3ROGA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine 3'-monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 72
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rogA00
3RRFA 1JZTA 3RSQA 3RSGA 3RTCA 3RTAA 3RU2A 3RTDA 3RT9A 3RS8A 3RT7A 3RNOA 3RSSA 3ROEA 3RTBA 3K5WA 3RREA 3RRBA 3RTGA 3ROXA 3RTEA 3ROGA 2O8NA 3RO7A 3RRJA 2DG2A 3RU3A 3D3KA 2AX3A 3RS9A 3D3JA 3RSFA 3ROZA
chains in the Genus database with same CATH superfamily
1DAGA 2JHPA 2K2QB 3VNRA 3SEFA 1WG8A 3PQ5A 4D81A 1NBAA 3RTCA 1HDXA 2AMVA 1QPGA 3T7CA 2AJBA 3MERA 5DM0A 1E8MA 1T3ZA 2EKDA 2HA5A 5IBRA 2J3JA 4CNBA 1J20A 2A1TS 2IPLA 3DE7X 5KQMA 2D3TA 2J48A 4JD5A 2AN3A 1QGUB 5JJLA 1AKEA 1BXGA 2QRGA 3BFPA 3BRSA 3NWOA 5DGXA 1IY8A 1C1DA 4YRCA 1OW3B 1RAIA 2HBYA 3PP8A 2PZJA 4DHEA 2I7CA 3LDGA 2YVAA 4KIWA 3VNUA 4CKWA 4KO8A 4DQLA 1JR6A 2G1UA 1GEGA 3RVQA 1W6RA 3O38A 4HGOA 2YIDA 2VI5A 3WYBA 2A1UA 2V55B 3RT9A 2DJIA 1GUBA 2YYYA 4IJQA 5FI5A 3TLXA 4DLKA 1KWGA 4E51A 2VUHB 4XQ9A 4KFSA 1KQ3A 1HV8A 2FYTA 2QNBA 3LNTA 1D5WA 2BI8A 4MI3A 2FSHA 4OJTA 1SKQA 2QTZA 4AJNA 3NI2A 1GSOA 2JAPA 1NV9A 2ZU6A 5I51A 4MRMB 3O93A 5CA0F 5IABA 5HHTA 4I55F 3CLVA 2ENWA 4CCWA 4KV9A 3QMWA 1N2GA 3PEFA 1P5HA 3OZEA 1U7PA 5TT1A 1AF7A 3CUKA 4E4RA 2A0FA 2VOJA 1Q0UA 4TUYF 3FKJA 2HXYA 4KUHA 4CI0B 5IANA 2JC3A 2AKAB 1PSWA 3C8DA 3KO8A 1E3WA 4OGKA 2IHZA 2JI7A 1RPZA 2PWYA 1G6OA 1CTQA 2R8OA 1XCPA 4J03A 4OG2A 1KOLA 5BW4A 4DLSA 1FTWA 1NPYA 1VIDA 1YULA 2C99A 2GBIA 2W7TA 4H08A 4PN3A 1J33A 4CDMA 2RK4A 2HU8A 1AKUA 3GYGA 3UMJA 3KCNA 2FY8A 3G2QA 4GOOD 4YIHA 1I4OA 1IEQA 4BB9A 3E15A 1CT9A 3M4NA 2BN4A 4X8MA 1SVKA 2F90A 3I1IA 4QAQA 4B2YA 3RADC 1LQTA 2W37A 4ON9A 1EFUA 4OQYA 1EAMA 3DE2X 2JH3A 3G0BA 3JWIA 3PYLA 2MYUA 5KNCA 2NSJA 1CNEA 1EFRA 2UUBB 1LU9A 5D3QA 3ILHA 1NLUA 4S05A 1GD1O 1H5NA 3UB2A 1EXMA 4AFNA 1PD0A 2CYBA 2O8FB 3G85A 1R0ZA 1XPJA 1GLNA 2PZAA 3DOEA 1MLDA 4X20A 5JAOA 4QEKA 3QLUC 7ADHA 4QFCA 2HQSA 4UQPA 4DLBA 1SCKA 2VQSA 3AZQA 1ZVJA 1VG8A 3DH0A 4GGPA 4IBOA 3O1HB 4J6FA 4CLHA 1PTJA 5A3QA 4UXJA 1LQ2A 2JHAA 4HMOA 4NI5A 4YJ3B 3KXPA 1FK8A 1LY1A 2RIRA 2ZRQA 5BNTA 3CPJB 2WMOB 3RC3A 1S7GA 4YRNA 1VRVA 1QFSA 1NBIA 2HMVA 5ERYA 1DC5A 2H1VA 4ZI2A 4N5DA 4CLOB 2LZ0A 3CEJA 4YH1A 1TW3A 4QBTA 2LWIA 4Q37A 3WAJA 1A8UA 5CTJA 3BJMA 4HYTA 3A10A 3UJBA 1W35A 2EF0A 2AWNA 1K63A 4GW3A 4ROSA 4B6FA 4EHAA 4WI1A 1F12A 1VQ1A 1CK4A 4UHDA 3THYB 1Y33E 1C9DB 3AVWA 4E30A 4CG2A 4BEVA 1ZW6A 1K97A 1I2ZA 3C7TA 2NZXA 4K9OA 3TBKA 4F86A 4OJQA 4ZDIA 2IZ7A 3RRZA 3ZE7A 5U9CA 3R6TA 2EGHA 5LZ5A 2HWYA 1JJVA 3PUVA 1EG7A 4TYQA 3IEPA 5AJZA 2NO5A 2PKRA 3I2IA 4BV8A 3CB4A 3Q1KA 5E2IA 2WVJA 1RLMA 2OFPA 2C9BA 2VJOA 5FWDA 2ZWAA 2BMJA 4QGBA 3VDMA 4FEEA 4L2IA 5MFPA 5LMUB 3UMSA 3N2KA 1QYXA 4Q02A 5EXDA 5H3LA 4U2CA 1RCUA 4C0SA 4RJLA 2V7QA 4EGCB 1OIWA 4EMSA 4WKOA 5IBPA 1Q1AA 4ZHQA 5KU7A 1Y37A 5DT9A 1ZD3A 2CXUA 3NRJA 2ZTVA 2NLOA 1SQFA 1MHTA 1T91A 4DBLE 3C7AA 3FVQA 3OJLA 1TAGA 1BSVA 1GSIA 1GG8A 3PC8A 2J31A 3MAGA 4W82A 1N6OA 1GV1A 2GHQA 2BZ1A 3BB4A 5CVTA 1JHZA 2XY4A 3EGCA 1MJFA 4BLTA 1LPAB 3ZDDA 5DX1A 1IIBA 1I51A 1KH3A 2C61A 2WUEA 5KNCD 1XJ0A 3CEMA 3V8PA 1EFRD 4IHAA 2X9GA 2PGAA 2DQSA 5DYYA 1QVRA 5F76A 4AXBA 3ONVA 3UUWA 1M2WA 3PNMA 4R1OA 3IIKA 1L5FA 1PR6A 3L7KA 1J5PA 1YV9A 3LUDA 3WLSA 2IHNA 2GT1A 3S5JA 1P4HA 2NACA 1HSOA 2XXBA 3LT1A 2IYWA 4WEQA 3ZX5A 3MCWA 1OLUA 2RMKA 4G97A 4AIIA 2CFIA 4B5LA 4C43A 3KR2A 4YRIA 2RJNA 4C6TA 2P9EA 3DP9A 4FN5A 1E3LA 1O8CA 1QO9A 3LBFA 1MO5A 3JAWB 5EQJB 5D00A 1I94B 3Q0EA 4H7JA 1TE2A 3HB9A 3GN2A 1F60A 1DC4A 3R0JA 5I4KA 1WQ4A 4MV8A 3K9QO 2NXNA 3VDXA 3IVRA 2C5HA 3MFQA 4WZBA 4Q7LA 3ZGVA 1GPKA 2A7XA 3MMPA 4X90A 1P1JA 4XWTA 2IV2X 1GAJA 1RRKA 1YKFA 2VHYA 5TQJA 1F7UA 4TKMA 4MWZA 2BSAA 5GIPE 3IEXA 1KYTA 4FYJA 3F6CA 1V2GA 2RAVA 5BW8A 3DDHA 1O5IA 1T3GA 3HA2A 4KN5A 4OKIA 3SDBA 4AULA 4EIWA 3EH2A 1GIAA 4DCMA 1JKJA 1VYVA 2CLDX 1Z7BA 2C5AA 2LW7A 4P6VF 1O2DA 3THXB 1Z7WA 2M2IA 2D8AA 1NZJA 3F9CA 1JQAA 4ND7A 4CKCB 1N6HA 4P31A 1F2VA 1I6WA 4J7CA 2UVQA 1Q0RA 4RMGA 4X6UA 1GT6A 2ZXFA 3RTAA 2GBFA 4TPKA 2Z6UA 2Z5LA 3OTWA 4LDJA 4TWJA 5FORA 3EULA 2I4RA 3GLKA 3DKPA 2CNNA 4IG9A 4KQHA 1Z28A 3DXFA 5CLIA 5CPFA 4DY6A 5M5BA 2V7QD 5K3FB 2AD5A 4WLVA 1OYVA 5SY6A 2ZOSA 3ZK7A 1E1KA 5IVHA 3LT2A 1F1BA 1JIVA 3L0ZA 2QLTA 4V0LA 4IWYA 2GCNA 6CHYA 3EGWA 2OFWA 4RVGA 3OOHA 2AN5A 5I9IA 1TF2A 3BH6A 4AJEA 1T26A 4AW9A 4FGKA 3WKAA 2HZ7A 4G67A 3QBDA 4FOOA 2BBWA 5LP6A 3DFFA 4O2BB 2YWDA 2PUGA 1T8UA 5K01A 4EEKA 2HJVA 4TWIA 5HSGA 5DK4A 2BM8A 2PFKA 4HWTA 1I3MA 4MCAA 3P5SA 1DQZA 1UPUA 2ZBRA 4V3BA 1G20E 1Q1BA 2CD7A 2MOKA 4IVQA 2JFPA 2O0LA 1WKCA 2AD1A 2H2AA 3BFXA 3GDWA 2OB1A 4LDNA 3LZDA 2RHCA 1QIFA 4QC2A 5TVGA 3TG8A 1FQOA 1Z5WA 2GETA 2QQGA 3PNKA 4Y2UA 4XWKA 3D02A 3I5YA 2NIPA 3QVJA 4WSOA 5IF9A 3BWCA 1XQVA 3OO1A 4LRSB 1QRTA 1I6KA 1GGHA 1P62B 1Z2DA 5DNDA 4OQZA 2JPDA 1H3EA 4NOJA 1KY4A 4D8VA 1EJ0A 3OA0A 1XTIA 1GNRA 3BMQA 1PUJA 3FMPB 3BJEA 4NAUA 4FFRA 2DLCX 1M83A 1ZZGA 2I4OA 1U0NA 1V7PC 2QE6A 5BMVB 1PZHA 3R2JA 2PTGA 1BMQA 3A2MA 2CY0A 4ZVNA 2FWMX 1UWVA 3T7DA 2XXJA 3HVHA 3PXDA 4WKPA 3I37X 2PO7A 1MEOA 3C5CA 4QTUB 4KAAA 2XNCA 4JI0B 1FX1A 4FGUA 3K32A 4PBTA 2Z8YM 4RETA 1G21A 2NMVA 2NYVA 1PZEA 4MW4A 2NPIA 2WTMA 1K89A 3FPCA 1AQUA 3HCAA 5IDYA 2JD0A 4UFNA 1OLXA 4U7FA 3BMCB 3ASZA 2EX0A 4B7UA 3TFOA 4RKQA 4DDKA 4DKJA 4G07A 5F5XA 1YWGO 3O2SB 3HY6A 4MVJM 2YOFA 1SQ6A 2Z4RA 5B30A 4AMBA 2Q8PA 2C5BA 4G5XA 1SC9A 3ENQA 5BSRA 1FNDA 4GMDA 5F98A 3HVRA 4JVOA 5FHQA 4DDWA 5CJJA 4GVLA 2UZIR 5U4QA 5CEFA 2NO0A 2DFLA 1YU6A 5EJIA 1DIOB 1GL3A 3GZ4A 4YRRA 1P2UA 1B6TA 2DPMA 1TM1E 2ORVA 2BEWA 1A1VA 1RMTA 4WXPA 2O07A 1VA5A 1R6DA 4YREA 3T4UA 5DFAA 1JJFA 3U4CA 4HHEA 3HO8A 1XHFA 1Q0HA 5CR9A 5F1PA 3TFWA 5BUCA 2F17A 1V7CA 2FWJA 2HQRA 5I6DA 4IGEA 1Q1GA 4XB6B 3C85A 2XMRA 4JSRA 3GLRA 1UBMS 4U7WA 5ALFA 1E0KA 1E63A 2XYHA 2JBHA 2Q2VA 2O8BA 2Z9CA 1XBTA 3FOFC 4Y1FA 3E2IA 1M7HA 3H8VA 4L7VA 4CIBA 1MVNA 4KB5A 1VPWA 4B8ZA 1T3HA 1JB1A 2B6HA 2FX3A 3E70C 4NBNA 4GX5A 3QLVC 1KZYC 1E59A 4H7HA 3WB2A 4PG6A 3ODGA 4IO1A 1KPHA 5DHUA 1WMSA 3TD9A 3ZZNA 2J87A 3OF2A 4P0TA 3IP8A 1IZ7A 1KU6A 5IYZF 1ZRMA 4PAGA 1BQ4A 1LDEA 2BGLA 4OV6B 4EHIA 4LF9B 1I0ZA 1E62A 1KE1A 4LTDA 4RTMA 2PWAA 2WNIA 1P0MA 5B7NA 1M7GA 1C7QA 1RIFA 1GZ3A 3DQZA 5EMHA 1IULA 1FFAA 3AR3A 5J4VA 4D26A 3THOA 1KY2A 3NDJA 2J4CA 2HU5A 1G64A 3HVUA 4OQFA 4JI5B 1UQTA 3T54A 1IIRA 4C7OA 1DADA 1YGYA 3F5QA 3P0RA 1FU8A 2PAFA 1EXWA 4KQMA 4LXIA 5LJLA 3F7TA 4QICA 5BVGA 1KHHA 1FDVA 4HGYA 5I9BA 1FFHA 2WBLC 2E9SA 2IYVA 3PKIA 3ZBPA 4BUJA 6NULA 1ONOA 4MKFA 4QPDA 1YVUA 3R3YA 3OJEA 4D6PA 5A71A 3QLUA 5CU7A 1KBOA 5IMBA 2ZUVA 4EQZA 1COZA 3PFIA 3QKRB 3DBRA 4B47A 4X85A 5DLQC 1X7WA 4IIXA 4BO7A 1JA1A 1DAPA 4LE2A 2F55A 4K9DA 3GAAA 5AKGA 1N2EA 4J49A 3BORA 5HUJA 1A9PA 3UQYS 3GXOA 4UU8A 2Y2UA 4YR9A 2OO3A 3GRKA 4J90A 5AO9A 4DS3A 3VO1A 1NVUQ 3Q40A 1OFIA 1E0SA 4GP6A 4Q34A 4KGZA 1QK4A 1SC3A 3U13A 5C1DA 1QOQB 4YQFA 2V3VA 1BEEA 3OMLA 3T7TA 5D8DA 3BKXA 3G17A 1EAYA 4FEYA 4F4HA 3G02A 3EZNA 2XYVA 3CQ9A 2GJ9A 3HN6A 3QXSA 1WL8A 4IXTA 3D43A 3EEOA 1GYQA 2WA2A 1K7CA 1KE2A 1V48A 4EBBA 1WA5A 1LV7A 1R66A 2LV8A 2Q9BA 2JIPA 5TPZA 2OBMA 3AM3A 4QQRA 3G0HA 3QNUA 5ECGC 3I2KA 1EVYA 1GWNA 4JGGA 1LW7A 4WX2B 2GCOA 4WZ6A 4BWVA 1TPZA 2C00A 3MAJA 4NLLA 4DMFA 2P9CA 1AQIA 1NWCA 2F1IA 2Z1DA 3LX6A 4QEDA 4LDRA 1JXOA 2XRYA 3E61A 2EVWX 4H1VA 4RIIA 1HR0B 4ATNA 4EJFA 3DKIA 3AL3A 2QXTA 4G1FA 2BI7A 5LKAA 3GF4A 4OKNA 4QUJA 1COWA 1U3GA 2WB4A 1CEXA 1GGFA 4PG5A 1P1KA 2ZRMA 3GPDG 2PSJA 4JVNA 4BWFB 1WTAA 3AEQA 5BNWA 1BH2A 2DE0X 1QP0A 4RTSA 3F7NA 3DPIA 2HSWA 1KZHA 3AEYA 3WGJA 4BYMA 1OWPA 1BHQ1 3RHZA 1IZ9A 3SNKA 5HX7A 1JLLB 1H85A 3SE0A 2CXXA 4FOTA 4L4XA 1P9WA 1GPMA 1K7XB 1JJIA 2JH8A 3MBKA 3OEYA 5DHAA 4M98A 4M9UA 4Q5IA 1J97A 5KWJA 5L3VA 3QU4A 3TCXB 1RWNA 1KAQA 3ZQ6A 1MIOB 3IPRA 3FDZA 4DYVA 3NC1C 4G4SO 4ZEMA 4QU0A 4LY0A 3IAXA 4FB4A 4DA4A 3A26A 4BQPA 1MG5A 2XTNA 1UJ4A 2V4MA 4PY2A 1D2RA 1V5GA 2ECKA 5TF0A 2PMKA 3MPOA 2OLJA 3KL2A 5CX1A 4Q3NA 5U4XA 3JAKB 3MCAA 1T0HB 1VFNA 5F35A 3TSYA 3WGMA 5H9WA 5JCXA 3T5MA 4D98A 1Z47A 4MRPA 4MIYA 4QGAA 4AK9A 1E2KA 1SELA 4DLXA 1AX9A 1HRDA 2YDYA 4WOPA 5JPIA 3U9TA 4ZK6A 1VKHA 4NBVA 2GN9A 1LI7A 1OLSA 3L8ZA 5K3DA 5KX5B 4WH0A 3DW3X 2GERA 1YZKA 1OZGA 4PQFA 3KSDO 5BT8A 3FWKA 2DB3A 2XZDA 3IAM1 5KAPA 4EBFA 2DGDA 2CMHA 4F4CA 1BVUA 1MU0A 2ZU0C 5E7QA 4PBSA 2QX9A 3SF0A 3W9UA 4ZEVA 2EF1A 1TZJA 2ODAA 4L5YA 3VC2A 5C51B 1V45E 3QYAA 1K08A 1XNGA 3AMVA 3O2JA 4Q1FA 4U8GA 4XWOA 4YMLA 2JGNA 4MRAA 3EPLA 3IAEA 3FGZA 2DPHA 3G5MA 1DG1G 1UK7A 4B09A 4MDFA 1Q50A 3DUWA 1ORDA 4WDRA 4ZTBA 1QMPA 1VE3A 4R8SA 1KEKA 1R8XA 5TPZD 4I4CA 5AVUA 4Y7DA 4E32A 1VL2A 3PGKA 4HMPA 3CLSC 3D64A 1J5XA 5EQTA 2QUIA 1ZJ5A 4H0FA 2NZ2A 4DDTA 4GYKA 2PJDA 2Z98A 2IYUA 4I4LA 2PSHA 2YWGA 5AJWA 2FNAA 5ELLA 4KYIB 1RC8A 1JKFA 5ALWA 1JJ7A 3CINA 5PGMA 2B5VA 2O4UX 4DJEC 3SWWA 1VA4A 1T9GS 2KBFA 5HIKA 3GFVA 4H7IA 1ZD4A 3F8SA 4P92A 4XXHA 3F3KA 1FYEA 4KWCA 2B1RA 4K9KA 3W3AH 5JY1A 2BDTA 3PDWA 5D2CA 2X8WA 1COWD 4OAQA 2YFQA 2D2XA 3FUVA 1XTPA 3MJCA 1VB3A 4DGQA 4DRXB 3STWA 5JASA 3OIGA 1UXGA 1ZESA 4E3WA 1UFKA 1RKBA 1UJ2A 5K8TA 1UKBA 2Q6TA 3L77A 3LJKA 4QODA 2PGIA 1HEUA 3FUUA 3SJ7A 1SB9A 2I7VA 3OAAA 3SSOA 3RGWS 3VPFA 4FNGA 2XMBA 3AQ4A 2VCHA 2HBRA 4JCCA 2EU8A 2XUJA 3FAZA 4BP3A 1SVMA 1KC1A 3KAJA 3LH5A 5BOSA 4KO3S 5ALTA 3VZCA 2IIQA 2FCAA 2B1JA 3L7JA 4IRMA 1RWXA 2D1TA 3F98A 3JD1A 4RVNA 2YJGA 5BSMA 1Z63A 4FVTA 2BMAA 5AQEA 1E64A 3EYAA 1TZMA 3G5LA 2RH4A 2CDNA 3U9LA 4ENWA 5TQ0A 3FCYA 2AZDA 3S1AA 5BYKA 2JCBA 5HK8A 4MYUA 2R5NA 4MDYA 3HUUA 3M9WA 3EVGA 2WIFA 1W2HA 4A2PA 2AR7A 3WJ1A 3UAXA 2ZSEA 3DSRA 5AVTA 2YNMC 2YOGA 2WT8A 1D7OA 3H4VA 3X0DA 2XNKA 2KB0A 3ND8A 4MMZB 4Z9BA 3HV2A 2B82A 4ROTA 3OJOA 5AUNB 1R2QA 1CRLA 2JK0A 3EGOA 3PZBA 4RJ2A 4DDMA 3LW8A 2RC5A 1WCIA 4IVNA 4JIMA 3A3KA 1NFQA 2F8MA 1C4XA 1V9LA 2G7MC 1PWEA 1ESEA 1NX6A 4FCWA 5F3DA 2X22A 3PB3A 1Y6GA 4KZKA 3RC8A 4KLCA 1SOAA 5TJHA 2GAFA 1J99A 1SRQA 2C2YA 3LQFA 3HUFA 4IH1A 5JWOA 2HRRA 1AZTA 3WB0A 3HS3A 3ZUPA 2PA0A 2UZ1A 1Q3HA 3SZOA 6YASA 1K1EA 2MSDB 3FMVA 1MKYA 3IMCA 2L42A 2ZT8A 1BO6A 1TTHA 3A4YA 3KEOA 3PFFA 3RFTA 2UUOA 1WUJS 2R751 4H6PA 3T3DA 4C6RA 3DL7A 3STVA 4KO4S 4AKHA 2F64A 3CONA 3SCZA 3WGOA 1HT2E 3F6EX 4CM8B 3H6KA 2WWWA 2P9HA 1M8KA 2GZRA 3L06A 4X94A 4RK4A 5ALMA 5E95A 2DUJA 4ZYVA 1RZ3A 3BIXA 1AA9A 1N34B 3EPPA 3FYSA 1GQOA 3CBQA 2POCA 3UWSA 4E5DA 4HQ6A 1PCXA 3PFWO 3UMMA 3RVOA 1KRWA 2GEUA 2ZDGA 2BT4A 4HZUB 4MYHA 4WXYB 2HJWA 1PTKA 3HYNA 4JJFA 4MH0R 4BGVA 2W90A 5KWIA 3UH1A 1N2ZA 1CUBA 1G8FA 4XQCA 1BMFA 1NBHA 2AX3A 2G80A 2W2TA 5G4KA 4YI3A 5EMLA 5C7LO 4L3OA 1STOA 4URZR 3A4MA 4YVFA 2O2HA 2WUGA 1HQDA 1UPBA 3YASA 3K4HA 4W99A 2OKGA 3ESQA 1DAMA 2Z2JA 3OAAD 5LZ4A 1V26A 4BE9A 2WYIA 4OFXA 4U8HA 3KJGA 4JUBA 2OAQ1 5H83A 1C30A 3I4FA 2CLFB 4ZV7A 3QLVA 4CN8A 4ZYTA 2JIBA 5KJFA 5LQAA 3RABA 3BE8A 1GZ5A 2OCPA 4MKXA 1K6IA 4BXOB 4C0KA 1XYGA 5KYWA 1FC0A 2VT6A 3HCFA 4KQJA 8OHMA 1Y6FA 3OMXA 4AN4A 4MYRA 2JKZA 3U19A 4OEHA 2LP4Y 3JASA 5B57C 4HDNB 3MZ0A 4D9HA 1VSUA 1QE3A 3A9TA 4NBRA 4UDOA 4L51A 1EWKA 4AKGA 3WADA 1F51E 1OYYA 3CPSA 5EHGA 3ZVLA 2ATVA 4HLCA 1Z35A 3AM1A 1XZQA 3BCUA 3CJTA 3K1ZA 3RARA 5KS2A 5FEMA 1FJ2A 1NVVQ 4FDTA 3WVNA 3OKFA 4D2IA 4Z0PA 2PT6A 3G5AA 5COQA 2A14A 3QWBA 1CCWA 2JAOA 1A5AB 2IXBA 4EHBA 1JQ3A 4HRVA 1JLRA 2V6BA 2UXDB 4LYEA 1BW9B 1YJXA 5AUPB 5K0JA 3LKDA 4H3SA 4R16A 1ZM2A 3BHIA 4UEQA 5LSAA 2Z5FA 3W6OA 4DWOA 1J0DA 1BD3A 1UM9A 4CCYA 5BQXA 5REQA 1E9EA 3ENZA 2DF8A 2ZI6A 3M33A 3OWHA 4YA6A 4D4GA 1MJHA 2IYRA 4LYDA 4ZQCB 5MN6A 4Q1CA 1EFTA 2F1OA 1R37A 3MD9A 1IN6A 3HFGA 5IKPA 1CJCA 1IJKA 3LCVB 3JX9A 4YAKA 5TLSA 1LSJA 4D0NA 2NVUA 2ZM5A 4TN1A 2GKGA 4Z8XA 4QXPA 4LHSA 2XGSA 4LWZA 3GNSA 1R00A 2VDRB 2W4MA 1EVKA 5CA0B 1ESMA 1NDUA 3OFVA 3OTIA 2IDMA 2NU9A 4DCVA 5CG1A 4WAUA 4ZOLA 2ZDQA 4OQXA 5LD2C 2GA9A 2PHZA 4ZIRA 1PF7E 1KO8A 2QXUA 1ZIYA 1JBKA 4RPKA 3CA8A 1QHYA 4TUYB 3T9CA 1LX7A 1WW3A 3ND6A 2AMYA 4KW7A 4LY9A 4LBWA 1IAQA 3F1LA 2QRZA 3TL2A 2O5CA 1BMFD 5KKCA 1PJBA 3AVVA 2AOXA 1ZCJA 3CLKA 2CL7X 1T0UA 2QT1A 3H3XA 1LV8A 3HL4A 1NRIA 4YDQA 1WPGA 1E2GA 2CCKA 2V8BA 1GQYA 1ZC3A 2OCYC 1T1RA 3U4QA 4QBGB 4CEHA 1T2UA 1XQXA 1OAKA 5HGJA 1X7DA 1HQKA 4W9NA 4Z53A 4XDYA 3NQ41 4QBKA 1ADJA 1AUPA 2AGVA 5IFLA 3TRKA 4OYHA 2ZRLA 2EFGA 3DW1X 3L0BA 2FSVC 4H6WA 2NSHA 3E3MA 4Q1BA 2ZT7A 5EP1A 3CLTC 2P9ZA 3L6CA 4EITA 2QP9X 4U3JA 4DNXA 2VOEA 1FTNA 1PR3A 4A2CA 3M6LA 3H5TA 1WV1A 4RHFA 2DERA 3SFTA 2IZ5A 4KKXB 3RAJA 2QRQA 4ZVKA 4JI4B 1QAMA 3AHIA 1D2GA 4Y6GB 5IHXA 4YRZA 1U5BA 4P5DA 5IJ9A 4UVEA 1P2TA 1U80A 3RJ5A 1KFEB 1UOPA 2JIOA 4MVCA 2UYHA 3VHQA 1V11A 1Y5RA 3O21A 1J2RA 5EVJA 1RBMA 2F4VB 2ZB8A 5C8ZA 3AB3A 2F3QA 4D9CA 3O8QB 1HC7A 3CWZA 3LZ6A 1JH9A 4DB2A 5LNK1 1DKRA 1SCJA 1Q3KA 2R6FA 3FNEA 2IUSA 3O03A 1JEYB 2XBMA 4KPEC 4GFDA 4EB3A 4M99A 3V8RA 2IH2A 1FF9A 1GTZA 4Y6QA 4EZIA 3EY9A 1RWBA 2R44A 1RQGA 1RQ7A 1VHWA 2G0TA 1V6CA 2V0GA 2PBRA 3HG7A 3TAXA 3C1OA 2G17A 1EDEA 4WOKA 4YCCA 3GD5A 3BE6A 4DAOA 4DUYB 1UXKA 2CL0X 3IDAA 4LOLA 3VU9B 4KPYA 2VTBB 3E5HA 3LOQA 2IYEA 2WF7A 4JIGA 2Y68A 4WNAA 4PLPA 4CVNA 4F04A 4N0PA 4XPIA 1F6BA 4R9VA 3TTVA 3TZQA 5IVIA 3W2FA 1NV8A 5MFZA 3RHSA 3TBFA 1UT6A 1VI5A 4M1QA 1Y3CE 5CNKA 5EXEA 4CR8A 4Q4CA 4NK4A 1JPJA 4F5ZA 2OOKA 1WP4A 2OD7A 5FWYB 1XKTA 4X3CA 4CIYA 1FDWA 2J41A 3KKKA 3AFHA 5LA6F 3B52X 2QIPA 2XMQA 3JD0A 2QMUA 4QNNA 4WK4B 3CIFA 3V97A 1XVTA 3UN1A 1JT2A 1BNCA 3A6DA 5A1TA 1EFAA 1MABA 3LYLA 5DM60 5EWJA 3KHKA 4G36A 2FW7A 4P9NA 4BNGA 3WL4A 2W2MA 2WV9A 3ZCTA 2R60A 3CBGA 4NYIR 4RHXA 3VR6A 3ZHOA 2WUDA 5CXXA 1JFSA 1X7ZB 2D6FA 4B83A 4BVFA 4KVZA 1YJ8A 2GUWA 2DKNA 1ZGZA 2Z6QA 3B9BA 3OZBA 2Q1YA 4BQFA 1II9A 1YS4A 3OZAA 3UK0A 5F9HA 3AVYA 5A4JA 1QLWA 5JATA 4KRFA 3GY0A 2NVWA 4GMFA 3H4MA 4NE2A 3RASA 1Y9AA 4LK2A 4XW2A 4P0PB 3ZW7A 1NJGA 1U11A 1YZ3A 3N75A 1USUA 4QEZA 2XX3A 3N9IA 1IOZA 3GEIA 4GLBA 2VWPA 4HLQB 3GRRA 1EFVB 3BSWA 2R9VA 3IOMA 1C80A 3OZVA 2Q4DA 3VKHA 2FR8C 1PZXA 3FLMA 4ZI5A 4F3CA 3KYBA 3AERB 4YUAA 3AFNA 3TLKA 3B3GA 3ZY5A 4TXLA 3OEWA 2QEQA 2GZMA 2GF2A 3VTKA 2H85A 3HI4A 3DCIA 4LC1A 1JIUA 3D6HA 2II6A 1VLQA 3W05A 5ES4B 5JECA 4KK4A 3W5BA 1XN4A 3H6HA 4EFNA 4IGFA 1HO3A 3H8SA 4YJKA 1RP7A 3AM5A 3HJCA 1HE1C 2B4YA 3B3QA 2LUOA 4ZQGA 4AG5A 4D3YA 3D81A 5KJ1A 4N7BA 1GPYA 1NUQA 2QPAA 4MR8A 4QUGA 4RDHA 5E2BA 4G8JA 2GPAA 1SUWA 5ESXA 5BUZA 1CR1A 3TSOA 4N3NA 1ECBA 2BBTA 3MJDA 4IAOA 4JB8A 3L3BA 4EK9A 5EWLA 3EZXA 4DSOA 4HQKA 4UVHA 5TDHA 2HWUA 1AT1A 2BTQA 1IWPB 3ANSA 1GGNA 2XIJA 1PL6A 1DC7A 1W1UA 2FFHA 2V58A 2YNMA 3UXHA 3B36A 2XUKA 1Y81A 3AHGA 1EGVB 4IP0A 4OQNA 3VHXB 1RXCA 4GPAA 3TNYA 1I4DD 3HXQA 3MMZA 1R5NA 3U3DA 5BXQC 2WK1A 1KFJB 1QFMA 3VVBA 1Q0LA 4TXNA 4PFKA 4RPLA 1K7FB 1EX6A 1V1JA 3MINB 4KE6A 1XRQA 3R5SA 2GAAA 2LVBA 1LK5A 4PAOA 4BB5A 4BRSA 4NHEA 1T8PA 1XDUA 4GR9A 1C2TA 2VSNA 1T4CB 4OI4A 3ZOKA 1U8AA 1YDGA 1HNZB 3N6RA 3ZU5A 2DP4E 4O8ZA 4CUZA 5HVNA 1KAMA 4JKOA 4OJYA 3LCUA 3B85A 3BGOS 5FQNA 4DPLA 3FDIA 3HNPA 4DB4A 2WP8J 2I2CA 5AVOA 3AL0C 1C9MA 1TM4E 2G08A 5CH5A 3O8DA 3VR6D 5HZHA 1HEYA 4JI2B 1O6FA 1OXUA 2QM3A 2Z2XA 5CYGA 1ECGA 5C37A 3CLSD 2HRDA 4UBNA 3UG7A 1Z4NA 3BFJA 4TTQA 2P9FA 1E7QA 5FUMA 1U0EA 3NETA 5EIOA 2W2QA 3CZ9A 1RR6A 1QCYA 3E9MA 4X24A 4RDIA 1IQRA 2V0CA 1K6EA 1GZ4A 4PYLA 1WVIA 2HDNB 2NG1A 2RB5A 4R9SA 5CNJA 4CCAA 1ULHA 3MRSA 1X86B 3MT9A 2ORED 5F2EA 3WDLA 4M0EA 3LWDA 3S1LA 3CRQA 4L5JA 4CMIA 1AGNA 1K9SA 4DC1A 4CL8A 2FUCA 1QJCA 1LBTA 2J9FB 1SNYA 1T4GA 2UYOA 2KMLA 4KX3A 3PD1A 3ROMA 5KSZA 2JGIA 1NVAA 3O8OA 3DEKA 5AVWA 1DQRA 2OD9A 1RM4A 2X8AA 4GF5A 3STYA 1TT5A 1MAVA 3AHCA 2AYYA 3GFQA 2MYPA 4K9NA 3N28A 4OI1A 4QAJA 2CNKA 4DMUB 4EY6A 5EGNA 3LZCA 4K2AA 4EGQA 3PX7A 3TZHA 1ZBQA 1IY2A 1G7CA 1ZN8A 4JBIA 3A6HA 3FA2A 1DMRA 4NDNE 4EVSA 4MX8A 4Z5XA 5CW2A 5A6VA 1RHRA 2YMPA 4NCBA 2NO4A 1DZIA 2ORWA 3GEGA 3OESA 4NNJA 4Q19A 3USES 2C7OA 4F6RA 4B45A 1RQ2A 3CMCO 1DPFA 2I3ZA 3JPYA 4G4GA 4GZLA 5HFAA 1QGAA 2VLBA 3HVJA 1WMDA 4JJKA 4J3JA 1KSJA 1LRKA 3B9PA 3RUCA 4EYEA 4ILKA 3J81k 3KT0A 3RU9A 1AGXA 2W83A 2YMQA 2I1WA 3T7AA 1L5ZA 2YNMD 4PQYA 2CXOA 2OXRA 3OE1A 3OU2A 1G60A 3ZKWB 3RYHA 3RT7A 1U0BB 1L5HB 3C14C 3B53X 4M9QA 3T4PA 4RVFA 3QEMB 4E09A 1RZUA 4YBZA 3PSHA 1UJ5A 4OHXA 2QN2A 5DHPA 3R09A 3EASA 3WGYA 4MV9A 1FRQA 5FHRA 1DCTA 4C4ZA 3L0SA 3LRTA 3TI7A 1IM2A 1G20B 4MKZA 3DOCA 4PYQA 2C59A 4UUNA 2Y6UA 1XTQA 4XZ3A 4GOKA 4L8YA 4JU9A 4TTRA 2JI6A 1GAQA 4GKVA 4BBPA 1TFRA 4R7GA 4D5GA 1RRVA 5K0LA 5EUCA 2NP7A 5FX2A 2B2NA 4G5FA 3W4IA 1OXMA 2OLEA 2VSFA 4RY2A 2V5VA 1I4TD 5CYOA 4TV8F 2A2ZA 5LMNB 1GZVA 2XB4A 1SVSA 1QKJA 4M8NE 1OROA 4S2EA 1TADA 3IIEA 4AJPA 1PGNA 1JEAA 1QJ4A 1UF9A 3BTOA 1DJNA 3FVTA 1SXQA 3BRWA 3V5NA 1TKBA 1OWLA 2CFOA 1DNPA 2R8ZA 2G28A 4JL5A 4KYTA 2ALJA 4FKMA 4EECA 3SD7A 3N2GA 3KOXA 5JBIA 1QO7A 5IUJC 2BYTA 5FPTA 2QVZX 1Q3TA 1JALA 3JQAB 4HZIA 4R9RA 5HRAA 2R4TA 3P19A 4UCXA 3SLRA 1IZZA 1Z62A 3FGPA 2DY0A 3FPEA 3SJZA 2CF5A 3UJ8A 3B3JA 5JPDA 3HKDA 3CRRA 4QOJA 4QL3A 4Y2HA 2ZTLA 1QHIA 3ZWDA 3UUGA 2QJFA 1V16A 3G49A 1I5OA 4OXKA 4TSRA 3SQMA 2EWMA 3QELA 4XUDA 1X13A 3K94A 3H1BA 1ZUWA 4FLFA 4OH1A 4QU8A 3AY6A 3RWMB 3UAVA 4XQEA 1SXHA 3VPSA 3A6LA 5LU8A 3D7LA 4ENRA 3LHIA 2Q1WA 4XX0A 4YFVA 5T4EA 1II8A 1QS0A 1WW8A 2FSVA 3QUCA 3KM0A 2NQ8A 2VP5A 1W34A 3V4RA 2BMEA 3L6UA 5KDLA 5FBWB 5D01A 5FLEX 1YR8A 4XM0A 1SUFA 4HPXB 1XRJA 1Z9BA 2EBUA 3DHEA 4AAYA 4Y18A 5FQOA 6LDHA 2V59A 1A88A 4I5FA 5CCDA 4W9MC 3UK1A 1A7AA 1M76A 2WEKA 3R8CA 4Q7QA 2RKWA 2DXIA 2I33A 1CZHA 4QREA 1HX7A 4GG1A 5LWQA 1HOTA 5K8LA 4ZMSA 3QMVA 4RLFA 2FPIB 3A9RA 3AP3A 1D07A 3RNOA 1CY2A 1K2WA 3PICA 3E53A 4EO4A 1BE0A 1FUYB 1UKAA 4Q3BA 1HL7A 3SX2A 4C4TA 3W1WA 5AVZA 4OJMX 5ADVA 3DZBA 4NBWA 5ALHA 5C31A 1RTKA 4QDJA 3FNBA 5TEWA 3F90A 4B2LA 4URWR 5CDFA 2CLLB 4PQEA 4F2GA 1QGOA 5FYQA 3S5UA 1XTBA 2W6IA 3EEIA 4R3UC 5C0OE 2WHPB 3RS4A 5LLTA 3MOIA 4BLQA 1V7QA 4YPFA 4A73A 1Y6JA 2ORIA 4GYJA 3DO6A 1PQUA 4DM7A 1BC5A 1B8NA 2C42A 3JYHA 3NWBA 3BM5A 2X41A 1Q7GA 5TMEA 3UEOA 4FBMA 2XCRB 2G1PA 1IHUA 3VKGA 2WW8A 4LS3A 2NW6A 4P38A 4MV3A 1JJBA 5FUXA 5ICMA 5CUQA 1TCCA 3SYLA 2XDQA 4G0WA 3ABIA 5EMJA 3E1GA 4R05A 5E4TA 4M88A 2JGAA 3CH5A 4L50A 1R4MB 2B9VA 1E4EA 3FMGA 2AG5A 3FN4A 3FOWA 4KSBA 3A1SA 3SEZA 4DWVA 2HCRA 1Z0FA 3BRWD 1BFDA 4KXFB 4EI9A 4M9RA 5FA8A 4LRWA 4TTPA 3DWGA 4YGYA 3ZZMA 2Q6LA 2C54A 2Q8QA 3MYYA 1N78A 3ZBUA 2HF7A 4FUQA 4B9EA 5FOWA 1N2IA 2HT6A 4DJ5X 4HXFB 2YCLA 4TMVA 4ZU1X 3CUSA 3ZWKA 5JJBA 3HYLA 1GPLA 4AQDA 3SXJA 4NBLA 2DUWA 3L43A 1D2NA 1CY0A 3OWXA 4OA8A 4WASA 3U0BA 1ID8A 1NI4B 3F0TA 4P7GA 2LBPA 1VLHA 1UZAA 1IATA 1S3GA 2HLHA 1Z4MA 2YVUA 5EUBA 2H1HA 2O57A 1ILEA 3NATA 1ZH2A 1JG3A 2V74B 2X8JB 1ICIA 3D8SA 2IT1A 4URFA 3RS2A 4B3XA 1G1AA 4MUNA 2SECE 2PX0A 4LE1A 3C2QA 3E8MA 4M7WA 4NSNA 4J0DA 5CT9A 1FQJA 3CLTD 5EHQA 3E7PA 3SFVA 5B64A 3GPBA 4Q1VA 1OY1A 2QYHA 1A2QA 1F8GA 2FR8A 5D87A 3SF8A 3ZTWA 4TS1A 1CJKC 3O4VA 1N0UA 3CHYA 5TPWB 5JS2A 3MG9A 4ENQA 1QRRA 3FFBA 1MV8A 4HH3C 3AU9A 3RU2A 4E12A 4JSTA 1FDOA 2NADA 4M76B 4NJMA 4DMRA 4ZYUA 2OCLA 4NG5A 1Y3BE 2IHBA 2NU6A 2VJNA 3BGIA 2CGEA 5IF3A 3GWZA 1I3LA 1XX6A 2H06A 4E0BA 2CUNA 3CISA 1P9LA 2IZ1A 4PZAA 1QGED 1SD2A 2ABWA 2EFDB 2QRHA 2VDMB 3FDJA 3MT8A 3PENA 4PC3A 1DTEA 1U0OC 4O6VA 4RLQA 1KL7A 1Y89A 2E85A 3BWMA 4ARVA 1VLLA 1RBYA 1ZU4A 1E60A 2VJBA 5KC8A 1SCDA 5G1NA 2W6ID 1CYDA 1LBSA 3TZCA 3G2MA 1I9GA 3I6BA 5JOQA 2WV7A 2G9QA 1KERA 3U44A 3WK7A 2BFOA 4JLVA 4AP6A 2NP6A 4RO0A 1ZSVA 3K5HA 3UMRA 1XWWA 1HDCA 3G59A 3M3PA 3H1AA 1PDOA 5JH7F 3WQHA 2X15A 4LHZA 2YXPX 3E7FA 3IULA 4RSRA 4N65A 1K5HA 1I01A 2RHMA 2VG8A 5FULA 2B99A 1SBYA 3T94A 4YUZA 5CB4A 5DI9A 2ZUCA 3MGBA 4PVCA 4YT4A 4AO8A 1KKUA 2A58A 3G2KA 1ABBA 4ZANA 5F78A 2QGFA 1WPRA 3OA2A 2AG1A 3OF5A 3X1YA 3ZWMA 2GWHA 2DFKB 1FUUA 4Y0NA 1D6MA 5IC5A 3K1AB 2WSLA 1ZP6A 1J2TA 3S40A 2JASA 1HFWA 2IITA 3KQTA 4P98A 2ZIAA 3VKWA 2DWPA 1PFWA 1P61B 2ENUA 2X4IA 4NF2A 1XCGB 3OD5A 2HUPA 1NW8A 3IS3A 2PJZA 2V45A 1JILA 4LV8B 4Q05A 1DBRA 5IASA 1PFUA 4XQ0A 3KEQA 2BKLA 2YC4C 2XKKA 2YWBA 1R6TA 1BS2A 1E1QA 1KBZA 4CT4B 1V5EA 2R7LA 1GGEA 3IAS1 2H1LA 2C96A 1F8FA 1TYDE 2HOQA 2KM1A 2YJ5A 4R2JA 5CGZA 1DT3A 1QIJA 4UMFA 3DOFA 4KODA 1MXFA 2PDAA 1P7PA 5L3SB 4DV6B 1QH1A 3PE4A 3ZNQA 3TQFA 4O4HF 4JP3A 2DG2A 2WDPA 3UA4A 2A4KA 1IHPA 3O26A 3KBOA 4JLMA 4KP7A 3W8RA 5L95A 3CRW1 2MSCB 2ZR8A 1A96A 2QAIA 4NEQA 3H4TA 4E2XA 2W0MA 4RZ3A 1AXRA 3GLHA 4EHFA 1T6ZA 1DU4A 4MLDA 1S8NA 4X44A 1A76A 1SJ9A 5KQRA 4R2XA 2X0NA 2FU5C 3HJBA 4MUAA 1I32A 3W4KA 1G59A 3I01M 3CKKA 4IFEA 2BIFA 3DF9A 2W43A 5D5HA 1GPDG 2ZCJA 1Z3CA 1KOGA 1CQZA 4O4JF 5SY9A 1PIWA 5EQFA 3UC5A 1YE8A 4XIGS 1KYYA 4ZRNA 5FBKA 3O1JC 2P41A 1O97C 2XE8A 4EMBA 3DJFA 4OXNA 3C6QA 5B6IA 2BGUA 2BF4A 2B7LA 5GP1A 1QGUA 1PV4A 1QRSA 2J0QA 5L3QB 4G26A 1Q1QA 3WMFA 3HVIA 3MJTA 3NLLA 3SLGA 3U3OA 2H0AA 4DR1B 1NF3A 1PEKE 4GXRA 4PQGA 4HX9A 5C1IA 1CUEA 3DNMA 3I9OA 2XZOA 1KJIA 5E8JA 5E6SB 5ESDA 4O08A 1JFLA 1QGDA 2CJPA 2LTAA 3DEYX 1BU5A 3KYDA 4IPTA 3TRIA 1ZOPA 1V3QE 1SHJA 4RM2A 5J5AA 2PTHA 5KYGA 1DWPA 4F4IA 1HK7A 3LXXA 3W6PA 5HRUA 4NAHA 1R4AA 4JEHA 4GL4A 1LLQA 2Z4TA 5FV7A 5BWOA 3GPCA 1R6VA 1HA3A 2I6QA 1C3LA 4L6IA 1KR5A 1ZM7A 3OUZA 4GSLA 1TVMA 2F8TA 1M6HA 2N1BA 4MW0A 4C4SA 3PNQA 5KKNB 2DETA 3LPLA 3FSRA 2G6BA 3WDMA 3WGQA 2PMDA 4GM1A 4MRMA 1EX9A 1NLMA 1ULZA 1VMKA 3KZVA 5CEJA 1ZXXA 3RVMA 2DQ4A 1XEWY 1MTOA 2VSOA 3AI3A 3EGIA 4AZ3B 1V1RA 2PZLA 3QF4A 4LOJA 4MKRA 4S1PA 4WVFA 1GAXA 1SBZA 1JX6A 1W93A 1T2DA 1EJ6A 2QP3A 1O94C 3KKMA 3ZGZA 5K3AA 1XQYA 3ZTYA 1VC2A 1ILWA 5BR4A 4YC7A 3MWGA 5JJIA 4IUBS 1E1QD 3ZLTA 2G25A 2C0PA 4TRNA 2YIMA 1SVNA 2IW3A 3EXHB 3PXUA 1VJTA 4HDRB 4RYDA 2Y0BA 3FLEA 1R8JA 5BYBA 2H59A 2H2WA 3OP1A 4ZODA 3Q7PA 2FJPA 3NGMA 3RH0A 3U7IA 3ZLVA 2BFFB 3BSFA 4GZ3A 4YCSA 5JANA 1ZVVA 1D2AA 4JQCA 2JGRA 3CKMA 1EEHA 4XQGA 5CFLA 2HXSA 2OCIA 2HWKA 2C4MA 3CNLA 1GUYA 3H0CA 4CMJA 3LP8A 2PSSA 3PRJA 1VLVA 1JSRA 2PNJA 1C9KA 1GGVA 1AQJA 2KJQA 1VSQA 2GPSA 1YS2X 1TX4B 4IQGA 4XWAA 4YJ2A 3MTJA 4NNOA 2GCIA 3BL6A 3KQKA 4WOJA 3ACCA 2GJAA 3DKRA 5F7JA 1F7VA 1Z5ZA 5CBPB 2VNAA 5KJEA 5IKMA 1YIOA 4LE0A 4TSFA 1NDHA 3DBVO 1R9NA 2BBOA 2ZBGA 3GJTA 3HJTA 4MRRA 5KC9A 5DLPA 2B21A 4RGBA 1QAQA 4CHTA 4PVDA 2YN0A 1NQWA 5HKBA 2I5PO 3AV0B 2IEGA 4YHBA 4U6NA 1XJWA 3EQZA 4ARSA 2NX2A 2JGDB 3H1EA 3OE4A 4UKDA 3GLFE 1EXVA 4C7MA 4DR4B 2BP7B 2N46A 2GEFA 4J0EA 4AJLA 1YJAA 1AKQA 2PMWB 4CLOA 5LB4A 1UAAA 4U4AA 4F97A 2GUGA 4DR5B 3FSGA 1E3SA 5JYCA 3M4YA 3A58B 4QQKA 1HE2A 4WFQA 1QYIA 2VZ9A 4X6YA 5GV7A 4D0LB 3THYA 4P22A 1DX6A 2HMTA 1LDBA 3U4IA 2Z3ZA 1L6IA 1A98A 1RM0A 2BKEA 2QX6A 4JJGA 3C7DB 4JZYA 4US2R 1X70A 3BIWA 5AI5A 4Q9LA 4MUMA 3WLLA 1FXSA 1QV7A 3DBHA 4WKBA 3E4DA 4YR7A 4AS1A 1LLCA 1QYVA 2ODBA 4JWKA 1RI5A 3SQDA 4Z7JA 2WM9B 4DTIA 2G40A 2X77A 4CKBB 3D3JA 3SZUA 4A9AA 5C3MA 2H92A 4UHKA 2C5LA 5DRYA 4PAQA 1YOBA 2G36A 3IA2A 2OZPA 4J1QA 1AU9A 2I22A 2L17A 1U3WA 1A4XA 4KYVA 5EKUA 1KJ9A 2ZQYA 3VUEA 2OXCA 5JI3E 5T8KC 4BJ3A 4PC6A 2B5WA 1T5IA 4I66A 4PGFA 3ROQA 2IK8A 2C9OA 2J45A 4UTRA 2B30A 2A9FA 2F8SA 1IQ0A 4A0HA 5BO5A 4E15A 3IV9A 2H9YA 3FIUA 1U02A 1QFJA 5ULLA 4B33A 1ZR4A 2VP4A 5I5GA 1CFJA 3KP1A 4B81A 2A5LA 3MTIA 1BX1A 4OMFG 2CCGA 3WV4A 2RGAA 4WFKA 5G4LA 3CZMA 3LC7O 3EPRA 2ZAYA 3BGVA 1TUIA 1EUZA 1SBTA 1XL0A 3VO9A 2JJ1A 2WJZB 4QRHA 1G7TA 2V6JA 2R7AA 3AK4A 1MXHA 2WZCA 1RPAA 4FQ8A 1DDIA 4W1SA 2O50A 4IOKA 1W1WA 3HCEA 3PUZA 2NV2B 3T9FA 4A4DA 821PA 2XWSA 4UW9A 1VL5A 5JDCA 2B61A 3HHPA 1JP7A 2NUTB 3KJQA 4UMEA 3SG0A 5LVAA 1WB9A 1Y8AA 3ULKA 3O2QB 4JBLA 3R7NA 4FWBA 3EW7A 5KTRA 1Y7IA 2EFYA 4ER7A 3W8DA 4ZHSA 1L1RA 1NG9A 4ZO4A 4X92A 5FPSA 4Q4AB 1ZKDA 4G5HA 1YQGA 3KVOA 3ERCA 2GRJA 2VK8A 4TSFD 2ZVJA 3S3TA 4FFSA 4B0PA 2OCKA 4GP9A 2MTBA 4C9BA 1Q20A 3WIVA 2WTNA 2PO5A 3S29A 4OXXA 3T8YA 2IXGA 3GN1A 4E4TA 4CL2A 1FDRA 2FG6C 2O2GA 4GPD1 4RVDA 5ERXA 2WZQA 1N4DA 4EJMA 2YZGA 3BEDA 2K4MA 5DTIA 2W4QA 221PA 1DBQA 3V32A 5K09A 2PD6A 2AXEA 3N0TA 2MINB 4CL3A 4YUXA 4MR9B 2XW6A 3FSGD 4RX1A 4XB2A 2ILVA 3KU4A 2YCBA 3QHQA 2PRKA 4WUVA 1N0IA 3WBJA 4D9GA 2XB8A 5EHNA 1QBKC 1Q16A 2C9CA 3DV2A 2XNJA 4N49A 4QECA 1LZKA 4XGIA 4PPNA 1TZKA 2JLXA 4OK5A 3TGWA 4AZSA 3QU9A 1WZUA 1WU7A 1KZ1A 1R0SA 3JVUA 4JEIA 3GLTA 1RWQA 3RU3A 1UH5A 4C7XA 5K4HA 3LXRA 5AW9A 3ER8A 3DMNA 1Y4UA 1BZYA 2X1HA 3NONA 4H1TA 4U2GA 3RYFB 4B17A 9ABPA 3OWOA 3TB4A 3CVUA 3THXA 4HN2A 3IDOA 4Y30A 3BWVA 5HF9A 4DN6A 1TF7A 1E2HA 1FFXB 3FUWA 2C8KA 2O1SA 3LIPA 1Z12A 1J49A 2R6ZA 2XQFA 3HNRA 5TQVA 3KZXA 3QWFA 2XDAA 3O8LA 4QUHA 4PZEA 3RSGA 2O7VA 1M2NA 2VA9A 1AG9A 1XFDA 3KLMX 4HRYA 2REBA 1AF4A 4Q1DA 5K3FA 1U3VA 3V8BA 2HLDA 2JGJA 3HM2A 2PVSA 5BSVA 1KYXA 1KU0A 1EK6A 5F4ZA 1H4QA 3FFAA 1XALA 1YS1X 2O2YA 4KIGA 1OZHA 4M8SA 4J9VA 1JL3A 3OQHA 5A62A 4MUFA 3BBPA 1JT9A 4G4SP 4AP9A 3Q2KA 7GPBA 2R2GA 1X1CA 3FYCA 3ELUA 1GUDA 3EWNA 1JH8A 3OQJA 4O2BA 4O25A 3QNMA 5EI5A 3SR0A 5LN1A 2WU1A 2JJ1D 4JJIA 2QN7A 2QGZA 1O7JA 1VBKA 2VAXA 4XVCA 3PUHA 5AJYA 5JSHA 5U1PA 5T3UA 2VQFB 4AJ9A 3DLCA 4BVBA 5D51S 3WQBA 1L7NA 1BEUB 1ETHA 1SC6A 5EYPB 5CCXA 2XOKA 3W8EA 4C0QC 2OK8A 3E58A 3J80A 2VPTA 3I9MA 4DCJA 3WO1A 3AIMA 1S6YA 4G84A 3L07A 1B0UA 1W94A 3C3BA 1G8KA 3AOEC 1CQPA 1I6LA 1C9EA 3F5SA 3MFYA 4FE4A 4MB6A 4AN1A 3O8RA 3DE3X 2JK1A 2TMGA 4I9UA 3L7IA 2DTEA 2OHXA 1XXLA 2G4VA 1V0JA 2JJQA 5BMVA 2RGDA 5IULC 1DQYA 1IXZA 1ZN2A 4ZMRA 3PCTA 1REQA 2RE8A 3P2IA 2EAUA 3FLAA 4JI7B 5CP8A 5DI3B 2ZJBA 2ZM6B 5FLYA 1RJDA 2V7VA 1VLJA 5EOVA 1EQUA 3DQQA 3D2BA 3LOPA 3E0QA 1JDBB 5ALYA 3PKJA 2C97A 1T1SA 4FYMA 4Q7KA 1SCUA 1P7WA 3BMCA 2QA5A 2NNWB 4ALLA 4ETMA 1Q83A 3A9SA 3EIUA 5AICA 1XZPA 2OFXA 3WRVA 2FEOA 3PE3A 4BX9A 4R0MA 5CD9A 3LHKA 4UQLA 3U5ZB 1N9GB 1M0EA 3WQSB 1T35A 1P81A 4F2WA 3R0IA 2J5BA 5KDOA 1YONA 2YOHA 3OPYB 1FSFA 5HA5A 1G4UR 1F2UB 2NQ2C 3BL8A 4MDEA 4PHFA 4TYMA 4UNSA 1YA8A 1CHDA 3H11B 4QGSA 2P5SA 5CFOA 4OGGA 5JNUA 5B1YA 5AKIA 1F17A 2PLAA 2IDKA 1WW2A 1HLDA 4Y6SA 4LWQA 2PSEA 1RXIA 3P0IA 3A9VA 1AHPA 1L4BA 1WXWA 4LHWA 4RJIA 3A70A 3JYNA 5AR1A 4B35A 4Y6RA 5KTNA 1Y8CA 4FEAA 5I3CA 1Z06A 1R18A 3JQEA 4W7HA 2VXCA 2RC6A 3H19A 2VDWB 2HLDD 3CZQA 2R68A 1QOZA 2YH2A 3IEUA 3K09C 5HCNA 3UOGA 1WCWA 4PLCA 4TZ6A 4JT8A 1YZVA 1E7YA 2OV1A 4M38A 3VPGA 1SVIA 3GRUA 2BCJQ 1M73E 5A0VA 4ZAWA 4EX6A 2VP6A 1K8XB 3K70D 3GDOA 5F51A 4JP5A 3PHIA 5KKAA 3UYKA 4DJTA 5BR8B 5CITA 4DV0B 4EUKA 2XT0A 1RKQA 1TQ6A 3H97A 2JA1A 2EEPA 3RSOA 4EPRA 1RJFA 4PE5B 4QOFA 2EFCB 4WIAA 3BTUA 1JSXA 3PDUA 4JEMA 4WY5A 2GJSA 2RARA 4B82A 4EJSC 1CD5A 2GYUA 3FZGA 1LNQA 2IV3A 3H05A 1QQ5A 3LF1A 4HMQA 5DEIA 3D7NA 2XOKD 1EDZA 4JL6A 2DBVO 2QAGB 4ZAFA 3AINA 4R40A 1YHYA 3UAGA 4BO5A 4MYCA 5GTDA 1WABA 1T6YA 3Q8XB 5JSZB 2PUVA 4OYYA 2CKMA 4F8JA 3VNSA 4EG4A 2P1RA 3EZ6A 3DGFC 1Y1RA 1EWTA 4Y1RB 2FPWA 1YO6A 4EHHA 3ICQB 2TMKA 2D4AA 2HSEA 2P2YA 4TXMA 4L02A 2L82A 1X8LA 4A8HA 2QVCA 2REQB 5A3VA 3KBBA 1OYOA 4HQRA 1KEZA 3HDVA 2AFVA 3DGEC 3WYGA 2DH5A 4E1BA 4JQZA 2DHCA 1VBFA 4DXHA 5B3AA 2XQVA 3K2QA 1M6EX 4Q21A 1Q7BA 3NIBA 4Q15A 1TYCA 2GSDA 3MWEA 4QT0A 1QQ7A 1JEQB 1THTA 3GMIA 2EIHA 4KXYA 3SMQA 3TNLA 1PT8A 1YF3A 2GK6A 3L6OO 2VKQA 1Z5VA 2EATA 1RTTA 2RGEA 3W6NA 3SZLA 5BYAA 2JI9A 3JATB 1KEEB 4GKJB 3I1YA 4FN4A 2W98A 5BWMA 5JJCA 4RA9A 4EYGA 3CR8A 3TUIC 3DPUA 2MU1A 1F0KA 1U2EA 3VKVA 3TQIA 1ZLYA 4QJ5A 2G70A 3U26A 4DV7B 3K9FC 3CG0A 4D9FA 1L7MA 1N1EA 1O9HA 3OCVA 4YB8A 5HPYB 3OUTA 2IYOA 4MV4A 2GVDC 4J43A 1ODJA 1ZIPA 2DZDA 3GJYA 4KFUA 5I7EA 4JB0A 1YRAA 3ESYA 3GIWA 3FTCA 5L6MB 3WP1B 1WBBA 1HI9A 3H9BA 3MD0A 2XDWA 2D7JA 2YDXA 3DCJA 2GEJA 4JKIA 3FCCA 3ABOB 3Q3JB 4TV8B 4YJGA 3BPSA 4CIDA 4QGGA 4CF5A 3A1NA 1VBMA 4HH0A 5ITWA 1E6UA 2GQ0A 2XBUA 4NQZA 2RHGB 2VQ3A 1QOPB 3CMMA 2FPKA 3FXAA 5T8KA 1B0PA 3EW9A 4V0RA 5ALQA 2AR9A 1GA1A 3WL8A 3I3SR 3KT8A 4MA0A 5IZ4A 1PG2A 3E2PA 1OI2A 4QQFA 5TJ9A 1WXEA 1XQWA 4EG5A 3EVZA 2F1JA 2GCGA 3JQQA 4YDRA 3NFYA 5E6RB 2EJUA 4NEHB 1JMKC 2WTBA 3B3AA 3NAZA 4W7IA 3FBTA 1EMDA 1P5RA 3UKDA 2P9QA 4CM5A 2A67A 3IJRA 4JDUA 2Q62A 4HDQB 3AVOA 4H9GA 4JOBA 4BMZA 4QPCA 3UUEA 3ZWAA 1BFUA 1W85B 2CVOA 1VTKA 2AG6A 2GRUA 1JLLA 2JCVA 3OP4A 1DXHA 4L08A 4TVKA 1KDPA 3AJEA 4U2DA 3W90A 5LQMA 3U7HB 4JI3B 3PFGA 4CMAA 3V1NA 3CXUA 3E9ZA 4JK3A 2VP3A 2VDUE 3D6FA 3G88A 3S2ZA 3NIDB 3PNVA 4N0EA 5I8ZA 3ES9A 3D3NA 1QU3A 3ASUA 1MIOA 5A7GA 2FZ5A 3DVAB 5KYVA 3VX3A 4B7AA 4YMUA 5HXAA 1FS5A 1Z25A 4KAXA 3K8YA 4JX9A 2ODWA 4NBTA 5KHAA 2BY4A 3EIOA 3FCOA 3B1JA 1QFYA 3K5PA 1MJGM 1PJAA 1ZGJA 2G07A 2OV4A 1EE9A 1KSFX 2OR3A 4HUQA 5FAXA 1KO7A 2ZLBA 1E7RA 2JBWA 2ZYTX 3VQTA 2XUHA 2ZBVA 3T1VA 2HA3A 1ABEA 3U4HA 2YR0A 5DBHX 1V96A 1NN1A 1F9AA 3EJ6A 1YQQA 3TCNA 4OLAA 2FETA 2PAAA 2OTCA 3FNFA 4I4TA 2YJ4A 5IJ0B 1DC8A 3WFZA 4QRDA 1D2MA 4BO0A 1JAYA 1NURA 4I2VA 3V55A 4NAVA 4OSEA 2J67A 2RHWA 3K92A 3LYAA 2CKDA 1WS6A 3AETA 3VDRA 4ARZB 2XI4A 3EGDB 8MHTA 3CUEF 4ECEA 1PU2A 1VZ3A 2PFSA 3S0JA 5FPKA 2XA9A 3DCYA 2J4FA 3CX4A 4GMGA 4N6OA 3S2IA 2BEVB 2ZFUA 3PG5A 1UEXC 3AESB 4R6WA 3LPNA 1A8SA 3SSNA 2Z6AA 1H2HA 4L74A 3PQ8A 1PZMA 2IEZA 1EUCA 2QD3A 2O0HA 4IMIB 2PUFA 3VISA 5CLHA 5FB3A 2FFRA 3DMHA 2IRWA 4D5EA 3RLIA 5CDYA 3KU1A 4P32A 4HNVA 1ML3A 2XBLA 1TI7A 4XCXA 2VRBA 4IJVA 2FTKE 2WG0A 4OBXA 1PJ2A 1BYUA 2Y66A 2IQIA 2ZK7A 4YONB 1TCUA 2ZKIA 4O8CA 1GCAA 2O19A 1FTQA 4PZZA 1X9HA 5JZBA 4LX8A 5G1PA 3V4PB 2IBTA 1ITZA 4MJLA 3GROA 5DK6A 1FXUA 5EIXA 3QXXA 1Z6XA 2R5FA 3A05A 4Q9NA 1D7AA 4REMA 3R8FA 3G0IA 1PJ8A 4DAEA 5EIFA 5LBUA 2ISSD 5ETJA 2ONJA 1ADBA 4B76A 4CV1A 1FUEA 2X0IA 2RONA 2H1IA 1Z73A 2CVZA 4QD3A 2IWHA 4MS3B 4YY3B 3NVAA 4CBVA 3UJHA 3K6JA 3JQPA 3EOBI 3KQSA 4KVAA 4Q9JA 2EERA 3RUFA 4CODB 4UTVA 4TVOA 4KDEA 2KSQA 4LVUA 1KK0A 4RACA 4EB6A 5KVSA 3HB0A 2C82A 1Y9ZA 4PLTA 4Q66C 5ITZB 1G8MA 2QR2A 2EZTA 1Q2XA 2QGNA 1FEZA 2CZGA 2JBAB 2YJNA 3IAM6 4ZI7A 3A36A 2AN9A 1SZCA 1YBMA 2O48X 1S89A 3A3YA 4OYLA 5B53A 2PA3A 4RBNA 2E2WA 1MPTA 2RCYA 3LK6A 4ZAXA 2DFTA 5AHKA 1WZIA 3J7TA 4OYRA 3T61A 2E6UX 3STUA 4P0QB 1A9XB 3U4DA 1XWIA 4D25A 3UJDA 3F6RA 3UWKA 4GECA 1KPIA 4DCCA 1I2DA 3N58A 5ICSA 5JRZA 4RTRA 4EP1A 2GMWA 3RU7A 2P9TA 3TRDA 3L8EA 3NASA 4DCGA 3AOEA 4Z49A 2BJVA 2NZUG 1MJ5A 4PINA 4Y9DA 2F8LA 2WKQA 3CF6R 1EZ1A 1VKOA 3MJ4A 3OT4A 2YWJA 2YN4A 1JE1A 1YI0A 2D1RA 3CTPA 1BWQA 1Q7TA 5EJMA 1WP9A 2R8YA 2Z2KA 2QMYA 5DEOA 3RUAA 1BJRE 3L4EA 3I2YX 4OBWA 3OEHA 4II7A 1PFQA 3GGOA 4DVJA 3DM9B 1PYGA 2P2NA 3HVKA 1RQXA 2C5FA 4L15A 1UDXA 3GRPA 3UWOA 1FP6A 6Q21A 3MOGA 3ZE1B 4JELA 1KMHB 1XZ8A 4HLDA 2HEGA 4I6EA 4QLAA 5I9MA 3RAPR 1Z13A 2ACKA 3NIGB 4Y98A 2VHXA 3E03A 3DR5A 4XUEA 2H31A 5B3LA 5JXJA 2EW8A 4KZPA 1JAXA 2X0KA 3B7WA 2ZYUX 1PSDA 2OHVA 1K27A 2WC1A 1E99A 3H3JA 4G3XA 4AUMA 5G53C 1YS9A 4R2KA 4Z0HO 1BDMA 3SEAA 1H2ZA 1F4VA 1N2XA 4HAUA 4ZVOA 5JH7B 1J09A 3CRNA 3JARA 4CM8A 4WBXC 1SPBS 2R00C 2YWHA 2QVXX 1PK8A 2RB4A 4I9HA 3EUFA 5DTJA 4DR7B 2H9AA 1NSYA 1Z0DA 1OA1A 2GZDA 1RHMA 4M3NA 4LQCA 1TAQA 2RGYA 2R11A 4DQUA 2CV2A 3WNBA 4ETWA 1HORA 3DDNA 1T4BA 5A6SB 2AI1A 5EG5A 2E49A 2CHUA 5AJVB 3H83A 4EX7A 4GI5A 4P3PA 3ETCA 2GYYA 1GRRA 1W49A 2OQVA 1AJEA 1G55A 4K7JA 4K2HA 2WJPA 3UQZA 2R8RA 3K96A 3KETA 2O05A 5BPFA 4W5JA 1B76A 2QNIA 2ZTSA 4Z1OA 1L1QA 2H29A 1SK9A 2QTCA 2Z30A 3D59A 2PJUA 3K35A 4RIEA 1Y7HA 2Q3DA 1LB1B 1D03A 2Q3BA 1MC4A 2JIMA 2FN4A 3K6RA 5IBCA 1FFEA 3KVNA 1QWOA 2MJLA 1U7OA 1Y1PA 2Y1LA 3O91A 4O4HB 1USGA 2AQKA 4OHVA 4D4IA 2A0UA 2NYRA 3ZDEA 3W5DA 3CEHA 2FEPA 4FINA 5JDIA 2WSYB 2LE0A 1XDGA 2E4UA 3D6JA 4EJSA 4W5RA 3G0CA 1Y9EA 1YJCA 5E3HA 4XVUA 1S2IA 4UUMA 2BTEA 4HDNA 2B4QA 4QTYA 1O87A 2O8VA 3EVAA 4OMDA 1ZMOA 2O3TA 4H35A 2QJWA 3E8SA 3NNSA 4HNAB 2JLSA 3KVYA 1XA3A 3TMKA 3RPEA 3SYKA 1QANA 4FGJA 2GHRA 4TL7A 2O5EA 3MJSA 3OM1A 1E1CB 4LC0A 4O4JB 1H1TA 3C0KA 1TJNA 1VL1A 1JTEA 1G18A 1P3JA 4R1LA 3PDHA 2WJWA 4NYMQ 3P97A 4MKGA 3HXMA 1P9OA 1HYHA 1UL1X 1G291 3MTAA 3OEHD 3KE9A 3FNGA 3M8KA 2C2GA 1YZTA 3O95A 5DMHA 1BW9A 3RSLA 5HM8A 2JFFA 1J06A 1WHTA 4YJ3F 2W70A 3RTGA 2RH9B 3CT4A 4ZCIA 5E7IA 5E0KB 4TS9A 1C0EA 2VHJA 3HSYA 3PNSA 4DQXA 3GLFB 3CO5A 2YICA 3FTPA 3HEAA 4XE5A 2WWHA 3QY9A 4UUOA 3JAMA 3RFUA 4G1CA 3RDPA 4IHJB 1GDHA 2FRXA 3G2HA 4LJKA 4MAFA 4YJDA 3ADCA 2YWCA 1MX3A 3CU5A 3DDOA 3V4ZA 4KKVA 3R7SA 1CZKA 2ZETA 1ISIA 5AI9A 1G42A 2GO7A 4HUTA 3H1TA 3EG5A 4LQ4A 2J3QA 1AMUA 1GITA 4KMRA 5J1SB 3EPHA 3LHFA 3H7AA 4V1CB 3HCCA 3IP1A 5EE1A 4ZO8A 1NRJB 2ZIFA 3B6MA 3BXEA 1XD8A 3EA4A 3QVVA 1V6AA 4TQ9A 4UPDA 5I8PA 1M1NA 3IB6A 4DLTA 4F9FA 5TGDA 3I05A 1RBQA 3OZWA 1TRKA 4M1KA 4B3CA 4JC5A 1N7GA 2I7XA 5JRJA 3CNOA 1EH5A 2GYWA 3N8DA 4FGZA 3U7RA 1IEVA 2AT1A 2LRHA 4N1AA 1AQYA 1BEZA 3SQXA 4GQAA 3DBOB 3MC1A 7MHTA 2H2GA 3DVRX 2Q3LA 4RC9A 2QRVB 3DHNA 3MN1A 5EE0A 2BMVA 3CG4A 3I12A 4G1UC 1AKVA 3GVIA 3MQ4A 2V4UA 4BQEA 1XG5A 3C15C 4BJ5A 1E6CA 2FMKA 4D99A 4RTQA 1WB4A 3IXMA 4FZJA 1WSBA 2FF7A 2BTOA 1I6MA 2FW0A 2GPBA 4LPKA 3AYXB 3T1OA 3V4LA 1GJRA 4IOJA 1G0NA 1B8PA 3EMKA 1T3TA 2GF9A 2PX6A 5JXWA 1FNSA 1SC4A 1OBVA 3N3BC 2DJ5A 2VDLB 1DEOA 1QKIA 4Q82A 2WTAA 4I3FA 3VZPA 1Z0IA 2N1MA 4MXDA 4C4PA 2FUEA 4IXNA 4TVSA 5AVXA 3F9IA 4LBYA 1OC2A 1FJHA 2HHAA 4JQOA 4EZEA 2ZRDA 2IC5A 1IHDA 4RZSA 5SY4A 5TY0A 2YN2A 1MFZA 2BHLA 2AA3A 4IIJF 4NENA 5DKFA 5AXAA 2NU7B 2BH2A 5GY7A 3JD4A 1YL7A 3EVNA 1L5WA 4FFMA 4FT2A 1EP3B 5IDVA 5AKZA 5JSKA 3TL3A 4EPVA 3QTBA 4J16C 2WLTA 3M1YA 4I8IA 4DPKA 3NBFA 4F1KA 3BMOB 1JEYA 1L3BA 4PZ9A 4TRMA 2J6BA 3IRUA 3U48A 3GC6A 4G0YA 4EVRA 5ICEA 1Y9JA 4B44A 1BCSB 3TK1A 3BZWA 3PEUA 4IJUA 3VHXA 4QXQA 1MC1A 3E22B 4KXNA 1QQ6A 1IC6A 1O5TA 3R3HA 2V9ZA 2ZVDA 1LA2A 1FJXA 3E7WA 3PV0A 3WWOA 3C3JA 5AQ1A 3VO2A 3VU9A 2PWPA 1T9HA 2VTBA 2CMDA 3BDAA 3HJRA 4RW0A 3WL5A 3WWCA 9ATCA 1TEZA 4YCNA 2B0CA 1P1IA 3SBDA 4GNRA 3OQMA 4CRWB 4A2QA 4QUDA 3TOZA 3PEVA 1NJ6A 1UDAA 3NCTA 2ZR7A 1FMFA 3V42A 3C6KA 1B16A 1G2PA 4ZFNA 3D7MA 3KQLA 1QPZA 1ESDA 2YUIA 2FPOA 3H9UA 1IVSA 1C3OA 2JFYA 2O1WA 2B9EA 3STHA 3CZAA 4YS6A 1KQFA 4KRXA 5GJWC 1LH0A 2PH7A 3IQFA 3V00A 5JNVA 1W4LA 1D09A 3A1FA 1PT5A 1FZTA 2FSPA 3C97A 3U3MA 3A25A 2EHDA 5CFQA 3AIIA 2OV2A 5KHLB 1H2RS 3DF7A 4JX8A 3ROZA 3H5AA 1XZNA 1ZGBA 3P32A 4AWAA 4DGSA 1R8SA 3D3QA 4RGVA 4YMTA 2A0KA 4QYTA 4FCCA 1WXQA 2OBNA 3IAFA 5H1YA 4NBKA 5HCUA 4D44A 4IWXA 5HQ3A 4QSHA 1U8ZA 2R87A 5LNK6 4NABA 3KHUA 1WRBA 2OE2A 5LOVF 1KK1A 2PCJA 2N75A 3E1SA 3NTQA 3PU6A 4XVQA 1UBRS 5DO9A 3OZXA 2OXIA 1XTZA 2FFBA 4U6QA 5E6UB 3UGKA 1V9CA 4O3FA 1QTQA 3OZCA 5GVRA 1IZ0A 1IVYA 3EDOA 2O7RA 2P69A 3NBAA 2IYLD 1EFVA 2O20A 4KQWA 5TVKA 5HZMA 5LXTF 4AZWA 1JWLA 2I8LA 2ASEA 4PX5A 3LV8A 3DZ8A 3LT5A 4POOA 1DCMA 1F2TA 5C32A 4JYMA 2P5TB 3WR5A 3D0QA 3QVXA 5TV2A 5FPPA 2GJKA 4G5RA 4G89A 1QQBA 4HVCA 1QHSA 2AC4A 3ESDA 3MELA 1I2BA 4L73A 3QBJA 5D1HA 2XNDA 1C0IA 2FE4A 4WGGA 4BIIA 5A5FA 3CVWA 4JUAA 2WAAA 1O96B 2HGZA 4JLDA 3E9NA 4CGZA 3OE7A 2UXCB 1RM5A 3KL4A 1FMJA 3QFSA 4H6VA 3RWOA 1GPUA 2AFIE 1TGVA 3H5RA 3IKMB 3H9QA 1GUZA 1Y1QA 3PC3A 4GIBA 3VRHA 1XTUA 4Z86A 2HI0A 1P2SA 2TS1A 2ZIUB 3EIFA 2VEOA 4EUEA 1SMKA 1WEKA 1I4WA 4UPVA 1TZ2A 5DCWA 1HE5A 1GXSB 1W8IA 3I5MA 3IP7A 4G9GA 1ZIDA 1GN8A 4V38A 3R9KA 4DA8A 5CG2A 1ODLA 4EJ0A 3D6MA 3TSWA 3UGJA 4KMOA 4EL0A 3RANA 1S0UA 4HO1X 3WK4A 4W5QA 1KYQA 4MCHA 2XQJA 5JNTA 1H66A 4OXRA 3RB8A 3RV4A 3WZLA 1P4RA 1POWA 3AX6A 5CPBA 3FKSA 3ZU4A 5LIPA 3CF2A 5FRDA 4ZDJA 1A5BB 4P08A 3VOBA 3CE9A 3ZH9B 2ZW9A 1TTTA 4FD2A 4UHEA 4C4YA 1EWQA 1GHTA 2Z8XA 2E0IA 2MMCA 3MINA 3NVKI 3EIXA 2ZZKA 2PRYA 3H0EA 1RHJA 1U0GA 2G1JA 4WEOA 3EUWA 3KKNA 4FHGA 4BO4A 1T4CA 2I6UA 4XVHA 3U0VA 2FSIA 1RLOA 3MW8A 1VJ1A 7REQB 1IOVA 1OZ0A 2IUTA 4J0KA 3WGTA 2NUBA 2IV7A 4INAA 3H2BA 1AKWA 4O0LA 4PAWA 4DTCA 2NSLA 4L4RA 4MQUA 1EE1A 2ATCA 1N5DA 1QCZA 4L9AA 4G5QA 5AW6A 2VJPA 1N8KA 2DHEA 2Z6VA 3D2LA 2PM8A 3IILA 4F8EA 1JDVA 4X45A 4DV5B 2HT1A 1MENA 4HXGA 5A3RA 3L40A 4U1RA 2ZJ6A 4N47A 1WZCA 4HGQA 2ZJYA 4ZVLA 4AJOA 4BMVA 2ZIXA 4GU5A 1FLNA 3C8HA 2YWEA 5CVEA 3VTZA 4DA7A 4CLEA 4NARA 4B0OA 2V4ZA 1N7JA 2WD8A 2YC2C 3NYWA 5MGBA 1N2CE 3C8ZA 4IG4A 3NHWA 3L4KA 3HCBA 3IX7A 4YMGA 3IRVA 3AUXA 4ABYA 4RPJA 1SKAA 3KJNA 3W1VA 2VBGA 3BG5A 1CEEA 3KQNA 1P1RA 1UJ6A 2D7CA 3CW2A 3PQDA 4BU1A 1AUVA 1JHMA 2HA0A 1UZLA 2I62A 2ZS7A 2PR2A 1KYWA 3KLBA 3PNLA 4JV5B 1E1YA 1YXMA 1P2VA 3K9WA 2J9FA 4I9GA 1ORWA 1P29A 3NHFA 2GAOA 2LPMA 4OBBA 4GOXA 2CL5A 4NYJQ 1YZHA 1Z7EA 5EEGA 2FZ4A 3SHOA 4A0FA 3BFKA 2MYTA 3KPYA 1QORA 2O14A 1ZO8A 2NQTA 2VHZA 4HNSA 3WP0A 4C22A 2F67A 2GFIA 2H00A 1ZAKA 4D96A 4I1OA 1Y4SA 3RI3A 3ZVRA 2XNDD 3RG2A 4G23A 4DUGA 4PLGA 3WLHA 4CM6A 2IZOA 4X66B 4KWIA 3TI9A 3OE7D 2RG7A 3PPXA 1W9HA 2IZZA 1L3CA 3ZIAA 3VA7A 2AMFA 2JG3A 2HB6A 3LF2A 3HGQA 1Z17A 2O0KA 3KJHA 2BGMA 5BQOA 1GGKA 1ARZA 5B1EA 1IBKB 1OU4A 2GBPA 4KXWA 1FPQA 4LYGA 1UIMA 1IPFA 4OBEA 4DY4A 1M66A 3GT0A 3GT7A 1OT3A 1H2BA 3C87A 5EXSA 4UU7A 4YRJA 3NDIA 1YD7A 3V4FA 3V4VB 5C2JB 5JYDA 4M2LA 4PSUA 1BWRA 5EKDA 4G85A 5EJFA 3K0FA 5HJ2A 1G5FA 1GPJA 1LK0A 3PUWA 3ZHCA 2QMQA 4CTJA 3SS7X 5KCZA 1BMDA 2QW0X 5KREA 2AMJA 3GARA 2QTHA 5KOJA 3W06A 4MVJE 3FG9A 4DLVA 3ZKWA 5HM6A 2FA9A 1N0VC 3AP2A 3FYTA 1P1BA 2M1XA 1L5HA 3ZEAA 3FKSD 1OUMA 4FS8A 1M2VB 4EGFA 3QPDA 3QEMA 4BNTA 2LNDA 3MLEA 5EFOA 1ZH8A 5E1OA 3I42A 3Q7QA 1XZLA 1RMYA 1MO3A 2Y71A 4I50A 1V39A 2Y27A 1G20A 3ETHA 1GVNB 4M49A 1L4LA 1YAHA 1RJEA 1UBJS 1VPEA 3LVRE 3PQ7A 1NMQA 3PTAA 3PGMA 2P5UA 1GY8A 2QZSA 3M6XA 4E33A 2AOVA 2IHYA 3AR4A 1DARA 1BE1A 1E79A 2FSSA 2Q1SA 3SK0A 3PITA 4KVFA 4PYNA 2QTNA 3UTDA 3Q1LA 3V33A 2ZJOA 1GVHA 1E3TA 4L4YA 1G4HA 5B1HA 2W2VA 5P8WA 1H6BA 2O3JA 3I30X 3QTTA 3RRMA 1RW4A 2CWDA 3H9EO 5DHQA 3WLTA 2KW5A 5KO2A 1ENPA 1M2OB 2YWFA 3OECA 4ND5A 4UHJA 1RACA 1EQAA 4RZXA 3VPHA 4DJJA 2AF4C 4E7OA 4LF8B 3A7EA 2X9VA 3NTRA 1XJCA 4AF6A 3KR0A 3A6GA 3JQBC 4JUDX 3R74A 2Q6KA 4JLWA 4WXHA 3CS3A 1QF6A 4D9EA 2PKCA 2GFQA 1UKCA 3ECCA 3JD2A 3R0XA 3EF0A 1V4NA 4NOLA 2HDHA 3IUPA 2BVNA 2PUAA 2P2CA 2OY0A 2VBIA 1JRLA 1KF0A 1R9GA 3AJ8A 3HB4X 4BY9E 3HEBA 2VF5X 3T06B 3U9SA 1TIPA 2J5XA 4FTWA 2Z56A 3LHDA 4C2AA 4HB3A 4DUGD 1QYDA 1DG9A 1MX9A 3VKFA 2QL6A 2ZVPX 1OFGA 3DDSA 4XDZA 3ZIAD 4CLRA 4WCFB 1Q11A 2DWQA 3BAFA 3ZGNA 4QM6A 1KETA 3C45A 4WINA 4UU1A 4TYWA 2WQZA 3HKCB 5KINB 1OVMA 4IW3B 4D8UA 1RE1A 1Z6QA 4V0QA 1R0RE 4UUPA 4PSKA 2KI5A 1J7JA 4R2HA 5LQSA 1IJFA 1GKYA 4RZQA 5FBZA 3T0GA 4BKMA 4YV2A 4ZEXA 4HKTA 2Q7DA 5CXUA 3A28A 3RVSA 1XMOB 1WXHA 1Y1LA 1Z6YA 4HWPA 4A23A 1Q7CA 1P44A 1JMYA 1G8AA 1TFUA 2OHFA 1FMTA 4LOIA 3DTVB 3ROFA 4J16A 2JFOA 2XHEA 3DV9A 4MW9A 4B1FA 4BMNA 5A3JA 1GZ7A 1GRQA 1KI9A 1N7IA 4PS1A 1JFFB 4Y2PA 4C0JA 2VF8A 4E2FA 2GK7A 4PPYA 4F6CA 1VPTA 3FHOA 1NSFA 2ZANA 3HXTA 3DBIA 3KOUA 4BFZA 1N8TA 4L57A 4CNQA 3O92A 5EAIA 1QAOA 3CEPB 3SXUB 2OHOA 5D6NA 5GZ6A 2WHPA 4NKRA 1E9FA 4L4UA 3G68A 5GQSA 2BFCB 1FTYA 5FUVA 4RSHA 5EE3A 5KHOC 3GL9A 3MTEA 1PEDA 2AIRA 1ZITA 1IUNA 2G77B 2I34A 4TS4A 4UHCA 4TMWA 4TKLA 2HPZA 1E79D 1S1CA 2WVHA 3ISTA 4M0UA 3JRWA 3TW4A 1NF8A 2X8BA 1RQRA 2ZDHA 5IARA 2J7PA 3OIFA 4HI0E 4OMCA 2Q6VA 3TMYA 1I3NA 1ZEMA 1SXJE 5EZSA 3EQ8A 5DISB 1R4MA 2HHCA 2IF2A 2WYUA 4MZXA 1EXDA 2YFKA 3QXCA 4K28A 1X3SA 1TEXA 4DNQA 3VU8A 2FZVA 3DAHA 1EVJA 4KN8A 3ER9A 1HDYA 3VFDA 1QZ3A 5F1KA 3RYTC 1HY3A 1XTJA 1CQIB 1VHDA 2ZSJA 4L6CA 1Q19A 4H0NA 4UM7A 1XZDA 1FVHA 2IELA 2FVYA 2ZJ2A 3JQ7B 5FOTA 4EPTA 1L7OA 3ZBTA 4C05A 2H0QA 2QSJA 5EWMB 4N40A 4Q3EA 3INRA 4Q16A 1B93A 1PJQA 1P2BA 4IEIA 4QE3A 1M74A 1NI4A 1DBPA 1Y1SA 2OGWA 1Z39A 1DO8A 4URXR 2ECPA 1YHNA 1U81A 2OWEA 3ZCUA 4JGBA 4URVR 2P6RA 4CEJA 5AH0A 1V5IA 4ENTA 1TK2A 1ZGCA 2VEDA 2OD2A 4JLBA 4K46A 3T9EA 4RZUA 3W5HA 3OIYA 3X43A 3RVJA 5F7OA 2ONKA 3QUSA 1C3XA 1YFKA 2SHKA 2A1TR 3DO8A 4DG9A 3ZW9A 5IJZA 3Q2OA 2P2LA 2NZVG 2QENA 4ZT7A 2ZAOA 5BV0A 5CCBA 4L27A 1YB1A 1CV2A 3D6NB 4DR6B 2IYXA 3TTWA 3INNA 2C8LA 3PX2A 4HAVA 5TPWA 3ELDA 3OHPA 4NE7A 1IHXA 1G2IA 1CS4C 2DBRA 3M82A 4IKOA 3OFNA 4U7TB 5HZGA 2FW8A 2IPAB 4PYKA 5JALA 4WJLA 1Z4PX 3BD6A 5JV5A 1VG9B 4EQ6B 4D02A 1U0JA 4FP9A 4KREA 2UZ3A 3FPGA 2YX1A 1TCBA 3E9YA 3PQ2A 4JHLA 4P7FA 5CVJA 3WLIA 3X2SA 1UQUA 1U28C 5E1MA 2YVKA 3NVMB 3RS3A 3CF4A 2YHIA 3NTLA 1NJ1A 1E89A 1WXDA 2ADMA 3KAKA 2V6MA 4OLJA 3TZKA 1I3KA 2Q1XA 4F9GA 5JAMA 2P78A 3HM9A 3LUAA 5AK5A 1X1QA 1U7HA 3CZPA 4P4TA 2O06A 2H9IA 1TO1E 3AO0B 3ECSA 4K05A 1CYEA 1J25A 2D0OB 3B9RA 5K05A 2VQ6A 3LY5A 2G8LA 3TD6A 3H3FA 4YAFA 4QA9A 4R5HA 1XEXB 1L7DA 2HO4A 4PIMA 3VH1A 1AMOA 1R8YA 1XLWA 4KXXA 1E6LA 3KZ1E 3MUNA 3QHPA 4MO9A 1U3CA 2HYDA 3AG5A 1JXAA 5J47A 2G6TA 5BSWA 4JLOA 2FPGB 2H18A 1Z26A 1M2HA 5JARA 1ISJA 4FFBB 4WERA 2J7PD 3HU1A 4K6OA 4FPXA 3CNHA 2A3NA 4CV0A 1U5CA 3KOWA 2H63A 5K8UA 2P0YA 3PNYA 1NT2A 3AHHA 2AL7A 3WLMA 3ZD7A 1E77A 1HQYE 2QHXA 3K1AA 4H31A 3U7QA 1DJLA 5HKOA 5K8IA 3AKZA 1J22A 1MIHA 1NYRA 2BM9A 3NU1A 3DZJA 5JXIA 2NTJA 3FOCA 1IG0A 4R1TA 3HJNA 4L8LA 4LSMA 5HQJA 5FFFA 1Z56C 5BN1A 1PKEA 4UCQA 1I9CA 2FMXA 3EIQA 4AN0A 1T5BA 1YTLA 4W1PA 2FR1A 3JRNA 3R75A 2X3UA 1L4MA 1UKEA 1A04A 4NZPA 2LCQA 4EY3A 5AI6A 4Q47A 4XB1A 1CIJA 1VXRA 1CF2O 1YMVA 1ENYA 1PE0A 3D7RA 4PFQA 3SICE 2Q29A 3B13B 1MV5A 1PQPA 2W93A 2A3RA 1LEHA 1SU7A 4YQZA 5JHGB 3OBBA 4XPZA 1FSZA 3OHSX 3PXEA 5E4FA 2XJ9A 1V95A 1CXZA 4AJ1A 4CZ2A 2F9LA