3RNJA

Crystal structure of the sh3 domain from irsp53 (baiap2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
b'GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Brain-specific angiogenesis inhibitor 1-associated protein 2
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
rcsb
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rnjA00
2RMOA 4CC3A 2DA9A 1UFFA 3SHWA 2L3QA 2OI3A 2FEIA 1OEBA 1BU1A 1ZUYA 4DEYA 2EYZA 3A98A 1JXOA 3UATA 2LZ6B 2KGTA 1VA7A 4J9EA 1YCSB 1HJDA 5IXBA 2DL3A 1WYXA 1I07A 2RQRA 1HSQA 1ABOA 1SEMA 1X6GA 1H3HA 1YN8A 2YUQA 2J6KA 2EBPA 1VYUA 1U3OA 2X3WD 3VS0A 4X1VA 5FWCA 1GFCA 3VRYA 4HCKA 1UJYA 1VYVA 1SRLA 2MOXA 2K7AA 3NPFA 4RTUA 1X69A 2DX1A 3C0CA 1B07A 1JXMA 2VVKA 4OMQA 1UJ0A 1UDLA 4J9BA 3I35A 1X2KA 2L0AA 4RTYA 3NGPA 2NUZA 5IHKA 1OPLA 2EGAA 5FW9A 2JTEA 4OMMA 3H0HA 4D8KA 1PRMC 3M0SA 4JZ3A 2GGRA 1WFWA 2KXCA 2KRNA 2BZYA 2O2OA 2GNCA 2JMCA 3REAB 1HD3A 2J06A 4IIOA 1IO6A 4J9FA 4J9CA 2GTJA 2L2PA 2OJ2A 1H8KA 2DLPA 3H0FA 2CH4W 2I0NA 2CT4A 2J7IA 2KYBA 1B3QA 4K11A 2F2XA 2O88A 3RNJA 4ZNXA 1UG1A 2DILA 2DVJA 1XOVA 2D8HA 1KSWA 4Z89A 5I11A 2KE9A 2RQWA 2DJQA 2FPFA 3H41A 2JMAA 4LUEA 1AEYA 3VS7A 2JS0A 2V1QA 2DBKA 4HVUA 2DL8A 4JJBA 4OMLA 4LN2A 2JXBA 2DMOA 4LNPA 1UECA 1VYTA 2GQIA 3PVQA 3EG1A 2FO0A 1AD5A 1NEGA 2RQUA 1TUCA 4F16A 2KXDA 4OMOA 3VS5A 3EG0A 2LQWA 2FPDA 4KRTA 1NG2A 1BBZA 2CSIA 4IIMA 2CT3A 1PRLC 1W70A 2GBQA 2RF0A 5IXFA 1K1ZA 2YUOA 2F2WA 2AK5A 2EVRA 1KFZA 4WCIA 3VRZA 2KBTA 1AWOA 2ROTA 1I1JA 1AZEA 1JO8A 1UHCA 3U23A 2DBMA 2GTOA 1WA7A 1BB9A 4FSSA 2C0OA 1W6XA 2ECZA 3NHNA 1RI9A 2HCKA 1M27C 3EHRA 2EGEA 1X6BA 5FWBA 1M8MA 1JQQA 1J3TA 2G6FX 3PVLA 2SEMA 1KIKA 2EW3A 4JZ4A 2VKNA 2CSQA 2J6FA 3TSWA 3GBQA 3EG3A 2DNUA 2C0IA 4F17A 3H0IA 4GBQA 2LCSA 2KYMA 2A28A 2D1XA 5I22A 3KFVA 3UA6A 4Z8AA 4RTZA 2M51A 1T0HA 1BK2A 1M3BA 2ED1A 1FMKA 5ECAA 2O31A 3JV3A 2M0YA 2K2MA 1K9AA 2DRKA 4LE9A 4GLMA 3QWYA 1X43A 2AKKA 2EYYA 1MV3A 2EQIA 4AG1C 1JEGA 3M0PA 5IHIA 3IQLA 3TSZA 4J9IA 4QT7A 1RLPC 2BZXA 1K0SA 5L23A 5EC7A 1SHFA 2PTKA 3ZL7C 3TVTA 2W0ZA 1T3LA 3VS4A 4DEXA 4D8DA 1QKXA 1A0NB 2YDLA 2H8HA 1K4US 2JT4A 2JM8A 3R6NA 2AZSA 1WLPB 2RQTA 2HBWA 4HVWA 1SPKA 1EFNA 1M3AA 2MIOA 5HCKA 3VS1A 2LQNA 1MV0B 2KT8A 4E6RA 2VWFA 2RNAA 1H92A 1T0JA 1ARKA 2ED0A 2YSQA 1NYGA 1E7OA 1GBRA 2DE0X 4AFUC 2ENMA 1Y57A 1PKSA 2J6OA 1SSHA 4R0KA 4CC4B 2A36A 4JJDA 1AOJA 2FRWA 2O9VA 2MCNA 3SEMA 1PHTA 1NLPC 1WXBA 4J9HA 2W10A 2ABLA 2BZ8A 2FRYA 3EG2A 2DF6A 5IH2A 1G2BA 2EKHA 3I5RA 2K6DA 1TG0A 1GCPA 1TUDA 2CUDA 4J9GA 2NWMA 2JM9A 2JS2A 2QDLA 1AWWA 4RTTA 1UTIA 3UF4A 4F14A 1NLOC 2D0NA 1RUWA 1E6GA 1WDXA 2LJ0A 2AKLA 4AG2C 2SRCA 4LUDA 4M4ZA 2HDAA 2LP5A 3EGUA 3QWXX 2EYWA 4J9DA 3VS3A 2X3XD 4ESRA 1KJWA 1CKBA 1UGVA 1AVZC 1UUEA 1Z9QA 2LJ1A 3REBB 3CQTA 3LH5A 3RBBB 2CDTA 2KR3A 1FYNA 1U5SA 1ZBJA 2FPEA 4Y92A 2FG0A 2DL7A 2LNHB 2OAWA 2F2VA 2KNBB 3THKA 1X27A 2DM1A 2XMFA 2BTTA 4JPBW 2LX7A 2EGCA 1OPKA 3UA7A 1NEBA 1QLYA 3I9QA 1M30A 4CC2A 4EIKA 1WXUA 1SRMA 2B86A 2LMJA 1T3SA 1ZLMA 2O9SA 3PE0A 3M0QA 2KT1A 1K76A 1AWJA 1GBQA 3VS6A 1PKTA 2RN8A 1WIEA 2YT6A 4HVVA 1Z9ZA 1CSKA 2DL4A 1QCFA 2HSPA 1E6HA 2ESWA 1YWPA 2EPDA 2K9GA 2L3SA 1ZSGA 1YP5A 1RLQC 3EHQA 2K79A 3NMZC 1ZX6A 5IHNA 1QWFA 2D8JA 3I5SA 3M0UA 1AZGB 2AZVA 1OV3A 1ZUUA 2PNIA 2A37A 5GJWB 2C0TA 3M0TA 1QKWA 4OMPA 4AFZC 1LCKA 2V1RA 4RUGA 1W1FA 1GCQA 4A63B 2P4RA 2A08A 2YUNA 1M3CA 1WXTA 2DRMA 1PWTA 1JU5C 2JW4A 1SHGA 1GL5A 1WI7A 1YNZA 1X2QA 3M0RA 1CKAA 2J05A 1ABQA 1Y0MA 4AFSC 1UHFA 2L3PA 1V1CA 2K3BA 1WX6A 4AFQC 2CH4A 4HXJA 4RTVA 2RPNA 1AWXA 4ORZA 4RTWA 3O5ZA 2YUPA 4Z88A 4RTXA 1OOTA 3VS2A 2LJ3A 2IIMA 2KEAA 1PNJA 4JJCA 2PZ1A 1I0CA 2EYXA 1U06A 2DL5A 1S1NA 2KROA 1UE9A 1NYFA 2HEQA 1QWEA 2KRSA 1ZUKA 3ULRB 4OMNA 5GJVB 2CREA 1N5ZA 2KRMA 1GFDA 3FJ5A 2CUBA 2DYBA 1K0XA 2E5KA 1YWOA 2ROLA 1MUZA 1GCQC 1GRIA 1NM7A 4CC7A 1G83A 2RQVA
chains in the Genus database with same CATH superfamily
3A1PA 2IPOB 3CCQA 4XTVA 4BI4A 3MP8A 1VQMQ 4M77B 1XNIA 2L89A 1QVFP 1KHIA 2LZ6B 2CKKA 2VASA 4PFZA 3CEYA 3EFOA 1LOJA 4L6V5 4FW2A 1HJDA 1OZ2A 4CI0C 3QUIA 1LVKA 4LXCA 2DL3A 2FL7A 5KYXB 3MKDA 1WYXA 2AT1B 6AT1B 3CCRQ 1ABOA 1H3HA 1YN8A 2CZ0B 2DZ9A 4M7DE 3EG9A 3QG1A 4JRIA 1U3OA 4B9XA 3VRYA 4HCKA 3T9NA 1QW1A 4RTUA 5DY9A 2FZKB 2LQ8A 3C0CA 4OMQA 4J9BA 5GMKi 3GOXA 3OS1A 2DYIA 1VIEA 5CQYA 2NUZA 4XTYA 2VV5A 3G71T 5FRMA 3A8MB 2GGRA 1Y96B 1HD3A 2DFUA 1IO6A 1VQKA 2OJ2A 1H8KA 3H0FA 2KYBA 3FLGA 2L5QA 3EFRA 4MZMA 2O88A 2QGFB 3CCJA 3OYJA 3LWHA 5KH6A 2XKOC 5I11A 2KE9A 1FMWA 1UGRB 2JTMA 2RQWA 3P8DA 3H41A 1QQJA 1V29B 2MI6A 2VXEA 4KUDK 1QVFA 3VS7A 2RB6A 2RI2A 1C1AA 1PSEA 4PJOD 2DL8A 4JJBA 4PJOC 4R56A 3KXTA 2DMOA 1Q81C 4LD9K 2XK0A 1OU8A 1VYTA 1KQSP 3HP9A 4J6WA 4KH1B 3V7RA 1AD5A 4F16A 5KYWB 3VS5A 4IUUA 4M7DD 3JCMd 3SB2A 1IHVA 3EG0A 3CD6T 3JCMQ 4MDWA 2R5MA 2FPDA 4IUPA 2F5KA 3QXEB 1KQ1A 3RUXA 1MMAA 3OSVA 1WNLA 1NG2A 2EAYA 3C95A 4IIMA 2RO0A 2YLBA 2DK3A 2QQAA 1KK7A 2X4YA 4M7AF 3PGGA 1JO8A 2EQKA 3U23A 4M7AE 3I56A 2GTOA 3BE3A 3MEWA 2RHYA 4XQ3A 4FSSA 4M78D 2C06A 4BI3A 1R77A 4FL6A 1VQ8T 4KT0E 1W6XA 3NHNA 1NE8A 4E2FB 4QW2A 2JJ9A 1M8MA 4L5GA 4P5NA 1J3TA 3TQ7P 5CR2A 4PL6A 3CXCP 4E7ZA 3L42A 5FLXE 2RHXA 3NTIA 2HL3A 1MGQA 1G3SA 2KI7A 2FB7A 3BY7A 2LCSA 3I55Q 4KBMB 3M54A 5J39A 3UA6A 4RKUE 1R0BG 4RTZA 2HKNA 3QSUA 2DEUA 1IXDA 1M3BA 1N9RA 5LJ3d 3JV3A 2KY9A 2VXFA 4JDSA 3FC3A 3OBYA 1JEGA 2EQIA 5L8RE 5GAN5 3M0PA 2CP2A 2ZPEB 3UWNA 3TSZA 4XTZA 5EC7A 2MF2A 1JRIA 2K3YA 1BI2A 5GAN7 4XU2A 1QKXA 1ZSZA 3SD4A 4QQ6A 1PG5B 1MNDA 2HZYA 4DBQA 2X4XA 3G4ST 1NJIC 3R6NA 2RQTA 2EKOA 3EGDA 3JCMe 1M1FA 4M77F 1EZZB 1M3AA 5HCKA 2CP7A 2MIOA 2LQNA 3R6OA 3VS1A 1W2BP 1MV0B 4NL3A 2RNAA 1NBEB 2F69A 4C92C 1VOMA 2EWNA 1SSHA 1U1SA 3HRUA 3QYHB 1PM3A 4DBHA 1NPRA 2MCNA 5GAOp 4FW1A 1XJWB 3QJ6A 1YJ9T 4X34A 5KYUA 1X01A 2BZ8A 2DF6A 4RCCA 1G2BA 4QQGA 2K6DA 4L59A 5KYYA 1PD1A 5FU6B 1Q95G 3M56A 1FWZA 4PK4A 5A0GA 5GAMf 4RTTA 2DIGA 4Y91A 2D0NA 1RUWA 1SSFA 2LJ0A 4XK8E 2QA4T 3GNGA 2DXTA 4LUDA 3DLLA 4M4ZA 3H9NA 5GAOl 3QPHA 1WHGA 5GANh 3JCMW 3VKIA 1TSFA 2R57A 5GAMe 4C8QD 2X3XD 4C8QE 1CKBA 1AVZC 3LYIA 5KYXA 5GAMj 2ZZDA 4C0GA 3CMEQ 1W2BS 4J83A 2E4HA 1FYNA 2BE7D 1U5SA 5GMKj 3OQ5A 1S72A 4GY5A 3QHSA 2DEQA 1JJ2S 1V76A 3THKA 1D3BA 3V8LA 1C6VX 1RADB 2ZGWA 3EGXA 3TCJA 2CYZB 3JB9G 2K2VA 1U1TA 2ATCB 2DM1A 2RJDA 2XMFA 3A8OB 1YI2A 1VQPT 3CXCA 2XHCA 2D6FA 2DTHA 3CC7T 5CIUA 3I55T 2A0FB 3FRNA 4EIKA 1B34B 3OYIA 2WSEE 3HKSA 3CBPA 3V8KA 4O6JA 2XI9A 4NOYA 3OYMA 3M53A 2EJFA 1GBQA 3AHUA 2YT6A 1CSKA 4M75F 2P4TA 1QCFA 2EPDA 1ZSGA 1BYMA 4FT4A 4AMCA 1RLQC 1JJ2P 1VQ9Q 3I5SA 2AZVA 3A8HB 4D6WA 2E70A 2PU9B 3MHXA 4E7HA 1YITT 4OMPA 4AFZC 3EG9B 2V1RA 4PJOA 1VQNT 1VQOA 1GCQA 4A63B 2FZGB 2LNVA 2YUNA 4C92B 1TTHB 2PUOB 1KQSA 3M0RA 1CKAA 1ABQA 2L3PA 1Q7YU 1M90U 4BUGA 2KDSA 4M7DA 1BCMA 4LDUA 1MMNA 2CH4A 4RTVA 2YUPA 2EYQA 4Z88A 3L2VA 3MCAB 1D1AA 2LJ3A 3OS2A 3A5ZB 1PNJA 5CO7A 2PZ1A 3L2UA 1QVFS 2K5LA 2XIDA 1KD1C 4M77A 1U06A 3OYGA 1VQMA 1VQLA 4XTUA 2RK2A 4BDZA 2HEQA 1QWEA 1KHCA 4XU3A 3CCVQ 4ATOA 2DYBA 1K0XA 1RAIB 1OU9A 2ROLA 1MUZA 4LDYA 4CC7A 4GBQA 2QGGA 2YRVA 4BACA 1YHQQ 1KC8R 4OF1A 2GF7A 2OI3A 2FEIA 3JCMc 4DEYA 3ER0A 4FIBA 2KGTA 2DD4A 1YCSB 2V26A 4M78B 3CC2Q 3JB9J 4DOVA 1BKBA 2RJCA 4JRPA 1KD1R 2RQRA 1YJNT 1SEMA 4C92G 2YUQA 2M1HA 1VYUA 4JLGA 3VS0A 2DJZA 5GAOq 3OW2P 4PJJA 1SRLA 4BB7A 1X69A 2JZ2A 4DBFA 3CC7Q 3CD6A 1VQOT 4Y28E 4QKUA 3NGPA 5IHKA 4M75E 2EGAA 1YFNA 5FW9A 3MP6A 3JRZA 4J7FA 4M7AD 2AIRB 1M9SA 1WQWA 1WFWA 2KXCA 3G6EQ 3JCMf 4IIOA 4M7AA 2DZCA 2L2PA 8ATCB 1R8OB 2CH4W 4MMKA 2J7IA 4M75A 2FHDA 3OYCA 3DB3A 4ZNXA 4M7DF 3I56Q 2DVJA 1XOVA 2D8HA 2DJQA 1W2BA 2IG0A 3AT1B 2L8DA 2JS0A 2FVUA 3P8HA 2QEXA 2DBKA 4HVUA 1KG1A 3JB9I 1K9MR 3CPWS 2JXBA 4PJOF 1UECA 2YLCA 1VQ5Q 3PVQA 4WF2A 3EG1A 2V8KA 1NEGA 2RQUA 1TUCA 3EAEA 2EJ9A 2KXDA 9ATCB 4DOWA 2ZPFB 3TU4K 3CBOA 2XICA 4ZGDB 4KRTA 1TWBA 2F5TX 3UPUA 3SWNC 4KGXB 1Y71A 1BBZA 2Y4XA 1TXQA 1W70A 2GBQA 2RF0A 4IUVA 8AT1B 2RI3A 3VRZA 2KBTA 2PVGB 2ROTA 1WA7A 1BB9A 5GAMg 3DKMA 2E65A 2HQEA 2AHJB 2JNGA 1TUGB 2ECZA 1D3BB 3EFSA 3CMAA 2GFAA 4HCZA 1PD0A 1AT1B 3OW2S 4E7KA 1JQQA 5IT9E 3SDZA 2PUKB 4C5IA 3PVLA 2KK4A 2SEMA 5LJ3e 1PSFA 2LC4A 1KC8C 2XU8A 2VKNA 2K3XA 5GANd 4KUIA 5LJ5j 3CC2T 5GAOn 1YJ9Q 4C5HA 2C0IA 4F17A 3CD6Q 1HK9A 2KYMA 5C0MA 2A28A 1K73R 5I22A 4RCBA 3KFVA 3M59A 4C92A 4Z8AA 2E3HA 3N5BB 2HQHA 2ED1A 1FMKA 4FSXA 2M0YA 2K2MA 1K9AA 3F70A 3QWYA 4HA8A 4AG1C 3MPUB 4A4GA 2LCCA 4M7AB 4EMKA 3CCSA 3CC2A 3VYGA 4QT7A 4EPCA 1K0SA 1SHFA 2PTKA 3ZL7C 3JCMg 1SKUB 4OP0A 1QCOA 5GMKl 3HRSA 2EJGA 5HK0A 2OTJA 4PJOG 3CCQQ 1VQ8A 2RD1A 4FYVB 5GAN2 2AZSA 3CCMA 4IKFA 4RG8A 2HBWA 4HVWA 3CC4Q 5FU7B 1EFNA 1M2VA 3CCMQ 4M78E 1M8VA 1GXIE 5LJ3f 1YJWA 2JOYA 1GBRA 2DE0X 3G1JA 1VQ5A 2ENMA 1Y57A 3WVEB 1D1BA 2J6OA 4JJDA 1K9MU 2LRQA 3PT9A 4M7DB 3BDLA 4IUQA 1D1CA 1S72Q 4EMHA 4PLLA 4ZN3A 5HK3A 3QIIA 1UB4A 3EG2A 5CKFA 3CMEA 5GANg 3QYGB 2E10A 1TG0A 2HD0A 1GCPA 4EMGA 4F04B 1AWWA 2MMPA 1Q82R 5GAN8 1UTIA 2LVMA 4AG2C 4C5EA 3GPLA 2G3RA 2SRCA 3V7SA 1Q81R 3JCMP 2LP5A 5D6YA 2I2LA 3M9QA 3PTAA 4N4IA 4J9DA 4ESRA 2K5FA 2ZCFB 1Z9QA 1Q81U 5D7UA 3INZA 1N27A 3CBMA 3JB9F 3RBBB 1VQNA 2CP5A 1N6AA 1QVGA 1X75C 2DL7A 2ZPHB 2A3LA 1Q7YR 1M90R 3CCEA 2OAWA 2F2VA 3OYLA 2RJEA 5GANf 1X27A 3CC7A 4JPBW 2COZA 1K9MC 2EGCA 3UA7A 5GMKm 2QA4Q 2CS7A 4DQ2A 2H3JA 3I9QA 1OZ3A 2RK1A 1YI2T 2LMJA 4EMKB 2O9SA 1D0XA 3M0QA 5KE3A 4IUTA 1K76A 5LJ3g 1G5VA 5CVIA 1IGQA 1WHMA 1Z9ZA 3SWNB 3J7AF 2DL4A 1JB0E 1EX4A 1OX8A 2ESWA 2K9GA 4M75C 2DPPB 4ME7A 2BKDN 4M75G 5IHNA 4M78G 3M0UA 2NLUA 1EIFA 2A37A 5GJWB 3M0TA 2DVEA 4HCBA 3G4SQ 4PLIA 4QQDA 1M3CA 5AT1B 1YJWQ 2DRMA 1JU5C 2JW4A 3C4SA 1SHGA 4E47A 1Y0MA 4AFSC 2E1HA 1V1CA 1VQPA 4IURA 2K3BA 4AFQC 4HXJA 2HMAA 2M0OA 3RMSA 2RPNA 2B8AA 1OOTA 1Y96A 2IIMA 4PJLA 2CZ6B 2CGHA 3KUFA 5A2QE 3RESA 4JJNK 4M75B 2DAQA 3UDCA 1KQSS 2QXFA 2MK5A 3Q1JA 3JAME 2FYKA 1M1KC 2QAZA 2IVWA 4OMNA 5FU7C 1VQMT 2KRMA 3FJ5A 1MNEA 3C94A 1YWOA 5LJ5d 1I5LA 2V8IA 4AT1B 1WHLA 2EQUA 2RMOA 1YITA 1UFFA 2KQWA 3SHWA 4B9WA 3HTRA 4LDWA 1O75A 1OEBA 1ZUYA 3VJPA 4JUVA 3A98A 5HKCA 2MAMA 3UATA 1HYOA 1VA7A 2E5QA 3E19A 4F7UF 1WJSA 1VQ6A 1MHNA 2LCLA 2NUPB 3WXMB 2DO3A 1RABB 1YHQA 2QQ9A 3OSSC 1WHHA 1HSQA 5LJ5h 4FYYB 4M77C 4X1VA 2P0QA 1VYVA 3NPFA 1VQKT 4MMLA 1UGSB 2DX1A 4ZN1A 3CCUQ 1B07A 1I5OB 1UJ0A 1UDLA 4QVZA 1VQ9A 4RTYA 3OYNA 3CCJT 4BDYA 2K4YA 1OPLA 2JTEA 1ZSZC 5CAIA 3M0SA 4E7JA 2ZPBB 2O2OA 2BZYA 1H641 4E7SA 2V8JA 2GNCA 3REAB 2J06A 4C8QG 4J9FA 1YJNQ 3FIFA 2GTJA 4J9CA 1BI3A 2CP0A 4BE1A 4JLIA 3HL8A 4R55A 1BCOA 4K11A 5IAYA 1UGPB 3OMGA 3RNJA 3ME9A 2DILA 3CPWP 1KSWA 2M16A 1IHWA 1NPPA 3LGFA 3LWIA 3QDFA 1QVPA 4ZTJA 4LUEA 5LJ5g 2QK0A 4PJOE 3RKWA 1WQ7A 4E7LA 3JB9D 4JRQA 4OMLA 4LN2A 4LNPA 3HSBA 1Q86C 2GQIA 3LW5E 2HAXA 2M02A 3RMQA 1BIBA 2QEXQ 1RL2A 2CZ7B 3FEOA 1N8RR 5DM7R 1YIJA 3X24B 2E64A 3G6EA 3H8ZA 4OB2B 3LLRA 1VQ6T 2CSIA 1QMCA 2RM4A 4A53A 4FM4B 1IRXA 2YUOA 2AK5A 2HKQB 1AZEA 1UHCA 2X4JA 1X6OA 1NJIR 2R5AA 5GMKe 3RIRA 2OTJT 3CCEQ 4E7IA 3P8BB 2O4XB 1RI9A 2HCKA 3QKJA 2KVQG 4M7DG 1U8RA 1X6BA 2E41A 2YRDA 2EW3A 2CSQA 2J6FA 3TSWA 2XDDA 3ZBDA 3EG3A 3CXCS 2DIQA 4M77G 2LQKA 3H0IA 1BI0A 2D1XA 3EGXB 3S3MA 2QQSA 2RHUA 2M51A 1ZA2B 1T0HA 3CC4A 5ECAA 2O31A 3CMET 1B7TA 1IZ6A 5KYUB 1WGSA 4XU0A 4LE9A 4GLMA 2AKKA 1VQ8Q 3IQLA 3ZFJA 4C8QF 4ELYC 3J80E 2BZXA 3RKYA 3OS5A 4J8OA 3TVTA 2OTLT 3WVDB 3VS4A 4DEXA 3OY9A 3RERA 2QTVA 1ZSZB 2DXCA 2MYSA 3CCMT 2YDLA 2NYSA 3GNFB 3MP1A 3VYHB 4C0ZA 2JT4A 2PVOB 3M55A 3L1AA 3CMAT 3M4GA 1WLPB 1TS9A 3OW2A 5KCOA 3C12A 4PJOB 4KULA 1QVGP 2QDYB 4E6RA 1RAGB 2VWFA 4FYWB 1YCYA 1H92A 1T0JA 1VUBA 4F7UB 1ARKA 2ED0A 1E7OA 2HQXA 4BI8B 3QBYA 5GAOr 1OULA 4O5VA 3S3OA 4NS5A 4XTXA 4R0KA 1G3WA 4CC4B 2HBPA 3X26B 3NFCA 1KC8U 4YTLA 2RH2A 3SEMA 1VQ5T 2QA4A 1PHTA 4KGZB 1NLPC 1WXBA 2W10A 1NZ9A 4FT2A 4HCCA 2XDBA 4PNOA 2FRYA 2MWPA 1OYXA 1VQOQ 4M7AG 3PMTA 1Q86R 2CUDA 3RR6A 4J9GA 4PFOA 2JM9A 2JS2A 1RACB 2E6ZA 5LJ5f 5FU6C 5GAN3 1D09B 5I21A 2F1LA 1Q82C 3BW1A 1NLOC 2NUTA 2DKGA 1WDXA 5LJ5e 3GF5A 4RG2A 4WTOB 3E2UA 4LDXA 4KGVB 3CCUT 1YJ9A 4C92F 3QWXX 2EYWA 2VGMA 1KJWA 3REBB 2LJ1A 3HFOA 3VUBA 3CQTA 3HRTA 1VQ4A 3CCET 2BE9B 2GFUA 1QP3A 3HPWA 1M1KU 1Y7XA 1VQ4Q 1BIAA 1ZBJA 3CMAQ 2FG0A 3CCJQ 4DA4A 5CKBA 3DLMA 4KH0B 3M58A 2KNBB 5D6WA 1YI2Q 3V8JA 1VQNQ 2OX7A 2LX7A 5CQXA 1OPKA 3S6WA 1NEBA 1JBMA 3EGDB 4BE0A 4N0AC 4OMFB 3OYEA 3X20B 1SRMA 2B86A 3OS0A 1MMGA 1RAEB 4C0DB 1BI1A 4Z02A 2RHZA 2DXUA 3PE0A 2KT1A 1AWJA 1PKTA 2RN8A 4LDVA 4XTWA 4HVVA 4NL2A 1JJ2A 3CPFA 1E6HA 1WPYA 1K8AR 1YJNA 1YWPA 2X51A 2DXBA 1YP5A 3O8VA 1VQ7Q 3DB4A 2E6NA 3EHQA 1QVGS 2MWOA 4ZGEB 4M78A 2K79A 1AHJB 3OYBA 4C0DC 2D8JA 1ZUUA 4HT8A 2C0TA 1VQLQ 2VB6A 1QKWA 1M1GA 3G7ZA 4BD3A 3J81E 2YRCA 3META 1W1FA 5LJ3h 5A0LA 2P4RA 2YHTA 2P84A 1WXTA 1PWTA 1O9SA 3D7SB 3PFSA 3GIBA 5A0DA 1GL5A 3RKXA 3OB9A 2HNIA 1WI7A 2Y4YA 1X2QA 1Q82U 4M77E 1UHFA 5CKEA 1N8RC 1VQKQ 2RHIA 5DLOA 3NTHA 1WX6A 4MZPA 3CCUA 1AWXA 1ACMB 1M4ZA 3O5ZA 3VS2A 3CCRT 2RI5A 4JJCA 1I0CA 2EYXA 2DL5A 2KROA 4EDUA 3JB9H 2VC8A 1YITQ 2RJFA 3JCMV 3QZ5B 3ULRB 1Q86U 5GJVB 2CUBA 3QDRB 2YWWA 3LH0A 5C6SA 3OYHA 4F7UA 3CCVA 2RQVA 3S3NA 3UT1A 4N4HA 4CC3A 2DA9A 2L3QA 3HHTB 4QVDA 1BU1A 2EYZA 1C0MA 1JXOA 1FX7A 1QCNA 4J9EA 1P92A 3CCLQ 2XDPA 2XG8D 3JCMh 4B6MA 5IXBA 4J6YA 1I07A 2ZPIB 1LPLA 2KMTA 1X6GA 1NJIU 4HKEA 2J6KA 2EBPA 5KCHA 4ZGJB 3PIPA 2X3WD 1VQ9T 5FWCA 1GFCA 1K73U 1UJYA 1N9SA 3LGLA 2MOXA 3VU3C 2K7AA 2GQVA 1PCXA 4M78F 2M9UA 1JXMA 2VVKA 3HFNA 3OBWA 1TOVA 1VQ7A 3I35A 1X2KA 1FXXA 2L0AA 3G6ET 1DJ7B 4M75D 2QG9B 2CP6A 4OMMA 4FCYA 3H0HA 4D8KA 1PRMC 2CZ1B 1N8RU 4JZ3A 2VUBA 2KRNA 2JMCA 2E12A 3G71A 2DLPA 3OYFA 3JCMb 2I0NA 2CT4A 1B3QA 2F2XA 1TU0B 1WHKA 1UG1A 4M78C 1I81A 2NUTB 1LJOA 4Z89A 1H3ZA 2WSFE 1G8XA 2PQWA 2FPFA 1W4SA 2JMAA 2X4WA 3QO3A 4MZTA 1AEYA 4PKCC 2V1QA 2HSEB 4BY6B 2OAUA 2KSSA 3E9GA 4A4KA 1F1BB 1XQHA 2QASA 3M57A 2K57A 3MO8A 2FO0A 2LDMA 1Q7YC 1M90C 3CCVT 1VQ6Q 4OMOA 4M7DC 2LQWA 3A8GB 1UGQB 4A4FA 3CC4T 2Z0WA 1KQ2A 1VIFA 5I2MA 2CT3A 3I56T 1PRLC 2E3IA 4OGCA 5CKDA 1K8AU 2LX9A 2FZCB 5IXFA 1K1ZA 2WACA 2F2WA 2EVRA 3TREA 3KBGA 1G3TA 4J7IA 4OGEA 4WCIA 2OTLA 1AWOA 1I1JA 1KFZA 3GP8A 2DBMA 2QYZA 2C0OA 4BY6C 5CCAA 1M27C 3EHRA 4Q5WA 2JTFA 2R58A 2RA2A 2EGEA 5FWBA 2G6FX 2EIFA 2JN0A 1KIKA 2HL5C 2KAFA 4JZ4A 3JCMJ 1M5Q1 4F7UG 2D9TA 1VQPQ 3GBQA 5KYNA 2DNUA 3ASKA 1UEBA 4XU1A 2QQBA 4FU6A 3SWNA 2K5IA 1YIJT 1FMVA 1BK2A 1OI1A 1SG5A 4V2SA 2DRKA 5GAOm 1X43A 2EYYA 1MV3A 3URGA 2XD0A 3H6ZA 5IHIA 2QEXT 4J9IA 1RLPC 5L23A 2A7YA 1WJRA 5HY6A 2W0ZA 1ZQ1A 1T3LA 4PJNA 4D8DA 1WHJA 2QTXA 1A0NB 5GANj 2H8HA 2ZPGB 2LTOA 4C8QB 5GAN4 1K4US 2JM8A 1MMDA 4M7AC 3V7CA 5D6XA 1SPKA 3CCST 3SFMA 2COWA 3OMCA 3G4SA 2KT8A 1ZA1B 3CPWA 5M9OA 2P0PA 3A8LB 2YSQA 1S72T 1RAFB 1NYGA 3PMIA 3MJXA 1XTDA 5GANe 4C92E 5KE2A 4C92D 4AFUC 5GAMh 1WZOA 5J26A 1PKSA 2QQRA 3RDVA 2WSCE 2A36A 5KYWA 1AOJA 2FRWA 3MEVA 2EQMA 2O9VA 3EFOB 3OA6A 5FRNA 4J5YA 2BIVA 4OB3B 4J9HA 3CCLT 3E9FA 2ABLA 3I55A 5IH2A 4PJMA 2EKHA 4JS4A 3I5RA 4X9DA 1RAAB 5IN1A 4II1A 2OTLQ 3BFMA 1TUDA 2CP3A 1YJWT 1YIJQ 1QP2A 5LL6S 4N0AA 2NWMA 2QDLA 3EH2A 2QI2A 4C0FA 1IB8A 3UF4A 4F14A 2X35A 1D0ZA 4J6XA 1ZHIA 1M2OA 1E6GA 2GCXA 4JS5A 2AKLA 3OYKA 2HDAA 1VQ4T 3EGUA 3VS3A 1RI0A 3TEEA 3FB9A 1UGVA 3OYYA 1UUEA 2COYA 1M2VB 4TVRA 3LH5A 4A4HA 4M77D 2JVVA 5LJ3j 2CDTA 4LD6A 2DERA 5KYYB 4DBRA 2D0QB 2KR3A 2VGNA 3JSCA 2FPEA 4Y92A 2LNHB 4RMOA 3MEAA 4PFPA 4QVCA 3E1SA 1LNXA 3NTKA 3GLXA 1YBYA 1D0YA 4A54A 2MPXC 4GLKA 5J3BA 1TH7A 2BTTA 4BE2A 5GAMd 1Y07A 1K73C 3M4YA 1QLYA 3CCQT 3L2WA 4MDXA 2H3EB 2LT4A 1M30A 3X28B 4CC2A 2DTOA 1WXUA 5FROA 1T3SA 1ZLMA 3L2QA 3G71Q 4HT9A 4CRIA 2DD5A 5AYFA 3VS6A 1WIEA 2ZAEA 4ZTFA 2EFIA 1YHQT 2HSPA 2VYTA 2L3SA 2PVDB 1OX9A 3VV0A 1I4K1 2NUPA 4C8QC 3OYAA 3NMZC 1ZX6A 5GMKh 4EMKC 1QWFA 3ZEHA 4C5GA 1AZGB 1I8FA 7AT1B 4OB1B 3L2ZA 1OV3A 2PNIA 2OTJQ 4VUBA 1IGUA 1SF9A 1LCKA 1B34A 3CCLA 2P0KA 4RUGA 5EG2A 4OVAA 4N4GA 2A08A 1HXDA 4ELZC 3FJPA 2L3RA 2YXYA 5CKHA 3CCSQ 2O01E 1YNZA 2J05A 1ZBXA 1M1KR 4XAXB 2EQJA 3PNWC 3BDUA 3MEUA 4A4EA 2X9HA 1G3YA 5GAN6 4F7UE 3VUZA 5I2SA 3QJYA 3X25B 3PIOA 2BUDA 4X9CA 4JRKA 2JUFA 4ORZA 4RTWA 4RTXA 3FDRA 3EH1A 2LT1A 2DETA 2KEAA 3L2RA 2DTIA 1WJQA 1S1NA 5DLQE 1VQ7T 4ANJA 1UE9A 4OB0B 1PC0A 3CCRA 2Y90A 1KD1U 1NYFA 1OQKA 1R0CB 4C8QA 4FYXB 2KRSA 1IREB 3OYDA 1ZUKA 1RAHB 1K8AC 2CREA 1N5ZA 2O4XA 3QZ9B 1VQLT 1GFDA 2E5KA 3M5AA 5CK9A 4UC4A 1GCQC 1GRIA 3JCMX 3LX7A 1NM7A 1G83A
chains in the Genus database with same CATH topology
2RMOA 4CC3A 2DA9A 1UFFA 3SHWA 2L3QA 2OI3A 2FEIA 1OEBA 1BU1A 1ZUYA 4DEYA 2EYZA 3A98A 1JXOA 3UATA 2LZ6B 2KGTA 1VA7A 4J9EA 1YCSB 1HJDA 5IXBA 2DL3A 1WYXA 1I07A 2RQRA 1HSQA 1ABOA 1SEMA 1X6GA 1H3HA 1YN8A 2YUQA 2J6KA 2EBPA 1VYUA 1U3OA 2X3WD 3VS0A 4X1VA 5FWCA 1GFCA 3VRYA 4HCKA 1UJYA 1VYVA 1SRLA 2MOXA 2K7AA 3NPFA 4RTUA 1X69A 2DX1A 3C0CA 1B07A 1JXMA 2VVKA 4OMQA 1UJ0A 1UDLA 4J9BA 3I35A 1X2KA 2L0AA 4RTYA 3NGPA 2NUZA 5IHKA 1OPLA 2EGAA 5FW9A 2JTEA 4OMMA 3H0HA 4D8KA 1PRMC 3M0SA 4JZ3A 2GGRA 1WFWA 2KXCA 2KRNA 2BZYA 2O2OA 2GNCA 2JMCA 3REAB 1HD3A 2J06A 4IIOA 1IO6A 4J9FA 4J9CA 2GTJA 2L2PA 2OJ2A 1H8KA 2DLPA 3H0FA 2CH4W 2I0NA 2CT4A 2J7IA 2KYBA 1B3QA 4K11A 2F2XA 2O88A 3RNJA 4ZNXA 1UG1A 2DILA 2DVJA 1XOVA 2D8HA 1KSWA 4Z89A 5I11A 2KE9A 2RQWA 2DJQA 2FPFA 3H41A 2JMAA 4LUEA 1AEYA 3VS7A 2JS0A 2V1QA 2DBKA 4HVUA 2DL8A 4JJBA 4OMLA 4LN2A 2JXBA 2DMOA 4LNPA 1UECA 1VYTA 2GQIA 3PVQA 3EG1A 2FO0A 1AD5A 1NEGA 2RQUA 1TUCA 4F16A 2KXDA 4OMOA 3VS5A 3EG0A 2LQWA 2FPDA 4KRTA 1NG2A 1BBZA 2CSIA 4IIMA 2CT3A 1PRLC 1W70A 2GBQA 2RF0A 5IXFA 1K1ZA 2YUOA 2F2WA 2AK5A 2EVRA 1KFZA 4WCIA 3VRZA 2KBTA 1AWOA 2ROTA 1I1JA 1AZEA 1JO8A 1UHCA 3U23A 2DBMA 2GTOA 1WA7A 1BB9A 4FSSA 2C0OA 1W6XA 2ECZA 3NHNA 1RI9A 2HCKA 1M27C 3EHRA 2EGEA 1X6BA 5FWBA 1M8MA 1JQQA 1J3TA 2G6FX 3PVLA 2SEMA 1KIKA 2EW3A 4JZ4A 2VKNA 2CSQA 2J6FA 3TSWA 3GBQA 3EG3A 2DNUA 2C0IA 4F17A 3H0IA 4GBQA 2LCSA 2KYMA 2A28A 2D1XA 5I22A 3KFVA 3UA6A 4Z8AA 4RTZA 2M51A 1T0HA 1BK2A 1M3BA 2ED1A 1FMKA 5ECAA 2O31A 3JV3A 2M0YA 2K2MA 1K9AA 2DRKA 4LE9A 4GLMA 3QWYA 1X43A 2AKKA 2EYYA 1MV3A 2EQIA 4AG1C 1JEGA 3M0PA 5IHIA 3IQLA 3TSZA 4J9IA 4QT7A 1RLPC 2BZXA 1K0SA 5L23A 5EC7A 1SHFA 2PTKA 3ZL7C 3TVTA 2W0ZA 1T3LA 3VS4A 4DEXA 4D8DA 1QKXA 1A0NB 2YDLA 2H8HA 1K4US 2JT4A 2JM8A 3R6NA 2AZSA 1WLPB 2RQTA 2HBWA 4HVWA 1SPKA 1EFNA 1M3AA 2MIOA 5HCKA 3VS1A 2LQNA 1MV0B 2KT8A 4E6RA 2VWFA 2RNAA 1H92A 1T0JA 1ARKA 2ED0A 2YSQA 1NYGA 1E7OA 1GBRA 2DE0X 4AFUC 2ENMA 1Y57A 1PKSA 2J6OA 1SSHA 4R0KA 4CC4B 2A36A 4JJDA 1AOJA 2FRWA 2O9VA 2MCNA 3SEMA 1PHTA 1NLPC 1WXBA 4J9HA 2W10A 2ABLA 2BZ8A 2FRYA 3EG2A 2DF6A 5IH2A 1G2BA 2EKHA 3I5RA 2K6DA 1TG0A 1GCPA 1TUDA 2CUDA 4J9GA 2NWMA 2JM9A 2JS2A 2QDLA 1AWWA 4RTTA 1UTIA 3UF4A 4F14A 1NLOC 2D0NA 1RUWA 1E6GA 1WDXA 2LJ0A 2AKLA 4AG2C 2SRCA 4LUDA 4M4ZA 2HDAA 2LP5A 3EGUA 3QWXX 2EYWA 4J9DA 3VS3A 2X3XD 4ESRA 1KJWA 1CKBA 1UGVA 1AVZC 1UUEA 1Z9QA 2LJ1A 3REBB 3CQTA 3LH5A 3RBBB 2CDTA 2KR3A 1FYNA 1U5SA 1ZBJA 2FPEA 4Y92A 2FG0A 2DL7A 2LNHB 2OAWA 2F2VA 2KNBB 3THKA 1X27A 2DM1A 2XMFA 2BTTA 4JPBW 2LX7A 2EGCA 1OPKA 3UA7A 1NEBA 1QLYA 3I9QA 1M30A 4CC2A 4EIKA 1WXUA 1SRMA 2B86A 2LMJA 1T3SA 1ZLMA 2O9SA 3PE0A 3M0QA 2KT1A 1K76A 1AWJA 1GBQA 3VS6A 1PKTA 2RN8A 1WIEA 2YT6A 4HVVA 1Z9ZA 1CSKA 2DL4A 1QCFA 2HSPA 1E6HA 2ESWA 1YWPA 2EPDA 2K9GA 2L3SA 1ZSGA 1YP5A 1RLQC 3EHQA 2K79A 3NMZC 1ZX6A 5IHNA 1QWFA 2D8JA 3I5SA 3M0UA 1AZGB 2AZVA 1OV3A 1ZUUA 2PNIA 2A37A 5GJWB 2C0TA 3M0TA 1QKWA 4OMPA 4AFZC 1LCKA 2V1RA 4RUGA 1W1FA 1GCQA 4A63B 2P4RA 2A08A 2YUNA 1M3CA 1WXTA 2DRMA 1PWTA 1JU5C 2JW4A 1SHGA 1GL5A 1WI7A 1YNZA 1X2QA 3M0RA 1CKAA 2J05A 1ABQA 1Y0MA 4AFSC 1UHFA 2L3PA 1V1CA 2K3BA 1WX6A 4AFQC 2CH4A 4HXJA 4RTVA 2RPNA 1AWXA 4ORZA 4RTWA 3O5ZA 2YUPA 4Z88A 4RTXA 1OOTA 3VS2A 2LJ3A 2IIMA 2KEAA 1PNJA 4JJCA 2PZ1A 1I0CA 2EYXA 1U06A 2DL5A 1S1NA 2KROA 1UE9A 1NYFA 2HEQA 1QWEA 2KRSA 1ZUKA 3ULRB 4OMNA 5GJVB 2CREA 1N5ZA 2KRMA 1GFDA 3FJ5A 2CUBA 2DYBA 1K0XA 2E5KA 1YWOA 2ROLA 1MUZA 1GCQC 1GRIA 1NM7A 4CC7A 1G83A 2RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMO A;  4CC3 A;  2DA9 A;  1UFF A;  3SHW A;  2L3Q A;  2OI3 A;  2FEI A;  1OEB A;  1BU1 A;  1ZUY A;  4DEY A;  2EYZ A;  3A98 A;  1JXO A;  3UAT A;  2LZ6 B;  2KGT A;  1VA7 A;  4J9E A;  1YCS B;  1HJD A;  5IXB A;  2DL3 A;  1WYX A;  1I07 A;  2RQR A;  1HSQ A;  1ABO A;  1SEM A;  1X6G A;  1H3H A;  1YN8 A;  2YUQ A;  2J6K A;  2EBP A;  1VYU A;  1U3O A;  2X3W D;  3VS0 A;  4X1V A;  5FWC A;  1GFC A;  3VRY A;  4HCK A;  1UJY A;  1VYV A;  1SRL A;  2MOX A;  2K7A A;  3NPF A;  4RTU A;  1X69 A;  2DX1 A;  3C0C A;  1B07 A;  1JXM A;  2VVK A;  4OMQ A;  1UJ0 A;  1UDL A;  4J9B A;  3I35 A;  1X2K A;  2L0A A;  4RTY A;  3NGP A;  2NUZ A;  5IHK A;  1OPL A;  2EGA A;  5FW9 A;  2JTE A;  4OMM A;  3H0H A;  4D8K A;  1PRM C;  3M0S A;  4JZ3 A;  2GGR A;  1WFW A;  2KXC A;  2KRN A;  2BZY A;  2O2O A;  2GNC A;  2JMC A;  3REA B;  1HD3 A;  2J06 A;  4IIO A;  1IO6 A;  4J9F A;  4J9C A;  2GTJ A;  2L2P A;  2OJ2 A;  1H8K A;  2DLP A;  3H0F A;  2CH4 W;  2I0N A;  2CT4 A;  2J7I A;  2KYB A;  1B3Q A;  4K11 A;  2F2X A;  2O88 A;  3RNJ A;  4ZNX A;  1UG1 A;  2DIL A;  2DVJ A;  1XOV A;  2D8H A;  1KSW A;  4Z89 A;  5I11 A;  2KE9 A;  2RQW A;  2DJQ A;  2FPF A;  3H41 A;  2JMA A;  4LUE A;  1AEY A;  3VS7 A;  2JS0 A;  2V1Q A;  2DBK A;  4HVU A;  2DL8 A;  4JJB A;  4OML A;  4LN2 A;  2JXB A;  2DMO A;  4LNP A;  1UEC A;  1VYT A;  2GQI A;  3PVQ A;  3EG1 A;  2FO0 A;  1AD5 A;  1NEG A;  2RQU A;  1TUC A;  4F16 A;  2KXD A;  4OMO A;  3VS5 A;  3EG0 A;  2LQW A;  2FPD A;  4KRT A;  1NG2 A;  1BBZ A;  2CSI A;  4IIM A;  2CT3 A;  1PRL C;  1W70 A;  2GBQ A;  2RF0 A;  5IXF A;  1K1Z A;  2YUO A;  2F2W A;  2AK5 A;  2EVR A;  1KFZ A;  4WCI A;  3VRZ A;  2KBT A;  1AWO A;  2ROT A;  1I1J A;  1AZE A;  1JO8 A;  1UHC A;  3U23 A;  2DBM A;  2GTO A;  1WA7 A;  1BB9 A;  4FSS A;  2C0O A;  1W6X A;  2ECZ A;  3NHN A;  1RI9 A;  2HCK A;  1M27 C;  3EHR A;  2EGE A;  1X6B A;  5FWB A;  1M8M A;  1JQQ A;  1J3T A;  2G6F X;  3PVL A;  2SEM A;  1KIK A;  2EW3 A;  4JZ4 A;  2VKN A;  2CSQ A;  2J6F A;  3TSW A;  3GBQ A;  3EG3 A;  2DNU A;  2C0I A;  4F17 A;  3H0I A;  4GBQ A;  2LCS A;  2KYM A;  2A28 A;  2D1X A;  5I22 A;  3KFV A;  3UA6 A;  4Z8A A;  4RTZ A;  2M51 A;  1T0H A;  1BK2 A;  1M3B A;  2ED1 A;  1FMK A;  5ECA A;  2O31 A;  3JV3 A;  2M0Y A;  2K2M A;  1K9A A;  2DRK A;  4LE9 A;  4GLM A;  3QWY A;  1X43 A;  2AKK A;  2EYY A;  1MV3 A;  2EQI A;  4AG1 C;  1JEG A;  3M0P A;  5IHI A;  3IQL A;  3TSZ A;  4J9I A;  4QT7 A;  1RLP C;  2BZX A;  1K0S A;  5L23 A;  5EC7 A;  1SHF A;  2PTK A;  3ZL7 C;  3TVT A;  2W0Z A;  1T3L A;  3VS4 A;  4DEX A;  4D8D A;  1QKX A;  1A0N B;  2YDL A;  2H8H A;  1K4U S;  2JT4 A;  2JM8 A;  3R6N A;  2AZS A;  1WLP B;  2RQT A;  2HBW A;  4HVW A;  1SPK A;  1EFN A;  1M3A A;  2MIO A;  5HCK A;  3VS1 A;  2LQN A;  1MV0 B;  2KT8 A;  4E6R A;  2VWF A;  2RNA A;  1H92 A;  1T0J A;  1ARK A;  2ED0 A;  2YSQ A;  1NYG A;  1E7O A;  1GBR A;  2DE0 X;  4AFU C;  2ENM A;  1Y57 A;  1PKS A;  2J6O A;  1SSH A;  4R0K A;  4CC4 B;  2A36 A;  4JJD A;  1AOJ A;  2FRW A;  2O9V A;  2MCN A;  3SEM A;  1PHT A;  1NLP C;  1WXB A;  4J9H A;  2W10 A;  2ABL A;  2BZ8 A;  2FRY A;  3EG2 A;  2DF6 A;  5IH2 A;  1G2B A;  2EKH A;  3I5R A;  2K6D A;  1TG0 A;  1GCP A;  1TUD A;  2CUD A;  4J9G A;  2NWM A;  2JM9 A;  2JS2 A;  2QDL A;  1AWW A;  4RTT A;  1UTI A;  3UF4 A;  4F14 A;  1NLO C;  2D0N A;  1RUW A;  1E6G A;  1WDX A;  2LJ0 A;  2AKL A;  4AG2 C;  2SRC A;  4LUD A;  4M4Z A;  2HDA A;  2LP5 A;  3EGU A;  3QWX X;  2EYW A;  4J9D A;  3VS3 A;  2X3X D;  4ESR A;  1KJW A;  1CKB A;  1UGV A;  1AVZ C;  1UUE A;  1Z9Q A;  2LJ1 A;  3REB B;  3CQT A;  3LH5 A;  3RBB B;  2CDT A;  2KR3 A;  1FYN A;  1U5S A;  1ZBJ A;  2FPE A;  4Y92 A;  2FG0 A;  2DL7 A;  2LNH B;  2OAW A;  2F2V A;  2KNB B;  3THK A;  1X27 A;  2DM1 A;  2XMF A;  2BTT A;  4JPB W;  2LX7 A;  2EGC A;  1OPK A;  3UA7 A;  1NEB A;  1QLY A;  3I9Q A;  1M30 A;  4CC2 A;  4EIK A;  1WXU A;  1SRM A;  2B86 A;  2LMJ A;  1T3S A;  1ZLM A;  2O9S A;  3PE0 A;  3M0Q A;  2KT1 A;  1K76 A;  1AWJ A;  1GBQ A;  3VS6 A;  1PKT A;  2RN8 A;  1WIE A;  2YT6 A;  4HVV A;  1Z9Z A;  1CSK A;  2DL4 A;  1QCF A;  2HSP A;  1E6H A;  2ESW A;  1YWP A;  2EPD A;  2K9G A;  2L3S A;  1ZSG A;  1YP5 A;  1RLQ C;  3EHQ A;  2K79 A;  3NMZ C;  1ZX6 A;  5IHN A;  1QWF A;  2D8J A;  3I5S A;  3M0U A;  1AZG B;  2AZV A;  1OV3 A;  1ZUU A;  2PNI A;  2A37 A;  5GJW B;  2C0T A;  3M0T A;  1QKW A;  4OMP A;  4AFZ C;  1LCK A;  2V1R A;  4RUG A;  1W1F A;  1GCQ A;  4A63 B;  2P4R A;  2A08 A;  2YUN A;  1M3C A;  1WXT A;  2DRM A;  1PWT A;  1JU5 C;  2JW4 A;  1SHG A;  1GL5 A;  1WI7 A;  1YNZ A;  1X2Q A;  3M0R A;  1CKA A;  2J05 A;  1ABQ A;  1Y0M A;  4AFS C;  1UHF A;  2L3P A;  1V1C A;  2K3B A;  1WX6 A;  4AFQ C;  2CH4 A;  4HXJ A;  4RTV A;  2RPN A;  1AWX A;  4ORZ A;  4RTW A;  3O5Z A;  2YUP A;  4Z88 A;  4RTX A;  1OOT A;  3VS2 A;  2LJ3 A;  2IIM A;  2KEA A;  1PNJ A;  4JJC A;  2PZ1 A;  1I0C A;  2EYX A;  1U06 A;  2DL5 A;  1S1N A;  2KRO A;  1UE9 A;  1NYF A;  2HEQ A;  1QWE A;  2KRS A;  1ZUK A;  3ULR B;  4OMN A;  5GJV B;  2CRE A;  1N5Z A;  2KRM A;  1GFD A;  3FJ5 A;  2CUB A;  2DYB A;  1K0X A;  2E5K A;  1YWO A;  2ROL A;  1MUZ A;  1GCQ C;  1GRI A;  1NM7 A;  4CC7 A;  1G83 A;  2RQV A; 
#chains in the Genus database with same CATH topology
 3A1P A;  2IPO B;  3CCQ A;  4XTV A;  4BI4 A;  3MP8 A;  1VQM Q;  4M77 B;  1XNI A;  2L89 A;  1QVF P;  1KHI A;  2LZ6 B;  2CKK A;  2VAS A;  4PFZ A;  3CEY A;  3EFO A;  1LOJ A;  4L6V 5;  4FW2 A;  1HJD A;  1OZ2 A;  4CI0 C;  3QUI A;  1LVK A;  4LXC A;  2DL3 A;  2FL7 A;  5KYX B;  3MKD A;  1WYX A;  2AT1 B;  6AT1 B;  3CCR Q;  1ABO A;  1H3H A;  1YN8 A;  2CZ0 B;  2DZ9 A;  4M7D E;  3EG9 A;  3QG1 A;  4JRI A;  1U3O A;  4B9X A;  3VRY A;  4HCK A;  3T9N A;  1QW1 A;  4RTU A;  5DY9 A;  2FZK B;  2LQ8 A;  3C0C A;  4OMQ A;  4J9B A;  5GMK i;  3GOX A;  3OS1 A;  2DYI A;  1VIE A;  5CQY A;  2NUZ A;  4XTY A;  2VV5 A;  3G71 T;  5FRM A;  3A8M B;  2GGR A;  1Y96 B;  1HD3 A;  2DFU A;  1IO6 A;  1VQK A;  2OJ2 A;  1H8K A;  3H0F A;  2KYB A;  3FLG A;  2L5Q A;  3EFR A;  4MZM A;  2O88 A;  2QGF B;  3CCJ A;  3OYJ A;  3LWH A;  5KH6 A;  2XKO C;  5I11 A;  2KE9 A;  1FMW A;  1UGR B;  2JTM A;  2RQW A;  3P8D A;  3H41 A;  1QQJ A;  1V29 B;  2MI6 A;  2VXE A;  4KUD K;  1QVF A;  3VS7 A;  2RB6 A;  2RI2 A;  1C1A A;  1PSE A;  4PJO D;  2DL8 A;  4JJB A;  4PJO C;  4R56 A;  3KXT A;  2DMO A;  1Q81 C;  4LD9 K;  2XK0 A;  1OU8 A;  1VYT A;  1KQS P;  3HP9 A;  4J6W A;  4KH1 B;  3V7R A;  1AD5 A;  4F16 A;  5KYW B;  3VS5 A;  4IUU A;  4M7D D;  3JCM d;  3SB2 A;  1IHV A;  3EG0 A;  3CD6 T;  3JCM Q;  4MDW A;  2R5M A;  2FPD A;  4IUP A;  2F5K A;  3QXE B;  1KQ1 A;  3RUX A;  1MMA A;  3OSV A;  1WNL A;  1NG2 A;  2EAY A;  3C95 A;  4IIM A;  2RO0 A;  2YLB A;  2DK3 A;  2QQA A;  1KK7 A;  2X4Y A;  4M7A F;  3PGG A;  1JO8 A;  2EQK A;  3U23 A;  4M7A E;  3I56 A;  2GTO A;  3BE3 A;  3MEW A;  2RHY A;  4XQ3 A;  4FSS A;  4M78 D;  2C06 A;  4BI3 A;  1R77 A;  4FL6 A;  1VQ8 T;  4KT0 E;  1W6X A;  3NHN A;  1NE8 A;  4E2F B;  4QW2 A;  2JJ9 A;  1M8M A;  4L5G A;  4P5N A;  1J3T A;  3TQ7 P;  5CR2 A;  4PL6 A;  3CXC P;  4E7Z A;  3L42 A;  5FLX E;  2RHX A;  3NTI A;  2HL3 A;  1MGQ A;  1G3S A;  2KI7 A;  2FB7 A;  3BY7 A;  2LCS A;  3I55 Q;  4KBM B;  3M54 A;  5J39 A;  3UA6 A;  4RKU E;  1R0B G;  4RTZ A;  2HKN A;  3QSU A;  2DEU A;  1IXD A;  1M3B A;  1N9R A;  5LJ3 d;  3JV3 A;  2KY9 A;  2VXF A;  4JDS A;  3FC3 A;  3OBY A;  1JEG A;  2EQI A;  5L8R E;  5GAN 5;  3M0P A;  2CP2 A;  2ZPE B;  3UWN A;  3TSZ A;  4XTZ A;  5EC7 A;  2MF2 A;  1JRI A;  2K3Y A;  1BI2 A;  5GAN 7;  4XU2 A;  1QKX A;  1ZSZ A;  3SD4 A;  4QQ6 A;  1PG5 B;  1MND A;  2HZY A;  4DBQ A;  2X4X A;  3G4S T;  1NJI C;  3R6N A;  2RQT A;  2EKO A;  3EGD A;  3JCM e;  1M1F A;  4M77 F;  1EZZ B;  1M3A A;  5HCK A;  2CP7 A;  2MIO A;  2LQN A;  3R6O A;  3VS1 A;  1W2B P;  1MV0 B;  4NL3 A;  2RNA A;  1NBE B;  2F69 A;  4C92 C;  1VOM A;  2EWN A;  1SSH A;  1U1S A;  3HRU A;  3QYH B;  1PM3 A;  4DBH A;  1NPR A;  2MCN A;  5GAO p;  4FW1 A;  1XJW B;  3QJ6 A;  1YJ9 T;  4X34 A;  5KYU A;  1X01 A;  2BZ8 A;  2DF6 A;  4RCC A;  1G2B A;  4QQG A;  2K6D A;  4L59 A;  5KYY A;  1PD1 A;  5FU6 B;  1Q95 G;  3M56 A;  1FWZ A;  4PK4 A;  5A0G A;  5GAM f;  4RTT A;  2DIG A;  4Y91 A;  2D0N A;  1RUW A;  1SSF A;  2LJ0 A;  4XK8 E;  2QA4 T;  3GNG A;  2DXT A;  4LUD A;  3DLL A;  4M4Z A;  3H9N A;  5GAO l;  3QPH A;  1WHG A;  5GAN h;  3JCM W;  3VKI A;  1TSF A;  2R57 A;  5GAM e;  4C8Q D;  2X3X D;  4C8Q E;  1CKB A;  1AVZ C;  3LYI A;  5KYX A;  5GAM j;  2ZZD A;  4C0G A;  3CME Q;  1W2B S;  4J83 A;  2E4H A;  1FYN A;  2BE7 D;  1U5S A;  5GMK j;  3OQ5 A;  1S72 A;  4GY5 A;  3QHS A;  2DEQ A;  1JJ2 S;  1V76 A;  3THK A;  1D3B A;  3V8L A;  1C6V X;  1RAD B;  2ZGW A;  3EGX A;  3TCJ A;  2CYZ B;  3JB9 G;  2K2V A;  1U1T A;  2ATC B;  2DM1 A;  2RJD A;  2XMF A;  3A8O B;  1YI2 A;  1VQP T;  3CXC A;  2XHC A;  2D6F A;  2DTH A;  3CC7 T;  5CIU A;  3I55 T;  2A0F B;  3FRN A;  4EIK A;  1B34 B;  3OYI A;  2WSE E;  3HKS A;  3CBP A;  3V8K A;  4O6J A;  2XI9 A;  4NOY A;  3OYM A;  3M53 A;  2EJF A;  1GBQ A;  3AHU A;  2YT6 A;  1CSK A;  4M75 F;  2P4T A;  1QCF A;  2EPD A;  1ZSG A;  1BYM A;  4FT4 A;  4AMC A;  1RLQ C;  1JJ2 P;  1VQ9 Q;  3I5S A;  2AZV A;  3A8H B;  4D6W A;  2E70 A;  2PU9 B;  3MHX A;  4E7H A;  1YIT T;  4OMP A;  4AFZ C;  3EG9 B;  2V1R A;  4PJO A;  1VQN T;  1VQO A;  1GCQ A;  4A63 B;  2FZG B;  2LNV A;  2YUN A;  4C92 B;  1TTH B;  2PUO B;  1KQS A;  3M0R A;  1CKA A;  1ABQ A;  2L3P A;  1Q7Y U;  1M90 U;  4BUG A;  2KDS A;  4M7D A;  1BCM A;  4LDU A;  1MMN A;  2CH4 A;  4RTV A;  2YUP A;  2EYQ A;  4Z88 A;  3L2V A;  3MCA B;  1D1A A;  2LJ3 A;  3OS2 A;  3A5Z B;  1PNJ A;  5CO7 A;  2PZ1 A;  3L2U A;  1QVF S;  2K5L A;  2XID A;  1KD1 C;  4M77 A;  1U06 A;  3OYG A;  1VQM A;  1VQL A;  4XTU A;  2RK2 A;  4BDZ A;  2HEQ A;  1QWE A;  1KHC A;  4XU3 A;  3CCV Q;  4ATO A;  2DYB A;  1K0X A;  1RAI B;  1OU9 A;  2ROL A;  1MUZ A;  4LDY A;  4CC7 A;  4GBQ A;  2QGG A;  2YRV A;  4BAC A;  1YHQ Q;  1KC8 R;  4OF1 A;  2GF7 A;  2OI3 A;  2FEI A;  3JCM c;  4DEY A;  3ER0 A;  4FIB A;  2KGT A;  2DD4 A;  1YCS B;  2V26 A;  4M78 B;  3CC2 Q;  3JB9 J;  4DOV A;  1BKB A;  2RJC A;  4JRP A;  1KD1 R;  2RQR A;  1YJN T;  1SEM A;  4C92 G;  2YUQ A;  2M1H A;  1VYU A;  4JLG A;  3VS0 A;  2DJZ A;  5GAO q;  3OW2 P;  4PJJ A;  1SRL A;  4BB7 A;  1X69 A;  2JZ2 A;  4DBF A;  3CC7 Q;  3CD6 A;  1VQO T;  4Y28 E;  4QKU A;  3NGP A;  5IHK A;  4M75 E;  2EGA A;  1YFN A;  5FW9 A;  3MP6 A;  3JRZ A;  4J7F A;  4M7A D;  2AIR B;  1M9S A;  1WQW A;  1WFW A;  2KXC A;  3G6E Q;  3JCM f;  4IIO A;  4M7A A;  2DZC A;  2L2P A;  8ATC B;  1R8O B;  2CH4 W;  4MMK A;  2J7I A;  4M75 A;  2FHD A;  3OYC A;  3DB3 A;  4ZNX A;  4M7D F;  3I56 Q;  2DVJ A;  1XOV A;  2D8H A;  2DJQ A;  1W2B A;  2IG0 A;  3AT1 B;  2L8D A;  2JS0 A;  2FVU A;  3P8H A;  2QEX A;  2DBK A;  4HVU A;  1KG1 A;  3JB9 I;  1K9M R;  3CPW S;  2JXB A;  4PJO F;  1UEC A;  2YLC A;  1VQ5 Q;  3PVQ A;  4WF2 A;  3EG1 A;  2V8K A;  1NEG A;  2RQU A;  1TUC A;  3EAE A;  2EJ9 A;  2KXD A;  9ATC B;  4DOW A;  2ZPF B;  3TU4 K;  3CBO A;  2XIC A;  4ZGD B;  4KRT A;  1TWB A;  2F5T X;  3UPU A;  3SWN C;  4KGX B;  1Y71 A;  1BBZ A;  2Y4X A;  1TXQ A;  1W70 A;  2GBQ A;  2RF0 A;  4IUV A;  8AT1 B;  2RI3 A;  3VRZ A;  2KBT A;  2PVG B;  2ROT A;  1WA7 A;  1BB9 A;  5GAM g;  3DKM A;  2E65 A;  2HQE A;  2AHJ B;  2JNG A;  1TUG B;  2ECZ A;  1D3B B;  3EFS A;  3CMA A;  2GFA A;  4HCZ A;  1PD0 A;  1AT1 B;  3OW2 S;  4E7K A;  1JQQ A;  5IT9 E;  3SDZ A;  2PUK B;  4C5I A;  3PVL A;  2KK4 A;  2SEM A;  5LJ3 e;  1PSF A;  2LC4 A;  1KC8 C;  2XU8 A;  2VKN A;  2K3X A;  5GAN d;  4KUI A;  5LJ5 j;  3CC2 T;  5GAO n;  1YJ9 Q;  4C5H A;  2C0I A;  4F17 A;  3CD6 Q;  1HK9 A;  2KYM A;  5C0M A;  2A28 A;  1K73 R;  5I22 A;  4RCB A;  3KFV A;  3M59 A;  4C92 A;  4Z8A A;  2E3H A;  3N5B B;  2HQH A;  2ED1 A;  1FMK A;  4FSX A;  2M0Y A;  2K2M A;  1K9A A;  3F70 A;  3QWY A;  4HA8 A;  4AG1 C;  3MPU B;  4A4G A;  2LCC A;  4M7A B;  4EMK A;  3CCS A;  3CC2 A;  3VYG A;  4QT7 A;  4EPC A;  1K0S A;  1SHF A;  2PTK A;  3ZL7 C;  3JCM g;  1SKU B;  4OP0 A;  1QCO A;  5GMK l;  3HRS A;  2EJG A;  5HK0 A;  2OTJ A;  4PJO G;  3CCQ Q;  1VQ8 A;  2RD1 A;  4FYV B;  5GAN 2;  2AZS A;  3CCM A;  4IKF A;  4RG8 A;  2HBW A;  4HVW A;  3CC4 Q;  5FU7 B;  1EFN A;  1M2V A;  3CCM Q;  4M78 E;  1M8V A;  1GXI E;  5LJ3 f;  1YJW A;  2JOY A;  1GBR A;  2DE0 X;  3G1J A;  1VQ5 A;  2ENM A;  1Y57 A;  3WVE B;  1D1B A;  2J6O A;  4JJD A;  1K9M U;  2LRQ A;  3PT9 A;  4M7D B;  3BDL A;  4IUQ A;  1D1C A;  1S72 Q;  4EMH A;  4PLL A;  4ZN3 A;  5HK3 A;  3QII A;  1UB4 A;  3EG2 A;  5CKF A;  3CME A;  5GAN g;  3QYG B;  2E10 A;  1TG0 A;  2HD0 A;  1GCP A;  4EMG A;  4F04 B;  1AWW A;  2MMP A;  1Q82 R;  5GAN 8;  1UTI A;  2LVM A;  4AG2 C;  4C5E A;  3GPL A;  2G3R A;  2SRC A;  3V7S A;  1Q81 R;  3JCM P;  2LP5 A;  5D6Y A;  2I2L A;  3M9Q A;  3PTA A;  4N4I A;  4J9D A;  4ESR A;  2K5F A;  2ZCF B;  1Z9Q A;  1Q81 U;  5D7U A;  3INZ A;  1N27 A;  3CBM A;  3JB9 F;  3RBB B;  1VQN A;  2CP5 A;  1N6A A;  1QVG A;  1X75 C;  2DL7 A;  2ZPH B;  2A3L A;  1Q7Y R;  1M90 R;  3CCE A;  2OAW A;  2F2V A;  3OYL A;  2RJE A;  5GAN f;  1X27 A;  3CC7 A;  4JPB W;  2COZ A;  1K9M C;  2EGC A;  3UA7 A;  5GMK m;  2QA4 Q;  2CS7 A;  4DQ2 A;  2H3J A;  3I9Q A;  1OZ3 A;  2RK1 A;  1YI2 T;  2LMJ A;  4EMK B;  2O9S A;  1D0X A;  3M0Q A;  5KE3 A;  4IUT A;  1K76 A;  5LJ3 g;  1G5V A;  5CVI A;  1IGQ A;  1WHM A;  1Z9Z A;  3SWN B;  3J7A F;  2DL4 A;  1JB0 E;  1EX4 A;  1OX8 A;  2ESW A;  2K9G A;  4M75 C;  2DPP B;  4ME7 A;  2BKD N;  4M75 G;  5IHN A;  4M78 G;  3M0U A;  2NLU A;  1EIF A;  2A37 A;  5GJW B;  3M0T A;  2DVE A;  4HCB A;  3G4S Q;  4PLI A;  4QQD A;  1M3C A;  5AT1 B;  1YJW Q;  2DRM A;  1JU5 C;  2JW4 A;  3C4S A;  1SHG A;  4E47 A;  1Y0M A;  4AFS C;  2E1H A;  1V1C A;  1VQP A;  4IUR A;  2K3B A;  4AFQ C;  4HXJ A;  2HMA A;  2M0O A;  3RMS A;  2RPN A;  2B8A A;  1OOT A;  1Y96 A;  2IIM A;  4PJL A;  2CZ6 B;  2CGH A;  3KUF A;  5A2Q E;  3RES A;  4JJN K;  4M75 B;  2DAQ A;  3UDC A;  1KQS S;  2QXF A;  2MK5 A;  3Q1J A;  3JAM E;  2FYK A;  1M1K C;  2QAZ A;  2IVW A;  4OMN A;  5FU7 C;  1VQM T;  2KRM A;  3FJ5 A;  1MNE A;  3C94 A;  1YWO A;  5LJ5 d;  1I5L A;  2V8I A;  4AT1 B;  1WHL A;  2EQU A;  2RMO A;  1YIT A;  1UFF A;  2KQW A;  3SHW A;  4B9W A;  3HTR A;  4LDW A;  1O75 A;  1OEB A;  1ZUY A;  3VJP A;  4JUV A;  3A98 A;  5HKC A;  2MAM A;  3UAT A;  1HYO A;  1VA7 A;  2E5Q A;  3E19 A;  4F7U F;  1WJS A;  1VQ6 A;  1MHN A;  2LCL A;  2NUP B;  3WXM B;  2DO3 A;  1RAB B;  1YHQ A;  2QQ9 A;  3OSS C;  1WHH A;  1HSQ A;  5LJ5 h;  4FYY B;  4M77 C;  4X1V A;  2P0Q A;  1VYV A;  3NPF A;  1VQK T;  4MML A;  1UGS B;  2DX1 A;  4ZN1 A;  3CCU Q;  1B07 A;  1I5O B;  1UJ0 A;  1UDL A;  4QVZ A;  1VQ9 A;  4RTY A;  3OYN A;  3CCJ T;  4BDY A;  2K4Y A;  1OPL A;  2JTE A;  1ZSZ C;  5CAI A;  3M0S A;  4E7J A;  2ZPB B;  2O2O A;  2BZY A;  1H64 1;  4E7S A;  2V8J A;  2GNC A;  3REA B;  2J06 A;  4C8Q G;  4J9F A;  1YJN Q;  3FIF A;  2GTJ A;  4J9C A;  1BI3 A;  2CP0 A;  4BE1 A;  4JLI A;  3HL8 A;  4R55 A;  1BCO A;  4K11 A;  5IAY A;  1UGP B;  3OMG A;  3RNJ A;  3ME9 A;  2DIL A;  3CPW P;  1KSW A;  2M16 A;  1IHW A;  1NPP A;  3LGF A;  3LWI A;  3QDF A;  1QVP A;  4ZTJ A;  4LUE A;  5LJ5 g;  2QK0 A;  4PJO E;  3RKW A;  1WQ7 A;  4E7L A;  3JB9 D;  4JRQ A;  4OML A;  4LN2 A;  4LNP A;  3HSB A;  1Q86 C;  2GQI A;  3LW5 E;  2HAX A;  2M02 A;  3RMQ A;  1BIB A;  2QEX Q;  1RL2 A;  2CZ7 B;  3FEO A;  1N8R R;  5DM7 R;  1YIJ A;  3X24 B;  2E64 A;  3G6E A;  3H8Z A;  4OB2 B;  3LLR A;  1VQ6 T;  2CSI A;  1QMC A;  2RM4 A;  4A53 A;  4FM4 B;  1IRX A;  2YUO A;  2AK5 A;  2HKQ B;  1AZE A;  1UHC A;  2X4J A;  1X6O A;  1NJI R;  2R5A A;  5GMK e;  3RIR A;  2OTJ T;  3CCE Q;  4E7I A;  3P8B B;  2O4X B;  1RI9 A;  2HCK A;  3QKJ A;  2KVQ G;  4M7D G;  1U8R A;  1X6B A;  2E41 A;  2YRD A;  2EW3 A;  2CSQ A;  2J6F A;  3TSW A;  2XDD A;  3ZBD A;  3EG3 A;  3CXC S;  2DIQ A;  4M77 G;  2LQK A;  3H0I A;  1BI0 A;  2D1X A;  3EGX B;  3S3M A;  2QQS A;  2RHU A;  2M51 A;  1ZA2 B;  1T0H A;  3CC4 A;  5ECA A;  2O31 A;  3CME T;  1B7T A;  1IZ6 A;  5KYU B;  1WGS A;  4XU0 A;  4LE9 A;  4GLM A;  2AKK A;  1VQ8 Q;  3IQL A;  3ZFJ A;  4C8Q F;  4ELY C;  3J80 E;  2BZX A;  3RKY A;  3OS5 A;  4J8O A;  3TVT A;  2OTL T;  3WVD B;  3VS4 A;  4DEX A;  3OY9 A;  3RER A;  2QTV A;  1ZSZ B;  2DXC A;  2MYS A;  3CCM T;  2YDL A;  2NYS A;  3GNF B;  3MP1 A;  3VYH B;  4C0Z A;  2JT4 A;  2PVO B;  3M55 A;  3L1A A;  3CMA T;  3M4G A;  1WLP B;  1TS9 A;  3OW2 A;  5KCO A;  3C12 A;  4PJO B;  4KUL A;  1QVG P;  2QDY B;  4E6R A;  1RAG B;  2VWF A;  4FYW B;  1YCY A;  1H92 A;  1T0J A;  1VUB A;  4F7U B;  1ARK A;  2ED0 A;  1E7O A;  2HQX A;  4BI8 B;  3QBY A;  5GAO r;  1OUL A;  4O5V A;  3S3O A;  4NS5 A;  4XTX A;  4R0K A;  1G3W A;  4CC4 B;  2HBP A;  3X26 B;  3NFC A;  1KC8 U;  4YTL A;  2RH2 A;  3SEM A;  1VQ5 T;  2QA4 A;  1PHT A;  4KGZ B;  1NLP C;  1WXB A;  2W10 A;  1NZ9 A;  4FT2 A;  4HCC A;  2XDB A;  4PNO A;  2FRY A;  2MWP A;  1OYX A;  1VQO Q;  4M7A G;  3PMT A;  1Q86 R;  2CUD A;  3RR6 A;  4J9G A;  4PFO A;  2JM9 A;  2JS2 A;  1RAC B;  2E6Z A;  5LJ5 f;  5FU6 C;  5GAN 3;  1D09 B;  5I21 A;  2F1L A;  1Q82 C;  3BW1 A;  1NLO C;  2NUT A;  2DKG A;  1WDX A;  5LJ5 e;  3GF5 A;  4RG2 A;  4WTO B;  3E2U A;  4LDX A;  4KGV B;  3CCU T;  1YJ9 A;  4C92 F;  3QWX X;  2EYW A;  2VGM A;  1KJW A;  3REB B;  2LJ1 A;  3HFO A;  3VUB A;  3CQT A;  3HRT A;  1VQ4 A;  3CCE T;  2BE9 B;  2GFU A;  1QP3 A;  3HPW A;  1M1K U;  1Y7X A;  1VQ4 Q;  1BIA A;  1ZBJ A;  3CMA Q;  2FG0 A;  3CCJ Q;  4DA4 A;  5CKB A;  3DLM A;  4KH0 B;  3M58 A;  2KNB B;  5D6W A;  1YI2 Q;  3V8J A;  1VQN Q;  2OX7 A;  2LX7 A;  5CQX A;  1OPK A;  3S6W A;  1NEB A;  1JBM A;  3EGD B;  4BE0 A;  4N0A C;  4OMF B;  3OYE A;  3X20 B;  1SRM A;  2B86 A;  3OS0 A;  1MMG A;  1RAE B;  4C0D B;  1BI1 A;  4Z02 A;  2RHZ A;  2DXU A;  3PE0 A;  2KT1 A;  1AWJ A;  1PKT A;  2RN8 A;  4LDV A;  4XTW A;  4HVV A;  4NL2 A;  1JJ2 A;  3CPF A;  1E6H A;  1WPY A;  1K8A R;  1YJN A;  1YWP A;  2X51 A;  2DXB A;  1YP5 A;  3O8V A;  1VQ7 Q;  3DB4 A;  2E6N A;  3EHQ A;  1QVG S;  2MWO A;  4ZGE B;  4M78 A;  2K79 A;  1AHJ B;  3OYB A;  4C0D C;  2D8J A;  1ZUU A;  4HT8 A;  2C0T A;  1VQL Q;  2VB6 A;  1QKW A;  1M1G A;  3G7Z A;  4BD3 A;  3J81 E;  2YRC A;  3MET A;  1W1F A;  5LJ3 h;  5A0L A;  2P4R A;  2YHT A;  2P84 A;  1WXT A;  1PWT A;  1O9S A;  3D7S B;  3PFS A;  3GIB A;  5A0D A;  1GL5 A;  3RKX A;  3OB9 A;  2HNI A;  1WI7 A;  2Y4Y A;  1X2Q A;  1Q82 U;  4M77 E;  1UHF A;  5CKE A;  1N8R C;  1VQK Q;  2RHI A;  5DLO A;  3NTH A;  1WX6 A;  4MZP A;  3CCU A;  1AWX A;  1ACM B;  1M4Z A;  3O5Z A;  3VS2 A;  3CCR T;  2RI5 A;  4JJC A;  1I0C A;  2EYX A;  2DL5 A;  2KRO A;  4EDU A;  3JB9 H;  2VC8 A;  1YIT Q;  2RJF A;  3JCM V;  3QZ5 B;  3ULR B;  1Q86 U;  5GJV B;  2CUB A;  3QDR B;  2YWW A;  3LH0 A;  5C6S A;  3OYH A;  4F7U A;  3CCV A;  2RQV A;  3S3N A;  3UT1 A;  4N4H A;  4CC3 A;  2DA9 A;  2L3Q A;  3HHT B;  4QVD A;  1BU1 A;  2EYZ A;  1C0M A;  1JXO A;  1FX7 A;  1QCN A;  4J9E A;  1P92 A;  3CCL Q;  2XDP A;  2XG8 D;  3JCM h;  4B6M A;  5IXB A;  4J6Y A;  1I07 A;  2ZPI B;  1LPL A;  2KMT A;  1X6G A;  1NJI U;  4HKE A;  2J6K A;  2EBP A;  5KCH A;  4ZGJ B;  3PIP A;  2X3W D;  1VQ9 T;  5FWC A;  1GFC A;  1K73 U;  1UJY A;  1N9S A;  3LGL A;  2MOX A;  3VU3 C;  2K7A A;  2GQV A;  1PCX A;  4M78 F;  2M9U A;  1JXM A;  2VVK A;  3HFN A;  3OBW A;  1TOV A;  1VQ7 A;  3I35 A;  1X2K A;  1FXX A;  2L0A A;  3G6E T;  1DJ7 B;  4M75 D;  2QG9 B;  2CP6 A;  4OMM A;  4FCY A;  3H0H A;  4D8K A;  1PRM C;  2CZ1 B;  1N8R U;  4JZ3 A;  2VUB A;  2KRN A;  2JMC A;  2E12 A;  3G71 A;  2DLP A;  3OYF A;  3JCM b;  2I0N A;  2CT4 A;  1B3Q A;  2F2X A;  1TU0 B;  1WHK A;  1UG1 A;  4M78 C;  1I81 A;  2NUT B;  1LJO A;  4Z89 A;  1H3Z A;  2WSF E;  1G8X A;  2PQW A;  2FPF A;  1W4S A;  2JMA A;  2X4W A;  3QO3 A;  4MZT A;  1AEY A;  4PKC C;  2V1Q A;  2HSE B;  4BY6 B;  2OAU A;  2KSS A;  3E9G A;  4A4K A;  1F1B B;  1XQH A;  2QAS A;  3M57 A;  2K57 A;  3MO8 A;  2FO0 A;  2LDM A;  1Q7Y C;  1M90 C;  3CCV T;  1VQ6 Q;  4OMO A;  4M7D C;  2LQW A;  3A8G B;  1UGQ B;  4A4F A;  3CC4 T;  2Z0W A;  1KQ2 A;  1VIF A;  5I2M A;  2CT3 A;  3I56 T;  1PRL C;  2E3I A;  4OGC A;  5CKD A;  1K8A U;  2LX9 A;  2FZC B;  5IXF A;  1K1Z A;  2WAC A;  2F2W A;  2EVR A;  3TRE A;  3KBG A;  1G3T A;  4J7I A;  4OGE A;  4WCI A;  2OTL A;  1AWO A;  1I1J A;  1KFZ A;  3GP8 A;  2DBM A;  2QYZ A;  2C0O A;  4BY6 C;  5CCA A;  1M27 C;  3EHR A;  4Q5W A;  2JTF A;  2R58 A;  2RA2 A;  2EGE A;  5FWB A;  2G6F X;  2EIF A;  2JN0 A;  1KIK A;  2HL5 C;  2KAF A;  4JZ4 A;  3JCM J;  1M5Q 1;  4F7U G;  2D9T A;  1VQP Q;  3GBQ A;  5KYN A;  2DNU A;  3ASK A;  1UEB A;  4XU1 A;  2QQB A;  4FU6 A;  3SWN A;  2K5I A;  1YIJ T;  1FMV A;  1BK2 A;  1OI1 A;  1SG5 A;  4V2S A;  2DRK A;  5GAO m;  1X43 A;  2EYY A;  1MV3 A;  3URG A;  2XD0 A;  3H6Z A;  5IHI A;  2QEX T;  4J9I A;  1RLP C;  5L23 A;  2A7Y A;  1WJR A;  5HY6 A;  2W0Z A;  1ZQ1 A;  1T3L A;  4PJN A;  4D8D A;  1WHJ A;  2QTX A;  1A0N B;  5GAN j;  2H8H A;  2ZPG B;  2LTO A;  4C8Q B;  5GAN 4;  1K4U S;  2JM8 A;  1MMD A;  4M7A C;  3V7C A;  5D6X A;  1SPK A;  3CCS T;  3SFM A;  2COW A;  3OMC A;  3G4S A;  2KT8 A;  1ZA1 B;  3CPW A;  5M9O A;  2P0P A;  3A8L B;  2YSQ A;  1S72 T;  1RAF B;  1NYG A;  3PMI A;  3MJX A;  1XTD A;  5GAN e;  4C92 E;  5KE2 A;  4C92 D;  4AFU C;  5GAM h;  1WZO A;  5J26 A;  1PKS A;  2QQR A;  3RDV A;  2WSC E;  2A36 A;  5KYW A;  1AOJ A;  2FRW A;  3MEV A;  2EQM A;  2O9V A;  3EFO B;  3OA6 A;  5FRN A;  4J5Y A;  2BIV A;  4OB3 B;  4J9H A;  3CCL T;  3E9F A;  2ABL A;  3I55 A;  5IH2 A;  4PJM A;  2EKH A;  4JS4 A;  3I5R A;  4X9D A;  1RAA B;  5IN1 A;  4II1 A;  2OTL Q;  3BFM A;  1TUD A;  2CP3 A;  1YJW T;  1YIJ Q;  1QP2 A;  5LL6 S;  4N0A A;  2NWM A;  2QDL A;  3EH2 A;  2QI2 A;  4C0F A;  1IB8 A;  3UF4 A;  4F14 A;  2X35 A;  1D0Z A;  4J6X A;  1ZHI A;  1M2O A;  1E6G A;  2GCX A;  4JS5 A;  2AKL A;  3OYK A;  2HDA A;  1VQ4 T;  3EGU A;  3VS3 A;  1RI0 A;  3TEE A;  3FB9 A;  1UGV A;  3OYY A;  1UUE A;  2COY A;  1M2V B;  4TVR A;  3LH5 A;  4A4H A;  4M77 D;  2JVV A;  5LJ3 j;  2CDT A;  4LD6 A;  2DER A;  5KYY B;  4DBR A;  2D0Q B;  2KR3 A;  2VGN A;  3JSC A;  2FPE A;  4Y92 A;  2LNH B;  4RMO A;  3MEA A;  4PFP A;  4QVC A;  3E1S A;  1LNX A;  3NTK A;  3GLX A;  1YBY A;  1D0Y A;  4A54 A;  2MPX C;  4GLK A;  5J3B A;  1TH7 A;  2BTT A;  4BE2 A;  5GAM d;  1Y07 A;  1K73 C;  3M4Y A;  1QLY A;  3CCQ T;  3L2W A;  4MDX A;  2H3E B;  2LT4 A;  1M30 A;  3X28 B;  4CC2 A;  2DTO A;  1WXU A;  5FRO A;  1T3S A;  1ZLM A;  3L2Q A;  3G71 Q;  4HT9 A;  4CRI A;  2DD5 A;  5AYF A;  3VS6 A;  1WIE A;  2ZAE A;  4ZTF A;  2EFI A;  1YHQ T;  2HSP A;  2VYT A;  2L3S A;  2PVD B;  1OX9 A;  3VV0 A;  1I4K 1;  2NUP A;  4C8Q C;  3OYA A;  3NMZ C;  1ZX6 A;  5GMK h;  4EMK C;  1QWF A;  3ZEH A;  4C5G A;  1AZG B;  1I8F A;  7AT1 B;  4OB1 B;  3L2Z A;  1OV3 A;  2PNI A;  2OTJ Q;  4VUB A;  1IGU A;  1SF9 A;  1LCK A;  1B34 A;  3CCL A;  2P0K A;  4RUG A;  5EG2 A;  4OVA A;  4N4G A;  2A08 A;  1HXD A;  4ELZ C;  3FJP A;  2L3R A;  2YXY A;  5CKH A;  3CCS Q;  2O01 E;  1YNZ A;  2J05 A;  1ZBX A;  1M1K R;  4XAX B;  2EQJ A;  3PNW C;  3BDU A;  3MEU A;  4A4E A;  2X9H A;  1G3Y A;  5GAN 6;  4F7U E;  3VUZ A;  5I2S A;  3QJY A;  3X25 B;  3PIO A;  2BUD A;  4X9C A;  4JRK A;  2JUF A;  4ORZ A;  4RTW A;  4RTX A;  3FDR A;  3EH1 A;  2LT1 A;  2DET A;  2KEA A;  3L2R A;  2DTI A;  1WJQ A;  1S1N A;  5DLQ E;  1VQ7 T;  4ANJ A;  1UE9 A;  4OB0 B;  1PC0 A;  3CCR A;  2Y90 A;  1KD1 U;  1NYF A;  1OQK A;  1R0C B;  4C8Q A;  4FYX B;  2KRS A;  1IRE B;  3OYD A;  1ZUK A;  1RAH B;  1K8A C;  2CRE A;  1N5Z A;  2O4X A;  3QZ9 B;  1VQL T;  1GFD A;  2E5K A;  3M5A A;  5CK9 A;  4UC4 A;  1GCQ C;  1GRI A;  3JCM X;  3LX7 A;  1NM7 A;  1G83 A; 
#chains in the Genus database with same CATH homology
 2RMO A;  4CC3 A;  2DA9 A;  1UFF A;  3SHW A;  2L3Q A;  2OI3 A;  2FEI A;  1OEB A;  1BU1 A;  1ZUY A;  4DEY A;  2EYZ A;  3A98 A;  1JXO A;  3UAT A;  2LZ6 B;  2KGT A;  1VA7 A;  4J9E A;  1YCS B;  1HJD A;  5IXB A;  2DL3 A;  1WYX A;  1I07 A;  2RQR A;  1HSQ A;  1ABO A;  1SEM A;  1X6G A;  1H3H A;  1YN8 A;  2YUQ A;  2J6K A;  2EBP A;  1VYU A;  1U3O A;  2X3W D;  3VS0 A;  4X1V A;  5FWC A;  1GFC A;  3VRY A;  4HCK A;  1UJY A;  1VYV A;  1SRL A;  2MOX A;  2K7A A;  3NPF A;  4RTU A;  1X69 A;  2DX1 A;  3C0C A;  1B07 A;  1JXM A;  2VVK A;  4OMQ A;  1UJ0 A;  1UDL A;  4J9B A;  3I35 A;  1X2K A;  2L0A A;  4RTY A;  3NGP A;  2NUZ A;  5IHK A;  1OPL A;  2EGA A;  5FW9 A;  2JTE A;  4OMM A;  3H0H A;  4D8K A;  1PRM C;  3M0S A;  4JZ3 A;  2GGR A;  1WFW A;  2KXC A;  2KRN A;  2BZY A;  2O2O A;  2GNC A;  2JMC A;  3REA B;  1HD3 A;  2J06 A;  4IIO A;  1IO6 A;  4J9F A;  4J9C A;  2GTJ A;  2L2P A;  2OJ2 A;  1H8K A;  2DLP A;  3H0F A;  2CH4 W;  2I0N A;  2CT4 A;  2J7I A;  2KYB A;  1B3Q A;  4K11 A;  2F2X A;  2O88 A;  3RNJ A;  4ZNX A;  1UG1 A;  2DIL A;  2DVJ A;  1XOV A;  2D8H A;  1KSW A;  4Z89 A;  5I11 A;  2KE9 A;  2RQW A;  2DJQ A;  2FPF A;  3H41 A;  2JMA A;  4LUE A;  1AEY A;  3VS7 A;  2JS0 A;  2V1Q A;  2DBK A;  4HVU A;  2DL8 A;  4JJB A;  4OML A;  4LN2 A;  2JXB A;  2DMO A;  4LNP A;  1UEC A;  1VYT A;  2GQI A;  3PVQ A;  3EG1 A;  2FO0 A;  1AD5 A;  1NEG A;  2RQU A;  1TUC A;  4F16 A;  2KXD A;  4OMO A;  3VS5 A;  3EG0 A;  2LQW A;  2FPD A;  4KRT A;  1NG2 A;  1BBZ A;  2CSI A;  4IIM A;  2CT3 A;  1PRL C;  1W70 A;  2GBQ A;  2RF0 A;  5IXF A;  1K1Z A;  2YUO A;  2F2W A;  2AK5 A;  2EVR A;  1KFZ A;  4WCI A;  3VRZ A;  2KBT A;  1AWO A;  2ROT A;  1I1J A;  1AZE A;  1JO8 A;  1UHC A;  3U23 A;  2DBM A;  2GTO A;  1WA7 A;  1BB9 A;  4FSS A;  2C0O A;  1W6X A;  2ECZ A;  3NHN A;  1RI9 A;  2HCK A;  1M27 C;  3EHR A;  2EGE A;  1X6B A;  5FWB A;  1M8M A;  1JQQ A;  1J3T A;  2G6F X;  3PVL A;  2SEM A;  1KIK A;  2EW3 A;  4JZ4 A;  2VKN A;  2CSQ A;  2J6F A;  3TSW A;  3GBQ A;  3EG3 A;  2DNU A;  2C0I A;  4F17 A;  3H0I A;  4GBQ A;  2LCS A;  2KYM A;  2A28 A;  2D1X A;  5I22 A;  3KFV A;  3UA6 A;  4Z8A A;  4RTZ A;  2M51 A;  1T0H A;  1BK2 A;  1M3B A;  2ED1 A;  1FMK A;  5ECA A;  2O31 A;  3JV3 A;  2M0Y A;  2K2M A;  1K9A A;  2DRK A;  4LE9 A;  4GLM A;  3QWY A;  1X43 A;  2AKK A;  2EYY A;  1MV3 A;  2EQI A;  4AG1 C;  1JEG A;  3M0P A;  5IHI A;  3IQL A;  3TSZ A;  4J9I A;  4QT7 A;  1RLP C;  2BZX A;  1K0S A;  5L23 A;  5EC7 A;  1SHF A;  2PTK A;  3ZL7 C;  3TVT A;  2W0Z A;  1T3L A;  3VS4 A;  4DEX A;  4D8D A;  1QKX A;  1A0N B;  2YDL A;  2H8H A;  1K4U S;  2JT4 A;  2JM8 A;  3R6N A;  2AZS A;  1WLP B;  2RQT A;  2HBW A;  4HVW A;  1SPK A;  1EFN A;  1M3A A;  2MIO A;  5HCK A;  3VS1 A;  2LQN A;  1MV0 B;  2KT8 A;  4E6R A;  2VWF A;  2RNA A;  1H92 A;  1T0J A;  1ARK A;  2ED0 A;  2YSQ A;  1NYG A;  1E7O A;  1GBR A;  2DE0 X;  4AFU C;  2ENM A;  1Y57 A;  1PKS A;  2J6O A;  1SSH A;  4R0K A;  4CC4 B;  2A36 A;  4JJD A;  1AOJ A;  2FRW A;  2O9V A;  2MCN A;  3SEM A;  1PHT A;  1NLP C;  1WXB A;  4J9H A;  2W10 A;  2ABL A;  2BZ8 A;  2FRY A;  3EG2 A;  2DF6 A;  5IH2 A;  1G2B A;  2EKH A;  3I5R A;  2K6D A;  1TG0 A;  1GCP A;  1TUD A;  2CUD A;  4J9G A;  2NWM A;  2JM9 A;  2JS2 A;  2QDL A;  1AWW A;  4RTT A;  1UTI A;  3UF4 A;  4F14 A;  1NLO C;  2D0N A;  1RUW A;  1E6G A;  1WDX A;  2LJ0 A;  2AKL A;  4AG2 C;  2SRC A;  4LUD A;  4M4Z A;  2HDA A;  2LP5 A;  3EGU A;  3QWX X;  2EYW A;  4J9D A;  3VS3 A;  2X3X D;  4ESR A;  1KJW A;  1CKB A;  1UGV A;  1AVZ C;  1UUE A;  1Z9Q A;  2LJ1 A;  3REB B;  3CQT A;  3LH5 A;  3RBB B;  2CDT A;  2KR3 A;  1FYN A;  1U5S A;  1ZBJ A;  2FPE A;  4Y92 A;  2FG0 A;  2DL7 A;  2LNH B;  2OAW A;  2F2V A;  2KNB B;  3THK A;  1X27 A;  2DM1 A;  2XMF A;  2BTT A;  4JPB W;  2LX7 A;  2EGC A;  1OPK A;  3UA7 A;  1NEB A;  1QLY A;  3I9Q A;  1M30 A;  4CC2 A;  4EIK A;  1WXU A;  1SRM A;  2B86 A;  2LMJ A;  1T3S A;  1ZLM A;  2O9S A;  3PE0 A;  3M0Q A;  2KT1 A;  1K76 A;  1AWJ A;  1GBQ A;  3VS6 A;  1PKT A;  2RN8 A;  1WIE A;  2YT6 A;  4HVV A;  1Z9Z A;  1CSK A;  2DL4 A;  1QCF A;  2HSP A;  1E6H A;  2ESW A;  1YWP A;  2EPD A;  2K9G A;  2L3S A;  1ZSG A;  1YP5 A;  1RLQ C;  3EHQ A;  2K79 A;  3NMZ C;  1ZX6 A;  5IHN A;  1QWF A;  2D8J A;  3I5S A;  3M0U A;  1AZG B;  2AZV A;  1OV3 A;  1ZUU A;  2PNI A;  2A37 A;  5GJW B;  2C0T A;  3M0T A;  1QKW A;  4OMP A;  4AFZ C;  1LCK A;  2V1R A;  4RUG A;  1W1F A;  1GCQ A;  4A63 B;  2P4R A;  2A08 A;  2YUN A;  1M3C A;  1WXT A;  2DRM A;  1PWT A;  1JU5 C;  2JW4 A;  1SHG A;  1GL5 A;  1WI7 A;  1YNZ A;  1X2Q A;  3M0R A;  1CKA A;  2J05 A;  1ABQ A;  1Y0M A;  4AFS C;  1UHF A;  2L3P A;  1V1C A;  2K3B A;  1WX6 A;  4AFQ C;  2CH4 A;  4HXJ A;  4RTV A;  2RPN A;  1AWX A;  4ORZ A;  4RTW A;  3O5Z A;  2YUP A;  4Z88 A;  4RTX A;  1OOT A;  3VS2 A;  2LJ3 A;  2IIM A;  2KEA A;  1PNJ A;  4JJC A;  2PZ1 A;  1I0C A;  2EYX A;  1U06 A;  2DL5 A;  1S1N A;  2KRO A;  1UE9 A;  1NYF A;  2HEQ A;  1QWE A;  2KRS A;  1ZUK A;  3ULR B;  4OMN A;  5GJV B;  2CRE A;  1N5Z A;  2KRM A;  1GFD A;  3FJ5 A;  2CUB A;  2DYB A;  1K0X A;  2E5K A;  1YWO A;  2ROL A;  1MUZ A;  1GCQ C;  1GRI A;  1NM7 A;  4CC7 A;  1G83 A;  2RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...