1M30A 2O9SA 1E7OA 2RN8A 4X1VA 2C0OA 4OMPA 2J05A 2JW4A 2OAWA 1H8KA 4OMQA 2ENMA 2C0TA 4GBQA 2LZ6B 4AFUC 2IIMA 4Y92A 4RUGA 2SRCA 1KJWA 2MOXA 2SEMA 3SEMA 2FRWA 3C0CA 1K0XA 4HVUA 2ED1A 4RTYA 2X3XD 3H0IA 1PRLC 2EVRA 2K7AA 4LE9A 4D8DA 3EHRA 1K76A 1X6BA 2FPFA 4EIKA 2JM8A 2AZSA 1QCFA 2ESWA 4FSSA 3NMZC 1SRLA 2BZXA 3VS1A 1SPKA 5FW9A 5GJVB 4AG2C 2K2MA 5IH2A 2NUZA 1JO8A 1YNZA 1TUDA 2EKHA 2LCSA 4HVWA 1WDXA 4AFZC 1UJYA 1Y57A 1UE9A 3QWXX 1M3BA 1W70A 2J6KA 2O88A 2OI3A 3ULRB 2EGAA 1N5ZA 1G83A 2DNUA 4GLMA 5EC7A 1G2BA 2LNHB 1X27A 2X3WD 4RTUA 2CT3A 3ZL7C 2FPDA 2JTEA 1X43A 1MV0B 3I5RA 2L3SA 2C0IA 3VS3A 2RMOA 1WX6A 2I0NA 1JEGA 1KIKA 4IIMA 4J9CA 2A36A 3EG3A 3IQLA 1AWJA 4J9IA 4Z8AA 5IXFA 2D1XA 1AVZC 3VS4A 1GRIA 4RTXA 5IHKA 2RQTA 1FYNA 1UHCA 4K11A 1KSWA 3O5ZA 3U23A 2BZYA 2YDLA 2KBTA 2KRMA 4LUEA 2O31A 2A37A 4RTWA 2ECZA 1A0NB 2LQNA 1ABOA 2YSQA 2CSQA 1PNJA 2F2VA 3H0FA 2YT6A 2DL8A 4JJCA 1AD5A 1WYXA 2DF6A 1UTIA 1NYFA 5I11A 5L23A 2HDAA 2EGEA 4LUDA 3UA7A 3VRZA 1NG2A 2DILA 4KRTA 1AZEA 1RLQC 1VYTA 1BK2A 2KXCA 1PKSA 4AG1C 2CH4A 1XOVA 3UA6A 1WLPB 2H8HA 1JXOA 2DBMA 1U5SA 4M4ZA 2DL4A 1NLOC 2ED0A 4F14A 4OMMA 2D8JA 2DBKA 2FO0A 1CKBA 2A28A 2HSPA 1AEYA 4LNPA 1JXMA 3TVTA 2NWMA 4J9FA 3JV3A 2KRNA 2JXBA 2XMFA 5IHIA 2CUBA 2EYXA 1GCQA 4CC3A 2EYWA 2RQUA 1QWEA 2LJ0A 2EW3A 1WXTA 2EPDA 3NHNA 5GJWB 3R6NA 4LN2A 1RI9A 2E5KA 2BZ8A 5FWCA 2LX7A 4HVVA 1LCKA 5IHNA 2W10A 4F16A 4CC7A 1UECA 3VS2A 1I07A 1K0SA 1GCPA 4A63B 2DMOA 3A98A 2PZ1A 1H3HA 1X2KA 3PVLA 3EHQA 2L2PA 4RTZA 4JJBA 1WA7A 4AFQC 1NM7A 3EG0A 3RBBB 1M8MA 1U3OA 4R0KA 2DM1A 2KYBA 2RQWA 1QKXA 2F2WA 2RPNA 1EFNA 2DX1A 2OJ2A 2YUNA 1E6GA 2AZVA 2CT4A 1AWOA 3H41A 2KR3A 2ROTA 4CC2A 1M27C 2KRSA 2W0ZA 3VS7A 2GBQA 2DE0X 3UF4A 3UATA 1GBRA 3FJ5A 1GCQC 3M0SA 1YWOA 4J9EA 2EYYA 3KFVA 4AFSC 1Y0MA 3SHWA 1T0JA 1SEMA 1K9AA 1ZSGA 1K4US 1PWTA 3PE0A 1GFDA 2DYBA 2JMCA 4JJDA 2KXDA 1UDLA 1W1FA 1M3AA 3I9QA 1AOJA 2O2OA 1W6XA 3NGPA 2HCKA 4Z88A 2DL7A 3RNJA 2L3QA 4WCIA 2KT8A 4IIOA 3REBB 3H0HA 1WFWA 2YUQA 2RNAA 2AKKA 1BU1A 1OV3A 3M0QA 1JU5C 2CDTA 1QKWA 1PRMC 2ABLA 2GTJA 1WIEA 4J9BA 4E6RA 2J06A 2KE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEX A;  1J3T A;  1UG1 A;  1WI7 A;  1UHF A;  2YUP A;  1HD3 A;  3THK A;  4JPB W;  2KYM A;  1BB9 A;  3EG2 A;  4J9G A;  1ZX6 A;  1GL5 A;  1I0C A;  2ROL A;  3TSW A;  1QLY A;  1UGV A;  1VYU A;  4HXJ A;  3LH5 A;  4JZ3 A;  4ESR A;  1OPK A;  2EQI A;  2MCN A;  2CH4 W;  1NYG A;  1V1C A;  2JM9 A;  1Z9Z A;  1BBZ A;  1VYV A;  2DL5 A;  2LJ3 A;  1QWF A;  4RTV A;  2MIO A;  1B3Q A;  2KRO A;  2QDL A;  2KNB B;  2DVJ A;  1K1Z A;  2JS0 A;  3VRY A;  3VS0 A;  1NLP C;  2V1Q A;  3I5S A;  2JMA A;  4F17 A;  2JS2 A;  1WXU A;  5FWB A;  5HCK A;  2M51 A;  1CSK A;  2AKL A;  1CKA A;  3M0T A;  2DLP A;  1YCS B;  1HSQ A;  1UFF A;  2FRY A;  2K3B A;  3I35 A;  1I1J A;  2DJQ A;  1X2Q A;  5I22 A;  4OMO A;  2HBW A;  1FMK A;  1UJ0 A;  2K79 A;  2CSI A;  2EYZ A;  3VS6 A;  5ECA A;  3GBQ A;  1AZG B;  1GFC A;  1RLP C;  1GBQ A;  2VWF A;  2L3P A;  1SHF A;  2FPE A;  3CQT A;  1U06 A;  3PVQ A;  3EGU A;  4HCK A;  2KT1 A;  1X6G A;  4JZ4 A;  1TG0 A;  2GQI A;  1T3L A;  4RTT A;  5IXB A;  2P4R A;  1NEG A;  1T3S A;  2DA9 A;  1WXB A;  3TSZ A;  2VKN A;  2YUO A;  2K6D A;  4D8K A;  1OOT A;  4OMN A;  1VA7 A;  2CUD A;  2EGC A;  4Z89 A;  3M0R A;  1S1N A;  2FEI A;  1M3C A;  1YWP A;  1Z9Q A;  2F2X A;  1ARK A;  2B86 A;  2DL3 A;  2D0N A;  2EBP A;  2LP5 A;  3M0U A;  1ZBJ A;  2J6F A;  1KFZ A;  1MV3 A;  2A08 A;  1B07 A;  2G6F X;  3REA B;  2O9V A;  3VS5 A;  1NEB A;  1RUW A;  2RQV A;  2PNI A;  1PKT A;  2J7I A;  1HJD A;  1YP5 A;  2GNC A;  2J6O A;  1TUC A;  2DRK A;  4ORZ A;  2CRE A;  1ZUK A;  3NPF A;  2FG0 A;  2LJ1 A;  1ZUU A;  4OML A;  1ABQ A;  3QWY A;  1JQQ A;  1E6H A;  2LMJ A;  1OPL A;  3M0P A;  2JT4 A;  1AWW A;  1YN8 A;  2RF0 A;  2GGR A;  2HEQ A;  2M0Y A;  1PHT A;  1X69 A;  1H92 A;  4J9H A;  1SHG A;  2KEA A;  1ZLM A;  2V1R A;  1IO6 A;  4DEY A;  2L0A A;  2LQW A;  1OEB A;  1AWX A;  1ZUY A;  3EG1 A;  4ZNX A;  1SRM A;  2VVK A;  4QT7 A;  2RQR A;  2GTO A;  2AK5 A;  1MUZ A;  1UUE A;  4CC4 B;  1T0H A;  2K9G A;  2PTK A;  2KGT A;  4J9D A;  2BTT A;  2D8H A;  1SSH A;  2DRM A;  1M30 A;  2O9S A;  1E7O A;  2RN8 A;  4X1V A;  2C0O A;  4OMP A;  2J05 A;  2JW4 A;  2OAW A;  1H8K A;  4OMQ A;  2ENM A;  2C0T A;  4GBQ A;  2LZ6 B;  4AFU C;  2IIM A;  4Y92 A;  4RUG A;  2SRC A;  1KJW A;  2MOX A;  2SEM A;  3SEM A;  2FRW A;  3C0C A;  1K0X A;  4HVU A;  2ED1 A;  4RTY A;  2X3X D;  3H0I A;  1PRL C;  2EVR A;  2K7A A;  4LE9 A;  4D8D A;  3EHR A;  1K76 A;  1X6B A;  2FPF A;  4EIK A;  2JM8 A;  2AZS A;  1QCF A;  2ESW A;  4FSS A;  3NMZ C;  1SRL A;  2BZX A;  3VS1 A;  1SPK A;  5FW9 A;  5GJV B;  4AG2 C;  2K2M A;  5IH2 A;  2NUZ A;  1JO8 A;  1YNZ A;  1TUD A;  2EKH A;  2LCS A;  4HVW A;  1WDX A;  4AFZ C;  1UJY A;  1Y57 A;  1UE9 A;  3QWX X;  1M3B A;  1W70 A;  2J6K A;  2O88 A;  2OI3 A;  3ULR B;  2EGA A;  1N5Z A;  1G83 A;  2DNU A;  4GLM A;  5EC7 A;  1G2B A;  2LNH B;  1X27 A;  2X3W D;  4RTU A;  2CT3 A;  3ZL7 C;  2FPD A;  2JTE A;  1X43 A;  1MV0 B;  3I5R A;  2L3S A;  2C0I A;  3VS3 A;  2RMO A;  1WX6 A;  2I0N A;  1JEG A;  1KIK A;  4IIM A;  4J9C A;  2A36 A;  3EG3 A;  3IQL A;  1AWJ A;  4J9I A;  4Z8A A;  5IXF A;  2D1X A;  1AVZ C;  3VS4 A;  1GRI A;  4RTX A;  5IHK A;  2RQT A;  1FYN A;  1UHC A;  4K11 A;  1KSW A;  3O5Z A;  3U23 A;  2BZY A;  2YDL A;  2KBT A;  2KRM A;  4LUE A;  2O31 A;  2A37 A;  4RTW A;  2ECZ A;  1A0N B;  2LQN A;  1ABO A;  2YSQ A;  2CSQ A;  1PNJ A;  2F2V A;  3H0F A;  2YT6 A;  2DL8 A;  4JJC A;  1AD5 A;  1WYX A;  2DF6 A;  1UTI A;  1NYF A;  5I11 A;  5L23 A;  2HDA A;  2EGE A;  4LUD A;  3UA7 A;  3VRZ A;  1NG2 A;  2DIL A;  4KRT A;  1AZE A;  1RLQ C;  1VYT A;  1BK2 A;  2KXC A;  1PKS A;  4AG1 C;  2CH4 A;  1XOV A;  3UA6 A;  1WLP B;  2H8H A;  1JXO A;  2DBM A;  1U5S A;  4M4Z A;  2DL4 A;  1NLO C;  2ED0 A;  4F14 A;  4OMM A;  2D8J A;  2DBK A;  2FO0 A;  1CKB A;  2A28 A;  2HSP A;  1AEY A;  4LNP A;  1JXM A;  3TVT A;  2NWM A;  4J9F A;  3JV3 A;  2KRN A;  2JXB A;  2XMF A;  5IHI A;  2CUB A;  2EYX A;  1GCQ A;  4CC3 A;  2EYW A;  2RQU A;  1QWE A;  2LJ0 A;  2EW3 A;  1WXT A;  2EPD A;  3NHN A;  5GJW B;  3R6N A;  4LN2 A;  1RI9 A;  2E5K A;  2BZ8 A;  5FWC A;  2LX7 A;  4HVV A;  1LCK A;  5IHN A;  2W10 A;  4F16 A;  4CC7 A;  1UEC A;  3VS2 A;  1I07 A;  1K0S A;  1GCP A;  4A63 B;  2DMO A;  3A98 A;  2PZ1 A;  1H3H A;  1X2K A;  3PVL A;  3EHQ A;  2L2P A;  4RTZ A;  4JJB A;  1WA7 A;  4AFQ C;  1NM7 A;  3EG0 A;  3RBB B;  1M8M A;  1U3O A;  4R0K A;  2DM1 A;  2KYB A;  2RQW A;  1QKX A;  2F2W A;  2RPN A;  1EFN A;  2DX1 A;  2OJ2 A;  2YUN A;  1E6G A;  2AZV A;  2CT4 A;  1AWO A;  3H41 A;  2KR3 A;  2ROT A;  4CC2 A;  1M27 C;  2KRS A;  2W0Z A;  3VS7 A;  2GBQ A;  2DE0 X;  3UF4 A;  3UAT A;  1GBR A;  3FJ5 A;  1GCQ C;  3M0S A;  1YWO A;  4J9E A;  2EYY A;  3KFV A;  4AFS C;  1Y0M A;  3SHW A;  1T0J A;  1SEM A;  1K9A A;  1ZSG A;  1K4U S;  1PWT A;  3PE0 A;  1GFD A;  2DYB A;  2JMC A;  4JJD A;  2KXD A;  1UDL A;  1W1F A;  1M3A A;  3I9Q A;  1AOJ A;  2O2O A;  1W6X A;  3NGP A;  2HCK A;  4Z88 A;  2DL7 A;  3RNJ A;  2L3Q A;  4WCI A;  2KT8 A;  4IIO A;  3REB B;  3H0H A;  1WFW A;  2YUQ A;  2RNA A;  2AKK A;  1BU1 A;  1OV3 A;  3M0Q A;  1JU5 C;  2CDT A;  1QKW A;  1PRM C;  2ABL A;  2GTJ A;  1WIE A;  4J9B A;  4E6R A;  2J06 A;  2KE9 A; 
#chains in the Genus database with same CATH topology
 1Y71 A;  3A8H B;  3LX7 A;  2F69 A;  1WI7 A;  1VQN T;  3FDR A;  2QG9 B;  1TSF A;  4E2F B;  4M7D G;  1UEB A;  5LJ3 f;  4JPB W;  1ZBX A;  4BDY A;  2R57 A;  2YLC A;  2HAX A;  2RD1 A;  2FVU A;  1ZX6 A;  1I0C A;  1KHC A;  3P8D A;  2JJ9 A;  3PMT A;  4MDW A;  1BI3 A;  4HXJ A;  4Q5W A;  4NL2 A;  1NYG A;  4BI3 A;  1Z9Z A;  3GP8 A;  2WSF E;  4RTV A;  1G3Y A;  1JJ2 S;  4II1 A;  5D6W A;  1YJ9 T;  2DVJ A;  2E70 A;  2JS0 A;  1KHI A;  4M7A D;  3VS0 A;  1V76 A;  2K3Y A;  2V1Q A;  4M78 E;  1QVG A;  2VB6 A;  2M51 A;  5KYX A;  2AKL A;  2H3E B;  4Y91 A;  4OP0 A;  5LJ5 h;  3RER A;  4FT2 A;  4DBQ A;  3JCM c;  2K3B A;  2OTJ A;  2VUB A;  3JB9 F;  2VXE A;  1BCO A;  2HBW A;  1UJ0 A;  2DJZ A;  4JS4 A;  2VC8 A;  4C92 B;  2FZG B;  1Q7Y C;  2EYZ A;  3GBQ A;  1RLP C;  1GBQ A;  2VWF A;  3D7S B;  2L3P A;  1N27 A;  2XHC A;  3CQT A;  4M7D A;  3G4S T;  1YI2 A;  3M4G A;  4M77 F;  2YWW A;  4RTT A;  2KVQ G;  4BE2 A;  3MEW A;  5FU6 C;  4J7I A;  1T3S A;  2YUO A;  2B8A A;  4D8K A;  2RHX A;  2EGC A;  4EPC A;  4Z89 A;  3M0R A;  1S1N A;  2FEI A;  1VQ9 A;  2PU9 B;  1Z9Q A;  2F2X A;  4FYY B;  3HFN A;  2LP5 A;  1MMN A;  2A08 A;  2O01 E;  2X35 A;  3V8J A;  2QGG A;  1AHJ B;  2QQA A;  1F1B B;  1Q81 R;  2RB6 A;  1JBM A;  1C1A A;  4A54 A;  1VQN A;  1HJD A;  4FW2 A;  4FYV B;  2DRK A;  3Q1J A;  4ATO A;  3CCU Q;  2BE7 D;  1KD1 R;  1KQS S;  1KD1 U;  2FG0 A;  4PFO A;  2JNG A;  5HKC A;  2HQE A;  2RA2 A;  2HL3 A;  4DQ2 A;  2MF2 A;  4WF2 A;  1YN8 A;  5KYX B;  2HEQ A;  1PHT A;  2DD5 A;  3CC4 Q;  4J9H A;  1ZLM A;  1BKB A;  3KUF A;  2NUP A;  3S3M A;  2MWP A;  2MWO A;  5KYY A;  1EZZ B;  5KE2 A;  1SRM A;  1XNI A;  5GAO l;  2EQJ A;  1TTH B;  1X01 A;  3L2U A;  2CP3 A;  1UUE A;  4CC4 B;  2K9G A;  2PTK A;  1I5L A;  2OAU A;  1M30 A;  2O9S A;  2RN8 A;  4X1V A;  2C0O A;  3QYH B;  1VUB A;  3CCS Q;  1LOJ A;  3QJY A;  2LZ6 B;  2F1L A;  5L8R E;  4RUG A;  2OTJ Q;  3V7R A;  3CCJ A;  5GAO r;  1YJ9 Q;  3MP6 A;  4NL3 A;  2FRW A;  2DAQ A;  3SDZ A;  1OX9 A;  3MCA B;  3VU3 C;  3T9N A;  2ED1 A;  4RTY A;  3SWN B;  2X3X D;  2OTL T;  2EVR A;  3HP9 A;  4LE9 A;  2QEX T;  4OGE A;  2CP2 A;  4C8Q D;  1D09 B;  4FW1 A;  5FRN A;  1MHN A;  3CCQ Q;  1SRL A;  3CC4 T;  1NZ9 A;  4XTZ A;  2K2M A;  2V8I A;  1VQN Q;  4HVW A;  1WDX A;  2DIG A;  1JJ2 P;  5GAN 4;  3LGF A;  2OI3 A;  2HNI A;  1G83 A;  4GLM A;  1YJN A;  2X3W D;  5I2M A;  2LQK A;  2CT3 A;  1RAH B;  2FPD A;  2NUP B;  2V8J A;  3CPF A;  2L3S A;  1VOM A;  5FU7 B;  4E47 A;  4X9C A;  1VQL T;  1KIK A;  1IGU A;  2A36 A;  3EG3 A;  3IQL A;  5GAN 2;  4J9I A;  5KYU A;  3G6E T;  5CKE A;  5IN1 A;  2PVG B;  1WJQ A;  1Q81 C;  2RQT A;  2DYI A;  1XQH A;  4PJO E;  3O5Z A;  4MMK A;  1SF9 A;  1WQ7 A;  4LUE A;  4JLG A;  2ECZ A;  1R0C B;  3EGX B;  1M1F A;  1Q82 C;  2L5Q A;  3OS5 A;  3CCR T;  2YT6 A;  2ZZD A;  3X24 B;  1NYF A;  5C0M A;  4QQD A;  3X25 B;  2XD0 A;  4J8O A;  2ZPG B;  2DIL A;  4KRT A;  1OU9 A;  1RLQ C;  1VYT A;  4XK8 E;  1JRI A;  3UA6 A;  1WLP B;  2EQU A;  3UPU A;  1U5S A;  4PJO D;  4OB1 B;  2LVM A;  1ZA2 B;  1NLO C;  3I55 T;  2ED0 A;  1YHQ T;  4OMM A;  2DBK A;  3CCS T;  5CAI A;  4J6W A;  1VQM A;  1M8V A;  4ZTJ A;  5GAM d;  3QJ6 A;  1AEY A;  1N9S A;  1JXM A;  5LJ5 e;  4LDW A;  3TVT A;  1U8R A;  3JRZ A;  3JV3 A;  5CCA A;  5KYY B;  3JCM e;  2EJG A;  2ZGW A;  2RJE A;  3UDC A;  1PSF A;  2EYW A;  2RQU A;  1GXI E;  2DIQ A;  2QK0 A;  4C5E A;  5GAN j;  2MI6 A;  2E6N A;  1SG5 A;  5FWC A;  3CCR Q;  1WQW A;  2NUT A;  4HVV A;  4KGZ B;  2NUT B;  4CC7 A;  4M75 G;  4F16 A;  2E12 A;  4BUG A;  4A63 B;  4M7D E;  4F7U E;  4J5Y A;  3OYK A;  3A98 A;  1YIT T;  2PZ1 A;  4M75 E;  1KD1 C;  3SB2 A;  2E10 A;  4O6J A;  3EHQ A;  5GAM h;  1WHG A;  4JJB A;  1QMC A;  2P0Q A;  2QQS A;  3SD4 A;  3CC2 Q;  1HYO A;  1QQJ A;  1U3O A;  2KYB A;  4KT0 E;  1YIJ Q;  1QKX A;  1VQL Q;  3CMA T;  2F2W A;  4N4I A;  2K5I A;  3CCU A;  1EFN A;  3DLL A;  2OJ2 A;  2YUN A;  2AZV A;  2K2V A;  1AWO A;  5FU6 B;  3OYJ A;  3CME Q;  2KR3 A;  2XI9 A;  4CC2 A;  2W0Z A;  4EMK A;  3H8Z A;  1GBR A;  1R8O B;  5CO7 A;  5CVI A;  5GAO p;  3CC2 T;  3KFV A;  2FZK B;  4AFS C;  4M7A C;  4L6V 5;  3RR6 A;  5LJ5 d;  1D1C A;  1K9A A;  1VQ6 A;  4BD3 A;  2M1H A;  3PE0 A;  4M7D B;  4BAC A;  2VGN A;  1UGQ B;  3V7S A;  2DXB A;  2GQV A;  2O2O A;  3NGP A;  2HCK A;  2DL7 A;  2LX9 A;  2KT8 A;  4DBR A;  4M78 B;  1K8A U;  1BU1 A;  3LH0 A;  3M0Q A;  3SFM A;  2CDT A;  5HK3 A;  4BI8 B;  2K5F A;  1N8R C;  1WIE A;  4J9B A;  2ZAE A;  2X4Y A;  2KE9 A;  3G6E Q;  1FXX A;  1UG1 A;  1WHK A;  3H9N A;  4A4G A;  1B34 B;  1UHF A;  1HD3 A;  2G3R A;  4M7D C;  3LLR A;  1I8F A;  1Q82 U;  1XTD A;  3CME T;  1KC8 R;  3EG9 A;  4BE1 A;  5CK9 A;  2PVD B;  3EG2 A;  3F70 A;  1OUL A;  3EFO B;  2CGH A;  1KQS P;  2P0P A;  1GL5 A;  5GAM j;  3C4S A;  3ASK A;  3ZFJ A;  1UGV A;  1YBY A;  3A5Z B;  4M7A A;  1MMA A;  1OPK A;  3QBY A;  2MCN A;  3RMS A;  2CH4 W;  3HTR A;  2JM9 A;  1UGS B;  2DL5 A;  1QWF A;  1QP2 A;  2FL7 A;  4XU0 A;  1B3Q A;  2LCL A;  4HA8 A;  4E7H A;  3E1S A;  1VQ8 Q;  4KH0 B;  3FJP A;  1BCM A;  1MMG A;  1YJW A;  1NJI C;  2XKO C;  3I5S A;  5HCK A;  5GAM g;  2COY A;  1CKA A;  2DLP A;  1YCS B;  2DEU A;  3M5A A;  3MPU B;  1VQ5 A;  3I35 A;  3CBO A;  2DJQ A;  3RKY A;  1X2Q A;  4OMO A;  3OW2 P;  2GFA A;  2RI5 A;  2AHJ B;  2CSI A;  5ECA A;  2EQM A;  1AZG B;  1QVF P;  1M2V B;  2F5T X;  1VQ4 T;  4M7A E;  2KK4 A;  5EG2 A;  1SHF A;  2L89 A;  4FU6 A;  4FT4 A;  1U06 A;  2OTJ T;  1RL2 A;  2KT1 A;  3CXC S;  1K73 C;  1TG0 A;  2QEX A;  1RAD B;  1ZA1 B;  4C92 F;  2P4R A;  1QVG S;  1AT1 B;  2HSE B;  2HQH A;  1YJN Q;  2K6D A;  1OOT A;  4OMN A;  4QQ6 A;  1RAF B;  1VA7 A;  4PJN A;  5GAN 7;  4RG8 A;  2PVO B;  1VIF A;  1YWP A;  3QYG B;  4F7U G;  4XTY A;  3E9G A;  5C6S A;  4M77 B;  2B86 A;  2DL3 A;  4GLK A;  1QCN A;  3MEA A;  4PFP A;  1KFZ A;  3H6Z A;  2QI2 A;  3LW5 E;  1W2B P;  3RES A;  3S3N A;  2HZY A;  1NEB A;  1RUW A;  2FB7 A;  2RQV A;  2PNI A;  3MEV A;  2BUD A;  4XU3 A;  2GNC A;  1HK9 A;  1VQO T;  3NTI A;  2LCC A;  1ZUK A;  3NPF A;  1ZUU A;  2K57 A;  4L59 A;  2DZ9 A;  3NTH A;  1JQQ A;  1E6H A;  3C94 A;  4PLL A;  4C8Q A;  1VQ9 T;  4M75 B;  5DLO A;  3CPW P;  2JT4 A;  2RF0 A;  2M0Y A;  1X69 A;  2KEA A;  1Y96 A;  4DEY A;  1VQP T;  4AT1 B;  4M77 E;  2LQW A;  3HSB A;  2XDD A;  3M57 A;  1AWX A;  3EG1 A;  1Q7Y R;  3CCL T;  1Q7Y U;  4QT7 A;  4LDY A;  2GTO A;  4JRI A;  2AK5 A;  4XU2 A;  2RHZ A;  4C5G A;  4LD6 A;  4ZN3 A;  1YIT Q;  1YJW Q;  1SSH A;  1D3B B;  3CC4 A;  3R6O A;  1M90 C;  2RJC A;  3L2W A;  2J05 A;  2JW4 A;  1NBE B;  4FM4 B;  1VQO A;  2ENM A;  5CIU A;  2C0T A;  4GBQ A;  2QA4 A;  1VQ5 T;  3EFS A;  4KBM B;  1PD1 A;  2HD0 A;  2IIM A;  4C5I A;  4PK4 A;  4DOW A;  2SRC A;  3C0C A;  3CMA A;  3L2Q A;  2QA4 Q;  3EGD B;  1VQP A;  3ME9 A;  5GAM e;  4QQG A;  3EHR A;  3E19 A;  1X6B A;  4V2S A;  1M90 U;  3VYG A;  5GAN 3;  4ZGE B;  2VYT A;  4LDU A;  3UT1 A;  2Z0W A;  2RHY A;  2BZX A;  2VGM A;  1RAE B;  3VS1 A;  5IT9 E;  5FW9 A;  4AG2 C;  5IH2 A;  2NUZ A;  2CZ0 B;  1JO8 A;  1TUD A;  2LCS A;  4AFZ C;  1UJY A;  2DXC A;  4JRP A;  4M78 G;  2O88 A;  3ULR B;  4RCC A;  3NTK A;  1KG1 A;  1PM3 A;  2KQW A;  1X27 A;  1LPL A;  2JVV A;  3ZL7 C;  2XIC A;  4M77 D;  3ZBD A;  2RK2 A;  4JLI A;  2FZC B;  5D6Y A;  3A8G B;  5A2Q E;  3I5R A;  3G4S Q;  3ER0 A;  3VS3 A;  2COZ A;  4PNO A;  2K3X A;  1IXD A;  3L42 A;  1GRI A;  4PLI A;  5LJ5 j;  2KMT A;  2V8K A;  5IHK A;  4K11 A;  5GMK h;  3EGX A;  1VQL A;  2KRM A;  2DEQ A;  2O31 A;  4RTW A;  2E1H A;  1U1S A;  3GNG A;  3OYI A;  2GF7 A;  3OW2 S;  3JB9 G;  2JUF A;  4J7F A;  2DL8 A;  4JJC A;  3JCM Q;  5I11 A;  1M1K C;  3TU4 K;  3OSS C;  2CYZ B;  3VRZ A;  5LJ5 g;  2MYS A;  1V29 B;  1PC0 A;  1AZE A;  4AG1 C;  3CCR A;  1XOV A;  5A0G A;  2H8H A;  1JXO A;  4J6Y A;  1D3B A;  3CCE Q;  4M4Z A;  4X34 A;  4NS5 A;  1OQK A;  2LNV A;  3EH1 A;  3HKS A;  4LXC A;  1K9M U;  1WJS A;  3PMI A;  2NWM A;  3RDV A;  3JCM h;  4J9F A;  4NOY A;  2KRN A;  5IAY A;  3MP8 A;  2CUB A;  2MAM A;  1MND A;  5D6X A;  1QWE A;  2LJ0 A;  2O4X B;  1VQM Q;  4M78 A;  3X26 B;  3NHN A;  1OZ3 A;  5GJW B;  4QVZ A;  8AT1 B;  2DPP B;  5GAN h;  1VQP Q;  4BY6 B;  3QXE B;  2P4T A;  1I07 A;  2LRQ A;  1KC8 U;  4ELY C;  1RAB B;  3JCM g;  4XTX A;  4BDZ A;  3BDL A;  1K73 R;  1H3H A;  1X2K A;  2R5M A;  4C92 C;  3CCM Q;  8ATC B;  4CI0 C;  4N4G A;  2L2P A;  5LL6 S;  1WA7 A;  1M90 R;  1NM7 A;  3EG0 A;  4M7A G;  4F04 B;  2A0F B;  3SWN C;  3OMG A;  4M7A F;  3LGL A;  1WPY A;  4A4F A;  1M2O A;  5LJ5 f;  5LJ3 j;  1YWO A;  2EYY A;  1X6O A;  4IUU A;  3SHW A;  1T0J A;  1SEM A;  3DB4 A;  2JMC A;  2KXD A;  1VQ6 Q;  3V8L A;  4E7S A;  1W1F A;  2QGF B;  3GPL A;  4B6M A;  1D0X A;  1Y96 B;  1M5Q 1;  1QVP A;  1W6X A;  3NFC A;  2K5L A;  2QQB A;  2E3I A;  2P84 A;  2PUO B;  2YRV A;  3H0H A;  2R5A A;  3QHS A;  5I2S A;  2RO0 A;  1VQM T;  3OS0 A;  3AT1 B;  2RNA A;  1I4K 1;  3OYA A;  3CME A;  2O4X A;  1QKW A;  3I55 A;  1PRM C;  2ABL A;  1M4Z A;  2GTJ A;  4E6R A;  4JJD A;  3V8K A;  2RJF A;  2K4Y A;  1PCX A;  2MK5 A;  1YIJ A;  3OSV A;  2COW A;  3THK A;  1R0B G;  4ZN1 A;  2KYM A;  3MKD A;  3PIP A;  4J9G A;  4BB7 A;  2JTM A;  2ROL A;  1RI0 A;  1QLY A;  1VQ8 T;  3LH5 A;  1YJ9 A;  4JZ3 A;  4ESR A;  3OYN A;  1LNX A;  1G5V A;  3A8O B;  3CCS A;  3WVE B;  1PG5 B;  2PUK B;  3C95 A;  4BE0 A;  1Q86 U;  1K1Z A;  3VRY A;  1NLP C;  2JMA A;  2HL5 C;  5FWB A;  1CSK A;  3A8L B;  3OS1 A;  1WHJ A;  4XU1 A;  1NJI R;  4E7Z A;  1UFF A;  3E2U A;  5I22 A;  1S72 Q;  2RM4 A;  2YRC A;  1FMK A;  1O9S A;  4M77 C;  3QO3 A;  2K79 A;  4ZGD B;  2DKG A;  2DO3 A;  3L2Z A;  1VQ8 A;  1GFC A;  1KQS A;  1FMW A;  2EAY A;  1ZSZ A;  3JCM P;  2FPE A;  3PVQ A;  2CZ7 B;  1X6G A;  4JZ4 A;  2GQI A;  4IUV A;  1T3L A;  4LDX A;  2IVW A;  1KQ2 A;  1NEG A;  2M9U A;  2QAZ A;  2ZPE B;  4B9X A;  2VKN A;  2RJD A;  3CPW S;  1M1G A;  4MML A;  4DA4 A;  4KGX B;  1PSE A;  9ATC B;  2CUD A;  3QG1 A;  1D0Z A;  4XQ3 A;  1M3C A;  3QDF A;  2FYK A;  2EBP A;  4EDU A;  2J6F A;  4DBH A;  5GAN g;  2G6F X;  2Y90 A;  3OYY A;  4PJO A;  5GMK i;  3M54 A;  3I56 Q;  3REA B;  2O9V A;  2DVE A;  3VS5 A;  5KYW B;  3HHT B;  2A3L A;  2CKK A;  5HK0 A;  1PKT A;  2J7I A;  2E41 A;  2E65 A;  1YIJ T;  1VQ6 T;  1YP5 A;  5AYF A;  1FWZ A;  4ORZ A;  2CRE A;  2HKN A;  4JS5 A;  2LJ1 A;  1ABQ A;  3CC7 T;  4KUD K;  1D1A A;  2LDM A;  2CS7 A;  3CCV A;  1VQK T;  4C92 D;  4JRQ A;  2YHT A;  1OPL A;  1SSF A;  2GGR A;  1H92 A;  3JB9 J;  3C12 A;  3MO8 A;  2HBP A;  2V1R A;  2MPX C;  3DB3 A;  1NE8 A;  5J3B A;  4FCY A;  3CD6 Q;  1Q86 C;  1I5O B;  2KSS A;  2L0A A;  2RK1 A;  3LWH A;  1YFN A;  3CCM A;  1TU0 B;  3TEE A;  2DK3 A;  1W2B A;  1LVK A;  3OYL A;  1QVG P;  2RQR A;  3E9F A;  1ZQ1 A;  5KYN A;  3FB9 A;  1T0H A;  3CCM T;  2LC4 A;  4M77 G;  3S6W A;  4PJO G;  4PFZ A;  2DRM A;  3OMC A;  4C0G A;  4B9W A;  2OAW A;  1LJO A;  2KDS A;  3EAE A;  4OMQ A;  1YHQ Q;  3I55 Q;  4M78 D;  3CCV T;  1VQK A;  4AFU C;  1S72 A;  4YTL A;  5GAO n;  4C8Q E;  3OYE A;  3M53 A;  1VQ4 Q;  2MOX A;  1K0X A;  2EWN A;  2X4W A;  3CPW A;  3CD6 A;  1MGQ A;  2CP5 A;  5J26 A;  4C92 A;  1PRL C;  3DLM A;  4HT8 A;  2D6F A;  5J39 A;  4D8D A;  1C0M A;  2AIR B;  4XTW A;  1N8R R;  1ACM B;  4BY6 C;  5FRM A;  2RI2 A;  1FMV A;  5FLX E;  1VQ5 Q;  2LT4 A;  1DJ7 B;  3NMZ C;  5GAN 8;  5LJ3 d;  1SPK A;  2NLU A;  4HT9 A;  1H3Z A;  2ZPI B;  2FHD A;  1YNZ A;  2CP6 A;  2EKH A;  1VQK Q;  2QTV A;  1Y07 A;  1YJW T;  1I81 A;  1Y57 A;  1UE9 A;  2YXY A;  1W70 A;  4J6X A;  4PJO C;  4C0Z A;  2BE9 B;  2EGA A;  3RMQ A;  4JDS A;  1N5Z A;  2DNU A;  3QKJ A;  5EC7 A;  3MHX A;  2LNH B;  3JAM E;  3VUZ A;  1UGR B;  3PNW C;  3RUX A;  4IKF A;  2DTI A;  2JTE A;  1WNL A;  1MV0 B;  1HXD A;  3JCM J;  3CXC A;  3RKW A;  1W2B S;  4IIM A;  3OS2 A;  1WHL A;  5IXF A;  4OF1 A;  3VS4 A;  1FYN A;  1D0Y A;  1KSW A;  2GCX A;  1VQO Q;  2KBT A;  4OB2 B;  2VAS A;  3JCM d;  5FU7 C;  3OYC A;  2YSQ A;  4A4K A;  4HKE A;  2KI7 A;  1PNJ A;  2F2V A;  3H0F A;  1VQ7 T;  3A1P A;  3M4Y A;  3GLX A;  2I2L A;  1AD5 A;  7AT1 B;  2DF6 A;  1UTI A;  1NJI U;  3FEO A;  2MMP A;  2HDA A;  2EGE A;  1NG2 A;  3DKM A;  3UWN A;  4XTV A;  2IG0 A;  5A0L A;  2KXC A;  1M1K R;  2CH4 A;  2RH2 A;  4ANJ A;  3BDU A;  3PGG A;  2DL4 A;  1D1B A;  3CCE A;  4F14 A;  2D8J A;  1IRE B;  1CKB A;  3G1J A;  2A28 A;  1NPP A;  1OX8 A;  2XG8 D;  3PT9 A;  2WSC E;  1YHQ A;  1RAA B;  1X75 C;  3CMA Q;  2ZCF B;  2EYX A;  3BE3 A;  4CC3 A;  3L1A A;  2EW3 A;  2WAC A;  4F7U B;  1WXT A;  3R6N A;  1G3T A;  4N0A A;  2BZ8 A;  3OBY A;  5KCO A;  1UGP B;  5IHN A;  4QW2 A;  4MZM A;  1KQ1 A;  2V26 A;  1UEC A;  3VS2 A;  4HCB A;  4ZTF A;  4OGC A;  4A53 A;  1WGS A;  4RMO A;  4E7I A;  2QYZ A;  3EH2 A;  1K0S A;  4PJJ A;  3QUI A;  3QPH A;  2DMO A;  3LYI A;  5CKB A;  3PVL A;  4RTZ A;  3CCU T;  2HMA A;  4MZP A;  3G4S A;  1YI2 T;  3EFR A;  1FX7 A;  1Q95 G;  2L3R A;  3HRT A;  4R0K A;  2RQW A;  3CCL Q;  3BFM A;  2HQX A;  2RPN A;  3VYH B;  2DX1 A;  1E6G A;  2CT4 A;  4WTO B;  4RCB A;  1QVF A;  1M27 C;  1QW1 A;  2KRS A;  3VS7 A;  3UF4 A;  3UAT A;  3QZ5 B;  2PQW A;  3RIR A;  5M9O A;  3M0S A;  3PIO A;  4J9E A;  2YLB A;  1N6A A;  3KXT A;  2KAF A;  1K4U S;  2WSE E;  2DYB A;  4C8Q B;  1BI1 A;  1WHM A;  1UDL A;  2E6Z A;  1AOJ A;  3JCM W;  4ELZ C;  4E7L A;  1TUG B;  4IUR A;  1YCY A;  4Z88 A;  5DY9 A;  4XTU A;  3RNJ A;  2EFI A;  1Q82 R;  2L3Q A;  4MZT A;  4WCI A;  3AHU A;  2EKO A;  3OYD A;  3CEY A;  1KC8 C;  3REB B;  2YUQ A;  2DTO A;  3TRE A;  3KBG A;  1K73 U;  4JRK A;  3EGD A;  4QVC A;  2KY9 A;  5GMK e;  2J06 A;  4DEX A;  4LDV A;  1J3T A;  4M78 C;  5LJ3 g;  4M77 A;  2YUP A;  1YJN T;  4ZGJ B;  1M9S A;  1BB9 A;  3FIF A;  5CQY A;  1IZ6 A;  4R55 A;  3TSW A;  5KE3 A;  2GFU A;  1VYU A;  6AT1 B;  3S3O A;  3A8M B;  4KGV B;  2EQI A;  3MJX A;  4KH1 B;  3WXM B;  1V1C A;  1YI2 Q;  1BBZ A;  1VYV A;  1RAI B;  2LJ3 A;  2EQK A;  2X51 A;  4C92 G;  2MIO A;  2KRO A;  2QDL A;  1M2V A;  2KNB B;  1Y7X A;  2BIV A;  1XJW B;  2OTL A;  4FYW B;  1QVF S;  3JB9 I;  5GMK j;  4C8Q F;  4F17 A;  2JS2 A;  3CCQ T;  1WXU A;  2QTX A;  3FRN A;  2L8D A;  3PFS A;  3OYF A;  3M0T A;  1VIE A;  2DER A;  1KK7 A;  4UC4 A;  4C92 E;  3HRU A;  1HSQ A;  2FRY A;  4L5G A;  1I1J A;  2R58 A;  4OMF B;  4PJL A;  3O8V A;  3P8H A;  4M75 D;  1W4S A;  4C0D C;  3VS6 A;  5FRO A;  5GAN 6;  3J7A F;  4RG2 A;  4X9D A;  2RHI A;  2X9H A;  4FSX A;  3VUB A;  1OZ2 A;  4F7U A;  3EGU A;  4HCK A;  1TH7 A;  3I56 T;  5DLQ E;  4N0A C;  1K8A C;  2AT1 B;  2JTF A;  3J81 E;  1BI0 A;  5IXB A;  3V7C A;  1WJR A;  1OI1 A;  4HCC A;  2E5Q A;  2DA9 A;  1WXB A;  3TSZ A;  2Y4X A;  2X4J A;  2XU8 A;  3QII A;  1ZHI A;  4M75 F;  2XDB A;  4E7K A;  1ARK A;  2QAS A;  1B34 A;  4PJM A;  3VJP A;  4M75 A;  2D0N A;  4LD9 K;  3INZ A;  3M0U A;  4JUV A;  1JB0 E;  1ZBJ A;  2JZ2 A;  1Q86 R;  1MV3 A;  1B07 A;  5GMK m;  4EMK C;  4Z02 A;  2M16 A;  1N9R A;  2J6O A;  3GNF B;  2QDY B;  4A4E A;  1TUC A;  3JCM V;  3MEU A;  4OML A;  3QWY A;  1ZSZ C;  1OYX A;  4EMH A;  2LMJ A;  3QSU A;  3M0P A;  5KYW A;  1EX4 A;  1AWW A;  4E7J A;  3JB9 H;  4PJO B;  2XDP A;  4JJN K;  4XAX B;  2CP7 A;  4BI4 A;  1SHG A;  1IO6 A;  2LQ8 A;  4PKC C;  4Y28 E;  1OEB A;  1ZUY A;  4EMK B;  4ZNX A;  2ZPF B;  3CBP A;  2VVK A;  1VQ7 A;  5GAM f;  3OBW A;  2EJ9 A;  3BW1 A;  4M7D D;  1N8R U;  1MUZ A;  3J80 E;  2XK0 A;  1TOV A;  3JCM b;  2KGT A;  1IGQ A;  4J9D A;  2BTT A;  5LJ3 h;  2D8H A;  1JJ2 A;  5LJ3 e;  3OYG A;  1E7O A;  1IB8 A;  3OW2 A;  4OMP A;  2LT1 A;  3TCJ A;  2M02 A;  4J83 A;  1H8K A;  4O5V A;  4AMC A;  3G71 A;  4Y92 A;  3CCE T;  4HCZ A;  1KJW A;  2SEM A;  3SEM A;  1U1T A;  3CC7 Q;  2DZC A;  4DOV A;  3JB9 D;  4QKU A;  4HVU A;  3OYH A;  3H0I A;  2K7A A;  4FIB A;  4IUT A;  1S72 T;  1K76 A;  4C8Q G;  3I56 A;  2FPF A;  4EIK A;  2JM8 A;  1WZO A;  2AZS A;  4EMG A;  4R56 A;  1QCF A;  2ESW A;  1OU8 A;  4FSS A;  1SKU B;  5AT1 B;  4OB0 B;  4IUQ A;  5GJV B;  4M7A B;  1TS9 A;  5A0D A;  3VKI A;  2VV5 A;  3QWX X;  1BIB A;  1M3B A;  1WHH A;  2J6K A;  3BY7 A;  1H64 1;  4DBF A;  1BIA A;  3G7Z A;  2ZPB B;  3OB9 A;  2DXU A;  3HPW A;  1G2B A;  2RHU A;  5CQX A;  4RTU A;  5GAN f;  1IHW A;  4C5H A;  2LTO A;  2C06 A;  3ZEH A;  3G6E A;  4OB3 B;  4M78 F;  4C0F A;  3M9Q A;  3HL8 A;  3CD6 T;  1X43 A;  2P0K A;  3MP1 A;  3JCM f;  5DM7 R;  2C0I A;  2E4H A;  2H3J A;  1WX6 A;  2E3H A;  2I0N A;  2RMO A;  2DXT A;  1JEG A;  3HFO A;  4J9C A;  5GAN d;  2Y4Y A;  1AWJ A;  4Z8A A;  5CKF A;  2D1X A;  3M56 A;  1AVZ C;  4A4H A;  1M1K U;  2QXF A;  3M59 A;  4RTX A;  2CP0 A;  3URG A;  5GAN 5;  2DD4 A;  1UHC A;  3QZ9 B;  4C0D B;  3U23 A;  3TQ7 P;  2BZY A;  2ZPH B;  2M0O A;  4KUI A;  2YDL A;  5CKH A;  4RKU E;  4CRI A;  3CCL A;  2A37 A;  1A0N B;  2LQN A;  2XID A;  3RKX A;  1ABO A;  1C6V X;  2CSQ A;  3FLG A;  2NYS A;  1BI2 A;  4F7U F;  5KYU B;  1WYX A;  4GY5 A;  1G3S A;  4OVA A;  3FC3 A;  5L23 A;  3X20 B;  4LUD A;  3OA6 A;  1K9M R;  3UA7 A;  1VQ4 A;  2DET A;  5D7U A;  3L2V A;  1BK2 A;  1PKS A;  2QQR A;  2QA4 T;  3OYM A;  2BKD N;  2EJF A;  3CCQ A;  3CXC P;  2QQ9 A;  1EIF A;  1G8X A;  3M55 A;  2DBM A;  4P5N A;  1PD0 A;  1UB4 A;  1NPR A;  2FO0 A;  4TVR A;  1QP3 A;  1B7T A;  4M75 C;  2HSP A;  4LNP A;  1IRX A;  3GIB A;  1IHV A;  5KH6 A;  2VXF A;  2OX7 A;  2JXB A;  3EFO A;  2QEX Q;  2E64 A;  2X4X A;  4FYX B;  2XMF A;  1MMD A;  5IHI A;  3OY9 A;  1GCQ A;  2OTL Q;  3CCJ T;  2EPD A;  4PL6 A;  2JOY A;  1ZSZ B;  4LN2 A;  3L2R A;  5GAN e;  1RI9 A;  2E5K A;  4IUP A;  5HY6 A;  2LX7 A;  3CCV Q;  2ATC B;  1LCK A;  1R77 A;  1K9M C;  2A7Y A;  2CZ6 B;  2W10 A;  3CC7 A;  4N4H A;  2RI3 A;  1GCP A;  1VQ9 Q;  3G71 Q;  3CBM A;  2CZ1 B;  5KCH A;  1K8A R;  3OYB A;  1BYM A;  3HRS A;  2EYQ A;  3X28 B;  4C8Q C;  2DTH A;  3M58 A;  1G3W A;  4AFQ C;  3WVD B;  4QVD A;  2JN0 A;  2F5K A;  3RBB B;  1M8M A;  2DM1 A;  2D0Q B;  5GAO m;  3LWI A;  1QCO A;  4VUB A;  2DFU A;  1VQ7 Q;  3EG9 B;  3GF5 A;  3H41 A;  3JCM X;  2ROT A;  4PJO F;  5GMK l;  2GBQ A;  2DE0 X;  1TXQ A;  2HKQ B;  3FJ5 A;  1Q81 U;  1GCQ C;  3MET A;  3GOX A;  2IPO B;  1Y0M A;  1YIT A;  3P8B B;  1ZSG A;  4FL6 A;  1PWT A;  5CKD A;  1GFD A;  3VV0 A;  4MDX A;  1RAC B;  3G71 T;  1MNE A;  3N5B B;  1M3A A;  3I9Q A;  3CC2 A;  5I21 A;  1O75 A;  5GAO q;  1RAG B;  3PTA A;  4IIO A;  3QDR B;  1WFW A;  4ME7 A;  3JSC A;  3CCJ Q;  5CR2 A;  2D9T A;  2AKK A;  1OV3 A;  3SWN A;  4D6W A;  1JU5 C;  1P92 A;  4KUL A;  1TWB A;  2EIF A;  4M7D F;  3OQ5 A;  2YRD A; 
#chains in the Genus database with same CATH homology
 4DEX A;  1J3T A;  1UG1 A;  1WI7 A;  1UHF A;  2YUP A;  1HD3 A;  3THK A;  4JPB W;  2KYM A;  1BB9 A;  3EG2 A;  4J9G A;  1ZX6 A;  1GL5 A;  1I0C A;  2ROL A;  3TSW A;  1QLY A;  1UGV A;  1VYU A;  4HXJ A;  3LH5 A;  4JZ3 A;  4ESR A;  1OPK A;  2EQI A;  2MCN A;  2CH4 W;  1NYG A;  1V1C A;  2JM9 A;  1Z9Z A;  1BBZ A;  1VYV A;  2DL5 A;  2LJ3 A;  1QWF A;  4RTV A;  2MIO A;  1B3Q A;  2KRO A;  2QDL A;  2KNB B;  2DVJ A;  1K1Z A;  2JS0 A;  3VRY A;  3VS0 A;  1NLP C;  2V1Q A;  3I5S A;  2JMA A;  4F17 A;  2JS2 A;  1WXU A;  5FWB A;  5HCK A;  2M51 A;  1CSK A;  2AKL A;  1CKA A;  3M0T A;  2DLP A;  1YCS B;  1HSQ A;  1UFF A;  2FRY A;  2K3B A;  3I35 A;  1I1J A;  2DJQ A;  1X2Q A;  5I22 A;  4OMO A;  2HBW A;  1FMK A;  1UJ0 A;  2K79 A;  2CSI A;  2EYZ A;  3VS6 A;  5ECA A;  3GBQ A;  1AZG B;  1GFC A;  1RLP C;  1GBQ A;  2VWF A;  2L3P A;  1SHF A;  2FPE A;  3CQT A;  1U06 A;  3PVQ A;  3EGU A;  4HCK A;  2KT1 A;  1X6G A;  4JZ4 A;  1TG0 A;  2GQI A;  1T3L A;  4RTT A;  5IXB A;  2P4R A;  1NEG A;  1T3S A;  2DA9 A;  1WXB A;  3TSZ A;  2VKN A;  2YUO A;  2K6D A;  4D8K A;  1OOT A;  4OMN A;  1VA7 A;  2CUD A;  2EGC A;  4Z89 A;  3M0R A;  1S1N A;  2FEI A;  1M3C A;  1YWP A;  1Z9Q A;  2F2X A;  1ARK A;  2B86 A;  2DL3 A;  2D0N A;  2EBP A;  2LP5 A;  3M0U A;  1ZBJ A;  2J6F A;  1KFZ A;  1MV3 A;  2A08 A;  1B07 A;  2G6F X;  3REA B;  2O9V A;  3VS5 A;  1NEB A;  1RUW A;  2RQV A;  2PNI A;  1PKT A;  2J7I A;  1HJD A;  1YP5 A;  2GNC A;  2J6O A;  1TUC A;  2DRK A;  4ORZ A;  2CRE A;  1ZUK A;  3NPF A;  2FG0 A;  2LJ1 A;  1ZUU A;  4OML A;  1ABQ A;  3QWY A;  1JQQ A;  1E6H A;  2LMJ A;  1OPL A;  3M0P A;  2JT4 A;  1AWW A;  1YN8 A;  2RF0 A;  2GGR A;  2HEQ A;  2M0Y A;  1PHT A;  1X69 A;  1H92 A;  4J9H A;  1SHG A;  2KEA A;  1ZLM A;  2V1R A;  1IO6 A;  4DEY A;  2L0A A;  2LQW A;  1OEB A;  1AWX A;  1ZUY A;  3EG1 A;  4ZNX A;  1SRM A;  2VVK A;  4QT7 A;  2RQR A;  2GTO A;  2AK5 A;  1MUZ A;  1UUE A;  4CC4 B;  1T0H A;  2K9G A;  2PTK A;  2KGT A;  4J9D A;  2BTT A;  2D8H A;  1SSH A;  2DRM A;  1M30 A;  2O9S A;  1E7O A;  2RN8 A;  4X1V A;  2C0O A;  4OMP A;  2J05 A;  2JW4 A;  2OAW A;  1H8K A;  4OMQ A;  2ENM A;  2C0T A;  4GBQ A;  2LZ6 B;  4AFU C;  2IIM A;  4Y92 A;  4RUG A;  2SRC A;  1KJW A;  2MOX A;  2SEM A;  3SEM A;  2FRW A;  3C0C A;  1K0X A;  4HVU A;  2ED1 A;  4RTY A;  2X3X D;  3H0I A;  1PRL C;  2EVR A;  2K7A A;  4LE9 A;  4D8D A;  3EHR A;  1K76 A;  1X6B A;  2FPF A;  4EIK A;  2JM8 A;  2AZS A;  1QCF A;  2ESW A;  4FSS A;  3NMZ C;  1SRL A;  2BZX A;  3VS1 A;  1SPK A;  5FW9 A;  5GJV B;  4AG2 C;  2K2M A;  5IH2 A;  2NUZ A;  1JO8 A;  1YNZ A;  1TUD A;  2EKH A;  2LCS A;  4HVW A;  1WDX A;  4AFZ C;  1UJY A;  1Y57 A;  1UE9 A;  3QWX X;  1M3B A;  1W70 A;  2J6K A;  2O88 A;  2OI3 A;  3ULR B;  2EGA A;  1N5Z A;  1G83 A;  2DNU A;  4GLM A;  5EC7 A;  1G2B A;  2LNH B;  1X27 A;  2X3W D;  4RTU A;  2CT3 A;  3ZL7 C;  2FPD A;  2JTE A;  1X43 A;  1MV0 B;  3I5R A;  2L3S A;  2C0I A;  3VS3 A;  2RMO A;  1WX6 A;  2I0N A;  1JEG A;  1KIK A;  4IIM A;  4J9C A;  2A36 A;  3EG3 A;  3IQL A;  1AWJ A;  4J9I A;  4Z8A A;  5IXF A;  2D1X A;  1AVZ C;  3VS4 A;  1GRI A;  4RTX A;  5IHK A;  2RQT A;  1FYN A;  1UHC A;  4K11 A;  1KSW A;  3O5Z A;  3U23 A;  2BZY A;  2YDL A;  2KBT A;  2KRM A;  4LUE A;  2O31 A;  2A37 A;  4RTW A;  2ECZ A;  1A0N B;  2LQN A;  1ABO A;  2YSQ A;  2CSQ A;  1PNJ A;  2F2V A;  3H0F A;  2YT6 A;  2DL8 A;  4JJC A;  1AD5 A;  1WYX A;  2DF6 A;  1UTI A;  1NYF A;  5I11 A;  5L23 A;  2HDA A;  2EGE A;  4LUD A;  3UA7 A;  3VRZ A;  1NG2 A;  2DIL A;  4KRT A;  1AZE A;  1RLQ C;  1VYT A;  1BK2 A;  2KXC A;  1PKS A;  4AG1 C;  2CH4 A;  1XOV A;  3UA6 A;  1WLP B;  2H8H A;  1JXO A;  2DBM A;  1U5S A;  4M4Z A;  2DL4 A;  1NLO C;  2ED0 A;  4F14 A;  4OMM A;  2D8J A;  2DBK A;  2FO0 A;  1CKB A;  2A28 A;  2HSP A;  1AEY A;  4LNP A;  1JXM A;  3TVT A;  2NWM A;  4J9F A;  3JV3 A;  2KRN A;  2JXB A;  2XMF A;  5IHI A;  2CUB A;  2EYX A;  1GCQ A;  4CC3 A;  2EYW A;  2RQU A;  1QWE A;  2LJ0 A;  2EW3 A;  1WXT A;  2EPD A;  3NHN A;  5GJW B;  3R6N A;  4LN2 A;  1RI9 A;  2E5K A;  2BZ8 A;  5FWC A;  2LX7 A;  4HVV A;  1LCK A;  5IHN A;  2W10 A;  4F16 A;  4CC7 A;  1UEC A;  3VS2 A;  1I07 A;  1K0S A;  1GCP A;  4A63 B;  2DMO A;  3A98 A;  2PZ1 A;  1H3H A;  1X2K A;  3PVL A;  3EHQ A;  2L2P A;  4RTZ A;  4JJB A;  1WA7 A;  4AFQ C;  1NM7 A;  3EG0 A;  3RBB B;  1M8M A;  1U3O A;  4R0K A;  2DM1 A;  2KYB A;  2RQW A;  1QKX A;  2F2W A;  2RPN A;  1EFN A;  2DX1 A;  2OJ2 A;  2YUN A;  1E6G A;  2AZV A;  2CT4 A;  1AWO A;  3H41 A;  2KR3 A;  2ROT A;  4CC2 A;  1M27 C;  2KRS A;  2W0Z A;  3VS7 A;  2GBQ A;  2DE0 X;  3UF4 A;  3UAT A;  1GBR A;  3FJ5 A;  1GCQ C;  3M0S A;  1YWO A;  4J9E A;  2EYY A;  3KFV A;  4AFS C;  1Y0M A;  3SHW A;  1T0J A;  1SEM A;  1K9A A;  1ZSG A;  1K4U S;  1PWT A;  3PE0 A;  1GFD A;  2DYB A;  2JMC A;  4JJD A;  2KXD A;  1UDL A;  1W1F A;  1M3A A;  3I9Q A;  1AOJ A;  2O2O A;  1W6X A;  3NGP A;  2HCK A;  4Z88 A;  2DL7 A;  3RNJ A;  2L3Q A;  4WCI A;  2KT8 A;  4IIO A;  3REB B;  3H0H A;  1WFW A;  2YUQ A;  2RNA A;  2AKK A;  1BU1 A;  1OV3 A;  3M0Q A;  1JU5 C;  2CDT A;  1QKW A;  1PRM C;  2ABL A;  2GTJ A;  1WIE A;  4J9B A;  4E6R A;  2J06 A;  2KE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...