3ROLA

Murine class i major histocompatibility complex h-2kb in complex with post-translationally modified lcmv-derived gp34-41 peptide, comprising a nitrotyrosine at position 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
271
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 75
structure length 271
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rolA01
1EO8H 43C9A 1CFVH 3S35H 4UQ3B 2CR3A 5BW7C 1E4WL 4F80A 4X5WB 4YBQC 2UZXB 3BN9C 4PG9A 1NGQL 2W9LA 4NIKB 1S7RA 3QHFH 4CMHB 1YNLH 3HMXL 3DGGA 1HQRB 5CEXA 5GZOC 5IR1A 5DI8B 4PRPB 1A0QH 2WWMC 3GIVB 1EK3A 3O2VL 2IALB 2NXZC 4LDOB 5DQ9A 4LSRH 1BQHA 1DUZB 3MRJA 1RHHB 3WNNA 1AP2B 5IJVB 5KG9A 1J1XL 3ESUF 4NRXB 4JGUA 3MPCA 4OLUL 4N0YL 3U82B 2L7JA 1HHKA 2XZZA 1F42A 1OT2A 2X2YA 3O2WL 5D5MF 5ICYB 3IJYB 4BSVB 3OHXB 1E28B 1QO3B 4QRRB 3TNNB 3UJJL 3SJVD 1KJ2A 4G6KL 4HKBA 2ICWB 3VDCA 1KIPA 5I1JL 3GGWB 1S9XB 5DMGC 1UJTA 4S1QL 5EDXA 2XFXB 5SX4H 1XMWA 1U95A 1MUJB 4Z5RA 1II4E 2DI9A 2PYED 4CVWA 5D1ZB 4M7JH 4PJCA 1QQDA 1ZLSH 3U7YH 1MFBH 3RWGA 3QUKB 3VXSD 5D7LE 5EUOF 2DICA 4CW1A 3BHBB 3BP6B 5HHMB 5DZNA 4NCDA 5D2NA 2Y1VA 3DTXB 4RAVB 3UJIL 4QGYA 2Q20A 1RZGB 2VC2H 3NCMA 3V4PH 3LB6D 1FC1A 4PRIE 4UILH 5K93A 4D3CL 3MUY1 3W2DL 3D85B 6FABL 2DKSA 3TN0C 4K94C 3BSZH 5F3BA 4LLQB 4MAYC 2IG2H 4E41B 3ULSA 2YPKA 4TRPL 1WBZB 3V7MA 2BHUA 3QCUL 3HPLA 4EIGB 1J8HD 2QHRL 4V1DB 2E7LA 1VPOL 3EYFB 5CZVL 2VE6A 2MQ3A 1T89C 1NFIA 1QFWI 4ZG1A 4U05A 4NUJA 5D70H 1PKQE 1KB5L 4LPWA 1OTSD 4GMSL 1H8NA 4OT1H 3QXDA 5F9JB 3E6FB 2OCFD 5CJXC 4K7PY 4XMLH 2A2QT 2HWZH 1LO2L 1J05B 1S7TA 3E2HB 3B8SA 3O11A 2VXSL 5C0EB 5EO1A 2ERJB 1DANU 5HGDB 2EE3A 2NY2C 3LDBB 3RDTD 5INDB 3CVHH 4PJ5D 1ZLWK 5L0QB 1XGUA 4BQ8A 1TDQA 1T7VA 4HX1A 5FA4B 5E9DA 4TPRH 4CBPA 1HIML 5KVGL 4GG6A 1FYTA 3VMPA 1EFXD 5C0BE 1HXMB 3M07A 5IP4A 3U46A 4X6BA 2PXYA 1NDGB 5EPMB 1E4WH 4RRPA 2AV1B 5E6ZA 3MFFB 2VDQH 5DRWB 4JRXE 3MV9B 4RGNE 1NGQH 1VDGA 4PDCE 1TVHA 1KULA 2XOTA 3STBA 2DQCL 1I7UB 3HMXH 5DLML 2BSED 1Z5LB 1BX2B 3ARQA 1F00I 1YY9D 4JPIB 3O2VH 1JHTA 3SGDI 4ALAL 4X9IA 4KKAC 5IOPB 2HJFB 4JHBA 1XZ0B 3QQ4A 3K4DA 1J1XH 4UDTB 3C8DA 2CLRA 4OLUH 1HSBA 4N0YH 2J6EA 4YHOL 4QRPD 1YEIL 3SO3C 1XGYL 3SCMC 1MCKA 4FQQB 4EKXA 5B39G 4ETYA 2ITDB 1BFOB 3BD4A 4ZUSA 3O2WH 3CPLB 3OAZH 4F15C 3UJJH 4U1KA 1RZIB 2YN3A 4G6KH 4JFQB 5KANI 1ORSA 1OGTB 5I1JH 1MFEL 5D7LA 3L5WB 5I66A 2H3NA 3O45A 4S1QH 2I27N 4A2MA 5BVJA 1P84J 1IEBA 2EIZB 4BSWB 4P23D 1XIWD 5T1KA 1JPGB 1BF8A 3ARDA 2VOTA 4NM8L 2B4CC 3LRSB 2DLTA 4XT1C 1NAMB 4NQDA 3MRKA 1DVFB 3JSSA 2APFA 3GMQB 4AEHH 3S7GA 3H8NA 4DGIL 1DBKL 4FHBD 3T0XA 2P45B 3ARGC 4UAOB 2YEZB 3BXNB 3X11B 2XTJC 4UMGA 2CUHA 3MMEB 4D3CH 2QSQA 2X10A 3W2DH 4G59A 2P5WA 3OR6A 3QCTL 3V8CA 6FABH 3Q5YA 3RZCA 1L6ZA 4MNQB 5F89A 4CN1A 1A7OL 3QIBA 3NIFE 1GVIA 2HLAB 4ZXBC 4TRPH 3QCUH 1P1ZB 4WI5A 2QHRH 1VPOH 1A7RL 5CZVH 2YPLA 3QEGH 2EDQA 5D9SA 1JTOA 2B8OT 1GZQB 3ULVF 4ZO8A 3U0WH 4O58L 3VXRA 2FATL 2VXQL 3JV4A 1KB5H 2HFEB 4A6YL 4Q9CA 4F9LA 1SYVA 2BNRB 1VGEL 2O5ZL 4U0QB 4Y19A 1OQXA 4WI9A 3T0WA 4P5MB 4Y5YB 2ATPA 1A6AB 4PRPD 1LO2H 4R6UA 3UBXB 4WFGD 5JZ7C 2VXSH 3BD5A 3RVVD 4HUXB 3BIAX 3HE6B 3IGAB 2V9RA 4DEPC 1KJMB 1DBML 2DYPA 3LAFA 2GQHA 2GT9B 4N0CC 4PJBF 1NH6A 4GLRH 2VQ1B 1JF1A 2DQEH 5KVGH 3PL6C 4GKZB 3P73B 1AGDB 1QSEE 3CXDL 4X7SL 3C5JA 1ZHBB 3U2SB 3AFLA 1NFDA 3FT2B 1U8HA 4RGNC 3OXSB 4ZFGL 4XBGA 1G9NC 2R29L 1I1YB 4I13B 3MOQA 4U3CA 3OJDB 3K74B 4WUUB 1WAAE 5ACLA 5GXBB 4DUXA 1JZ4A 1AI1L 2DQCH 5DLMH 1IM3A 4EXKA 2RHEA 4WNQA 1T2QL 4DKDC 4AT6B 2XWTB 4ALAH 4HPOL 4PRDA 5TE4L 3L3GA 4NT6B 2M8XA 1QVOA 3HZKA 5FO9B 4C56D 4YHOH 4RFEB 1YEIH 1XGYH 2V5YA 2VQTA 4OF5A 1K8IA 2BY2A 5DFVD 2FIKB 3RTQB 1DDHB 4G6AD 1URLA 2Q86B 2DRUA 3QAZC 4XGZB 5D2LB 2FZ3B 5CBEA 1ZTXH 1Q94A 5JUEL 1MFEH 4ZD3L 1BJ8A 1D3CA 3TBYB 1BOGA 1MY7A 1CFNA 2GFBB 5E8EA 1ZHLA 3LSOB 3L95A 1FN4A 2VISA 4GKNB 4ODXA 4NM8H 5ESQB 1KPRA 2FRGP 2BVUA 3WHE1 2HVJA 1OAYL 3DJ9A 1TVBA 4X4MA 2DJSA 4DGIH 2DF3A 2VERN 3PGCB 2Z9TA 3SJVA 2H26A 3H2WA 3NFNB 5KBNC 1C5BL 3QDHA 4L3AA 3GI8L 5CILL 4PR5B 1PZUB 3QCTH 4XVUD 5TFSL 4BFIA 5JXAH 2D0FA 2PYEA 2Q3ZA 4N8VA 2H32A 1A7OH 2MHAA 2VB5A 2C3VA 2ZJSL 5JDSB 4LOUD 4F7PB 1NCBL 2MQCA 5DHYA 4NNYA 1A7RH 5I75B 3VXSA 4HUVA 1LP9B 3NCYP 4DQOL 1D5MB 1I1AC 12E8L 3ALWA 2EKSA 4O58H 2FATH 2VXQH 4JFDE 3WIIL 5IWLA 4FQXA 2ADFL 2XNAB 3VGEA 4MQ7B 2O5ZH 1VGEH 4EOWL 5C70A 1JZ5A 1J1OL 1FVEA 3HAEB 4X7TA 5EB9A 1YMHB 1WLHA 3TH2T 1YYML 5EC1B 1IKNC 1OTUC 5TH2A 1U8OB 5EBLA 1LE5A 4NKDA 4ZTOL 3SDCB 5D1XA 3BO8B 1ZLUH 1HSAB 4M61A 5HHQA 5I1LA 4O5LL 2HH0H 1DBMH 5KW9L 2VAJA 3BE1L 5IHZA 5GSVB 4DOHB 4TN9A 5I1AB 1JFQL 2NY7L 1EEZA 4WFFE 3TO2A 1HYSC 4J23A 5SX5H 3O8XC 4U3HA 2K9UA 4XXDA 3NVQA 1N59A 2R2CA 5J6GA 2J2ZA 5HGAB 3L3JA 4X7SH 4BK5A 1PZ5B 3QUML 1NFDF 1JNJA 3KPMA 4PJGF 4ZFOA 1YMME 1HHHA 4ZFGH 2GEEA 1K8DA 2HJLB 2R29H 2OYPA 4Z7QF 1KJ2L 3QO0B 3U0PA 3RDTA 4AENA 1KEML 4N1CA 4PJ5A 2VKXA 2HG5B 1AI1H 3IFPB 4G80A 1MCLA 4HGKC 3QJFA 3MREA 2FEEL 3G6JB 3VXMB 3UZVB 4KGJA 1T2QH 1OLZA 4HPOH 3BDBA 1D5XB 4U1LB 5TE4H 2CRMA 1Z9MA 1WWCA 2NTSP 1G7JB 4DKEL 1EFXA 3B9KB 5C08E 1ZWIA 1MHHB 1YJDC 1FQ9C 3GUTA 2J5LB 4PJHE 5CLTA 4K94L 5L2JA 2J7LA 2YXMA 4RMWA 1IC7L 5HHOD 3ZE2F 5JUEH 3ZTJH 1OGAE 3T2NH 5JHDB 1A6UL 1YUHA 3DYPA 1KIRA 5I2IB 4XTRD 4ZD3H 1FGVL 4L9LC 2UYLB 4MJIA 3LVEA 3VCLB 2FHCA 4ORGB 4OFIA 1MJUL 4PJDE 5IB4B 4P9HC 5F1NB 4JFPB 4YDLB 1KTLA 4WV1A 1JPFB 5ETUB 1NMCB 1WC7A 4WWKD 2DD8L 4QRPA 1AFVL 1OAYH 5KVDL 1DQML 2ADGA 4Y4FB 5DC9B 1U8NA 3MLVL 3OXRB 3L5HA 4HSQA 4K3GA 2BSRB 4GKOA 4QRQA 1VKXB 3AUVA 2BY0A 5TQ2L 1W72A 2EDEA 5GGTH 3P4NA 3HZYB 3ZKXB 2R1YB 2VL5B 1C5BH 1AXSB 5IESH 3G6AB 2VDLL 3H9HA 5CILH 3ME0A 3MA7B 4UIMB 2WBWB 5TFSH 5DEGB 4WW1A 4LLUB 1IAIL 3BPNC 1D9KB 2VUOA 2ZJSH 4NO0D 1Z2KA 3IDNB 1NCBH 1L9MA 5E8OB 2W07A 5AAWA 5C09B 4DQOH 5HVFB 4M02A 12E8H 4PGJA 3VGGA 4IRZL 3WIIH 4JJ5B 1ZKAA 4ZO7A 1H5BB 3TVMD 4WUUD 2ADFH 4H26A 1P7HL 2C4XA 2EDFA 3MLTA 1FNHA 4EOWH 1J1OH 1ZS8A 1QEWA 1CXFA 1YYMH 4LSVL 2F74B 2CPCA 3H0TA 4ZTOH 5DK3A 4ODVH 3CDYA 1FE8H 2AJUH 3WIFA 1P6AB 4GXUM 4H1LB 4O5LH 5KW9H 4X5XB 3BE1H 1OW0C 1Q8MA 3MZGB 2XZAL 1VEMA 4PLOB 4AEFA 4HUMB 1XCTB 2BCKB 1JFQH 2NY7H 3RTQD 3RGVB 4M6ML 4UZGA 1S7WA 5MERA 3ZT7A 4WCYL 4YIQB 2HTLC 5KZCB 2D31A 5BZWB 2AJZA 2J6EL 4ZUUA 2AQ3A 3HG1B 3QUMH 4AM0A 4L4JA 1AGFB 1RU9L 1BOYA 2DQDL 1T0MB 1JP5A 1G7HB 4AH2A 4MDIB 1Q72H 5GZND 3S36X 3BKMH 3SBWC 1KJ2H 3PGFL 2BY1A 2Y6SC 3VFSB 1KEMH 2VDNL 3IKCB 3NCFB 3REWA 3GNML 1DLFH 3HI5L 1F6LL 5HYSA 5ELIA 4QHMA 1CFSB 3MRCB 3B6SB 5ILTL 4FMFA 5DGQA 1X5HA 5JA9A 2CLZA 2RFXA 5DD3L 4DKEH 1LD9A 4DZ8A 1QRKA 2ID5A 4DK3A 3FQWA 3RX5A 3L3KB 4K94H 2PO6D 4J3OC 3D0LB 3C6LD 2Z8VC 4W6WB 1CDBA 1JTPA 3OG6B 4FTVD 3R0NA 1IC7H 1PD6A 4IRSA 4P99A 5A2KH 1A6UH 5HHNB 3SDDB 1X7QA 5DUML 4FG6C 2R23B 1CF8L 1F90L 1FGVH 3KXFB 2VYRE 4D0BA 4KDWA 4JN2A 4P46D 1MJUH 3G5YB 2E8YA 4ISVA 3WN5C 4OBRA 4C56A 2F54A 1N5AA 1I3UA 2DD8H 4LHUA 1AFVH 1B88A 5KVDH 1DQMH 2ADIA 3MRIA 3MLVH 3VFPB 2P49B 1WCBA 2ITCB 4ZFFA 2FX8L 1H8OA 5TQ2H 5F1IA 4Z0BL 4JZOB 2KPNA 4RFNC 3DYOA 1AR2A 3BPCA 1MCDA 4UQ2A 1Y6MR 4LEOA 4Y1AB 4U6HB 3RX8A 2VDLH 3BH8A 2YWYA 1CD8A 5ICZB 5J11B 4ZQKA 3RL1A 1I7ZA 5EZJB 1IAIH 3QG6A 1T1WA 1Y0LA 1Q0YL 4X9BA 3ARBA 2B7DT 2GAZA 3MO1B 3SKNB 3MGOA 2FDBP 4Z95L 3RVWC 3FRPG 5D1QD 3ARFA 3RAJL 3VMNA 1G9NL 5DJ6B 3P3YA 1F4YL 2EH8L 4NFDA 4NQXB 1ZVHA 4IRZH 4S11A 3MRRA 1WBYA 2C7UA 3DX6A 1I85C 1GC1C 3PQYD 5GHWL 4C58B 4JZJA 4LSVH 1RJZB 3VXMD 3D3VE 2ORBL 2RAMA 1K9TA 4I2XA 4QCIB 1WIUA 2FIRT 2JCCF 2VDRL 5FDWA 1CDGA 3D69A 4I18C 3D18B 3B9KD 5TDNA 4HLZG 2XZAH 4M43H 4CN4A 4ZYKA 3TT3L 4G9FB 1U92A 3KJ6L 3GSQB 5BQ7A 4M6MH 3TGXA 2W60A 1JIBA 3EYQC 1BEYL 4WCYH 3GKZA 3HCVB 4MD4A 5DR5L 4XAKD 5GRZA 1DEEA 4P3CL 2J6EH 4EIZC 1RU9H 2DQDH 3CLEL 4AIXA 5SWZA 4YDIL 3VDAA 2NNAB 5CSBA 3E6HB 4PTTB 5IEKB 3PGFH 3ARRA 2GITB 4OM0L 5HD8C 4NKOA 2VDNH 2VXUL 2VXTL 1EXUB 2XTLA 3GNMH 4KRLB 4MJ5A 1MLBB 5A43C 3HI5H 5C7XL 2R2HB 2WMPA 1IGJA 5GIRA 5KVEL 2HA1A 2HP4A 3RVTC 2R9HC 4Y16D 5JPNA 1FNGA 4TTDD 1FO0B 3DVIA 1G1CA 3LKOB 5I73C 3SDAC 5DD3H 5HI5D 4PRNA 4I1NB 1MFNA 2I9TA 4POZC 4FN0A 4QY8B 5FYKE 3C09C 5E6IB 3E0GA 3K80A 3DMMA 3EO1B 3HNVL 4L8SA 3MRDB 5MEQB 2X1QA 4K8RD 3INUL 5FYKU 1X5GA 1A1OB 1D9KD 2D0HA 2HT4C 5DUMH 5C09D 3ELAT 1DQDH 1CF8H 1F90H 4K7FA 1FNAA 1KNOB 1LO0L 1W0VA 3ALPA 1FL6A 3O3AA 5MEOA 3R4DA 1R3HA 2EXWD 4TSBL 5CEZE 1XF2B 4U6XB 5F71A 1ONQA 5DHVA 3DX8B 3DURB 1X5AA 2D4DA 4RCAA 5F8QC 2H1PL 2AJSL 3SE3A 4JRYD 2FX8H 1BPVA 4Z0BH 2VUYA 5HHOA 1TZHB 4GH7B 4R2GC 5ENWB 1ZSDA 4OV5B 1AIFB 5FUOH 5I1CL 3TM6A 2CIKB 1NPUA 3VFWB 3I85A 4UT6L 3LQAL 5B4MC 4OZFG 3EOAB 2LU7A 1UWXK 1AD9A 2AKRB 5T3ZD 5SX4I 1Q0YH 5CD5C 2FECL 4WWKA 3ZE0F 4PGCA 4XNZB 4X4ZA 5K9KB 5DDHB 3ARED 3P2TA 4LKCA 3D3VA 3RAJH 3KPOB 1XGQB 4L4TB 1G9NH 4P57A 3ROOB 3KJ4C 1F4YH 1QFUL 2Q7NA 1ULVA 2EH8H 3ZYZA 2F53E 1HQ4B 3SKMB 4F8QA 3JTTB 4LVOC 4N1EA 1P5VA 5IT2L 4ZFOL 3OQ3B 1RUML 4OLVL 2A0LD 1R3KA 2A6DA 1AGBA 5GHWH 2X70B 3RPIB 4PV9B 3KPRB 3UTSE 4OZIA 1FVCA 3C6SB 4BH7B 2ORBH 3QXAB 1P9MA 4NO0A 2UWEB 5SWSE 1SY6A 5JW4M 2V9TA 4OF3A 3WKNA 2VDRH 4F7MB 2P5EA 4S1SL 3IKKA 1YJDL 3QDGB 8FABA 1HHGA 4Y4HB 3BGMB 4JY4B 3TT3H 3KJ6H 1CYGA 4PJ8D 4HH9B 2PTUA 1BEYH 5CP7A 1NLDL 3TVMA 1RQ5A 5DR5H 2WIMA 3JUZA 1ZT7A 4P3CH 4X6EA 3WUWB 1YN6A 3SDDD 1PYWB 3CLEH 4OM1L 3PP3H 4YDIH 4U1SB 4Y4KC 2LE9A 4LEXL 1I8LC 2X4QB 3UYPA 4OM0H 4P9HL 2X4OB 1FL3A 1JWMB 1VFAA 1WZKA 2VXUH 3N1PC 5KSUA 1PEWA 2VXTH 1KG0B 1ZLVK 5C7XH 1BECA 5C0GB 5IG7A 5KVEH 3GSNA 1YZZA 4BQ9A 4F7TA 2K7QA 3MACL 1ZT1A 2CK2A 4KMTL 4FFWC 2YKLL 1FNSL 4PRHE 4N0UA 3QFDB 2EYRA 4IOFC 4WFEE 3M1BA 3IRZA 3L3HB 1KCGC 5I74C 4N0FA 5HHXL 1J0YA 1YN7B 3HNVH 1W72L 1J86A 2L7UA 3INUH 1I8KB 4NQEE 5DJXA 2GJ6B 2AJ3B 2BHZA 3UBXG 4LU5L 3O9WC 4KDTC 2ZOKB 3REVA 1X5FA 4X98B 5JOPD 3OV6A 4QT5A 5F21B 4LVNC 5HGBA 1ZGLM 4LCWE 2H32H 1LO0H 2EDBA 2J4WL 1R6VA 3PGDB 3T65A 5I8KL 1OAKL 2I24N 4V2CB 4W81A 4TSBH 2ZSWA 3MV8D 5MENE 2WANA 1IGYA 1QZ1A 4JGJA 2OSLA 2PO6A 5BS0B 1FNLA 1FFPA 2H1PH 2AJSH 2BY3A 3C6LA 4KK8D 3H3PH 4KKCC 5DA0B 5JW4R 4TUOB 3FQTA 5T3XD 3ULVE 1EEYB 2A83A 3LIZL 4S2SA 2I5YL 3T8XB 5D6CA 3LS5L 3LV3B 5F96L 5I1CH 5HYQB 4S10A 3LQAH 4P46A 5EZLB 3VD3A 2F53A 3SDXE 3HTLX 5E5MA 4G9FD 4PJXF 4NDMB 4LVHB 2GTZB 4DKAA 1XR8A 3LHPH 1YQVL 2AI0L 3VA6A 3FZUC 3PDDA 1L6XA 3PWPD 3B3IB 2VZ1A 5KSVA 4ZUTA 4JEGB 3GSWB 4NQCB 4GBXC 1D6VL 1GZPA 4Z7UA 4KQ3L 5L88L 4PJBE 3EO0A 2P4AB 2IAMD 3F12A 3TBVA 5DJ2B 4XNMB 1G0YR 4P5TB 4FQCL 2MKWA 4XCNA 3MODL 3O2DA 4BQCA 3UO1L 3S5LB 4EDXB 5IT2H 3SKUD 1RUMH 4OLVH 2E3VA 2AK4E 5IF0B 4OZIF 1G6RA 4HK0B 3TN0B 1BIIA 1T1XB 2Z91B 3I3BA 4IRJD 2P24B 5CKGA 1CLZL 3FRUB 1N8ZA 2DMKA 3TP4A 4E9LA 4S1SH 5C3LD 5D1QA 4QNPE 1YJDH 3QB7C 1NLBL 2BDNL 2ESVD 4G8GB 5IMKA 1DBJL 1YNKL 4MWFB 3S98A 5JIIA 1IEHA 1TQBB 1NLDH 5GS1A 2A6KB 3NFSL 3PQYA 3TPUB 4OM1H 4WGVB 4LLAA 1CFTA 4QTIL 5KSBA 4G8IB 2I9LA 3P77B 4P9HH 2XZQL 3C87A 4M8QB 3HZMA 2NW2B 5J56B 2KQNA 3WFZA 2EZ0D 3SGEH 1NUGA 3CC5B 1WWAX 5AD0A 3W0WB 4BH8A 1IGML 1JF6A 2YPVL 4NQEA 3MACH 2ZOLB 2VIRA 1K5NB 1NC4B 4KMTH 3RVXD 5C6TL 3BGFC 5D2LF 4CNIB 1ZGLA 3KPSD 4X4XA 2YKLH 4GLRI 1FNSH 1R5WB 3VGDA 2F15A 1INQB 3BP5A 1B2WL 4HFWB 4HT1L 2PW2A 4OZGA 1CT8A 5DUBA 4QYOA 5HHXH 4GS7B 2DLFL 3HAEG 1OHQA 3ZZ1A 1W72H 3KYNB 4MX7B 4J8RB 5MENA 3SKJL 5D7IE 4LU5H 4GKSA 1X5ZA 5MEPB 4E5XA 5T5FL 4APQA 1NGXA 2IQAB 1JMZA 5JIHA 3KYOA 3R06B 5C8JB 1HHIB 5E00A 1FIEA 3MUGB 5ITFA 4OIAA 3I6GA 4Y16A 3VXUE 2J4WH 2QHLA 5I8KH 4L4TD 1OAKH 1RFDL 4U1GB 3VH8B 1NANH 3ECBB 4V3DB 3O3DA 4X80L 3AAZB 1IC5L 3QQ9D 3WFHB 5DSCB 4GAYA 2NY0C 4KK6C 3QJHA 4YLQT 3SDXA 1GC1L 3ULVC 3F7RA 1MI5B 3KPRD 1MCRA 4R4BA 3MRQA 4PGZA 5IW1B 4I9WD 5D4QA 5DRZA 1M6OA 3LIZH 4KK5C 3T1FB 3UTTB 1EUTA 1J87A 3LS5H 5F96H 5JQHC 3MR9A 2YC1B 2PTTA 4LASL 4GW4B 1FSKC 5E95B 1BFVL 2DI7A 3RPKA 3DROA 1JPTL 2OQJA 3TWCH 4LDEB 4ZSOA 5I71C 5FUCE 5GPRA 1LQSR 1YQVH 2AI0H 3B9VA 1OLLA 2IFFL 1L7TL 4CVZB 3QIUB 1B0RA 1MCQA 3MUHL 3FN9A 1CGTA 4JPWL 1D6VH 2X4PB 4JRYA 5JLZA 4LMQI 2VLJB 1FFNB 4IS6B 3HB3C 4KQ3H 5L88H 2DQHL 1U58A 2R0LL 1V05A 1BJ1H 2X4RA 5TGBA 1T20A 4HIIB 3ARGB 4FQCH 3MODH 1NL0L 3W82A 2XTJB 1T6WA 5CSZA 3UO1H 1HWGB 3V6BR 2DM4A 4OF6A 2BJMH 5I8OL 4PJGE 1UM5L 1U42A 3S4SG 4BZ2L 3L3DA 1S5HA 3LKQB 4Z7QE 2GW5A 3QXVA 3MYJB 1DN2A 1RSFA 2FWOB 1CLZH 2FJHB 5LAXA 1G7PA 3C5ZA 3L6FB 3QA3A 3AREA 5GQBA 1P7QD 1KSRA 3CFKA 1NLBH 3WHXB 4MVBD 2BDNH 4J3VA 3GHEL 1YNKH 4OF0A 5FKAB 3CFCH 4YR6B 1AE6L 1LEKB 3RFZC 3EZJB 2BNUB 4YHIA 4HQQL 5DJZA 2OP4L 3NFSH 5HGGS 3G6JF 1GYAA 2XRAH 4GJTB 1BQLL 4UINL 4QTIH 3FB5B 4L5FL 2Z31B 1SJEB 5FYLD 1RK1A 4UUJA 4MHHG 4M7LT 3TV3L 2BMKA 2PNDA 2A1WL 2XZQH 2D7NA 4FQHA 4I48A 4F7EA 3ZE2E 3FFCD 1JNHB 3PABB 4NQSA 3CFDA 1IGMH 1Y6KR 1OWRM 2YPVH 5F7KC 4Z0XA 4YHNB 1UVQA 3QDJB 4K3JL 5DK0A 4PJ8A 1I7RB 1Z0NA 5C6TH 2Q7YB 4KJYB 1JUFA 3V4VL 1RD6A 3ZT5A 4JG0L 4J6RL 1CIUA 3V7AG 2RB8A 1B2WH 4HT1H 3MGTA 2AXHA 2NY5C 4RMTA 3VFOA 2GKIA 2DLFH 2H8PB 2V6HA 2QQNL 1F11B 4GAFB 3U7AA 3VFRA 4E0RA 3SKJH 4ZS6C 3DRQA 4PV8A 2YA1A 1P4LA 2IH1A 3Q3GB 2AERT 4H1LG 4HS3A 35C8L 3AS1A 1RZ8B 5BRZD 3KWWB 4NQCD 4Y5VB 1DN0B 3U6RB 1DQTA 1RFDH 2NX5D 3JV5A 1G9MH 2B0SL 5C92A 1NGWB 4CAGA 1EJOL 1FFOA 1WZ1L 4AG4L 4P5TD 3LKRA 3SGKC 2OI9A 3DVNA 4ZPTA 4X80H 4D9RD 1IC5H 3H9SA 4U7KA 2HT3D 1GC1H 5I6XC 3CDFA 4WHYG 1KJVB 1H3VA 3U1SL 3OPZH 3MNWB 1IKFH 2FO4A 2O5XL 1CLYL 4KI5D 5CIPB 2G5RA 4UOJA 4GG8A 5B8CB 3PV7A 2QR0A 1AQDA 3BEVB 3FB7A 4ZMAT 4JM2D 1M7IA 3ZSSA 2W65A 2NYYD 3FFDB 3ZMRA 4OFKA 1XGTA 5FK9A 5FUCC 1BFVH 2DM7A 4FFVD 1HDMA 1BZ9A 1SY6L 2VLKB 1JPTH 3RWIA 1BGXL 5IB3B 3TCXA 2ZUYA 4MJ2A 3TO4D 1J8HE 5H8DA 3X13A 1F4HA 4YFDB 2IFFH 1J0KA 1L7TH 3F6IA 2AXFA 3F65A 4JPWH 1S9KC 3TNMA 3O3BA 1H0DB 4RNRB 5HYEA 2R0LH 4NRZA 3VG9B 1KT2A 1MCFA 3UTPE 1NL0H 4BFGA 3WL9A 3HI6L 2BVOA 4U1NB 4EQ3A 3CCHB 3ETBF 3G04A 2A74B 2OX5A 5I8OH 1UM5H 4BZ2H 5BXFB 4R7DA 3PWVA 1SYSA 3KYMA 3DRTB 4M48H 3T0EE 5JORB 4PP1D 5FYKL 1K2DB 4YDVA 3PWPA 5J1TC 3IJSA 4YNYB 4D94A 3GB7A 3DETD 3GEWB 5J3HC 2EE9A 3RWHA 4TNVK 5HJ3A 2YZ8A 3GHEH 2YZ1A 1DEDA 2IAMA 2JE8A 4PJAA 1FFRA 1AE6H 4NO5B 5ADOL 2ATKA 1RK0B 4HQQH 2OP4H 1VERA 5EO9A 3MCKB 1BQLH 4UINH 4R7NB 4L5FH 2GJJA 1PAMA 5IVXB 3L7EB 4P4KB 4IRJA 3TV3H 5JQ6L 2A1WH 1ETZB 1C16A 2B5IB 5JW4Q 1WITA 5D7KD 3LPGA 1HEZB 2YBRB 1D5ZB 4F2MA 3WIHL 4NO2A 1T5XA 1QLFB 4ODWA 1XCQB 3GMRA 1A9EA 2G5BB 2ESVA 4K3JH 2BOBA 4CRPA 4YDJB 4YFLF 5IROC 3BIBX 4YGAB 1A9BB 1MI5D 1OP3H 4RQQA 3V4VH 1MCPL 1G0DA 3FHAA 1G0XA 3HLAA 5C0CA 2FJFA 4J6RH 3P4LA 4U1HB 1KPVB 4U6TA 5DHVH 3ZKND 5F3HB 5IMMB 1ND0A 1X3DA 2HRPL 1QNZL 2QQNH 4NNXA 3U79A 1WISA 5IB1B 2NQCA 4MNHA 3G08B 2NR6C 4WO4B 4L1DA 1N3NA 3V9FA 1JZ3A 1NBYB 3IXAB 3QIUD 4NRYB 3LKNA 35C8H 4KZDL 3AROA 2NPLX 5BJTA 4LL9A 1KLUB 1QP1A 2DQTL 3KPSA 2FEEI 3S36L 2IPUK 1TZIA 1EERB 2B0SH 2DL9A 1EJOH 1WZ1H 4AG4H 1DE4B 4WU5B 3WXVL 2E7BA 5ICXB 3BN3B 1NKRA 3U1SH 4TULL 1G1YA 2NXYD 2APTA 2V2WB 3T04D 2O5XH 1CLYH 2MWCA 3KPNA 3TA3C 1R24A 4LSSL 4U1JB 3HE7A 4YHLL 2BXZA 2EXYD 3MNZB 4PGDA 3MLWL 4D0DB 1T03L 5B38G 2X40A 2IGFL 1F6AB 3IS1X 1G6RL 3BQUB 4PRAA 1NDMA 1A4JB 3CSYA 4QOKE 4RZCA 4IIQC 1SY6H 4OI8A 1EEQA 4X7CC 4WTZG 3UYRL 4K7PX 1ZHNA 1G9EA 1H3UA 1BGXH 1Q9LB 4KTDL 1MY5A 4XPTL 1CD1B 2BFVL 5HYJB 5I8EA 2JCCE 3QEHA 4OCMC 5BO1L 4F9PA 3F5WA 4J3XA 1VFMA 5E2WL 3FQXB 1AH1A 3DOSA 1I8MA 5B22A 4FFYL 5JIPA 4Y2DB 5ESVB 3H9ZA 1SEBA 2DLEA 3JWOC 4LCCC 1ZA3B 1AO7D 4UV7L 4X9HA 2PR4H 4OAWB 2V2TA 5KSAC 4NJAL 4K3EL 3HI6H 1SJHB 2C1OA 4M7KL 1JWUB 4MA1B 3OGCB 3T0EC 4PRPE 2JTDA 2Y7QA 3QDJD 4B41A 4JY5L 5DGRA 1DQQB 2DQIL 3C60A 4DW2L 5ISZD 1C08A 2VLRD 1UJ3A 4EI5A 1I8IA 2YSSA 3F7YA 1ZOXA 3GSNH 5DJ8B 4KC3B 4ONOA 5ALCL 4JLRB 4HWUA 4CUCA 3WYRA 2PW1B 3VW3L 4QRRE 3QI9C 5D7SL 2Y07L 4Y8DC 1EVUA 3PWLB 3GMOA 1G7LB 25C8L 5ADOH 4AIZB 5AWNL 1VGKA 4UU9B 4R0LA 4LCYB 2CKBA 3HKFA 3AB0C 4OV6F 3DO7A 4JFFB 4PJFA 3VI3F 3QULB 3B4NA 1NMAH 3IT8D 5JQ6H 4XZUA 1CICA 1FNEB 3CVHB 1O7SA 1YY9C 3WDIA 3UTQA 3WIHH 3VD5A 4MVBA 5IEHA 1A02N 2G75B 3DHJA 4YAQB 5E8PA 3B83A 4AQOA 3ULVL 1BD2B 1A47A 2VITA 4DUVA 5HHME 3DNKA 2GSIA 3DV6A 2NY4C 1MCPH 5JIKA 1X5LA 4M93B 3BVNA 4EI6A 5ESAB 3AM8C 2Q1EA 4HGWB 1QLRB 1U8IB 2HRPH 4M3KB 1QNZH 5D6DA 3T4YB 2N1KA 3EYVA 1U8JB 1BAFL 1T3FA 4LFHG 1UA6L 1UACL 1FZJB 4E41E 4P2YA 3QIWC 4OFVA 3FFCA 3KPLB 3CH8A 4V1DE 2MQ0A 4X7DC 5T5NF 5CP3H 3MLRL 1B4RA 3RWEA 5HGHB 4P23C 1T5WA 1XIWC 4L1HA 5DEFA 2DQTH 3S36H 4I0CC 3O4LB 3GSUB 4L8DA 3MRMB 3LRGA 1U3HB 5INCA 3WXVH 3ZE0E 4LLDA 4MB3A 1ZA6A 2EDTA 3P4MB 4HIJA 2FSEB 4TULH 3QPQC 2ZCHH 4KMLB 4PJ9A 4P2QD 4JAMB 4LSSH 5C9JA 1P7KA 2WBJC 3ILPB 4YHLH 4LLWB 5DJAA 2NY3B 2XQYK 4PLJD 3MLWH 1T03H 5BRZA 2IGFH 1A4KB 2Y5TA 1G6RH 3IFOB 3QUXB 3N1QC 4HIHB 2NX5A 3UYRH 1EH9A 5K33A 4KTDH 4XPTH 3EFFA 2BFVH 1DTUA 5JNYA 3OR7B 4LK4A 5BO1H 1U2CA 2BNQB 4CVXA 4R96A 3GIVA 3VI4E 5EZIL 5E2WH 1XT5A 2IH3B 4S1RL 2B39A 2AEQL 4FFYH 4QXGL 4YBLB 2UWEF 4OLXL 4CMHC 5IW3A 4NSKA 3MV9E 4UV7H 3UYOD 1F4XL 4JM2A 3FO9A 4NJAH 1R5VB 4K3EH 1R3IL 2Z35A 2R39A 1KYOK 1EO5A 4M7KH 4J4PD 1NCUA 2DL2A 3KAAA 4JY5H 2DQGL 4QRRA 4LSQL 3QNZB 2ICWA 4B50A 4KKNA 5B3NA 4P2CG 3PP3K 4GRLD 2CGRL 4QRSA 3HRZA 4TUJA 5HY9A 1YNTA 5FF6B 2XFXA 3BZEB 2NY5L 1AGEA 4QHLB 5ALCH 3TIEA 4JFHD 3MV7D 2CSPA 1MCSA 1R3LB 5DYOB 1ES0B 3VW3H 4D9QD 5CZXD 2OJZL 4XP4L 5JO5B 2OS7A 5D7SH 1AD0A 2Y07H 4WO4D 4ZPVB 4JVPA 25C8H 5AWNH 2CUIA 1A6PA 1JV5A 4WI3A 1JHLL 1E0OB 3BHBA 3BP6A 4M6OL 5DK2A 5D1ZC 1A5FL 4PJFF 4Q2ZB 1A1NA 3OKNB 4RAVA 5CWSA 4EN3B 1UC6A 1LILA 3D25B 5HVHB 4DGYL 4IHOA 1KCRL 1RJLA 3TIDA 4IEFB 4KROB 1JYXA 3ULVH 4JFED 1FLTX 3VFMA 1KLFA 4JKWA 1OB1B 2OJEB 3VWKB 1U91A 1TENA 3RBGA 2BRRL 1JNLH 4XVTL 2DBLL 5DFVC 2QSVA 4G6AC 4LF3B 4XBPB 1NCCL 4Z7VA 5EIIA 1P6FA 4YPJA 5K9JL 5IIEB 1XR9B 1NBZB 5CGMA 4MNQE 3BQUD 2J8UA 1BAFH 3EW3B 4RISL 4BKLB 5E8NA 1UA6H 5ALBH 4OF7A 3BUTA 5DD0L 3PUCA 1G7QB 5F9JA 1T66D 3E6FA 5E94A 1NCDL 4KVNL 5E4IA 1BJMA 3MLRH 1U2HA 4MGXA 4Z7NF 3TJHA 3GK8L 2EYTA 1L0YA 4WI6A 2XKNB 1G7MA 3VD7A 4WW2A 3LPWA 4P3DA 4Y2DD 2X7LA 3K1KC 4RIRA 5C0IA 1RY7B 2AXGA 4NHUB 3WD5L 2BNRE 4ZUVB 2HT2D 1MFDL 4OLEA 1S9VB 3E2HC 1CCZA 1CFBA 2XYCA 3BRFA 4UIKL 4XH2B 3QWOA 1KXQE 3PWNA 2ERJC 3BISA 4K9EL 1MH5B 3PWUA 2XN9D 5DEZA 4Z78A 2OXGA 4KRPB 3CK0L 2Q87A 3X14B 5HPOA 3U0TB 4D2NA 4XVUC 1JK8B 3BOVA 3FB8B 1V3LA 5L2KA 2AEWA 2JKXA 2KQMA 3U4EA 1NDGA 1TJIL 1V7NL 3WLWD 5DD1H 1TITA 1BZ7A 4LPTA 2IPUG 4JDVA 3RJDA 3OKLA 4U1MB 4YPGB 5IKCA 5L7XL 5C0AA 3IFLH 3STZB 3UPRB 2W9DL 4I5BA 4OZFA 4KHTL 1BX2A 2WV3A 2EDLA 4U49A 5EZIH 4KI5F 4S1RH 3GJFB 4ZOCA 2AEQH 1I3RA 4QXGH 4P5KB 4OLXH 2X4NB 3AY4C 4JM2F 1F4XH 4JDZB 4MJ6B 5DHXB 4LHQB 4WUUE 3TZVB 1S9YA 3O6FA 3MRFA 1R3IH 4L4VB 1BFOA 3OAYH 4DVBA 4KJQD 4GW1A 2DQGH 1OP5K 3VFUB 3IDUA 2GUOA 4LSQH 4JFQA 4GRWB 4ELMB 2CH8A 1LGVA 1A7NL 3D87B 2CGRH 1ED3B 5EN2A 4TTGA 3UEZA 4BUHA 2Z8RA 3MFGB 2GTWB 3TBTA 4RGMB 4RAHA 4JY6B 4NJ9L 1RIVH 2YUVA 2NY5H 1NEZA 4AJ0A 4BSWA 5IB2B 1AO7A 5D2LE 5IFJB 4GW5B 4LCIL 1PQZA 2OJZH 4XP4H 4JKMA 1EZVY 3E8UL 1DVFA 4O9HL 3B2UC 2Y23A 3CX5K 3OL2A 1JHLH 4XC3L 4OQ1A 4M6OH 1A5FH 5GGRA 5DO2D 5T1DL 3NFPA 1S7QB 4G6FB 4HZLB 2FJGA 3G5VB 1OM3L 3O4LD 1LNUA 4JQXA 3BP4A 1IEAA 1KCRH 1ZVYA 3OF6A 1U3HD 5E56A 5FM5O 5DS8A 2ZG3A 2ILLA 5C0JB 3O81A 4DAGH 3PV6A 2ICEB 2BRRH 5CJ5A 3O41B 2DBLH 5ACZA 1VEOA 1NCCH 4I0PB 4Y88A 3QWRD 5K9JH 1RZ7H 4AIOA 1GZQA 3IDGB 1B9ZA 5D5MB 1MJ7L 4QEGA 3GMPB 2B2XL 4RISH 5I16B 2JK5B 2HMIC 4P2OA 2HFEA 4Y4KB 5L8JB 2QKIB 4XTRC 4X6DA 2VH5L 3KLAA 1NCDH 4YDKL 4KVNH 5D7JB 2XWJA 5E2TH 5A1AA 4L8CB 4CADB 3GK8H 1LP9E 1A3QA 5I30L 5FECB 3VRJB 4OGXL 5CMAA 2NZ9C 3OKEA 2HTKD 1E4XH 4POYA 4RMUA 4K23L 3FT4A 1ORQB 1WTLA 4QF1A 5GGUB 5I1EL 3QEQE 4Y5YC 5DTFB 1H8SA 5EUOB 5DUPL 1MFDH 4UIKH 1L4IA 3LRHA 5FO7A 4K9EH 3LH2L 4K2UL 4GKZA 1AGDA 3HE6C 3CK0H 1DUYA 1RUPL 2WQ8A 4Z7WB 1UCBL 4XVJL 5F88B 5J6HB 5FYJE 4YQXL 1CGXA 3FT2A 3MBED 1TJIH 1V7NH 4HIEB 5TDPA 4XRCB 3B9AA 1NGYA 5FYJU 1I1YA 2MKLC 4DOHE 2R56L 1FG2A 3MUZ1 2UV3A 1GL4B 4CMMB 3OMZA 3FKUS 5L7XH 2BSTB 2JJSC 1QRND 3QUZA 2W9DH 4X0KA 4D0CA 3BWAA 4MA3B 2R2EA 4XX1E 1UXSA 3MRBA 2ARJQ 3EJYD 4ZFZB 4KHTH 1MHEA 1S5IL 2QADD 1NANI 3UPAA 3BW9B 4X6FB 3V52L 2PYFA 1CWVA 1LDSA 3OJMB 4MZ3A 3E3QE 4G42A 1HH6B 4P2QA 1P2CB 1CFQB 1V3JA 4LLMA 2ZSVB 4NFCA 2XQYG 1RZJC 4J12A 3QUYD 5IV2B 2FIKA 1YPZA 1MRDL 3G6JE 3VXME 1MREL 3GMMB 3K4ZA 4KROD 2FZ3A 3QFJB 3RZWA 4XHJD 3VWKD 1A7NH 5ID0A 5J1AB 1F3JA 3QNXB 1TVDA 2LQRA 1UB5B 3RTQC 4IDJL 4R90L 4ZAKB 3C9NB 1ZLWH 5EFIA 3AU1A 3B2VL 3Q1SL 4LCIH 3ULUE 4KI1A 5JHDE 43C9B 4O9HH 4XC3H 4YEEA 5GZNC 4JFYA 4J4PA 3GJEA 2XKSA 1X5KA 4MNGA 1CVRA 4PG9B 3CZJA 3VD4A 5T1DH 1UYWL 1S7RB 1RPQA 4GRLA 4MDJB 3MC0A 1CZ8L 3DGGB 5CEXB 4C59B 2R0WL 4DTGL 2DQJL 1QFHA 5IR1B 3ZTNL 1GJIA 1J7VR 5HHVL 5DQ9B 3MV7A 1BQHB 3MRJB 5JXEC 4F7PA 5KG9B 5SV3A 4KRPD 2P8LA 4FXGA 2WWKT 1XGRA 2OTUA 2X1PA 1HHKB 2FLBT 1BFTA 1IGTA 3DSNA 1CK0L 4NN6B 2FL5A 1QSZA 4G8FA 1MJ7H 1RIHL 1KJ2B 2B2XH 4HKBB 3QEQA 2DM3A 1JF5A 1KIPB 2FYYA 5I75C 4MQ7A 2XG4A 2VH5H 4XWOC 4YDKH 4MXQA 5C09E 2VNCA 1F02I 1U95B 2HFFA 5EC1A 4Z5RB 5I30H 4QHNB 5F7NC 4LSUL 4JRWA 4OGXH 4PJCB 1QQDB 1T0NA 3BO8A 3V7AE 4YO0A 3RWGB 3V6FA 4ETQA 2JJTA 5I19L 3TZVD 1L0QA 3UPCA 4NWUL 4CW1B 1MWAA 3L3OA 3NIDF 3PWJA 3NN8B 2Z93A 4L4VD 5BVPL 5D2NB 3FQRA 3LH2H 3RWFA 3SDCC 4S1DD 4MD0A 6CGTA 1RUPH 1F4AA 1UCBH 4XVJH 3KPQB 4UOW1 4YQXH 2O26U 4LLVA 1TTGA 3E3QA 1MCWW 5F3BB 2R56H 3SDYL 3QO0A 5T3ZE 4HC1A 3WNOA 3ULSB 2YPKB 3TPKA 3HPLB 2VZSA 2BVPB 2VE6B 3DXAD 1UKQA 4M1DL 1MJJA 3HG1E 3WS6A 1NFIB 3ARZA 3V52H 3MRGA 4NUJB 2XN9A 2FHFA 4MCYA 1A14L 2KH2B 5J4MA 4G6FD 4Q6IA 3QXDB 3CUPA 1YPZF 1BF2A 5FM5M 3LZFL 1T1YA 1S7TB 3V6OE 4AQ1B 3O11B 1MREH 5EO1B 2RGSA 3B9KC 2Q76A 4PD4K 4PGEA 4Q9QL 5I71B 1XGUB 4JANA 4N5ED 2J5LC 4HX1B 3S4SA 4IDJH 4I0PD 4R90H 3CFJA 4KJPD 5E9DB 5IVXF 3BKCL 3B2VH 3Q1SH 1P53A 4GG6B 1FYTB 2EDDA 3GJFK 1NUFA 2IQ9L 3D1MC 3U46B 3K1DA 4X6BB 2PXYB 4CU6A 1KB9K 4KGLA 5IUSA 4P2RD 5D7JD 5J8OA 1N0XL 3KXFE 1UYWH 4W70A 1NUNB 2UUDK 3H3BC 4YDLC 4WY7L 4EVNB 1TVHB 5GSRA 5BOPA 1AXSA 2P8PB 1CZ8H 1TTFA 4Y4FC 4JO3L 2FBJL 2R0WH 4HXAL 3MA7A 2DQJH 4DTGH 1N0LA 4XP5L 3ZTNH 1DANT 4LLUA 4HBCL 5HHVH 1JHTB 3A6CL 5ANMA 4LCUA 3ZKXC 1E4KA 4HUKB 5HI5C 3QQ4B 1OTTD 2CLRB 1HSBB 4N8PA 3LN4A 5FV1L 4Y1AE 1WZMA 4K8RC 5I0ZA 3WUZA 1CK0H 1D9KC 4P3WA 5LKNA 1RIHH 3M17A 1ORSB 4QHKI 5D7LB 5I66B 2H3NB 5IMOA 1BQUA 1UH4A 3KYAA 1A2YA 3O45B 1YY8A 4YXLL 4QWWD 4YZFF 5JDJA 2CKNA 5ERWA 5BVJB 1JN6A 3F58L 1IEBB 2BERA 4HS8H 5H2BA 4LSUH 3ZLQC 3TYFA 5T1KB 1H5BC 3OKOA 4G3YL 2H2PC 3ARDB 1JYVA 5DRNA 4CKVX 1SM3L 4NQDB 3MRKB 1EX0A 1RVFL 3QWRA 4NWUH 4UTAL 1S8DA 2BCKA 2QQLL 3BESR 4NUGL 1LEGA 1L0XA 3NACL 3J8F7 3FL7A 5CJBA 4NQUA 4JB9L 4M9PA 2E7HA 5EBWA 2ZUQB 1N6QL 5HI3C 3E1F1 2P5WB 3OR6B 1B0GB 3RZCB 4R26L 3G5ZA 5F89B 3RGVC 2YD4A 3QQ3A 3QIBB 4QTHA 3SDYH 3BN9D 3BH9A 3IKCA 3KHOA 4OD3L 1QACA 1HXYA 3DIFB 1BVLA 3BEWA 3LEXA 2RBLA 2YPLB 3VA2C 4M1DH 1CFSA 3SKOA 3V6OA 3MRCA 3S6CA 3RNQA 1E27A 5D9SB 4HWBA 4NO3A 1ACZA 1QYGL 2WWMD 5JMOC 2VLLA 3VXRB 2NXZD 4OFYA 3TF7A 2E9JA 3FAXA 1A14H 1NAML 4HLZH 2A0LC 1SYVB 3S34L 4Y19B 1CR9L 3MBEA 2VMFA 1A3LH 1FG9C 1M1SA 3LZFH 5B21A 3D0LA 4DCQA 5LGHL 5J12C 5AZEH 2EO9A 2GK0A 4M6NL 1QRNA 4BELD 1KB5A 4Q9QH 5FDYA 3NH7H 3U9UA 2DYPB 2R23A 3W11C 3VFGL 5GJTL 3FHQA 4Q0XH 5DD6A 3B9EA 3KXFA 4RFOL 5DMGD 1VFOA 2WZPD 2YUXA 3BKCH 3MNVA 1JF1B 3ARVA 4K7PL 5EWIL 4H25A 3SDDC 4KWUA 3C5JB 3QUYA 5J9PA 1QA9A 2IQ9H 3DI2B 3JBG7 4FZ8L 5DJYA 1NFDB 4LGRB 4HKXA 3BWUC 1U8HB 1UH3A 2DIBA 2ITCA 1D6EA 4GUPA 4WY7H 2XPGA 3WS3A 3PG2A 4KV5F 1IM3B 4JO3H 2FBJH 1J0ZA 4HXAH 3MJ8A 5ICZA 4XP5H 2W91A 3EYOA 4B7IA 4HBCH 3QDMB 4C54A 3C8KA 3A6CH 3NZ8A 4PRDB 2BVEA 3L3GB 3UTOA 3MBXL 3QISA 4OZHA 2YOCA 4DN3L 5EOCL 3GMLA 5J11C 1K8IB 1KTDA 4HMDA 2VL4A 4Y89A 1YEGL 3TEUA 4XHQA 1GGYA 5DJ6A 1VHPA 5CBEB 1QSFD 2ZUSA 1PFCA 1Q94B 4EQ2A 4PJ7A 1ADQA 4Z76B 4YXLH 1BOGB 3IDYB 4LQFL 3F58H 1CFNB 1X9QA 4L4TE 5E8EB 1ZHLB 1KIQA 3L95B 4G3YH 3THML 5FGBA 1FN4B 2GCYA 2VISB 5A2FA 4ODXB 2Y25A 3HUJA 1KPRB 4OLWL 2NY2D 2HVJB 1RZJL 4OZFH 1RVFH 4UNUA 5B3JF 4POUB 3DX9A 3PIQA 4UTAH 1TVBB 3IU4L 2QQLH 2G2RA 4NUGH 2BSSA 4RDQG 3NACH 3V0WL 3Q2CA 3KPRE 3SJVB 4I9WE 2H26B 1LEIA 4JB9H 2EE6A 2UWEE 5HDBE 4BZYA 3VDBA 1DBAL 1N6QH 4YFEA 3I2CL 5GS0C 4X4YA 1FCGA 4R26H 2PYEB 4XB7A 3QDGE 4WTXA 4FABL 1HI6A 2H32B 1V3MA 2W1NA 2YWZA 2W0LA 5E9DD 2C3VB 2GITA 2OMBA 3UJTL 5DHYB 5LWYL 4OD3H 4MLSA 2CRZA 1G6VK 1FYTD 1GGTA 3WEXA 5B38A 3VXSB 4HG4K 2DLGA 4O2EB 4HUVB 2J8HA 2PXYD 4PJIA 4KXZH 3V0AC 4HGMA 2EKSB 4Y5XC 4NGHL 3PHSA 5J0BA 4FQXB 3DARA 3S34H 1CR9H 1FVEB 4X7TB 5E6IA 4LBEB 3I6KA 3SE4A 4HW6A 3SCMD 5LGHH 2C3WA 5IVZA 2DIJA 5TH2B 5EBLB 1LE5B 4NKDB 1S7XA 4M6NH 5KS9A 4KKLD 4RA3A 4MCZA 4C83A 1CBVL 1KUMA 5D1XB 3VWJA 4ZO6A 1RJYA 4M61B 5HHQB 5I1LB 1XF5A 3OJ2C 4A6YA 5E6YA 3VFGH 5GJTH 5IHZB 3TFKC 1OSPL 3IF1A 4RFOH 4HAGA 3IVKA 2FB4L 2IANA 4X8JA 2DOCA 3BI9X 1KYOJ 1EEZB 3TO2B 4G7YL 5FM8A 2CJUL 4JFZH 4XXDB 4Z77A 4L9DA 5LQBL 2F8XC 3IDIA 4K7PH 4U7MA 1N59B 2GJ6E 5J6GB 1MCWM 3L3JB 1MAJA 4ONHA 1CDYA 2CLVA 5D7LD 3MLPA 5E70A 3RY6A 4FZ8H 3K3QA 4BSJA 4ZFOB 1JPSL 4LNVA 1HHHB 5KOMC 3JVGC 1K8DB 3H6JA 4MQTB 1A7BA 4NC1E 2E9WA 1EPFA 3FONA 3U0PB 2EZ0C 3RDTB 4AENB 4PJ5B 4F7CA 4TVPE 5ECJE 4XXCC 4PRID 3ARDD 3UTZB 3RNKA 2C3XA 4N5EA 4G80B 3D39A 3SGJA 5DURD 2YUWA 1IGIL 4EZMA 4U7SA 5E7BA 5CS7A 5BS0E 2YD8A 2HYMA 3H9YA 3MBXH 1UWGL 4OZHF 1EFXB 1W0WA 3OKKA 3W39A 2OXHA 4DN3H 4WHDA 4ZXBD 5JW4N 1ZWIB 1MWAL 3WJLA 1I1FA 3GUTB 1YEGH 3FT3B 4BQBA 5L2JB 5DMJB 3RZCD 3NIGF 1CQYA 4JPKL 3OAUL 1EVTC 1HILA 4XNZC 3V2AR 3DUSA 4Z6AT 2AW2A 5D93B 1YUHB 4AEEA 1UFUA 1KIRB 3BIKB 3BRDA 1OWWA 3G6DL 4MJIB 2YPLD 2AJYL 4LPVA 4LQFH 4NQCE 4XPHL 4MS8A 4BH7A 5A16A 4HC1L 1I4FA 3THMH 1KTLB 1WC7B 5DWUL 4OLWH 4PY8I 4QRPB 3PHOA 1RZJH 4KDVA 3ROLA 1X5YA 2ADGB 3FQUA 1U8NB 4WDIA 5IBLC 2LU3A 4QRQB 1U8QA 3IU4H 3V0WH 1W72B 2HVKA 1FAIL 3P4NB 3QXWA 5GGQL 2Z92A 4PJEA 5EBGA 1B4JL 2I07B 1T21A 2DN7A 2CDGA 1DBAH 3H9HB 1DR9A 1LDPL 1CDHA 2HKFL 3I2CH 4O4YL 4Y4HC 4WW1B 2ZG1A 4FABH 4FQIL 4JRXD 4RGND 3ZKQD 1XIWB 4G8GE 2IWGA 1J0IA 3GSOA 3ULUL 4PTUA 3N1GC 3UJTH 2A6JA 5LWYH 4LAQL 4Q6YA 1F3DH 1R0AL 3QRFM 3NABH 3TPUE 1RURL 2V5MA 4OCNC 3AC0A 1QUNA 4NGHH 4ELMF 3P9WB 4LKXB 1CGSL 4H26B 4IMKC 3MLTB 3VRLF 3P4OA 4R97C 1QPXA 5SWQA 1OOAA 1ZS8B 1QEWB 2HFGH 1ROWA 3W0WE 5BW7A 1BREA 1PGRB 3ARXA 1XF4A 3H0TB 3T3MF 1CBVH 3WIFB 1Z0MA 4IOIA 3W9DA 4X98A 3IS0X 5F6HI 1OSPH 1IAIM 2FB4H 1C7SA 2BZDA 2CIIA 3PGDA 3O0RL 4G7YH 1LE9A 1S7WB 2CJUH 3NTCL 5MERB 1FZOA 5LQBH 3N0PB 2CK0L 3ZDYF 5JPMA 3FTGA 2DI8A 2VABA 2AJZB 4ZUUB 3K2UL 3VXQA 1V5JA 1O5DT 4AM0B 3WHE0 4NC1C 1JPSH 4X6CA 1SEQL 3ZYOA 3QRGL 3WE6A 2LFGA 1KN4L 3REWB 3HAEH 3QBTB 1YECL 5HYSB 4NPYA 3QUMA 4R4NC 4QHMB 3KS0H 2V9QA 3CX5J 1X6NA 1FL5A 3C08L 3AXLA 2CLZB 4D8PA 1MI5E 1N6UA 2RFXB 1UWGH 1LD9B 4QXTA 4DZ8B 1BP3B 1ITCA 3LMJL 3UTTE 4NC0B 1MWAH 4N68A 3FQWB 4OIBA 3MJGX 3IAPA 1TJHH 5E1AB 4PLKC 4LVHC 3VFNA 3WFCL 1KCSL 3HNSH 4JPKH 3OAUH 5DJ2A 4IRSB 1GHFL 4AEIL 1X7QB 4I8DA 3HR6A 4G6ML 3G6DH 2AJYH 4D0BB 4JN2B 4XPHH 4LARL 3T0AA 3TN0A 3DV4A 5C07E 4HC1H 5EU6A 4RWHA 1OTUD 2VLJE 4ISVB 4P5TC 1BBJA 4MAYA 2Q3AA 3HC0A 5EU7E 5MHSE 1S9WA 3FRUA 4C56B 4Z7WF 2F54B 1N5AB 5DWUH 4LHUB 1CVSC 2HT3C 4FQXD 3EOTL 2ADIB 3MRIB 4JCMA 4KI5C 2XTJE 4HWBL 2P7TA 2VQUA 1KGCD 1T89A 1WCBB 2EKJA 1QBAA 1FAIH 3EHBD 1QSFA 2ZUXA 4PJEF 5GGQH 3VGAB 1HYSD 5F1KC 2DMCA 2Y72A 1QSED 3SPVA 3O8XD 3BPCB 1B4JH 4UQ2B 1EHXA 4LEOB 5D1XD 3V5HA 3BH8B 5C2BL 4E42A 3RUGA 1LDPH 4WU7A 2HKFH 4DK6A 4O4YH 3TPUA 3IDJA 3CXHK 4ZQKB 3RL1B 1I7ZB 1X4XA 2VR9A 5CJXA 5F9WB 4G8IA 3TBWA 4FQIH 5DXWA 1T1WB 1SHMA 2EECA 3TO4C 1TQBC 1Y0LB 3ULUH 1AHWC 4RAUA 1YEJL 3ARBB 1BQHG 2GAZB 3MGOB 4I3SL 5TE7L 4LAQH 1YEFL 1S78D 5EOQL 1UWXH 1TZGL 1E4XI 1R0AH 3TT1L 3ARFB 4W4OC 2R1WA 8CGTA 1RURH 1BJ1J 4N8CL 4RMVA 5HYFA 2ED8A 4PG2C 4HJJL 3RVUC 4U31A 5TE6L 1IM9A 1MHCA 1CGSH 1WBYB 3MRLA 5DFTA 2L0DA 2XY2A 3QG7L 3AMLA 1OSZB 1U8PA 4JZJB 4MD5A 5E03A 1Z9OA 1U8KA 4I2XB 2AVGA 3V5DA 1WWWX 5DJCA 5EC2A 4KMQA 4TSAL 3D69B 2UZIL 4JN1L 1NGZA 5TDNB 2Y4SA 4GS7C 1KXVC 1UADC 3FOLA 4ZYKB 1U92B 5BQ7B 5F7WC 3O0RH 4OB5L 2W60B 3NTCH 1F3RB 1XH3A 1GGBL 4LP4A 2VZOA 3K7UA 4MD4B 2CK0H 1DEEB 4ZDHA 2JIXA 3K2UH 3ECBA 4RX4D 3RIAF 1QR1A 5SWZB 2COQA 4X6CF 2AQ1A 3VGFA 3SCMA 1SEQH 5IQ7L 4OKDA 4MJID 5IW1A 3CZFA 3CU1A 1K4DA 3QRGH 5M7QA 4U1GC 2X41A 4M3JA 1FCCA 4NKOB 1ADQL 1KN4H 4MJ5B 3K81A 1YECH 1A7QL 4HJ0C 1IGJB 5GIRB 2LVEA 1FDLL 3WKML 4KK9C 5JPNB 1FNGB 3C08H 3CFBA 2WBKA 1ZLVH 1K3IA 1H3WM 1GGIL 5DC4B 5EBMA 1IL1A 2R1XA 1KXTB 4H1LH 4NZDA 4PRNB 1RZKC 3L5IA 3LMJH 2YK1L 2I9TB 4FFZL 5GS0L 3DMMB 1DFBL 5C07A 3NIDE 1CGYA 4L8SB 4TNWK 5F70A 2SEBA 3KLSA 3WFCH 4OI9A 4NKMA 3NPSB 4PJCF 1KCSH 4JFDD 4O02L 4H20L 2VLKE 4HBQA 4HIIA 3ARGA 3PNWA 4PRIA 1GHFH 3QIUC 5AAMA 4AEIH 4WHYH 3X17A 43CAB 4QO1A 2WLZA 4Y0GA 3VE0A 4G6MH 5D71L 4K7FB 3RL2A 2ZZUT 2FGWL 1W0VB 2E6QA 1JZ6A 1DQLL 5EU7C 1I75A 4LARH 3O3AB 5MEOB 1R3HB 3UJIH 5F7EL 2EDHA 4ZXBA 3L6FA 1ONQB 3EOTH 2R4SL 2DKMA 4HPYL 2NXYC 3U30B 4U2YA 3PP4L 4HWBH 1Y18A 4WFFD 4N9GA 5KTEL 1FO0L 3S88L 1PKQA 3WJJC 4RRPG 2EXYC 1HZHL 5HHOB 3P9LA 1ZSDB 3VRIA 3T3PF 2Y06L 3RUGF 5C2BH 1ZT4A 4P59L 4KUCD 3FO0L 1J88A 1SJEA 3A6OA 4W6YB 4KJWC 2NTFA 2X4SA 1AD9B 4PGBA 4PJXB 1EAPA 1YEJH 4HF5L 2EDRA 4QRUA 3OKDA 1SJVA 4WWKB 3CVIL 4PGCB 1JE6A 4I3SH 4GMSH 2CO6B 2Y6SD 1YEFH 5TE7H 5EOQH 5JW3L 2VDKL 1TZGH 4LKCB 3RHWF 3RX7A 3TT1H 2D2OA 2Z31C 5HVGB 4WHTA 1C12A 1KEGL 4TQEL 4N8CH 4P57B 4N0CA 1HWHB 5ID1A 4HJJH 2NY1B 5IVXE 5LCVL 1T22A 5TE6H 1C7TA 3RP1A 5C0BA 3RIFK 3PL6A 5HPMA 5C08D 4LIQE 5T1LD 2A6DB 1R3KB 3QO1A 1QHOA 4NYLA 1CG9A 4JRXA 4OZIB 1FVCB 2DQFA 4NO0B 2FH6A 3ZE1F 1UM6L 1TQCB 4GG6F 1HIMH 1QPPA 3W9EA 1K85A 4TSAH 2P5EB 2NZIA 1N2RA 2UZIH 3MRHA 1VADA 3Q3GA 8FABB 5KVFL 4OCSL 3S96A 4JFHE 1GGBH 5CP7B 3TVMB 4CDGC 3I6LE 4OGAC 1ZT7B 4IRSD 4PD4J 1IZKA 4X6EB 5LGJA 5C86A 4NQVA 2KZWA 1YN6B 2W38A 4QHKJ 5IMLA 4I4WA 2AK1L 4Y5VC 5IQ7H 3MNWA 1BBDL 2BVQA 4PY7A 3U83A 5GGVL 1ZHKA 1UXWA 1Q9WA 1ADQH 1VFAB 5KSUB 3KPPA 4NOFA 2OZ4L 2F54D 1A7QH 4LHUD 5IG7B 1IZJA 1R3JA 1JFMA 2BC4A 1FDLH 3GSNB 3WKMH 2NW3B 1KB9J 4F7TB 4H8WL 1ZT1B 3T08A 4YZFE 2NLJA 5B8CC 1GGIH 3N9GL 3VFVA 2JJVA 2BOCA 4N0UB 2EYRB 2YK1H 3P40A 3M1BB 1XGPA 4FFZH 5GS0H 4N0FB 1DFBH 1I3GL 2QLVB 4RNRA 5DJXB 4ZOAA 2YRPA 4O02H 5J57B 3GI9L 4H20H 3ARBD 3REVB 5A3ID 4PRBA 5HYJE 4QT5B 4KY1L 1FZKA 5D71H 3F62A 5HGBB 2FGWH 5IQ9A 3ARFD 3ORJA 2YR3A 3B5TA 3T65B 4QRTA 1DBKH 1HINL 1H3XA 1HK6A 3K8MA 3VG9C 3VGHA 3OBAA 5JORA 2VDOL 5F7EH 2ZSWB 1IGYB 4HPYH 4XCYA 2OSLB 2PO6B 1FFPB 3C6LB 1UM4L 5KTEH 1FO0H 3FQTB 1ZE3C 1I1AA 4FTVB 3S88H 1I9RL 3I02A 1HZHH 2A83B 4S2SB 5FO8A 5J1SC 4HWNA 3L9RA 3VMOA 4PLJC 3EYQD 2Y06H 4HK3J 4NO5A 2GY5A 2LTQB 2F9BT 3FO0H 4DJMA 1QFPA 1MVUA 4P46B 5E5MB 1K3ZA 3QH3A 4S0UC 1IKNA 5DVOA 2PCPA 1XR8B 4HF5H 4M8VA 5E5UB 1YEHL 3PDOA 1TIUA 3CVIH 5HD8D 4A6YH 4ACPA 1D5ZA 1I7TA 2BVYA 5J06A 5JW3H 5JW5A 2Q6WA 2ZKHL 2VDKH 1XCQA 5KSVB 1A6TA 4ZUTB 2AABL 3NCYS 2WIIA 3JTSA 3OX8A 5SWZD 1KEGH 1GZPB 4P4KC 4TQEH 4OFPA 4Z7UB 2R9HD 4TVPL 1C1EL 3K2MC 4J7RA 3EO0B 1QSEA 3TBVB 3O8XA 4JFFE 1X5JA 2B5IC 1QHPA 5DMYA 1TETL 3PJSA 4XCNB 3VG0L 3SDAD 3P0YL 4MXWL 2B1HL 1HYRC 5EU5A 1P84K 4POZD 5IGXL 5IW6A 1G6RB 1BIIB 1WT5C 1BD2E 1WAAA 3BPOB 5HDQL 4CU7A 3CXDH 4P4RA 2ICWI 3CD4A 5D1QB 3PDGA 2MOVA 4NRYA 3IU3A 4F37F 1JGVL 2A77L 5IMKB 5KVFH 4OCSH 5CZXC 3DMMD 1G7IA 4X5LA 3MRNA 4WO4C 5GS1B 4ZNEE 2J8OA 3F7QA 1AR1D 3VXNA 3PQYB 5CKAA 4BJLA 2AK1H 3JXAA 3JUYA 1CFTB 4GRMA 5KSBB 3H7LA 1BBDH 1NUDA 1U8LA 2I9LB 5GGVH 3TLRA 3IRPX 4U1JA 3HZMB 3GSVA 3O4LE 1RUAL 1CD0A 4FXKB 4UBDD 1GRWA 5AD0B 1CIDA 4R2GD 5F7DA 4D0DA 4BH8B 4H8WH 4NQEB 4L9LA 2VIRB 4HMCA 3MROB 4JQVC 1ZGLB 5FEBA 1OPGL 2ZG2A 4X4XB 5FKPA 3N9GH 4TUKL 3RRQA 1Q9LA 1A1MA 3RWJA 3FJTA 4RX4A 4O51A 5CD5D 3FO1A 3BP5B 3GSXA 2PW2B 3QEUA 4OZGB 3BQUC 5DUBB 4QYOB 2X09A 5B3JE 3ABZA 1I3GH 4GT7A 2H41A 1T66C 5MENB 5F6IB 1UQSA 3GI9H 3DO3A 3T0BA 2VZ3A 4GKSB 4E5XB 2X4TA 4APQB 3CU7A 3KYOB 5E00B 4WIQA 5ITFB 4KY1H 2FX9L 3I6GB 3OGCA 3NIFF 4Y16B 2BNQE 3D3VD 4Y2DC 3R8BB 1HINH 2NY1D 2VDOH 5GRVK 1CS6A 3O3DB 3GI8H 4GAYB 3QJHB 4MA1C 4ELKA 2R4RL 3IAQA 3B8YA 1UM4H 4HUNB 4OI7A 3ARPA 4R4BB 3MRQB 4JFDA 1I9RH 5FOBA 5DRZB 1PBYA 3X12A 5C0FB 2W0KA 3H3KA 4F57L 2GSGA 2I25N 2PTTB 2P5ED 1M71A 1WFUA 1TFHA 4PB0L 1RAMA 4MSWA 3DROB 4I77L 1IAKB 4ZSOB 1YEHH 2YHGA 3GHBL 3HZVA 4IDLA 2EDNA 2ZKHH 2AABH 1B0RB 1Q0XL 1OW0A 1KENL 3ILQD 5KAQF 4JRYB 5JLZB 3OZ9L 4TVPH 1C1EH 1X4ZA 3PXJA 1B0WA 2GIYA 1U58B 1F2XK 2X4RB 4FFWD 4L3EE 5TGBB 1T20B 1TETH 4YHML 3VG0H 4K3HA 2DB8A 4K71B 3P0YH 4MXWH 2B1HH 5CSZB 5ESAA 5FYKD 1YMMA 4KJQC 2C3GA 2OTWA 4HG4J 4YGVB 3H7BA 3ISWA 5IGXH 4OCWL 1EZVX 4XCEA 4YK4B 5FGCB 3L3DB 1S5HB 5F97E 3MJ9L 4NN7B 2WINB 5HDQH 4M93C 3SBWA 1DJSA 5LAXB 1G7PB 1RZKL 3LY6A 3QA3B 3AREB 2EDYA 3GIZL 3CFKB 1JGVH 2A77H 4XC1L 1LK2A 4IMLB 3GSUA 2K7PA 5DJDA 4KXZI 2A6IA 5C08A 4N9OB 1LVEA 2B4CL 4FZEL 2DLIA 4PJHA 4YHIB 5DJZB 5DO2C 5T1LA 3ZHDA 5HDLA 4YHKL 1UB6A 4IM8A 2AS5M 5CHNA 1RK1B 4UUJB 4BUGA 1AKJD 3RKDD 3KYKL 3I75A 4B5EA 4KKCD 1CE6A 3NIGE 5J12B 1OGAA 3CFEB 1RUAH 4KPHL 2O61A 4I48B 1U3HC 4FQHB 3WNMA 3L3IA 4M1CD 4F7EB 3A0OA 1OD7A 4NQSB 4PLNC 3CFDB 1DP0A 4C4KT 2ZUUA 1CLOL 4PY8J 4Z0XB 1A4KA 1UVQB 4NHUE 1Q9OA 5DK0B 4PJDA 4PJ8B 1PG7X 1OPGH 2EIBA 2YD2A 2FH8A 2WNGA 1JUFB 4TUKH 3TJEL 4JFXB 2NY3C 3WN5A 1S7UA 1C5CL 3VXPA 3MGTB 3VFOB 3QUXC 3F8UB 1TNNA 3VFRB 2ICCA 4E0RB 4LSTL 4GBXD 2F53D 2XY1A 5E4EB 5C0DA 3DRQB 1L9NA 1MLCA 4ODUA 4LRIC 4PV8B 4W68A 1P4LB 2I60L 1DQJA 4HS3B 2FX9H 1IGFL 4ZODA 3UTSD 4YBLC 4NBXB 2HTKC 5SWSD 1J0HA 2ZCKL 3WXWL 5BZDB 1FFOB 4DWHA 2IBZY 4HHAA 3LKRB 3DVNB 4ZPTB 3U36A 4I0KA 1PY9A 3H9SB 2R4RH 4X8XA 2OL3B 1JGEA 2OM5A 4L4VE 2FO4B 4RMRA 5C0NC 4GG8B 1GCFA 2QR0B 1AQDB 1BVKA 3FB7B 4HWZA 1M7IB 4GRWE 4ZPVA 4ELME 4F57H 2W65B 4M62L 1AY1L 5IB5A 5HYSG 1BHGA 5FK9B 3SY0A 4PB0H 1I85A 2VSCA 4Q2ZA 5F6HJ 1HDMB 4ODHL 1BZ9B 5GGSA 4L3EA 3Q6FA 3RWIB 3ES6B 4I77H 4HKZB 3T3ME 3F7PC 3MV8B 3X13B 4HKJA 1MF2L 3GHBH 4I18A 2AXFB 4GMTL 4OD2A 1KENH 4U3XA 1LO3L 3OZ9H 4EN3C 5D72L 3FQNA 3TNMB 1OB1A 3DVGA 5HVHC 4PRHD 4NRZB 4YHMH 4WFED 3JV6A 3ZDYE 4KUCF 3HMWL 4Q97A 3WL9B 2BVOB 3VGBA 3G04B 4KROC 3MUJA 3OKMA 3AS3A 1NBZA 4OCWH 4R7DB 2N7AA 3PWVB 4NQED 1SYSB 4XHJC 3KYMB 1WSST 3VWKC 3MJ9H 4NCC1 2CRYA 4G8EA 5DQJA 1G7QA 4YDVB 2XXCB 5HBBA 4JKKA 5JOEA 3PWPB 3GIZH 2A73A 3IJSB 3GB7B 1TCRA 3UAJC 1TNMA 5F7FA 3CH1A 3RWHB 5HJ3B 4XC1H 3L7FA 2YA2A 2YD6A 2IAMB 3SQOL 4PJAB 5D5ME 4OUUB 5MEND 4Y5XB 3SDAA 3DX7A 2B4CH 4Q7DA 4APQD 4FZEH 4YHKH 5EO9B 4JR9L 2NY0D 2HLFC 1TMCA 5ILTH 3KYKH 4IRJB 3ULVD 1T7ZA 2DQUL 1KPUB 1NJ9A 2FEDD 2Y9RT 4H0GA 1GSMA 2NY6B 4KK5D 4F2MB 4NO2B 1T5XB 4ODWB 5ITBL 3GMRB 1CLOH 3IJHB 5EORL 2ESVB 1U8MA 3BUYA 5EUOE 2BOBB 3L1OL 4QHUA 5JA8B 4KRPC 3P30L 3B43A 4MQSB 3HLAB 5C0CB 3H42L 3TJEH 2FJFB 2HN7A 1VFBA 1LO5A 1C5CH 2EEAA 2P1YA 4Z7WE 2Z8WC 4OZ4A 1ND0B 3MTRA 1WJ3A 5JOFB 5K9OA 3GJFA 3GSRA 4NNXB 1MCNA 4MNHB 1IAMA 2X4UA 2ADJA 3HB3D 1N3NB 3HC3L 5CGTA 2I60H 2N56A 3LD8B 5KOVC 2AK4D 3LKNB 5FA3A 1IGFH 5BJTB 3TCLA 3KPSB 2ZCKH 3CFIC 3WXWH 1TZIB 4N90E 3TZVC 5C9KA 1VB9A 3OB0K 3NZHL 3BKYL 4WVRA 4WFHD 1Q1JL 3KPNB 1HHJA 1R24B 4WHCA 3QFJE 4U0RB 2FLRT 3VXTA 4OKVA 4M62H 4RGMC 1AY1H 2IADA 3C5ZD 3F7VA 4Z95H 2BHYA 4PGDB 4ZO9A 3S8WA 3ET9F 5BV7B 2C26A 1NDMB 3CSYB 7CGTA 1CXKA 4ODHH 4RZCB 1S7QA 3QHFL 4HZLA 1UG9A 1EEUA 2KKQA 4N1HB 3VXOA 1BWWA 1YNLL 1IQDA 4JE4B 1MF2H 5I8EB 3QEHB 4N5UA 1CI5A 4GMTH 2EDXA 4PREA 1LO3H 2WLYA 2FNBA 2YRZA 5D72H 1SEBB 2ICEA 4PP2A 3O41A 2V2TB 1NKOA 3HMWH 4JFOA 2ICES 2M1KA 5EULV 1T1ZA 2DLHA 2C1OB 5DVKA 5DQDL 4WUKL 2Y7QB 5D5MA 2F19L 4Y4KA 1C08B 1I8LA 2QKIA 2VZVA 1UJ3B 4EI5B 4I0PC 5DVMA 1I8IB 4NWTL 2YSSB 3LKSB 4R3SA 3SE9L 3RI5F 3RWDA 4G7VL 3VXUD 2E5EA 1FJ1A 1KCKA 1BLNA 3BJLA 1WVZA 3SQOH 2YD9A 5D7JC 3GMOB 1VGKB 4R0LB 5DTFA 2R69L 3BP7A 5EUOA 2V7NB 4WI4A 4R97B 2CKBB 4JR9H 2EE2A 3CDGA 3DO7B 2IMMA 4PJFB 1ZV5A 2R15A 3B5HA 1ITBB 2DQUH 3UDWC 3JWDC 4MZ2A 1XFPA 4OCXL 4XZUB 4C4KO 4PJCE 1CICB 3QPXL 5F88A 3L5XL 5IJKC 3O9WA 1EFQA 4KDTA 5H35B 1P7QB 3I3DA 5I9QB 5ITBH 3V6ZA 4FMKA 1WFNA 3H9SD 5E8PB 3L1OH 2IC2A 4MHHI 4F3FA 1JWSB 5D2NE 2GSIB 3P30H 3DV6B 2BSTA 3H42H 5IM7A 2VN7A 3BVNB 3C8HA 5EOTA 2ARJB 5T1MA 4EI6B 1SVZA 3KNBA 1ZK9A 1H15A 3R1GL 5E08L 5F44A 3WIHA 9CGTA 4C57C 3GBML 4XP6L 1AKJA 3EYVB 5H37G 1HH6A 1NMBL 1T3FB 3V95A 3FFCB 3HC3H 3NA4A 1R5IA 2KUTA 3GO1L 2KL6A 4AZ8A 2I26N 3RWEB 1T5WB 3C2AL 2D7TL 4IJ3B 3QFJA 5DA4A 4L8DB 2W59A 1OCWL 5J1AA 4FQ1L 4UNTA 2ZP0T 2EYSA 2H6PA 2DWEA 1B90A 4NNPL 4LLDB 5INCB 4OLYL 4WJ5A 3NZHH 1ZA6B 32C2A 5CP3A 3BKYH 1U41A 3JWNC 4UT6H 3BAEL 5DJ0B 4AYFA 4GBXA 4NBYB 1Q1JH 1T83C 3RU8L 3GBNL 4PJ9B 2P8MA 1P7KB 1EBAA 2X1OA 4LPYA 4XNQA 5H94A 4EUPB 5DJAB 3UROR 1DCLA 3LN5A 4ZAKC 5BRZB 3CJJA 3UTSA 5K9QG 2Y5TB 2VDQL 5SWSA 1UKSA 5MI0B 1YA5A 5E9DE 2NX5B 1QFUH 3ZE1E 1J11A 2XI9A 4MDJA 5E2VL 4GG6E 3EFFB 5HDOA 1FYTE 5JNYB 4FOMA 4CVXB 4R96B 4U6YA 4G43A 1B6DA 1X6LA 5GRWA 5HI4D 1IVLA 5FM4A 3D2UD 4NSKB 2DDQL 2V17L 3CX2A 4JM2B 3FO9B 4PFEA 4WGWB 4WEUD 5GISL 2NY6D 2Z35B 2WSKA 2DMBA 5DQDH 4WUKH 1HKLL 2F19H 2N7BA 5CJ8A 4PP8C 3TO4B 4MXVF 4RA0C 1AHWB 4YFLI 5CSGA 5I17A 2ZUVA 1LWRA 4QRSB 3IETA 3HRZB 5C0CD 2NR6D 4NWTH 4TUJB 1OP5H 5HY9B 1YNTB 4F33B 3SE9H 4G7VH 1AGEB 4NN6C 4P49A 4QHNA 3TIEB 2RR3A 2LAGB 1IAOB 1VENA 4JCLA 5F8RC 4LEXH 1QFOA 2JB6A 4PRHA 1UZ8A 1AD0B 1CQKA 4AEHL 2G9HA 3BZ4A 3CNKA 2R69H 1JV5B 4DN4L 3NN8A 5DK2B 1ZVSA 4PYHA 4HV8A 1A1NB 5CWSB 5CINL 4OCXH 4XCCL 3TA3D 1MRFL 3QPXH 4XWGL 1QLEL 2C4FU 3KPQA 3L5XH 2V7HA 2R0KL 4IHOB 4NQDE 1JGDA 1RJLB 5BOZG 4LAJH 3TIDB 4LCWA 5D2NC 4J1UB 3VFMB 2CDFA 4NN5B 1U91B 3FB6A 5GGRY 4BYHA 1Q9KA 3HE7D 4MQXD 2BVPA 5B39A 3QEGL 3R1GH 4Z7VB 1UEYA 5EIIB 5E08H 4CVUA 2P5WE 2W92A 3GBMH 1OAZL 4XP6H 2UVFA 3U0WL 3G5XA 2J8UB 1NMBH 1T04A 2Q8AL 2JLLA 2OR7A 5TDOA 5E8NB 2E7LC 3HFML 1NCAL 5EIQA 1VACA 3UTPD 4BM7A 5E94B 2OBGA 3T77A 3GO1H 3MXVL 4XX1G 3WSQL 5KSAD 4CJ0A 2EYTB 2YPLE 1FZMA 1ZANL 3C2AH 4R8WL 3RY4A 2D7TH 4DFHA 1C8PA 1G7MB 4H5SA 5A2LH 1XF3B 4WW2B 4P3DB 3BZFA 3T0ED 5EO0B 2X7LB 5F1SA 3VXRE 4RWYL 2I5YH 1OCWH 4RIRB 1F4WL 5C0IB 4FQ1H 2AXGB 1VESA 4NNPH 4OLYH 4Y19E 5C6WH 1H3GA 3BAEH 1RZFL 3QWOB 3PWNB 5F7LB 4BA8A 4PJBA 4JZNA 3PWUB 2DQEL 4Z78B 3RU8H 4QLRA 3GBNH 3KLHD 3O3EB 5I76A 1TLKA 3SHSA 2C1PA 3C60D 3QI9D 5L2KB 3V8OA 2MMXA 2AK4A 4EI5D 3U4EB 2ICWJ 4HUWA 5D96C 4Z7UF 1NC2A 1UZ6F 1BZ7B 4JDVB 4EVNA 3OKLB 5IKCB 5FXCH 2IJ0C 5C0AB 5E2VH 2P8PA 3BRGC 4I5BB 2PXYC 4OZFB 1U9KA 5MP6L 2NXYB 1NFDE 3MRPA 1U0QA 3BT2L 1I3RB 4NZUL 5HVWA 2OMNA 3MLSL 3LS4L 5CZKA 2J1KA 3D9AL 2DDQH 2V17H 5GISH 1CICD 2NY4D 1S9YB 3O6FB 4LLYA 3MRFB 2DJUA 4M5ZL 3MYZA 4DVBB 4KKLC 4OSUL 4GW1B 1HKLH 3QDME 1DBJH 2GUOB 1ZTXL 3V0VA 3EZ8A 3T2OA 5EN2B 3KDMA 3TBTB 3AS0A 3QIWD 4GAJL 3QNYA 4RMSA 5KSBF 5I1DA 5L8LB 5FB8A 1NEZB 1AO7B 1PQZB 2EIDA 2QSTA 1N4XL 2XA8L 3NCBB 3O4OB 1EDQA 1I3VA 4DN4H 5GGRB 4NM4L 4ONFL 3NFPB 1HE7A 5D7IA 1RUKL 3ARDC 4IBLT 5CINH 5CBAA 5ISZB 2XWBA 1A6ZA 2FJGB 2VLRB 4XCCH 3QPQD 1LNUB 1MRFH 4XWGH 4HEPG 4F8TA 1QLEH 2DTSA 3BP4B 4GO6B 2R0KH 1FVDA 2EC9U 1IEAB 2WBJD 5C1MB 3EO9L 4OZGF 1B0GA 5JXAL 4XI5C 3VXUA 3PHQA 3T1WA 5DS8B 4QOKD 3DBXA 1T4KA 1GGCL 4X4ME 3PV6B 3SJVE 4PJ9D 3DIFA 2ZUQC 5ACZB 5T5FH 2W0FA 3RZCC 3SGKA 1C5DB 1FV1B 2O93L 3QIBC 3FOMA 1CDJA 1OAZH 2PYEE 2Q8AH 2IBGA 4P2OB 5KVMC 3HFMH 1NCAH 3Q5TA 1TPXB 4X6DB 3DUUA 3BKJL 3KLAB 2LAAA 1CN4A 3MXVH 2XWJB 3BMVA 3WSQH 3VXSE 1KBGL 2YN5A 3SDXF 3EJZD 3HPJA 1ZANH 4R8WH 3LQZA 5CMAB 2GHWB 3IXTA 3OKEB 5FFLA 4RWYH 4F9LC 1F4WH 3FT4B 4QF1B 3ZYIA 2UY7A 2HH0L 4DZBA 2P42B 2VO5A 4LASH 1KGCE 5CGYC 1RZFH 1N6VA 5FO7B 3STLA 4L29B 5IFHL 4QRRD 4L8BA 4Y2OA 1WGOA 1DUYB 2AV7A 2HKHL 1WZLA 3S3JA 1YEEL 4HJGA 5FCSH 4PJGA 3TBSB 5TDPB 5E5RB 1XAUA 1NGYB 5F7UA 3S3SA 1FG2B 4KUZL 5D1ZD 1RULL 2DQHH 3QUZB 4QNPF 1DLHB 4X0KB 4D0CB 3BWAB 2R2EB 1UXSB 3MRBB 1MHEB 1QR4A 5MP6H 1ACYL 3O6LL 3QDMA 2PYFB 3SE8L 1JPST 5HHMD 3BT2H 4G42B 4NZUH 4P2QB 3MLSH 3LS4H 3JWDL 3D9AH 4LLMB 3TH4T 4PJ5E 2GYSA 1AGCB 1YPZB 2VDPL 3D85D 3CSBA 4M5ZH 1KCUL 4OSUH 2XV6B 4UDUA 2B1AL 1IILE 5AUMA 4ZUWA 4PBWD 4E41D 1GPOL 4ZOBA 4FQJL 3T2NL 5ID0B 1V8HA 1AQKL 1HN1A 1F3JB 4V1DD 5C6PB 3QXTA 2Y5EA 4Z76A 1W8NA 4A2LA 4GAJH 2XIDA 5EU4A 1F5WA 3LKPA 5HHPB 3P9MA 2Z4QB 3AU1B 5EFIB 3D2UA 3ZKMD 3HS0A 5CEZL 2G60L 5IROA 2VR4A 2ENSA 3FCTA 5I8CA 5I1HL 1N4XH 3QYCA 2XA8H 4ZOEA 1H3TA 3EBAA 1MCBA 3IDYC 5HTSA 4JFYB 2X6MA 3T0VA 3GJEB 1KLGA 3GJFH 2DM2A 4MNGB 3TJHD 4MJIE 4NM4H 4ONFH 5GGTL 5D7IF 4CN6A 2E9IA 1RUKH 4G9DA 4KKBD 2IPKA 4GRLB 5IESL 2V2XA 1UT9A 4JG0H 4OJFL 2UUDH 4QRPE 3EO9H 2VTFA 3MV7B 1GGCH 4GRWH 5EOCJ 2VAAA 3C5SA 1FPTL 1S7SA 1K4CA 2P8LB 4FXGB 4GOSA 4MJ4A 1M05A 1XGRB 4O2EA 2OTUB 1K6QL 4ZTPL 5L2KD 3Q6GL 1IGTB 15C8L 1CDIA 1YC8A 5DMKB 2FL5B 3O3UN 4HH8A 4G8FB 3MV9D 3QEQB 3TA3A 2IBBA 1T0PB 2YMXL 2FYYB 2L4OA 2DWDA 5C0AD 3BKJH 4O2FA 2KDGA 1T80A 1U93A 4LBEA 1KBGH 3WLBB 2HFFB 1FLRL 4JFEB 3CMGA 5IWLC 1FNFA 1FIGL 4LNRA 4ODVL