3ROCA

Crystal structure of human p38 alpha complexed with a pyrimidinone compound
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted N-aryl-6-pyrimidinones: A new class of potent, selective, and orally active p38 MAP kinase inhibitors.
pubmed doi rcsb
molecule keywords Mitogen-activated protein kinase 14
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 110
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rocA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rocA01
3G0EA 3M11A 4UMUA 2BKZA 2Y0AA 3EQBA 5IA3A 4IVBA 4JDHA 5BYYA 1UNHA 2WKMA 4M0YA 4EH3A 4QMNA 4YJRA 1XBAA 3ANQA 5A14A 1PYXA 2RFDA 3HAVA 3EH9A 3R22A 2XJ2A 2R2PA 2PVJA 4TRLA 4D2TA 3DS6A 4JJRA 4ARKA 5JT2A 3KL8A 2WAJA 3EZRA 3F61A 2C0IA 2ZYBA 3I4BA 3O8UA 3TIYA 4O82A 5EHYA 5TKDA 3ENHA 1H1SA 4EYMA 3HECA 3NZ0A 4FV5A 3LAUA 5KBRA 5T3QA 5LJJA 1GNGA 1YOJA 2RG5A 5BVDA 3KULB 5KNJA 4L46A 2BMCA 4OTFA 3VS2A 2UW0A 4V0GA 1UKIA 3JYAA 3FEGA 4UYNA 5JGAA 5HICA 5CALA 1LP4A 4DCAA 3D7ZA 3QQKA 2IW9A 5E9EA 4DF3A 3LZBA 4FZFB 4PMMA 4J97A 4PQNA 4CFVA 4XYFA 5KKRC 2RKUA 2OXXA 1PY5A 4WNKA 3UOLA 3R71A 4CMTA 4L53A 4ZY4A 2F4JA 4IB3A 4YPSA 3PFQA 3KC3A 4OTQA 2IG7A 4D9TA 3R21A 5EYDA 1YI3A 3G15A 4EI4A 4FMQA 4FV8A 2W1ZA 4FL1A 3PE1A 4FTIA 2J0JA 4GT3A 4BYJA 3DQWA 2R4BA 4J71A 3VQHA 4IAKA 2JDOA 2IO6A 2B9HA 3NVMB 4F9AA 2PYWA 3FJQE 3NAXA 3DBFA 4ACMA 4NM0A 3JS2A 4XUFA 5LVOA 5FEDA 4BTJA 2WMSA 3RPSA 5CVFA 2QOLA 4L52A 5LARA 4EWHA 3Q4CA 3E63A 2W96B 3A7FA 3BWJA 4V0GB 5CLPA 5JKGA 4GVJA 4E4LA 3HP5A 1KE5A 3LM0A 1E1XA 1WBPA 5E90A 3HAMA 1W82A 3A60A 1GIIA 4TT7A 2GSFA 2V7AA 2Y9QA 3IECA 1WBOA 3QTWA 4IAZA 4K11A 3SOAA 4NH1A 4JG7A 5I3RA 4MEDA 4MBLA 3AC3A 4AA5A 1IAHA 2YLEA 4FKLA 3V6SA 4FE2A 1XH9A 4IAIA 4EJ7A 2P0CA 3F2NA 4DINA 3GT8A 5FP6A 1P2AA 1W84A 3A61A 4NSTA 3SQQA 4ACHA 3E8EA 5IDNA 3G2FA 3UOJA 4Y5QA 2B52A 2YCRA 3KFAA 3SDJA 4ZTSA 2WQMA 3BBTB 5AR8A 4JBPA 4FIEA 4H36A 4NCTA 3LFCA 4KIKA 2O63A 4I1ZA 4KIOA 1XO2B 3AC2A 4U40A 2XK4A 2REIA 4DH8A 1S9IA 5KO1A 2C6TA 1YDRE 2CN8A 1OUKA 1PW2A 4FKJA 1SNXA 4FV9A 5T6KA 4BDBA 4CMUA 2ZMDA 4NJ3A 4RT7A 3R7YA 4O7NA 5EQYA 3NAYA 4FNXA 5HTBA 3BQCA 2J2IB 5L6OA 4FNZA 4O6EA 5HVKA 3CTQA 5E7RA 1PYEA 5E91A 5CSPA 2LAVA 3DY7A 5L8LA 4JDIA 1G8SA 4IAFA 5BVOA 2GNFA 4O0RA 1KUTA 3EQDA 5AR5A 3I5ZA 3CBLA 4FKRA 3VS7A 3P78A 4C33A 4JQ7A 2PTKA 3FAAA 4CV8A 3OT3A 5HOAA 4GFOA 5E8VA 5K3YA 1KV2A 4JG6A 2XNOA 5A9UA 2BRBA 2QVSE 3GU8A 5CAQA 1Q8TA 2QI8A 4WO5A 4NW6A 4KIKB 3VRZA 2OIDA 1JKLA 2P55A 3OW4A 1WBTA 5AUZA 2ONLC 3HGKA 2R3NA 2G2IA 2X2KA 2UW6A 3L8PA 4NFNA 3E3BX 4O27B 5F94A 3UZRA 3ORIA 5B2MA 4BI2A 3ZRMA 2XKFA 3C4WA 3GENA 4FSYA 3DCVA 4I0TA 4YGAA 3GXLA 2R7BA 4FG8A 2A1AB 4LUEA 5DIAA 3RVGA 3KF4A 3KGAA 5C8NA 4JR7A 5GZAA 4L43A 3ORPA 4D5KA 4IH8A 4YTIA 4XG4A 2C5VA 5DN3A 3SKCA 5BNJA 4O84A 4KIQA 1REKA 2PVLA 5ETAA 3SRVB 4IADA 4BDCA 3POOA 4YZMA 5BUEA 1M2QA 4X2JA 3CQUA 3OOGA 3KXZA 3PJ1A 3SV0A 3SA0A 1R0EA 3KU2A 3OCBA 5E8ZA 5JGBA 1PXPA 2YM8A 2VX3A 3C0IA 4FV1A 3FY0A 4FIJA 4V01A 5M4FA 3RHKA 1OKWA 1JNKA 3JUHA 5D9HA 3VS3A 3NVKI 1BYGA 5JRSA 4I6FA 2WMBA 3HZTA 1Z9XA 3NEWA 4WRGA 3SW4A 4ZZMA 4EJNA 4YJUA 5JRQA 5H3QA 5HGIA 2PZPA 1OL7A 1JSTA 2GNGA 2Y7JA 4DEIA 1OI9A 3RNYA 4MTAA 2WIHA 3HV5A 3QZHA 2BR1A 3P79A 1H28A 4L42A 2Z7SA 3TACA 4G5PA 4E4MA 4JQEA 4AUAA 4G2FA 3LCKA 4BCGA 2QLUA 4UALA 3IG7A 3OBGA 3NCZA 5F20A 4EH4A 2GNLA 1BUHA 3WI6A 4EOPA 4E4XA 3WOWA 4RX7A 3OBJA 4RBLA 2JIVA 4F09A 4F7LA 4OAUC 2W4KA 4WG5A 3TWJA 4IQ6A 3H30A 2XCHA 1BL6A 1IG1A 1PF8A 4ZLYA 2PE0A 4MXOA 4HGEA 4X2GA 1MUOA 1OITA 4UV0A 4E5WA 1XH7A 2ITYA 2AC5A 3E88A 2XA4A 1OKZA 4FTUA 5EI2A 3JPVA 4IZ5A 4X3FA 5IDPA 3MESA 4OBOA 3NUPA 4JIAA 5BVEA 2R5TA 3RM6A 3T8OA 4I23A 1GAGA 3H0YA 4U79A 2EU9A 4R5SA 4ZZOA 5J7BA 3BU6A 1HOWA 1XWSA 4OTDA 4EOSA 4OR5A 5AUXA 2UW9A 4OW8A 4AS0A 4DGOA 4Z7GA 1SNUA 4WBOA 4J53A 4AAAA 3AD5A 1B38A 3MN3A 4X21A 2IVUA 5E8SA 3MS9A 1YXSA 1Q62A 4GJ2A 5ANJA 4TYIA 3TV4A 3FI2A 3TN8A 3ZZEA 4CLJA 3D4QA 4YC8A 1DAWA 3E7OA 3HMIA 3O23A 3ZUVA 5EM6A 4QP4A 4R7BA 5M08A 2XYNA 3I0QA 2HCKA 4DEBA 4APCA 2WFYA 3FMLA 3QTRA 4UZDA 4OTRA 4BDHA 4ONAA 1YQJA 5HEZA 1S9JA 2OH0E 3FMJA 1PXKA 3PJ8A 3GQLA 2XK9A 2YEXA 5CQWA 4O7RA 4BCNA 4FSZA 2UZNA 4D2RA 1ZMUA 2QQ7A 4X3FB 3DAEA 3EOCA 1DI8A 2YISA 4NT4A 1JSUA 4CEGA 4RJ7A 3BYUA 3MSSA 4AA0A 3DXQA 4HPUE 3EMGA 5IA4A 3OROA 1F5QA 3CY2A 4XHKB 3GCQA 3PP1A 2H34A 4UZHA 3RI1A 2C6OA 2VTJA 4IAYA 3LMIA 2VGOA 3ZC5A 4N57A 1MQ4A 3QZGA 2OICA 3SG8A 2VUWA 2WQOA 1UU8A 3DNEA 4ZOGA 3RCDA 3V8TA 5IA0A 4P5ZA 2QURA 4F63A 5KMNA 2YM7A 4W4VA 5AX3A 4KKHA 4ALUA 5LXMA 2UZUE 5H2UA 4H1MA 3ZH8A 1KWPA 3LLTA 3NWWA 3VBTA 3RM7A 4YHFA 5JN2A 1BI7A 3GC8A 3QKMA 3VUHA 5FDXA 4XG9A 5HKMA 2ESMA 3OFMA 2F9GA 4XS2A 4YTHA 4ZMEA 4G9CA 3PE2A 3PTGA 4QMVA 5HD7A 4F0FA 4MBIA 5A6NA 3N4TA 5FRIA 2V22A 4CSVA 3C13A 3FYJX 4JIKA 3VWAA 3ZRKA 1NXKA 5D7VA 2JBOA 1T46A 3MA6A 3OXIA 3QCYA 5I9YA 4S32A 5FBOA 5BMMA 4NM7A 5GINE 2ETRA 3RPVA 2UVYA 5CANA 4NTSA 3EIDA 3O7LD 2RFSA 1GOLA 4JS8A 5ACKA 3VVHA 3GCVA 4FTJA 3MPTA 4FA2A 5FEEA 4WUAA 3WE4A 4MX9A 5HNIX 3VBQA 1VJYA 3CJFA 5HLWA 2P33A 5CEKA 2CDZA 3KVXA 2B0QA 1V0OA 4KBAA 3UO4A 1GIJA 2NPQA 3KXXA 4AOJA 2YCSA 2XUUA 3E8NA 4A4XA 4EK4A 4QRCA 2P2IA 3CPBA 2IZSA 1B6CB 4RX8A 3HRCA 5L6WL 4FEXA 2BDJA 2F2CB 2UUEA 2YDKA 4QNAA 3ET7A 4DTBA 3FPQA 1WBSA 4MWHA 4UMRA 4EH5A 1OMWA 3DAKA 2PUUA 2WTIA 4GMYA 3VNTA 4E6CA 2A0CX 4Y73A 3E64A 4RJ5A 2R3JA 2YDIA 3GP0A 3R1SA 3W2RA 4K0YA 3D2IA 2HWPA 5J5SA 2UW5A 4QMQA 4FZ6A 5ANIA 2GNHA 5GNKA 1OPKA 2YLFA 3ZSHA 5F1ZA 3TTIA 2W1HA 3GCSA 4G5JA 2X8DA 4AW0A 1ZOEA 4F6UA 3DKGA 2WTVA 4D2VA 2XEZA 2YIXA 4L7SA 4ZSEA 4BHNA 4ANBA 4C3FA 5J1WA 4G6OA 4EKKA 1A06A 5AP6A 3FC1X 3EN7A 3QTSA 1KSWA 3PZEA 4F9CA 3KREA 1JAMA 5K5XA 2J90A 4QP7A 4BWKA 3FQEA 5IQIA 4DH1A 4ALVA 3UNKA 5AIRA 3E62A 4IC7A 4QO9A 3FZOA 4FVRA 2O64A 2UZEA 3BHVA 3LFDA 3Q9ZA 4KIPA 4UYAA 4XNEA 3UMWA 4D4SA 4DG0E 4X3JA 2YJSA 3P08A 4M8TA 4KBKA 1O9UA 5CX9A 5DT4A 5BPYA 4UWBA 3UTOA 3WYYA 3L9NA 4UXQA 4AF3A 3MB6A 5L2WA 4ZLZA 2FSLX 3FLQA 4BI1A 4PV0A 4PMTA 2W17A 3VJNA 3Q52A 4HVSA 2IW6A 1KE7A 3DPKA 4Y72A 2VTIA 4BCFA 3TZMA 3RCJA 1RW8A 2YM4A 4OT6A 3C51A 4GJ3A 4MK0A 5DI1A 4FSTA 5CNNA 5M44A 5KX8A 5EH0A 1SVHA 3CXWA 4HYSA 4YZ9A 5CT7A 5C27A 4G3DA 4DA5A 2OW3A 1PJKA 4Q5HA 4MD8E 4ZEGA 3DDPA 2BRGA 4EOQA 5JK3A 4ZJJA 1CMKE 4CQEA 4P4CA 3W2PA 3TEIA 3LQ5A 2UVZA 5J95A 2EWAA 4RA5A 3ZOSA 4CYIA 1NVQA 4A9RA 2WU6A 2YAAA 4NYEA 2OJ9A 3HP2A 4XOYA 4U97A 2C5OA 1WFCA 4MAOA 4RC2A 5LVMA 3TKIA 3KRRA 3P7AA 4XEYA 5K5NA 2AUHA 2Y4PA 1OPLA 4HCVA 1BKXA 3QQLA 3C5IA 4BIDA 1U59A 4JR3A 4FUXA 5DLSA 4BIBA 2ZJWA 4N70A 3ZO4A 1OBDA 4BCOA 2JKOA 3ACJA 3R7GA 2B7AA 2IVVA 2W1EA 1H07A 4G16A 4IB5A 4BZDA 2X2MA 5B7VA 4EK8A 3GI3A 4M66A 3MGYA 2UZWE 2W1IA 2QCSA 5AV3A 4IB0A 3T9IA 4MXXA 3ZSIA 4A9YA 1J1CA 2WOTA 5AV1A 4ZJVA 1PXNA 4QMLA 1DI9A 4DFYA 3A62A 2ZDTA 3QX2A 1YI6A 3BKBA 5IUIA 2W1GA 3II5A 3ATTA 4EZ3A 1PXMA 5DA3A 5HCXA 5A4EA 4GKIA 4PMSA 2B9FA 4AWIA 4RFZA 4ASXA 5JFWA 4FKGA 3RGFA 3T3UA 4KS7A 2PE2A 3O71A 1J7UA 2P4IA 2R3HA 3KVWA 4CZUA 3R8VA 4MF1A 2OF2A 3KY2A 2A4LA 2P3GX 3DJ5A 2I0EA 2WELA 4RA4A 4RFYA 4O7WA 5A4CA 3D2KA 5BQ0A 4JDKA 5F9EA 2QO2A 3TDWA 5J1VA 3IOKA 2BTSA 3CD3A 1PXIA 3P7CA 4AZVA 3MDYA 4I3ZA 3PIXA 1GZ8A 4GW8A 3VF8A 3CGOA 4A7CA 3THBA 3ZRLA 4TXCA 2XBJA 4I6QA 2B9IA 2HENA 3MA3A 3FY2A 5KKRB 1OL6A 4YSMA 2GFCA 3UZTA 2GNIA 3TIZA 3EZVA 2VGPA 3EYHA 2J4ZA 2VWBA 4O21A 3EFKA 4XCUA 1WBNA 4RVKA 3R7OA 3TTJA 4AP7A 4ENYA 4ERKA 5AP7A 4R7IA 3TNQB 3FI8A 4J8NA 4YJQA 2XIRA 3R83A 3PJ2A 4BDEA 4PL4A 4FKPA 3T9TA 2NRUA 4RJ3A 2OIQA 4YU2A 4ANSA 4BI0A 5IEYA 4D4YA 4J52A 2W05A 3FKLA 3NUSA 3W10A 3FMHA 3QD4A 4OTGA 3RJCA 2XNGA 3RWQA 5DNRA 2A2AA 2BUJA 5AM7A 5L2TA 1STCE 4LUDA 4ZTHA 3FZSA 4FTQA 3AXWA 3TDVA 1VYZA 3WZEA 5CXZA 4O1OA 2W0JA 3RAWA 4DG2E 4G9RA 2QG5A 2HZIA 2VWYA 5AUYA 5LCJA 2J50A 3S4QA 3F7ZA 2YM3A 1GIHA 2ETKA 2ZVAA 3A4OX 3FHRA 4DHFA 4O0XA 4YPDA 2PVFA 4USDA 3LFEA 3IKAA 3NRMA 3PJCA 4LGDA 3CR0A 3V8SA 2VO6A 4U45A 1RDQE 4JI9A 4U6RA 3RNIA 4D28A 3SXSA 4A4LA 5CAOA 2ITQA 4AT5A 2RGPA 1P4OA 2BDFA 2CGXA 2FB8A 3PVUA 3R8PA 1OB3A 3KQ7A 3DXPA 3UC3A 3RZFA 3U4UA 1L8TA 3PUPA 4EHVA 5CAVA 3K3JA 4O7TA 3Q6WA 3V8WA 3F9NA 5EYKA 4M67A 3LPBA 3PXKA 3PXFA 2CKOA 3R6XA 1FVVA 2IWIA 2ONLA 3U54A 2FA2A 3W8QA 1QPJA 2XK3A 2BRMA 4AG8A 4EHGA 5IF1A 5J7HA 2OI4X 4AE9A 4KUJA 3OT8A 2BTRA 3TG1A 4DH5A 2BAKA 4EH8A 4EHEA 4GH2A 3WF7A 4AT4A 4EK6A 1ZYDA 3TI1A 2CGUA 2PHKA 4B4LA 4EONA 2OK1A 4IXPA 1JWHA 4TWCA 1M2RA 5CVHA 4YZCA 3SVVA 4FSUA 1YXVA 4FKVA 5LVLA 3C4CA 4FTLA 3ORKA 3U9CA 5K4JA 1UA2A 3KK9A 3LQ8A 4FTTA 2C5XA 4RVTA 1L3RE 3M2WA 3EQGA 4DAWA 5CENA 1Z5MA 4BBMA 4FEQA 5D10A 3TXOA 2WMTA 2YA9A 2WMXA 3V6RA 5EDQA 5JFVA 4RWLA 5EHLA 4ACDA 4MQ2A 2IVSA 3H4JA 2VWZA 3UGCA 3LVPA 4ASEA 3G6HA 4KSPA 3KN5A 5A46A 5IQGA 4GK2A 3GU5A 3HV6A 4X7QA 4CG8A 1CKIA 2X2LA 4NFMA 3R9HA 3U51A 4DGLC 3ZMMA 3BZ3A 4HZRA 4G3FA 4IAAA 3UVPA 3QQUA 3QL8A 4C59A 2JDRA 4ZTRA 2C1AA 2PVYA 1CM8A 3I7BA 3LOKA 5I3OA 3RK7A 3ZBFA 4ANNA 1PKGA 5AA9A 2BKKA 3C4XA 4K2RA 4YZDA 3VRYA 3UVRA 4AN9A 1A48A 3LE6A 3PG3A 4MCVA 5ETFA 4AZSA 3ITZA 1XHAA 4W4WA 4X0MA 2GTMA 4HW7A 3IDBA 2XJ1A 1QPDA 5C8MA 4A07A 1JKKA 4F7NA 3PSCA 1GZOA 5FDPA 3OHTA 4FC0A 4QOXA 1P14A 2VTPA 3COMA 5JEBA 5DR2A 3VF9A 2UZDA 3E93A 4UWCA 5HLPA 4FF8A 2J0MB 5CY3A 4QP3A 2I0VA 4C61A 2FSTX 4F7SA 3FL5A 2B4SB 5ANDA 3UYSA 3GC7A 4YZNA 3A4PA 2W1FA 2EB3A 3D15A 3ZDUA 3R02A 5AP0A 2XP2A 1M2PA 3RMFA 3DTCA 1F0QA 2ITUA 3DKFA 2GHGA 3NS9A 4IWDA 4QNYA 2PULA 3LMHA 4R1VA 5CU4A 4FNYA 3WZUA 3QC9A 4YO6A 4FUYA 4R3RA 2R3KA 4HCTA 5CSVA 3VIDA 2R3LA 3C50A 3IK3A 5HCZA 4LM5A 5L2QA 2JITA 4PTCA 1IA8A 4S2ZA 3PLAE 2VTOA 4QYFA 4DEGA 5EI6A 1Y6AA 2XEYA 3F82A 2XNMA 3HV4A 3NYOA 4WNOA 5K9IA 5L4QA 4U8ZA 3L8SA 4JX3A 3IW6A 4RIYA 2JIUA 5F4NA 3R7IA 4OUCA 4FTRA 4YJNA 5CSXA 4WHZA 5AFVA 4Y5HA 4YTCA 2C6IA 3O8TA 4YLJA 2X9EA 4B9DA 2ERZE 4U81A 2WTWA 1IRKA 3IPHA 3PZHA 2JDTA 2X81A 1H25A 2O2UA 3NW6A 4HJOA 4IX3A 4Z7HA 3HKOA 4L3PA 2W06A 2BCJA 4RC4A 4FKSA 4XG2A 3F2RA 3P4KA 5HBHA 2R64A 3SW7A 4KWPA 4RIXA 4PPCA 5HD4A 3RK5A 4N4SA 4BB4A 4FX3A 3ZEPA 4DGGA 1LEZA 2X6EA 3DU8A 3E92A 4M7IA 4A4OA 4QTAA 4YBJA 2ZV8A 2JKMA 4W4YA 3HV7A 3QQHA 3R8LA 3UPZA 1YXUA 2RFEA 2B55A 3U8WA 4DEDA 4IVCA 2HIWA 4IANA 3VUDA 2XNBA 2H8HA 3N9XA 4AGUA 1ZZLA 4LL5A 2VAGA 4FTCA 4WA9A 5CEQA 3TL8A 4DITA 3JVSA 4FKOA 4BHZA 4ZK5A 2ZDUA 3CLYA 3MI9A 3H9RA 1YKRA 3IDPA 5EW3A 2J5FA 4FOCA 4RIYB 3LM5A 3UQGA 3F6XA 2JFLA 2VTMA 4IWOA 1J7LA 5EYMA 1CDKA 4U41A 2QG7A 3W2SA 1OBGA 4FT3A 1ZYCA 4I0SA 2Y6MA 3G51A 4MD7E 3BWFA 4PMPA 5M51A 4IB1A 2GQSA 4UY9A 4U7ZA 4KA3A 4U80A 4YLKA 3ZO3A 3SXRA 2QU6A 2EUFB 3VW6A 4IJ9A 5IQBA 3R1YA 3QUDA 1MRUA 2CKPA 2OJGA 2ZV9A 4RIXB 3GNIB 1I09A 1VZOA 3OCSA 3WZKA 3JY9A 5AUUA 4FG9A 2XKDA 2XM9A 4E6AA 2JAVA 5HX8A 1H1QA 3S0OA 2R3MA 2FH9A 5BVKA 4BWXA 4AGDA 3ORZA 3EN5A 3SXFA 4DLJA 4QYYA 3QYWA 4AOIA 3QZIA 3EN4A 3QRKA 4ENXA 5A6OA 4E26A 4IM3A 4NKSA 4PL3A 3UODA 3ZUTA 3MY0A 3Q4TA 2BVAA 4TW9A 4BY9E 4R7HA 4YNEA 5HTCA 2ZOQA 3CJGA 5DWRA 2ERKA 3CGFA 3OUKA 2WGJA 4AE6A 4XH6A 4UN0C 1U4DA 2QKWB 4JAJA 4EH2A 2QOFA 2Z7LA 3OS3A 5GZ9A 4M14A 4XLVA 5D41A 4AGWA 4I21A 4FKIA 2HZ4A 3VBVA 1NY3A 2BIYA 3BGPA 3COHA 3GVUA 4A9UA 1OPJA 1XQZA 4PNIA 4XP2A 3W16A 5CU6A 5KBQA 3UQCA 3TUDA 1VR2A 1YVJA 1JLUE 5IPJA 3A7IA 4E4NA 3FWQA 3IOPA 5E92A 5HZNA 3FYKX 4PUZA 4KRDA 4HNIA 4Q9SA 3EQFA 5IQFA 5FXRA 3R9DA 2V55A 5EW8A 3UP7A 3NR9A 1X8BA 5CI6A 4J96A 4CV9A 1EH4A 3DLSA 4WIHA 1JKTA 3R9NA 1CKPA 1RQQA 3DB6A 1XR1A 3IS5A 2EXEA 5EQEA 2WTKC 3G6GA 2OF4A 2PUIA 4JXFA 1H8FA 3R63A 3F3VA 4NU1A 3IDCA 5AIKA 3Q96A 3NCGA 2JDSA 4FVPA 3RPOA 4AFJA 1K3AA 4YJTA 5AAGA 2PY3A 2YCFA 2ZM3A 2VO0A 3SLSA 4C4EA 1IAJA 2PPQA 4Y83A 3NIEA 4KNBA 3DBEA 4JL9A 2UV2A 4KRCA 3VQUA 4C37A 1PRYA 5EQPA 1Y8YA 4UEUA 5H9BA 4CRSA 4RG0A 3KXHA 1OZ1A 4DLIA 4E6QA 1UWHA 3FLWA 2PMOX 3KA0A 2XCKA 4N0SA 3RZBA 4CYJA 4C4FA 4TYHA 3MFSA 4F9BA 4GK3A 2OJIA 4X2KA 4AA4A 3I7CA 3NPCA 2CKEA 2IJMA 3MPMA 5CI7A 3VULA 4QMZA 1REJA 4TWPA 3EJ1A 4ZAUA 4MVFA 1G3NA 4B0GA 2WQNA 5CF4A 4DH3A 5AADA 2YIYA 3V5PA 4IIRA 3MH0A 3IQ7A 1FMOE 3ZDIA 4YJPA 3UDBA 2OBJA 4ZSGA 3UZPA 4FT0A 4ZSJA 4C3RA 3GB2A 3UIBA 4DGNA 5DBXA 4QD6A 5FGKA 5IZFA 2V62A 3I6WA 2YWPA 2CLQA 4WD5A 4BFMA 4LI5A 4EC8A 3DBQA 2ZAZA 4FYNA 3E8CA 2AYPA 5C9CA 3ZCLA 4CRLA 4F64A 3DLZA 4M3QA 1UVRA 3HVCA 3AG9A 3HA8A 2ZMCA 3Q60A 1Q97A 5DFPA 4J1RA 3QRUA 4TNDA 2WMWA 4USEA 1YW2A 4IACA 2VTHA 2IZRA 4MWIA 2ZB0A 2QOIA 3OF0A 3QTXA 4TYHB 5DG5A 3ZEWA 4GG5A 3P1AA 4EOJA 3KK8A 3JY0A 3FMNA 4RX9A 2PZIA 3FUPA 4F7JA 3TZ8A 2XVDA 3KRXA 3FHIA 5M55A 2W4OA 4J98A 1CKJA 1H4LA 2V7OA 4RIOA 2OKRA 3VO3A 4GG7A 5LMKA 5FP5A 2WB8A 1FVRA 3A2CA 3PG1A 3HA6A 5DR9A 4FEUA 2BFYA 2OG8A 4MF0A 4IDTA 5AR3A 3SX9A 3A7HA 3Q04A 4FK3A 2W5HA 5TT7A 3ZFMA 3L9LA 2VTSA 1ZY5A 2R3GA 3DZQA 4I5HA 5E1SA 5A3XA 5AX9A 1I44A 4JAIA 5CASA 3G33A 3Q2MA 3LFFA 2R7IA 1YOLA 2IVTA 5HG9A 4H39A 1Q24A 4FV3A 4ZXTA 3QF9A 2WZJA 4C3PA 3RBWA 5A4LA 4O81A 3VAPA 4EQMA 5I0BA 4FOBA 4HCUA 3WIKA 3VW8A 3PSDA 2UW4A 5GJFA 3V3VA 2VRXA 3F88A 4CQGA 3BPRA 1JPAA 5L3AA 4D0WA 2F7EE 2JDVA 4ZLOA 2HK5A 3R8UA 2QONA 3IO7A 5IH6A 1M52A 2JAMA 4HYHA 4IVAA 4YJOA 3VBXA 5LQFA 4AZFA 4WOVA 4ANOA 1YRPA 3LCOA 3R2BA 2WQEA 4ZY6A 3VC4A 3CPCA 3AT3A 4FBXA 3I1AA 4QP9A 4W8DA 2C3IB 4FV4A 5CTPA 3GGFA 3FMKA 1YI4A 2E9PA 4IZAA 4O0YA 3G5DA 3BYOA 4A9TA 3O8PA 4Y95A 4L68A 4ID7A 2WO6A 4PTGA 4ANQA 1SYKA 3O7LB 3P0MA 2W9FB 4AZWA 5HESA 4NW5A 4FR4A 5C4LA 3VUIA 2X39A 3DFAA 5HTIA 2F57A 5KCVA 4M12A 4NL0A 5AA8A 3R1NA 5HX6A 4ZTMA 5CEIA 3WF9A 2NRYA 3CC6A 4GV1A 5IA5A 2VTQA 3BU5A 3UIUA 1PKDA 1QL6A 2W1CA 1NVSA 3QRTA 1W8CA 2VWWA 4M68A 5FXQA 5HLNA 5JMSA 4IFCA 5C8KA 3SG9A 4M0ZA 5HE1A 2BRHA 2QOHA 1W0XC 2Y4IB 2F49A 5GIPE 2J6MA 4C62A 4LV8A 2R3QA 1OL1A 3R7UA 4QYEA 1V0BA 1WVXA 2X4FA 3DK6A 4HVHA 3GU6A 1XH6A 3UOHA 3QHWA 3PLSA 4RPVA 5L2SA 4FG7A 3VUGA 4RJ8A 1ATPE 4IM2A 4BL1A 2VX1A 4L8MA 4C58A 3EFLA 3F5GA 2GFSA 4AACA 4GCJA 5IA2A 2OXDA 2C68A 1SVEA 3EL8A 3ZLWA 3OMVA 4E8AA 3I5NA 4IMYA 4NZWB 4XMOA 5DVRA 1QMZA 1JBPE 3G9NA 3LXNA 5CZIA 3VS4A 3AT2A 1OL5A 3D0EA 3ZBXA 3EQRA 3FLZA 5FTQA 3ZLXA 2PUNA 3Q4UA 5D1JA 3GCUA 3TNWA 4BCIA 5ACBC 5AR7A 2GCDA 2C1BA 4H3QA 3WF6A 1BX6A 1ZXEA 4O22A 3QKLA 3QQFA 2W99B 2H9VA 4IC8A 4E20A 1GZNA 5G1XA 3UPXA 2UZLA 2QNJA 4LOPA 1HCLA 3QC4A 4ALWA 2GS6A 3MTFA 3P5KA 3PYYA 3PXYA 4O96A 5GHVA 4ANMA 5GIOE 4II5A 2VTAA 5HO6A 4PDSA 2WTCA 3QFVA 2C6DA 2UW3A 3OUNB 1VYWA 4DFNA 4X2FA 1SM2A 3QCXA 3UE4A 4CKJA 3NSZA 1H0VA 4MNEA 4ZY5A 3SD0A 2Z60A 3MW1A 5FXSA 4DGMA 4CZYB 5CU0A 3PRFA 2FO0A 2XRUA 4U3YA 4NK9A 1O6LA 5I9WA 3WARA 5H8GA 2ZV2A 5K0XA 2OIBA 2ZV7A 4PP9A 5AP4A 4H3PA 4H1JA 4BCKA 4PP7A 3ZXTA 2UW7A 3IW8A 4XP3A 4TWNA 4KB8A 5CEMA 1NT2A 2O0UA 3OC1A 2PZ5A 1R78A 1G8AA 4U5JA 1FMKA 4FTMA 4RVLA 2Z8CA 3D94A 4E6DA 3QWJA 4BGQA 3E87A 2J7TA 3IW4A 5I9VA 3ZYAA 4FT9A 4NCTC 2C5NA 4WKQA 3WBLA 2LGCA 2R0UA 4FGBA 2QD9A 2XKEA 5FQDC 3KKVA 3OEZA 1XBCA 4YP8A 4R77A 4F08A 3IGOA 2ZM4A 3H9OA 2FGIA 2WNTA 3U87A 4IM0A 4YHJA 5M53A 3Q9YA 4PRJA 2C6MA 1O6KA 4RZVA 4CZTA 3A7JA 4FYOA 1J3HA 3K5VA 3HMNA 1Y57A 1PMEA 4AN3A 4LRJA 3RINA 1BL7A 5DRBA 4KABA 3UIMA 1R1WA 3P86A 3BU3A 4YC3A 4DTAA 1TQIA 2O3PA 4A9SA 3PRIA 2BRNA 5IQCA 2JC6A 5E8UA 2CNVA 1YDTE 3KRJA 1E1VA 3HDMA 4BZOA 4MXZA 4D55A 3RALA 1OKVA 1OIUA 4BN1A 3B8RA 3L8XA 1CSNA 3ERKA 4GUEA 1M7NA 5AV4A 3LQ3A 2I40A 3W2QA 3QHRA 5D11A 3ORTA 3ZM4A 3ALOA 2GHMA 4J7BA 2E9NA 2JKKA 4FICA 3F3TA 3HDNA 2PZYA 4FSWA 3BCEA 2BIKB 5EM5A 3BRBA 4C0TA 4EOLA 4BCHA 3C1XA 4NM5A 1GJOA 5IUGA 4B99A 3R01A 3C4FA 2BDWA 2XJ0A 4GYIA 4XG6A 5HG7A 4HVGA 2G2HA 4D58A 2WU7A 3N51A 2E9UA 3R30A 2VWIA 3QD0A 3MH1A 4GSBA 3RPRA 3TKUA 3DA6A 3OWKA 4DFUA 4C2VA 4FTKA 2WXVA 4R3PA 3DKCA 1B39A 4RWIA 3VUTA 4FIIA 5CQUA 5KMKA 4IWQA 4FGRA 4P7EA 2FVDA 5JFSA 3DJ7A 5CU2A 4Y46A 3F5XA 1UKHA 4RIWA 5I5ZA 3MVLA 3GOPA 4ZZNA 3FLSA 5A54A 2W9ZB 2ITTA 3TZ9A 4G1WA 2WQBA 3O0GA 3P9JA 5J8IA 1H0WA 1V1KA 5HBEA 3RAKA 4GEOA 3PA5A 2XIXA 2NP8A 3MH2A 4L00A 4JLCA 4MHAA 3RAHA 2R3RA 5T68A 5HO7A 4CGAA 2FUMA 4MBJA 4C8BA 2PE1A 2QR8A 5CAUA 3V01A 2VTRA 2B54A 4EUTA 4FZDB 3H10A 2NO3A 3BBWA 5KMMA 1R3CA 5IEXA 4RWKA 1RJBA 5CXHA 4CMOA 3GFEA 3VN9A 1ZOHA 3ANRA 3OZ6A 4HGTA 4PY1A 4LGGA 4D5HA 3QA0A 1DAYA 5FWKK 4ZTLA 1OL2A 3TJDA 4BVUA 2PZRA 2CCHA 4RRVA 3W2OA 2XNEA 1JOWB 2XYUA 1YXXA 4DCEA 5KUPA 5IUHA 4IWPA 2C6EA 5AWMA 4I22A 4FV0A 3R73A 3C0GA 3WE8A 5I9XA 3MFUA 3MPAA 4K8AA 4ZS4A 5ANKA 4O7LA 3LFNA 3VS1A 5GJGA 3R8ZA 4L67A 5HVJA 2HOGA 4UBAA 2B53A 1M14A 3MJ2A 4E1ZA 2EXCX 3OVVA 3V5WA 3GEQA 2Q83A 4ITJA 2HXQA 4JBVA 4C57A 3GC9A 2CHLA 3SHEA 2YCQA 4MXAA 3L1SA 4WG3A 3EFWA 4AT3A 4YUQA 3N4UA 3MBLA 3R28A 5CSHA 4M13A 2WEVA 3AT4A 4GVAA 4GFGA 1OM1A 5DPVA 3S3IA 3AMYA 4FSNA 4V04A 5EG3A 5LCKA 4DFLA 4EKLA 4FI1A 3LFSA 4CD0A 3OCGA 1XKKA 3Q53A 3QD2B 3LCDA 4I0RA 4XX9A 1W83A 4FVQA 1Q3WA 2YIQA 4APPA 5BVNA 4I4EA 3EQCA 5ITAA 5EOLA 5LMBA 4QP1A 3LXLA 4E3CA 2RFNA 2C3KA 4HPTE 4IZYA 1TQPA 3MY1A 4WSQA 1LUFA 1YWRA 3UBDA 3W18A 4GT5A 4H3BA 2VTTA 1K2PA 5AR4A 3EKNA 4ZTQA 5TR6A 3MY5A 3R8MA 5AUWA 3UVQA 4UX9A 5GJDA 1KOBA 4BF2A 4IFGA 4QMPA 4HOKA 3AD4A 1Y91A 2HAKA 3CCNA 4FV7A 5HG8A 1YXTA 2Z7QA 3KMWA 5KHXA 1YWNA 1XH5A 3C7QA 3LCTA 3OD6X 3D5VA 5LWNA 4XJ0A 1PMNA 5I4NA 4ORKA 4JT3A 2CGWA 1FGKA 2OJJA 3MFTA 3FSKA 4PTEA 5KZIA 3O17A 1AQ1A 3KXGA 3AC1A 3Q4ZA 5HU9A 1H01A 2RL5A 4C35A 4FODA 4W9WA 1R0PA 4R5YA 1P4FA 3K54A 4BCJA 2WTKB 1UU9A 3ETAA 4CTBA 1J7IA 5CEOA 3HNGA 1UNLA 4UMTA 3KCKA 5FG8A 3SOCA 3V51A 1F3MC 4DEAA 4ITHA 3BHYA 3L8VA 4QTCA 5ANEA 4BDAA 4CKRA 4F6WA 2C4GA 3U4WA 3WZDA 5M06A 3UMXA 4XG7A 5GZ8A 4EHZA 1OVEA 4K77A 3PY0A 3FL4A 4GT4A 5CU3A 4G6LA 5L2IA 2PUPA 3OEFX 4L7FA 2GNJA 3PA4A 4BCMA 2OFVA 2P2HA 3VBWA 3MV5A 2KTYA 3PWYA 1NW1A 2VTLA 4ANLA 1MP8A 4PDPA 2QHNA 1H1RA 5HCYA 3UNZA 2QKRA 3SGCA 4DTKA 4EK5A 1MRVA 4ZS0A 3NDMA 4YC6A 4MKCA 4B6LA 4JBQA 4QP6A 3FLYA 3D5UA 5M07A 3F3ZA 2OWBA 4LV5A 4LMNA 5ANOA 4CCUA 3C0HA 3LKMA 4XG8A 2J51A 4S30A 5H8BA 4EOIA 5HO8A 2XH5A 3RTPA 2CLXA 5JQ5A 2WMAA 2F7ZE 3D7TA 3ODZX 4AZEA 3E5AA 2PK9A 3R2YA 3DGKA 3V5LA 3T3VA 3KRWA 5FLFA 4AX8A 3KB7A 5BYZA 3VBYA 1KV1A 4AW2A 3K5UA 2QODA 4F99A 1Q4LA 3QGWA 4IEBA 4LYNA 4QQJA 1SZMA 2E9OA 4G31A 2OZOA 5EKNA 3PXZA 4U9AA 5KMIA 2BZIB 3GC0A 4C4GA 4DE4A 2YIRA 2BROA 4FIGA 4BDJA 3WYXA 3DNDA 2BFXA 3F69A 4LRKA 3R9OA 3NLBA 4CT1A 2JLDA 2Z7RA 3QUEA 1SVGA 3E8DA 2QOKA 4B7TA 1OIRA 2I7QA 3OY3A 2YN8A 3FZPA 1Q5KA 2X6DA 4FK6A 5IG1A 1J91A 2WD1A 3PJ3A 1ZYLA 1KE9A 3R1QA 5M57A 2ZM1A 4RQKA 5M56A 4O0UA 4CLIA 5BYLA 3U9NA 4DYMA 5CYIA 1ZOGA 2E2BA 3D7TB 3MTLA 3BV2A 3KRLA 3PIZA 2GTNA 3QU0A 3OTUA 4I93A 3BLRA 5ETCA 2XS0A 2R0IA 5CF6A 5TO8A 3BHTA 2BZJA 2WHBA 1LEWA 1PHKA 5CS6A 4IHPA 3QCSA 4L01A 4BCPA 5IQEA 1OKYA 2XIYA 4MNFA 3CD8A 2PMLX 4I4FA 3GFWA 3GU7A 3AC5A 3F66A 3I81A 2WTJA 3ZLSA 4C34A 3FI3A 4Z55A 4IX6A 4O86A 2QR7A 3NMUF 1Q61A 3OWPA 5FTOA 2YDJA 3BHUA 3S00A 5CT0A 4OTIA 3DXNA 4Q5EA 4TPTA 2XM8A 4O2ZA 4AN2A 4KBCA 3B2WA 5DT3A 2DUVA 4PNKA 2XMYA 4BGHA 4O1PA 2QU5A 3BI6A 3GOKA 2IPXA 4OTPA 1Q99A 2UZTA 5J9LA 4EUUA 5AM6A 2YIWA 3ACKA 3DK7A 3V5JA 3NNXA 5KZ0A 2XK6A 3NGAA 3Q6UA 3JXWA 1JVPP 4WNPA 3ULZA 4AW5A 4EH9A 5LMAA 3MJ1A 2Q0BA 3HEGA 5F95A 3OW3A 1WVWA 4QQCA 2YJRA 4EOKA 5AP3A 4EZ5A 4RZWA 5C01A 3FV8A 3O51A 4JNWA 3CQWA 4IX4A 4M69A 4DBXA 2PVMA 3LXPA 3VS6A 4TTHB 4BCQA 1ZLTA 5HIBA 4XP0A 3TT0A 3FMDA 3ZONA 3UQFA 4XBUA 3NUAA 3WIGA 1H08A 1PMVA 3CKWA 3HUBA 2WMRA 5CZHA 4TKSA 3KMMA 3MVJA 3B2TA 2F7XE 1XJDA 3NW7A 5EW9A 5AUVA 4USFA 4JBOA 3BYMA 4YLLA 3DK3A 4FIHA 3COIA 5HIDA 4I24A 4R6VA 3PVGA 1ZY4A 1WAKA 1MQBA 3DV3A 5L6PA 4AU8A 2OSCA 3UG2A 4QMUA 2VV9A 4QMOA 3BEAA 4MQ1A 1MRYA 1YOMA 5L8KA 2XK7A 4EWQA 3QALE 5BMSA 5EKOA 4QTEA 5J9YA 1DS5A 3CP9A 3Q5IA 4BTKA 2RG6A 4KSQA 3KXNA 3UO6A 1FOTA 4L3JA 4YR8A 4BDDA 4QMSA 4FSRA 4MD9E 3ZZWA 3ZS5A 3PSBA 4M69B 4HVIA 4DG3E 4Q2AA 3GCPA 2ITWA 3QUPA 5LVNA 2KULA 2PMNX 4ZTNA 3NYNA 4PWNA 1FVTA 2QOQA 5AP2A 4BRXA 5EDPA 2B9JA 3QYZA 4LFIA 3OXTA 3DKOA 4QMMA 3GUBA 2QO9A 3K3IA 5EK7A 3W8LA 5JSMA 5DR6A 3I6UA 4NWMA 1M7QA 2Z2WA 3ENMA 4AXAA 1UWJA 4A06A 3MIYA 1ZWSA 5DYJA 1TKIA 5HG5A 2VU3A 2XF0A 3FZTA 4PX6A 4LQMA 3PWDA 5E8XA 4IW0A 2G9XA 5B0XA 3H9FA 5ANGA 2BZHB 4FKQA 4NKAA 3FLNC 3CSVA 1U46A 1WVYA 2XKCA 4EORA 2PVKA 3OXZA 4ZSLA 1AGWA 5CF8A 3JR1A 3DTWA 5K4IA 2J0LA 4QMTA 4YO4A 1LR4A 5HE3A 3CQEA 4F70A 5HI2A 1ZZ2A 1LPUA 4DN5A 5B2KA 3BLHA 3NNVA 5CSWA 3BELA 5AP1A 1IEPA 4JQ8A 1FGIA 4ZIMA 3QTZA 5E8YA 5KMOA 2WEIA 2C5YA 4WSYA 3SRVA 1IR3A 4X6RA 3AOXA 3EL7A 4HYIA 4DFBA 1OUYA 2C0OA 2ETMA 4GIIA 4ASZA 2BAQA 5AJQA 3BV3A 2ITOA 3W1FA 3VHKA 4FL3A 2CMWA 1KE8A 1T45A 5DEYA 4S34A 1AD5A 3ROYA 1W98A 4OTWA 3ULIA 4IJPA 3NUNA 3TNHA 2XNNA 5HORA 1H26A 2IN6A 3LHJA 4DEEA 3ZXZA 2J5EA 3HL7A 4I6HA 4F1TA 1K9AA 3RAIA 4YZBA 2JBPA 2JEDA 2QOBA 5DRDA 5JH6A 5IQDA 4MYGA 5C03A 4L44A 3R7EA 3D9VA 3I79A 3UO5A 5BVFA 3W32A 3G0FA 4R1YA 4F1OA 4O7ZA 3QLGA 3BIZA 4FTOA 3HMPA 3COKA 2EB2A 3QLFA 3ZTXA 4IZ7A 4U0IA 4EQCA 2I0YA 4BDIA 5FEQA 2G01A 2PWLA 2R3IA 4W8EA 4G3CA 1Y8GA 3BGZA 3KXMA 3ZU7A 1YHWA 3EKKA 5IKWA 4WUNA 4PL5A 4EZ7A 1WMKA 4ACGA 4F6SA 4FT5A 4O6LA 3WILA 3QTIA 3PXQA 1APME 2PVNA 3EFJA 1NVRA 5LVPA 4CFFA 3L9PA 3FQHA 3QKKA 4LGHA 4R78A 2ITPA 3AGLA 2PL0A 3MIAA 4C38A 5JFXA 4L9IA 3M42A 2BPMA 3LJ2A 5TF9A 5M4CA 3QA8A 2DYLA 4FZAB 4E93A 5CWZA 3DOGA 3RHXA 4XLIA 3ZFYA 3QZFA 3HMMA 4DH7A 5E1EA 2PMIA 3FZRA 4NM3A 2QO7A 3FKNA 3MWUA 2FSOX 4MXCA 4Y85A 2OLCA 2CGVA 3TKHA 3OP5A 5ICPA 4GKHA 2J0KA 3LJ1A 4GUBA 1JKSA 4BTFA 1UV5A 2PVRA 3VS5A 4ACCA 2WIPA 3QBNA 1WBVA 2GPHA 3OOMA 3UNJA 5EFQA 2JIIA 4KS8A 4JOAA 1XBBA 4KKGA 3ZSGA 4E5BA 4G17A 4M84A 1JQHA 3MB7A 1Q3DA 4I6BA 2X8EA 4EOOA 3EQHA 1Q8YA 4R3CA 4ERWA 2Z02A 5LWMA 5HNGA 2I0HA 3A7GA 3FXWA 3SAYA 4LOOA 4RQVA 4MXYA 4Q9ZA 3ZUUA 3LW0A 2O5KA 3TUCA 4J99A 4QTDA 2R3OA 2SRCA 1Q8UA 3G90X 4WRSA 3UJGA 4YSJA 4O7VA 3TUBA 2R9SA 4BDFA 4KAOA 3DB8A 3ZM9A 4IVDA 4CNHA 4QPMA 3W33A 3TCPA 1URWA 4JDJA 3S2PA 4I41A 4EH6A 1BMKA 2VWXA 3GU4A 3PY3A 2V5QA 3QRIA 4OBQA 4M97A 4RMZA 4XRLA 4XG3A 4J8MA 2YZAA 4I5MA 4D2PA 1H1PA 3R9RA 3PXRA 4G6NA 1YWVA 3LMGA 2W5AA 4S31A 3ORNA 3DBCA 4CKIA 4QMYA 4OBPA 5E8WA 3RP9A 2VO7A 1YHSA 3FZ1A 2WMQA 4RVMA 5DHJA 4H05A 4K6ZA 5HQ0A 3FBVA 4OAVB 4ITIA 2EXMA 4C4JA 5IH4A 2JKQA 1WZYA 2WPAA 2C3JA 4GL9A 4EBVA 2J0IA 1GY3A 3ODYX 4K1BA 2XB7A 1UU7A 3EYGA 1KE6A 4RSSA 2WMVA 5C1QB 3BE2A 3Q9WA 4EEVA 4HYUA 2PSQA 2WMUA 1YDSE 3AMBA 3Q32A 3RPYA 5BX0A 1GZKA 2VNYA 4QYHA 4WT6A 5IU2A 2YERA 4L45A 4Y8DA 5M4IA 3OWJA 1VEBA 2VD5A 2G1TA 2DQ7X 3R04A 4W9XA 4AGCA 4CXAA 3V5TA 4P90A 1IASA 3HRFA 3ZFXA 5J5TA 4OTHA 4AZTA 4XOZA 2XIKA 4BICA 4GFMA 4X2NA 4Z3VA 4QPSA 2OJFE 1O6YA 1U5QA 3R0TA 4UWYA 4BWPA 4RC3A 4F0GA 2OZAA 3KCFA 4UMPA 2V0DA 4U44A 4ASDA 3FQSA 5J79A 3FKOA 3TM0A 4BDGA 3QD3A 2CN5A 5EDRA 5DT0A 1PMUA 1ZYJA 3Q3BA 3FXXA 2HW7A 4C02A 5EHOA 4TL0A 3ORXA 4E5AX 5IMXA 3HLLA 5FM3A 5DGZA 4O7SA 3Q9XA 3N4VA 2C6KA 3C4ZA 1ERKA 4I92A 4U42A 2OXYA 5HU3A 3CTHA 3Q2JA 2BAJA 4LRMA 3FE3A 4BTMA 2CJMA 4N6ZA 4DC2A 1FQ1B 1UU3A 1P5EA 5CEPA 2OO8X 4UXLA 4P2KA 2GU8A 3D5WA 4D1ZA 4ZJIA 4KD1A 4LOQA 2JFMA 4FTNA 4O0VA 1Y6BA 5G6VA 1W7HA 2W7XA 3DT1A 4XV9A 4RJ6A 3HV3A 4ZMFA 2VNWA 4TY1A 3MYGA 3PPKA 5DEWA 3NUYA 2BHEA 4KINA 4YNOA 4PPBA 1U5RA 3A99A 4FV6A 3K2LA 4YBKA 3P7BA 4TNBA 4AW1A 2OZAB 4GS6A 1UNGA 4O91A 3UP2A 3GBZA 2QOCA 3LJ0A 5HE2A 1U54A 4XV1A 4BYIA 2ITXA 2CPKE 3W55A 4QYGA 5KMLA 2CNQA 2YHVA 2YITA 4TN6A 3MVHA 2QLQA 2YM6A 3AC4A 5AR2A 4BR3A 1R39A 2AC3A 2XRWA 3F2AA 3KEXA 3VJOA 3VS0A 1E9HA 4MNEB 4OLIA 4WBBB 4CFNA 4CCBA 4CFUA 3AGMA 3U6HA 2GS7A 3BQRA 5I9UA 3EN9A 5TOZA 5IH5A 2GHLA 4BDKA 5AV0A 2C30A 2OH4A 4LG4A 4WG4A 4PF4A 3MH3A 4NJDA 3R7VA 3QTQA 4GU6A 1V0PA 4TYGA 3LCSA 3RK9A 4FKWA 2UZOA 1FPUA 4I94A 1BLXA 3P23A 3TZ7A 3CTJA 5AMNA 2C47A 2JD5A 5AV2A 1TQMA 2XNPA 1U54B 4O0TA 4FNWA 2ITVA 3F3WA 3PPJA 4YURA 5I9ZA 5DOSA 4RX5A 4DBNA 4R8QA 3PVBA 3TV6A 4FEWA 5FD2A 1J1BA 3LXKA 2ACXA 4K18A 4NUSA 3UC4A 2C3LA 4EC9A 3BX5A 4BGGA 4UB7A 4NIFA 3UOKA 1OGUA 1JSVA 2VWVA 4RJ4A 5HE0A 2HXLA 4O0SA 3M1SA 2A19B 4D2SA 3LIJA 3AC8A 4K33A 4NTTA 2GQRA 2C69A 2H6DA 3A8WA 3BLQA 4RLKA 3NNUA 3UYTA 4DFXE 2CSNA 2ITZA 5HNBA 4YJVA 4F0IA 2YABA 4D4VA 3F7WA 5A4QA 4CFWA 4F65A 3U6JA 5AEPA 1ZYSA 4DT8A 4BBFA 4L6QA 4HGLA 1SMHA 2HWOA 3SC1A 3NX8A 4D1SA 5B2LA 5HIEA 2X4ZA 2IZUA 2Y8OA 4QT1A 3Q5ZA 2VO3A 5JQ8A 5DH3A 2BALA 1QPEA 2JGZA 4X6QC 2OGVA 5AAEA 2XZSA 3PDTA 1PXOA 3KF7A 4EH7A 4BBEA 2X1NA 5JZNA 3ID6C 3QQGA 3CY3A 4HZSA 3G9LX 4FSQA 2E9VA 4EK3A 3ELJA 3S1HA 4BZNA 2HZ0A 3BGQA 4O7YA 5IISA 1YHVA 4FSMA 1QCFA 5M09A 4CG9A 5IEVA 2W1DA 4IX5A 4UMQA 3WF8A 4HGSA 3PY1A 4NIFB 3FXZA 2RIOA 2CKQA 4FKUA 3D5XA 4FTAA 4TWOA 3KMUA 3HMOA 1FINA 3IW5A 3I60A 4FEVA 5EI8A 3RWPA 2C6LA 5DMZA 2VN9A 3LFAA 2W4JA 3HYHA 1ZRZA 1ZAOA 3QQJA 4QMWA 4G3GA 1Q8ZA 4RFMA 5HVYA 3REPA 5JGDA 2YFXA 5HBJA 1XH4A 3POZA 4BIEA 3CIKA 3DAJA 5E8TA 3CS9A 5CF5A 2DWBA 5LMKC 2A27A 2I6LA 5KHWA 3F3UA 3UIXA 2H96A 4C4IA 2CNUA 2NNWB 1ND4A 1H27A 4RIWB 2ITNA 3CE3A 3NNWA 4X3FC 3C9WA 3MVMA 3TNPC 4CTCA 2X8IA 4GK4A 3OG7A 3O96A 4IBMA 5A4TA 3WZJA 3DFCB 4OT5A 1TVOA 3ORLA 3PP0A 2WTDA 3TNIA 5IA1A 2YZLA 3C4EA 1WBWA 3DQXA 2HY0A 4LL0A 3HX4A 3ORMA 2OFUA 4JVGA 1ZARA 4AFEA 2VTNA 4C4HA 3OWLA 1ZMWA 3PVWA 4O0WA 5BVWA 1PXLA 3OTVA 3IGGA 4B8MA 3W2CA 2YWVA 1PXJA 3FMMA 2HYYA 5FBNC 3ZC6A 2Y4IC 2X7OA 3UG1A 1XH8A 3FI4A 4PDOA 5ETIA 4E7WA 4JX7A 4AOTA 4EL9A 4B8LA 4W4XA 4XV2A 5CNOA 4TZRA 5M4UA 2Y6OA 2QHMA 3D83A 3H0ZA 4C7TA 4QTBA 1OECA 4QP8A 2X9FA 2FSMX 4G34A 3FMEA 5EOBA 1G5SA 4ZP5A 4GRBA 4GU9A 2EVAA 2UZBA 5HHWA 5TE0A 4BC6A 4V05A 3BEGA 2YACA 2X0GA 2G15A 3ROCA 3L9MA 5AAFA 4CFMA 3VUMA 4D1XA 5BUJA 1H1WA 3A8XA 2R3FA 4PPAA 3QCQA 1OIYA 3ZLYA 4I5CA 2G2FA 3S95A 5CVGA 3AD6A 5K0KA 3RKBA 3NUXA 3V04A 2Q0NA 3LLAA 2RSVA 4F9WA 1ZMVA 4OGRA 2YM5A 4F9YA 3BHHA 4J95A 4M15A 1KOAA 4NEUA 3JVRA 3QRJA 4XRJA 4FL2A 4C2WA 2UW8A 4YJSA 2YAKA 3U55A 4AQCA 3F5UA 5EM7A 2FYSA 2B1PA 2DS1A 2UZVA 4Z9LA 4BKJA 4O2PA 2CCIA 4TYJA 2IZTA 2I1MA 4GIHA 4I5PA 3TJCA 3TV7A 3WF5A 4YTFA 3PA3A 5H8EA 4F1MA 4RWJA 5E4HA 1OIQA 4BKZA 3O2MA 4LMUA 3EB0A 1CTPE 3FDNA 1Z57A 4QMXA 4TYEA 2BHHA 3ZO1A 4F4PA 2PU8A 4EOMA 3FSFA 5D7AA 3NUUA 2XK8A 3R00A 3QXPA 4CFXA 2UVXA 3CEKA 2O8YA 4IE9A 4EQUA 3ZO2A 3O50A 4RLLA 4QP2A 4I20A 4D9UA 4DEHA 1H00A 3NW5A 5IQAA 5FTGA 1Q8WA 4HVDA 2GDOA 4G3EA 2XBAA 3EQIA 4FZ7A 4DT9A 3GQIA 5EM8A 5J87A 1Q41A 5EYCA 4DFZE 1FBNA 3H3CA 3EQPA 3OCTA 2BILB 3EWHA 3KN6A 3QTUA 3E7VA 4HNFA 4QQ5A 2WOUA 3I0OA 3BE9A 3EN6A 4FIFA 3VHEA 4JRNA 2IW8A 2F2UA 4EYJA 1QPCA 5KMJA 3QAME 1RE8A 1DM2A 5AUTA 5IQHA 4N6YA 2GMXA 2VWUA 2ZB1A 3DZOA 2VX0A 3OY1A 5FM2A 3AQVA 3NYXA 4BKYA 3QGYA 4C36A 4GYGA 3PIYA 4RGJA 3DDQA 4FT7A 4Z16A 3QXOA 4CVAA 2C0TA 4WNMA 5CAPA 1NA7A 4XV3A 3E3PA 3LFBA 4D0XA 3AMAA 1H24A 3DBDA 2O65A 3QWKA 4D2WA 3QX4A 4FKTA 3DJ6A 3C5UA 3IONA 4KKEA 3LFQA 4L3LA 3HUCA 2HY81 5L8JA 3VUKA 3HRBA 3NYVA 4QPAA 4CT2A 3U6IA 4E73A 3IW7A 3ALNA 2OU7A 4U3ZA 2QOOA 2QC6A 2W5BA 4MH7A 2R3PA 3EHAA 1URCA 2X7GA 4JRVA 3ATSA 4U43A 4YHTA 3B8QA 2GQGA 3V5QA 4QQTA 5J9ZA 2XIZA 3FPMA 2BZKB 4PDYA 3FC2A 4ZSAA 3CKXA 3BYSA 2HZNA 4D4RA 3F5PA 4JG8A 2J9MA 2GS2A 3BYVA 5LOHA 2RF9A 1M17A 5D12A 2HW6A 3D14A 2HELA 3ZHPC 4EBWA 2X7FA 4FV2A 5KE0A 1BI8A 1IA9A 4XBRA 3MFRA 5C26A 1HCKA 3PPZA 4H58A 1WCCA 4P5QA 2PVHA 5DE2A 4YMJA 3KULA 1A9UA 4S33A 5AP5A 4O38A 2VZ6A 4O83A 5IMEA 4IDVA 4K9YA 5C4KA 3NIZA 5JZJA 5BUIA 5FUTA
chains in the Genus database with same CATH superfamily
3G0EA 3M11A 4UMUA 2BKZA 2Y0AA 3EQBA 5IA3A 4IVBA 4JDHA 5BYYA 1UNHA 2WKMA 4M0YA 4EH3A 4QMNA 4YJRA 1XBAA 3ANQA 5A14A 1PYXA 2RFDA 3HAVA 3EH9A 3R22A 2XJ2A 2R2PA 2PVJA 4TRLA 4D2TA 3DS6A 4JJRA 4ARKA 5JT2A 3KL8A 2WAJA 3EZRA 3F61A 2C0IA 2ZYBA 3I4BA 3O8UA 3TIYA 4O82A 5EHYA 5TKDA 3ENHA 1H1SA 4EYMA 3HECA 3NZ0A 4FV5A 3LAUA 5KBRA 5T3QA 5LJJA 1GNGA 1YOJA 2RG5A 5BVDA 3KULB 5KNJA 4L46A 2BMCA 4OTFA 3VS2A 2UW0A 4V0GA 1UKIA 3JYAA 3FEGA 4UYNA 5JGAA 5HICA 5CALA 1LP4A 4DCAA 3D7ZA 3QQKA 2IW9A 5E9EA 4AXCA 4DF3A 3LZBA 4FZFB 4PMMA 4J97A 4PQNA 4CFVA 4XYFA 5KKRC 2RKUA 2OXXA 1PY5A 4WNKA 3UOLA 3R71A 4CMTA 4L53A 4ZY4A 2F4JA 4IB3A 4YPSA 3PFQA 3KC3A 4OTQA 2IG7A 4D9TA 3R21A 5EYDA 1YI3A 3G15A 4EI4A 4FMQA 4FV8A 2W1ZA 4FL1A 3PE1A 4FTIA 2J0JA 4GT3A 4BYJA 3DQWA 2R4BA 4J71A 3VQHA 4IAKA 2JDOA 2IO6A 2B9HA 3NVMB 4F9AA 2PYWA 3FJQE 3NAXA 3DBFA 4ACMA 4NM0A 3JS2A 4XUFA 5LVOA 5FEDA 4BTJA 2WMSA 3RPSA 5CVFA 2QOLA 4L52A 5LARA 4EWHA 3Q4CA 3E63A 2W96B 3A7FA 3BWJA 4V0GB 5CLPA 5JKGA 4GVJA 4E4LA 3HP5A 4AQKA 1KE5A 3LM0A 1E1XA 1WBPA 5E90A 3HAMA 1W82A 3A60A 1GIIA 4TT7A 2GSFA 2V7AA 2Y9QA 3IECA 1WBOA 3QTWA 4IAZA 4K11A 3SOAA 4NH1A 4JG7A 5I3RA 4MEDA 4MBLA 3AC3A 4AA5A 1IAHA 2YLEA 4FKLA 3V6SA 4FE2A 1XH9A 4IAIA 4EJ7A 2P0CA 3F2NA 4DINA 3GT8A 5FP6A 1P2AA 1W84A 3A61A 4NSTA 3SQQA 4ACHA 3E8EA 5IDNA 3G2FA 3UOJA 4Y5QA 2B52A 2YCRA 3KFAA 3SDJA 4ZTSA 2WQMA 3BBTB 5AR8A 4JBPA 4FIEA 4H36A 4NCTA 3LFCA 4KIKA 2O63A 4I1ZA 4KIOA 1XO2B 3AC2A 4U40A 2XK4A 2REIA 4DH8A 1S9IA 5KO1A 2C6TA 1YDRE 2CN8A 1OUKA 1PW2A 4FKJA 1SNXA 4FV9A 5T6KA 4BDBA 4CMUA 2ZMDA 4NJ3A 4RT7A 3R7YA 4O7NA 5EQYA 3NAYA 4FNXA 5HTBA 3BQCA 2J2IB 5L6OA 4FNZA 4O6EA 5HVKA 3CTQA 5E7RA 1PYEA 5E91A 5CSPA 2LAVA 3DY7A 5L8LA 4JDIA 1G8SA 4IAFA 5BVOA 2GNFA 4O0RA 1KUTA 3EQDA 5AR5A 3I5ZA 3CBLA 4FKRA 3VS7A 3P78A 4C33A 4JQ7A 2PTKA 3FAAA 4CV8A 3OT3A 5HOAA 4GFOA 5E8VA 5K3YA 1KV2A 4JG6A 2XNOA 5A9UA 2BRBA 2QVSE 3GU8A 5CAQA 1Q8TA 2QI8A 4WO5A 4NW6A 4KIKB 3VRZA 3W0PA 2OIDA 1JKLA 2P55A 3OW4A 1WBTA 5AUZA 2ONLC 3HGKA 2R3NA 2G2IA 2X2KA 2UW6A 3L8PA 4NFNA 3E3BX 4O27B 5F94A 3UZRA 3ORIA 5B2MA 4BI2A 3ZRMA 2XKFA 3C4WA 3GENA 4FSYA 3DCVA 4I0TA 4YGAA 3GXLA 2R7BA 4FG8A 2A1AB 4LUEA 5DIAA 3RVGA 3KF4A 3KGAA 5C8NA 4JR7A 5GZAA 4L43A 4QDVA 3ORPA 4D5KA 4IH8A 4YTIA 4XG4A 2C5VA 5DN3A 3SKCA 5BNJA 4O84A 4KIQA 1REKA 2PVLA 5ETAA 3SRVB 4IADA 4BDCA 3POOA 4YZMA 5BUEA 1M2QA 4X2JA 3CQUA 3OOGA 3KXZA 3PJ1A 3SV0A 3SA0A 1R0EA 3KU2A 3OCBA 5E8ZA 5JGBA 1PXPA 2YM8A 2VX3A 3C0IA 4FV1A 3FY0A 4FIJA 4V01A 5M4FA 3RHKA 1OKWA 1JNKA 3JUHA 5D9HA 3VS3A 3NVKI 1BYGA 5JRSA 4I6FA 2WMBA 3HZTA 1Z9XA 3NEWA 4WRGA 3SW4A 4ZZMA 4EJNA 4YJUA 5JRQA 5H3QA 5HGIA 2PZPA 1OL7A 1JSTA 2GNGA 2Y7JA 4DEIA 1OI9A 3RNYA 4MTAA 2WIHA 3HV5A 3QZHA 2BR1A 3P79A 1H28A 4L42A 2Z7SA 3TACA 4G5PA 4E4MA 4JQEA 4AUAA 4G2FA 3LCKA 4BCGA 2QLUA 4UALA 3IG7A 3OBGA 3NCZA 5F20A 4EH4A 2GNLA 1BUHA 3WI6A 4EOPA 4E4XA 3WOWA 4RX7A 3OBJA 4RBLA 2JIVA 4F09A 4F7LA 4OAUC 2W4KA 4WG5A 3TWJA 4IQ6A 3H30A 2XCHA 1BL6A 1IG1A 1PF8A 4ZLYA 2PE0A 4MXOA 4HGEA 4X2GA 1MUOA 1OITA 4UV0A 4E5WA 1XH7A 2ITYA 2AC5A 3E88A 2XA4A 1OKZA 4FTUA 5EI2A 3JPVA 4IZ5A 4X3FA 5IDPA 3MESA 4OBOA 3NUPA 4JIAA 5BVEA 2R5TA 3RM6A 3T8OA 4I23A 1GAGA 3H0YA 4U79A 2EU9A 4R5SA 4ZZOA 5J7BA 3BL9A 3BU6A 1HOWA 1XWSA 4OTDA 4EOSA 4OR5A 2X0OA 5AUXA 2UW9A 4OW8A 4AS0A 4DGOA 4Z7GA 1SNUA 4WBOA 4J53A 4AAAA 3AD5A 1B38A 3MN3A 4X21A 2IVUA 5E8SA 1ST0A 3MS9A 1YXSA 1Q62A 4GJ2A 5ANJA 4TYIA 3TV4A 3FI2A 3TN8A 3ZZEA 4CLJA 3D4QA 4YC8A 1DAWA 3E7OA 3HMIA 3O23A 3ZUVA 5EM6A 4QP4A 4R7BA 5M08A 2XYNA 3I0QA 2HCKA 4DEBA 4APCA 2WFYA 3FMLA 3QTRA 4UZDA 4OTRA 4BDHA 4ONAA 1YQJA 5HEZA 1S9JA 2OH0E 3FMJA 1PXKA 3PJ8A 3GQLA 2XK9A 2YEXA 5CQWA 4O7RA 4BCNA 4FSZA 2UZNA 4D2RA 1ZMUA 2QQ7A 4X3FB 3DAEA 3EOCA 1DI8A 2YISA 4NT4A 1JSUA 4CEGA 4RJ7A 3BYUA 3MSSA 4AA0A 3DXQA 4HPUE 3EMGA 5IA4A 3OROA 1F5QA 3CY2A 4XHKB 3GCQA 3PP1A 2H34A 4UZHA 3RI1A 2C6OA 2VTJA 4IAYA 3LMIA 2VGOA 3ZC5A 4N57A 1MQ4A 3QZGA 2OICA 3SG8A 2VUWA 2WQOA 1UU8A 3DNEA 4ZOGA 3RCDA 2AQXA 3V8TA 5IA0A 4P5ZA 2QURA 4F63A 5KMNA 2YM7A 4W4VA 5AX3A 4KKHA 4ALUA 5LXMA 2UZUE 5H2UA 4H1MA 3ZH8A 1KWPA 3LLTA 3NWWA 3VBTA 3RM7A 4YHFA 5JN2A 1BI7A 3GC8A 3QKMA 3VUHA 5FDXA 5BV3A 4XG9A 5HKMA 2ESMA 3OFMA 2F9GA 4XS2A 4YTHA 4ZMEA 4G9CA 3PE2A 3PTGA 4QMVA 5HD7A 4F0FA 4MBIA 5A6NA 3N4TA 5FRIA 2V22A 4CSVA 3C13A 3FYJX 4JIKA 3VWAA 3ZRKA 1NXKA 5D7VA 2JBOA 1T46A 3MA6A 3OXIA 3QCYA 5I9YA 4S32A 5FBOA 5BMMA 4NM7A 5GINE 2ETRA 3RPVA 2UVYA 5CANA 4NTSA 3EIDA 3O7LD 2RFSA 1GOLA 4JS8A 5ACKA 3VVHA 3GCVA 4FTJA 3MPTA 4FA2A 5FEEA 4WUAA 3WE4A 4MX9A 5HNIX 3VBQA 1VJYA 3CJFA 5HLWA 2P33A 5CEKA 2CDZA 3KVXA 2B0QA 1V0OA 4KBAA 3UO4A 1GIJA 2NPQA 3KXXA 4AOJA 2YCSA 2XUUA 3E8NA 4A4XA 4EK4A 4QRCA 2P2IA 3CPBA 2IZSA 1B6CB 4RX8A 3HRCA 3VONA 5L6WL 4FEXA 2BDJA 2F2CB 2UUEA 2YDKA 4QNAA 3ET7A 4DTBA 3FPQA 1WBSA 4MWHA 4UMRA 4EH5A 1OMWA 3DAKA 2PUUA 2WTIA 4GMYA 3VNTA 4E6CA 2A0CX 4Y73A 3E64A 4RJ5A 2R3JA 2YDIA 3GP0A 3R1SA 3W2RA 4K0YA 3D2IA 2HWPA 5J5SA 2UW5A 4QMQA 4FZ6A 5ANIA 2GNHA 5GNKA 1OPKA 2YLFA 3ZSHA 5F1ZA 3TTIA 2W1HA 3GCSA 4G5JA 2X8DA 4AW0A 1ZOEA 4F6UA 3DKGA 2WTVA 4D2VA 2XEZA 2YIXA 4L7SA 4ZSEA 4BHNA 4ANBA 4C3FA 5J1WA 4G6OA 4EKKA 1A06A 5AP6A 3FC1X 3EN7A 3QTSA 1KSWA 3PZEA 4F9CA 3KREA 3PFYA 1JAMA 5K5XA 2J90A 4QP7A 4BWKA 3FQEA 5IQIA 4DH1A 4ALVA 3UNKA 5AIRA 3E62A 4IC7A 4QO9A 3FZOA 4FVRA 2O64A 2UZEA 3BHVA 3LFDA 3Q9ZA 4KIPA 4UYAA 4XNEA 3UMWA 4D4SA 4DG0E 4X3JA 2YJSA 3P08A 4M8TA 4KBKA 1O9UA 5CX9A 5DT4A 5BPYA 4UWBA 3UTOA 3WYYA 3L9NA 4UXQA 4AF3A 3MB6A 5L2WA 4ZLZA 2FSLX 3FLQA 4BI1A 4PV0A 4PMTA 2W17A 3VJNA 3Q52A 4HVSA 2IW6A 1KE7A 3DPKA 4Y72A 2VTIA 4BCFA 3TZMA 3RCJA 1RW8A 2YM4A 4OT6A 3C51A 4GJ3A 4MK0A 3W0RA 5DI1A 4FSTA 5CNNA 5M44A 5KX8A 5EH0A 1SVHA 3CXWA 4HYSA 4YZ9A 5CT7A 5C27A 4G3DA 4DA5A 2OW3A 1PJKA 4Q5HA 4MD8E 4ZEGA 3DDPA 2BRGA 4EOQA 5JK3A 4ZJJA 1CMKE 4CQEA 4P4CA 3W2PA 3TEIA 3LQ5A 2UVZA 5J95A 2EWAA 4RA5A 3ZOSA 4CYIA 1NVQA 4A9RA 2WU6A 2YAAA 4NYEA 2OJ9A 3HP2A 4XOYA 4U97A 2C5OA 1WFCA 4MAOA 4RC2A 5LVMA 3TKIA 3KRRA 3P7AA 4XEYA 5K5NA 2AUHA 2Y4PA 1OPLA 4HCVA 1BKXA 3QQLA 3C5IA 4BIDA 1U59A 4JR3A 4FUXA 5DLSA 4BIBA 2ZJWA 4N70A 3ZO4A 1OBDA 4BCOA 2JKOA 3ACJA 3R7GA 2B7AA 2IVVA 2W1EA 1H07A 4G16A 4IB5A 4BZDA 2X2MA 5B7VA 4EK8A 3GI3A 4M66A 3MGYA 2UZWE 2W1IA 2QCSA 5AV3A 4IB0A 3T9IA 4MXXA 3ZSIA 4A9YA 1J1CA 1XMLA 2WOTA 5AV1A 4ZJVA 1PXNA 4QMLA 1DI9A 4DFYA 3A62A 2ZDTA 3QX2A 1YI6A 3TMOA 3BKBA 5IUIA 2W1GA 3II5A 3ATTA 4EZ3A 1PXMA 5DA3A 5HCXA 5A4EA 2XALA 4GKIA 4O4CA 4PMSA 2B9FA 4AWIA 4RFZA 4ASXA 5JFWA 4FKGA 3RGFA 3T3UA 4KS7A 2PE2A 3O71A 1J7UA 2P4IA 2R3HA 3KVWA 4CZUA 3R8VA 4MF1A 2OF2A 3KY2A 2A4LA 2P3GX 3DJ5A 2I0EA 2WELA 4RA4A 4RFYA 4O7WA 5A4CA 3D2KA 5BQ0A 4JDKA 5F9EA 2QO2A 3TDWA 5J1VA 3IOKA 2BTSA 3CD3A 1PXIA 3P7CA 4AZVA 3MDYA 4I3ZA 3PIXA 1GZ8A 4GW8A 3VF8A 4QDEA 3CGOA 4A7CA 3THBA 3ZRLA 4TXCA 2XBJA 4I6QA 2B9IA 2HENA 3MA3A 3FY2A 5KKRB 1OL6A 4YSMA 2GFCA 3UZTA 2GNIA 3TIZA 3EZVA 2VGPA 3EYHA 2J4ZA 2VWBA 4O21A 3EFKA 4XCUA 1WBNA 4RVKA 3R7OA 3TTJA 4AP7A 4ENYA 4ERKA 5AP7A 4R7IA 3TNQB 3FI8A 4J8NA 4YJQA 2XIRA 3R83A 3PJ2A 4BDEA 4PL4A 4FKPA 3T9TA 2NRUA 4RJ3A 2OIQA 4YU2A 4ANSA 4BI0A 5IEYA 4D4YA 4J52A 2W05A 3FKLA 3NUSA 3W10A 3FMHA 3QD4A 4OTGA 3RJCA 2XNGA 3RWQA 5DNRA 2A2AA 2BUJA 5AM7A 5L2TA 1STCE 4LUDA 4ZTHA 3FZSA 4FTQA 3AXWA 3TDVA 1VYZA 3WZEA 5CXZA 4O1OA 2W0JA 3RAWA 4DG2E 4G9RA 2QG5A 2HZIA 2VWYA 5AUYA 5LCJA 2J50A 3S4QA 3F7ZA 2YM3A 1GIHA 2ETKA 2ZVAA 3A4OX 3FHRA 4DHFA 4O0XA 4YPDA 2PVFA 4USDA 3LFEA 3IKAA 3NRMA 3PJCA 4LGDA 4AXDA 3CR0A 3V8SA 2VO6A 4U45A 1RDQE 4JI9A 4U6RA 3RNIA 4D28A 3SXSA 4A4LA 5CAOA 2ITQA 4AT5A 2RGPA 1P4OA 2BDFA 2CGXA 2FB8A 3PVUA 3R8PA 1OB3A 3KQ7A 3DXPA 3UC3A 3RZFA 3U4UA 1L8TA 3PUPA 4EHVA 5CAVA 3K3JA 4O7TA 3Q6WA 3V8WA 3F9NA 5EYKA 2XARA 4M67A 3LPBA 3PXKA 3PXFA 2CKOA 3R6XA 1FVVA 2IWIA 2ONLA 3U54A 2FA2A 3W8QA 1QPJA 2XK3A 2BRMA 4AG8A 4EHGA 5IF1A 5J7HA 2OI4X 4AE9A 4KUJA 3OT8A 2BTRA 3TG1A 4DH5A 2BAKA 4EH8A 4EHEA 4GH2A 3WF7A 4AT4A 4EK6A 1ZYDA 3TI1A 2CGUA 2PHKA 4B4LA 4EONA 2OK1A 4IXPA 1JWHA 4TWCA 1M2RA 5CVHA 4YZCA 3SVVA 4FSUA 1YXVA 4FKVA 5LVLA 3C4CA 3TYKA 4FTLA 3ORKA 3U9CA 5K4JA 1UA2A 3KK9A 3LQ8A 4FTTA 2C5XA 4AAYA 4RVTA 1L3RE 3M2WA 3EQGA 4DAWA 5CENA 1Z5MA 4F78A 4BBMA 4FEQA 5D10A 3TXOA 2WMTA 2YA9A 2WMXA 3V6RA 5EDQA 5JFVA 2X0PA 4RWLA 5EHLA 4ACDA 4MQ2A 2IVSA 3H4JA 2VWZA 3UGCA 3LVPA 4ASEA 3G6HA 4KSPA 3KN5A 5A46A 5IQGA 4GK2A 3GU5A 3HV6A 4X7QA 4CG8A 1CKIA 2X2LA 4NFMA 3R9HA 3U51A 4DGLC 1W2CA 3ZMMA 3BZ3A 4HZRA 4G3FA 4IAAA 3UVPA 3QQUA 3QL8A 4C59A 2JDRA 4ZTRA 2C1AA 2PVYA 1CM8A 3I7BA 3LOKA 5I3OA 3RK7A 3ZBFA 4ANNA 1PKGA 5AA9A 2BKKA 3C4XA 4K2RA 4YZDA 3VRYA 3UVRA 4AN9A 1A48A 3LE6A 3PG3A 4MCVA 5ETFA 4AZSA 3ITZA 1XHAA 4W4WA 4X0MA 2GTMA 4HW7A 3IDBA 2XJ1A 1QPDA 5C8MA 4A07A 1JKKA 4F7NA 3PSCA 1GZOA 5FDPA 3OHTA 4FC0A 4QOXA 1P14A 2VTPA 3COMA 5JEBA 3BL7A 5DR2A 3VF9A 2UZDA 3P5JC 3E93A 4UWCA 5HLPA 4FF8A 2J0MB 5CY3A 4QP3A 2I0VA 4C61A 2FSTX 4F7SA 3FL5A 2B4SB 5ANDA 3UYSA 3GC7A 4YZNA 3A4PA 2W1FA 2EB3A 3D15A 3ZDUA 3R02A 5AP0A 2XP2A 1M2PA 3RMFA 3DTCA 1F0QA 2ITUA 3DKFA 2GHGA 3NS9A 4IWDA 4QNYA 2PULA 3LMHA 4R1VA 5CU4A 4FNYA 3WZUA 3QC9A 4YO6A 4FUYA 4R3RA 2R3KA 4HCTA 5CSVA 3VIDA 2R3LA 3C50A 3IK3A 5HCZA 4LM5A 5L2QA 2JITA 4PTCA 1IA8A 4S2ZA 3PLAE 2VTOA 4QYFA 4DEGA 5EI6A 1Y6AA 2XEYA 3F82A 2XNMA 3HV4A 3NYOA 4WNOA 5K9IA 5L4QA 4U8ZA 3L8SA 4JX3A 3IW6A 4RIYA 2JIUA 5F4NA 3R7IA 4OUCA 4FTRA 4YJNA 5CSXA 4WHZA 5AFVA 4Y5HA 4YTCA 2C6IA 3O8TA 4YLJA 2X9EA 4B9DA 2ERZE 4U81A 2WTWA 1IRKA 3IPHA 3PZHA 2JDTA 2X81A 1H25A 2O2UA 3NW6A 4HJOA 4IX3A 4Z7HA 3HKOA 4L3PA 2W06A 2BCJA 4RC4A 4FKSA 4XG2A 3F2RA 3P4KA 5HBHA 2R64A 3KIOC 3W0QA 3SW7A 4KWPA 4RIXA 4PPCA 5HD4A 3RK5A 4N4SA 4BB4A 4FX3A 3ZEPA 4DGGA 1LEZA 2X6EA 3DU8A 3E92A 4M7IA 4A4OA 4QTAA 4YBJA 2ZV8A 2JKMA 4W4YA 3HV7A 3QQHA 3R8LA 3UPZA 1YXUA 2RFEA 2B55A 3U8WA 4DEDA 4IVCA 2HIWA 4IANA 3VUDA 2XNBA 2H8HA 3N9XA 4AGUA 1ZZLA 4LL5A 2VAGA 4FTCA 4WA9A 5CEQA 3TL8A 4DITA 3JVSA 4FKOA 4BHZA 4ZK5A 2ZDUA 3CLYA 3MI9A 3H9RA 1YKRA 3IDPA 5EW3A 2J5FA 4FOCA 4RIYB 3LM5A 3UQGA 3F6XA 2JFLA 2VTMA 4IWOA 1J7LA 5EYMA 1CDKA 4U41A 2QG7A 3W2SA 1OBGA 4FT3A 1ZYCA 4I0SA 2Y6MA 3G51A 4MD7E 3BWFA 4PMPA 5M51A 4IB1A 2GQSA 4UY9A 4U7ZA 4KA3A 4U80A 4YLKA 3ZO3A 3SXRA 2QU6A 2EUFB 3VW6A 4IJ9A 5IQBA 3R1YA 3QUDA 1MRUA 2CKPA 2OJGA 2ZV9A 4RIXB 3GNIB 1I09A 1VZOA 3OCSA 3WZKA 3JY9A 5AUUA 4FG9A 2XKDA 2XM9A 4E6AA 2JAVA 5HX8A 1H1QA 3S0OA 2R3MA 2FH9A 5BVKA 4BWXA 4AGDA 3ORZA 3EN5A 3SXFA 4DLJA 4QYYA 3QYWA 4AOIA 3QZIA 3BLAA 3EN4A 3QRKA 4ENXA 5A6OA 4E26A 4IM3A 4NKSA 4PL3A 3UODA 3ZUTA 3MY0A 3Q4TA 2BVAA 4TW9A 4BY9E 4R7HA 4YNEA 5HTCA 2ZOQA 3CJGA 5DWRA 2ERKA 3CGFA 3OUKA 2WGJA 4AE6A 4XH6A 4UN0C 1U4DA 2QKWB 4JAJA 4EH2A 2QOFA 2Z7LA 4BJJA 3OS3A 5GZ9A 4M14A 4XLVA 5D41A 4AGWA 4I21A 4FKIA 2HZ4A 3VBVA 1NY3A 2BIYA 3BGPA 3COHA 3GVUA 4A9UA 1OPJA 1XQZA 4PNIA 4XP2A 3W16A 5CU6A 5KBQA 3UQCA 3W0OA 3TUDA 1VR2A 1YVJA 1JLUE 5IPJA 3A7IA 1TFFA 4E4NA 1VLRA 3FWQA 3IOPA 5E92A 5HZNA 4DHJA 3FYKX 4PUZA 4FJVA 4KRDA 4HNIA 4Q9SA 3EQFA 4LDTA 5IQFA 5FXRA 3R9DA 2V55A 5EW8A 3UP7A 3NR9A 1X8BA 5CI6A 4J96A 4CV9A 1EH4A 3DLSA 4WIHA 1JKTA 3R9NA 1CKPA 1RQQA 3DB6A 1XR1A 3IS5A 2EXEA 3AKJA 5EQEA 2WTKC 3G6GA 2OF4A 2PUIA 4JXFA 1H8FA 3R63A 3F3VA 4NU1A 2XAOA 1W2DA 3IDCA 5AIKA 3Q96A 3NCGA 2JDSA 4FVPA 2IF8A 3RPOA 4AFJA 1K3AA 4YJTA 5AAGA 2PY3A 2YCFA 2ZM3A 2VO0A 3SLSA 3ML1A 4C4EA 1IAJA 2PPQA 4Y83A 3NIEA 4KNBA 3DBEA 4JL9A 2UV2A 4KRCA 3VQUA 4C37A 1PRYA 5EQPA 1Y8YA 4UEUA 5H9BA 4CRSA 4RG0A 3KXHA 1OZ1A 4DLIA 4E6QA 1UWHA 3FLWA 2PMOX 3KA0A 2XCKA 4N0SA 3RZBA 4CYJA 4C4FA 4TYHA 3MFSA 4F9BA 4GK3A 2OJIA 4X2KA 4AA4A 3I7CA 3NPCA 2CKEA 2IJMA 3MPMA 5CI7A 3VULA 4QMZA 1REJA 4TWPA 3EJ1A 4ZAUA 4MVFA 1G3NA 4B0GA 2WQNA 5CF4A 4DH3A 5AADA 2YIYA 3V5PA 4IIRA 3MH0A 3IQ7A 1FMOE 3ZDIA 4YJPA 3UDBA 2OBJA 4ZSGA 3UZPA 4FT0A 4ZSJA 4C3RA 3GB2A 3UIBA 4DGNA 5DBXA 4QD6A 5FGKA 5IZFA 2V62A 3I6WA 2YWPA 2CLQA 4WD5A 4BFMA 4LI5A 4EC8A 3DBQA 2ZAZA 4FYNA 3E8CA 2AYPA 5C9CA 3ZCLA 4CRLA 4F64A 3DLZA 4M3QA 1UVRA 3HVCA 3AG9A 3HA8A 2ZMCA 3Q60A 1Q97A 5DFPA 4J1RA 3QRUA 4TNDA 2WMWA 4USEA 1YW2A 4IACA 2VTHA 2IZRA 4MWIA 2ZB0A 2QOIA 3OF0A 3QTXA 4TYHB 5DG5A 3ZEWA 4GG5A 3P1AA 4EOJA 3KK8A 3JY0A 3FMNA 4RX9A 2PZIA 3FUPA 4F7JA 3TZ8A 2XVDA 3KRXA 3FHIA 5M55A 2W4OA 4J98A 1CKJA 1H4LA 2V7OA 4RIOA 2OKRA 3VO3A 4GG7A 5LMKA 5FP5A 2WB8A 1FVRA 3A2CA 3PG1A 3HA6A 5DR9A 4FEUA 2BFYA 2OG8A 4MF0A 4IDTA 5AR3A 3SX9A 3A7HA 3Q04A 4FK3A 2W5HA 5TT7A 3ZFMA 3L9LA 2VTSA 1ZY5A 2R3GA 3DZQA 4I5HA 5E1SA 5A3XA 5AX9A 1I44A 4JAIA 5CASA 3G33A 3Q2MA 3LFFA 2R7IA 1YOLA 2IVTA 5HG9A 4H39A 1Q24A 4FV3A 4ZXTA 3QF9A 2WZJA 4C3PA 3RBWA 5A4LA 4O81A 3VAPA 4EQMA 5I0BA 4FOBA 4HCUA 3WIKA 3VW8A 3PSDA 2UW4A 5GJFA 3V3VA 2VRXA 3F88A 4CQGA 3BPRA 1JPAA 5L3AA 4D0WA 2F7EE 2JDVA 4ZLOA 2HK5A 3R8UA 2QONA 3IO7A 5IH6A 1M52A 2JAMA 4HYHA 4IVAA 4YJOA 3VBXA 5LQFA 4AZFA 4WOVA 4ANOA 1YRPA 3LCOA 3R2BA 2WQEA 4ZY6A 3VC4A 3CPCA 3AT3A 4FBXA 3I1AA 4QP9A 4W8DA 2C3IB 4FV4A 5CTPA 3GGFA 3FMKA 1YI4A 2E9PA 4IZAA 4O0YA 3G5DA 3BYOA 4A9TA 3O8PA 4Y95A 4L68A 4ID7A 2WO6A 4PTGA 4ANQA 1SYKA 3O7LB 3P0MA 2W9FB 4AZWA 5HESA 4NW5A 4FR4A 5C4LA 3VUIA 2X39A 3DFAA 5HTIA 2F57A 5KCVA 4M12A 4NL0A 5AA8A 3R1NA 5HX6A 4ZTMA 5CEIA 3WF9A 2NRYA 3CC6A 4GV1A 5IA5A 2VTQA 3BU5A 3UIUA 1PKDA 1QL6A 2W1CA 1NVSA 3QRTA 1W8CA 2VWWA 4M68A 5FXQA 5HLNA 5JMSA 4IFCA 2A98A 5C8KA 3SG9A 4M0ZA 5HE1A 2BRHA 2QOHA 1W0XC 2Y4IB 2F49A 5GIPE 2J6MA 4C62A 4LV8A 2R3QA 1OL1A 3R7UA 4QYEA 1V0BA 1WVXA 2X4FA 3DK6A 4HVHA 3GU6A 1XH6A 3UOHA 3QHWA 3PLSA 4RPVA 5L2SA 4FG7A 3VUGA 4RJ8A 1ATPE 4IM2A 4BL1A 2VX1A 4L8MA 4C58A 3EFLA 3F5GA 2GFSA 4AACA 4GCJA 5IA2A 2OXDA 2C68A 1SVEA 3EL8A 3ZLWA 3OMVA 4E8AA 3I5NA 4IMYA 4NZWB 4XMOA 5DVRA 1QMZA 1JBPE 3G9NA 3LXNA 5CZIA 3VS4A 3AT2A 1OL5A 3D0EA 3ZBXA 3EQRA 3FLZA 5FTQA 3ZLXA 2PUNA 3Q4UA 5D1JA 3GCUA 3TNWA 4BCIA 5ACBC 5AR7A 4AXEA