3ROLA

Murine class i major histocompatibility complex h-2kb in complex with post-translationally modified lcmv-derived gp34-41 peptide, comprising a nitrotyrosine at position 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
271
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 75
structure length 271
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rolA01
5CBEA 4M5ZH 3D2UB 4XNXL 2NXZC 4YHZH 1CDIA 3BWAB 2YRZA 1T1WA 3WS3A 1NQBA 3K46A 5HHOB 4OD2A 2GHWB 2WP3O 3QHZH 3TO4B 1DVFA 1EEZB 4MAYC 2XTJE 3EJZC 4RAUB 4Y5XA 2PO6A 4YXHL 4F33A 4I3SH 1EVTC 4ZO8A 1XF2A 5F97E 3IKKA 1I8MB 4OZFG 1I8KA 2AV1B 5T33L 4HBQA 4DKEH 1F3DH 5SWSA 3AGVA 4RMVA 1EO7A 1XF5A 5GS2H 3GI8H 3V4UH 3QIWA 1KCSH 3QA3B 1BQUA 2DWEA 4J3OC 4PJEA 5K9QI 4LARH 1A64A 4F37F 4NQUA 4APQD 1T2XA 5GGVH 5DUML 1PG7H 2X4SA 5CIPB 4QRRA 4GW5A 2QADD 4NHUE 2CO7B 3OJDA 1PY9A 1BVKB 2VNCA 1BJ1J 2QJDA 5B3JF 3C5ZA 1G84A 5E2TL 1SJEB 2EO1A 5ANME 5F9OL 4NN6C 1WC7B 2AI0L 3VXSD 3QUML 2HRLA 4OFYA 4ZO6A 1DQQA 4N0YH 4XPTH 4KDTC 1YEJH 1JYXA 3DX7A 3CJJA 4FQ2L 5I16A 5E9DB 1CICD 2NW2B 4HV8A 1PQZB 1IQWL 3TBVA 4CUCA 5C86A 1LEKB 4Q7DA 4U1LB 4XP9L 1YEKL 1FLTX 1N5AB 3EHBD 5MEOA 3NMEA 2GY5A 4XNQB 5CLTA 4BSVA 3G5YA 4AIXA 1T1XB 5DHVA 3LN5A 3N1GC 4MZ2A 4XP5L 2HTKD 1OB1B 3BEWB 4FQHA 4Y4KB 5DJ0B 5JW5B 2YOCA 5IGXH 4ERSL 1TQBB 4R7NB 5I1CL 4BUHA 2PYFA 3D18A 1U93B 2V2TB 5TJWK 4KZEH 1WFUA 1UZ6F 3DSFH 4P2OC 1OSPH 4RWHA 4M48L 1I7RA 1QLEL 2MNUA 1KPVA 1I1FB 3HZMA 2EKJA 3T4AA 5I18L 1G7QA 4UIMA 1JJUA 1F90L 2XA3A 5E00A 1FORL 1VACB 3QWRD 4X9FA 3VXRA 4AH2A 1YECH 1FNLA 3CXDL 1QSVA 4ZNEE 1A6VL 5FYJL 2D2OA 2X9YA 1B2WH 5KW9H 4P59L 3TJEL 5E1HB 4R2GC 3OB0K 5I1DA 4BSJA 1IGCL 3DRQA 3QDAA 1QFWL 3H6JA 3VH8A 4PJXF 3F7VA 2IAMA 1OARL 1ZVHA 4PGDA 4MHHG 4U1SA 1YEIH 3IDNA 2R56H 2P5EE 5C0RH 1HHHB 4RFNB 5FUZL 1WAAE 1M05A 1O7SA 1RMFH 1L9MA 2VOTA 5A2FA 1CE1H 3FQRB 5BOPA 3VG9C 4PGEA 3CH1B 4RSVA 3TPUA 3EFFA 4J3XA 2DIJA 3AMLA 1FFOA 1BD2E 4Z7OF 3MX0A 2F8XC 2B4CH 4PUBH 2OMBA 2H3NA 3FQUB 4ONGL 5E95B 4S0UC 3OJVC 2W0PA 1YPZE 4K94H 1HNFA 3BW9A 1EXUB 5C8JA 5DWUH 4IS6B 1CGXA 1K4DA 5DA4A 4LLDB 4JRXA 5EU7C 1HILB 2W0KA 3T0WA 1PZ5A 2APWA 3BXNA 2KZWA 5D7JB 3CFKA 3U82B 3FN9A 1I7TB 3MLWH 2HFEA 2XNAA 1E27B 3ARFB 1IM9A 2RCSL 1T2JA 2EIDA 5CWSA 4WO4D 1DLHB 3GRWH 4NO3A 1KG0A 4XP6H 5DUBA 4P49A 3L5HA 2EYRA 4JRWA 4PV8A 3VFRA 2GJJA 1UZ8B 4OZGF 5HGAA 2PUQT 2HAZA 5DD6B 4TTDD 4K8RC 5JW4Q 5E2WL 1GVIA 2O5XL 1RY7B 3CVHH 1JF1B 5C09D 5KAQF 1N6VA 5DJAB 1BFVH 4ODUB 4ZFOL 4JGUA 3LD8C 3QH3A 2VABA 1KNOA 5EFIA 4PREA 4XVSL 4L3CA 5HHXH 2F19L 3GHBH 1EHLH 4ETYA 3PE9A 3LEYH 3MLVH 5IB1B 4PJ7A 3TJHC 3S37L 3VFSB 2DQGH 5T1MA 4HKBA 1T89C 1S9VA 2YD2A 5IVNA 4F8TA 5FA3A 3MC0A 5E7FA 3EOYG 1A1OB 4PRIA 1QSEA 2CIIB 5LQBH 4EVNA 1N3NA 3H8NA 5D2NE 2LTQB 2ESVA 3EDKA 3MV9B 4GRLC 5FUCE 1KFAL 2BOCB 3OAYH 1EX0A 2V2WB 3FOLA 2R29L 1V3LA 2P42B 4LF3B 5IJKC 5M7QA 2DRUA 5BW7A 1MFEL 1F6FB 4C59B 2DJUA 1A0QL 1HN1A 2DYPD 3CZJA 3MRHB 4UNTA 2JCCB 2L7UA 4Y4KC 4LASL 2GUOB 5IT2L 2ENSA 4W6WB 1TQBC 2UYLB 1L7IH 3CZFA 1RIVL 2BMKA 3KPOB 1RK1A 2IH1B 3SKOA 4U1MB 2VITA 1W72H 4NQED 3ARGB 2YZ8A 3NAAL 3QZWB 12E8H 4P2RA 1ZT1A 3W81A 1U92B 4X99B 5JOFB 1TFHA 3WL9A 1B4JH 5LXGH 3PWJB 4XAKE 1IAOA 3QUXD 3HE7D 3IKCA 5I9QB 4OZIE 1CDYA 3EYSH 2DLFH 2G9HA 1BMGA 4PJFE 4OFKA 5L8JB 4M43H 3O2WL 4IIQB 1EJOL 3V8CA 5FYLD 4OFVA 4U49A 1ND0B 4FQCL 3L3DA 1J8HE 3DUHA 2ICWA 2VDQL 2DM7A 5DHYB 4BKLA 1I1YB 3Q3GB 3DUSB 3FO1A 4DOHE 4FXGB 1KULA 3FO0H 5CJQL 4HCRH 1C5BL 3NCJL 3L3GB 5CSZB 1HXMB 2WANA 3NABL 1VESA 4XX1E 3RNKB 1G1CA 1R24B 4UB0L 4XGZB 5FCUH 1HXYB 1IRAY 2NYYC 5HYIA 3UYPA 4ODHL 4JM2B 4QCIA 3VGHA 4R4FH 4ZPTA 1P2CA 2NXYD 3O6FD 4JG1H 3GJEB 1E6JL 4F58L 2I27N 1LQVA 3MJ6A 2WLYA 2BC4B 4Y1AA 2QKIB 4IMKA 1DE4A 1CDJA 5FKPA 2BNRE 4JDVB 1YNKL 2GQHA 2Y06H 3NTCH 3EZ8A 3WJJC 4R3SA 3PDOA 3M45A 3MRRB 2RFXB 4GKSB 5JUEL 4BZ1H 4FFVC 3QYCA 4UV7L 1JUFA 3FO2A 1KTDB 2F53A 1U95A 3FONB 4JO1H 1XF4A 2DQCH 4K23H 4I2XA 1OTSD 5CZXD 4YFEA 3ARFC 5E2VL 4TVPE 4KZDL 2V9RA 2HG5A 4MQTB 1FFPA 5DZOA 5FECA 4XCFH 3RBSA 5LBSH 3ARBD 2VLRA 1H5BA 4XHJC 4J3TA 4X7TA 2J8UA 3BH8B 3S96B 1ZK9A 5CSGA 3H7LA 3LV3B 1WICA 1EEQA 4KVNL 2R0WH 1S7QA 1I9JL 3GMQB 3LKOB 3MRBB 5IVXB 1BGXL 1Z9SA 1FFNA 5A16A 3QDME 2WSKA 4Z7WE 5DK2A 1VEOA 1MCRA 2ARJB 2YA0A 1SYVB 4GH7B 5ITBL 3DVIA 1EIBA 4LSRL 1VGEH 3GMMB 5IESH 5IMMB 4M6OL 3MNVB 2HLFD 4GAJL 4LLWB 4OI7A 4AEHL 5DJDB 2E7BA 4F3FB 3MODH 4K9EH 4NKIH 3ZLQC 4M62H 2NY6D 3UZQA 3DIFA 2BVYA 1MLCA 1U8LB 2PTVA 1LP9A 3U79A 1DBBL 4JO4H 4BH7B 3MUZ1 1AQKL 4XI5D 1YA5A 4NQDA 4P0DA 4XXCC 1LO0L 5EG6C 3ULUD 1T03H 1NC2D 4MVBC 4X6DA 4WGWB 3E3QA 1A5FL 3L95A 4LSPH 4QTHA 2J6EL 2DQHH 1A7QH 4HC1H 1FVEA 3TIEB 2VSCA 4PJ8B 4CJ1A 5E5UB 5C0AD 3MJ9L 5SX5K 5F7EL 1P4IL 5GHWH 5K9KB 4O5LL 4PJ5A 4PGZA 4WW1A 5D5MF 3T0XA 4P2OA 2GYSA 3X3FL 1F6LL 4UMGA 1BM3L 3AAZB 1QLFA 4D2NA 4YAQA 3TVMC 4IRZL 3HZVA 1JGUL 1WBXA 4MD4B 2ADIA 5C0IA 5I9QC 3QUKA 3RKPA 3V2AR 3SDAD 1ZHLB 4X98A 4IIQC 4QRSA 3BQUD 5SV3A 3CCHB 2VJXA 1ROWA 2GEEA 4RFEA 1DJSA 3BMVA 2P5EB 1JGDA 4DUXA 4Z0XA 2EDOA 4L1DA 4PRPE 3CUPB 4OBRA 2BY0A 2FATL 5FO9A 5J57B 1ZE3C 4DVRH 5AG9A 4PJDF 5JLZA 5TDOB 1FQ9C 5DD3H 4LNRA 3FQXA 5HHME 3GMLB 4BJLA 4JVWA 4ZXBC 4YXKL 3FN0L 4KV5F 3F7YB 4BFIA 1LEIB 2E7LC 4OQTH 3KPSB 4MJID 25C8L 3PIQB 1LK3L 2IMMA 1T22B 3NIFE 3R1GL 1G6RA 2DQEL 3EOBA 4HD9A 3HRZB 2I9TA 3TN0A 2BSRA 2DLTA 1Z3GH 4X9IA 5IQ9B 4EI6A 4A6YH 1ZT7B 2P24A 4HMCA 3BDYH 5I74C 2EE2A 1JMXA 1E28A 2DQJL 2KBGA 3EDEA 3AS0A 4FQLL 3UJIH 5FB8B 5J8OA 5BZWB 2XTJC 2CLRA 5JNYB 3C60B 5DGRA 3MRJB 3KYAA 3DX9B 1SY6A 3SE3C 4UV4L 1J0HA 2E8ZA 3BWAA 4F7CA 3HS0B 1KLGA 4NFDA 5I2IB 4ZFFB 3PGCA 3KYMA 1D5BB 1Q0XL 3U36B 2PF6A 4Z8FH 2IBBA 3AM8A 5CILH 5JHLL 2VB5A 4NM4H 1FG9C 4PLJD 4XB8A 3OB0H 3W5NA 4LCWE 1G9NH 2OMNA 3QA3A 2DN7A 4XPHH 3LAFA 3V95A 4W81A 5H94B 1CR9H 2R15A 1RZGB 4YX2H 1RZIB 1MIEL 3U0PA 4XH2B 3BP6B 4HIJA 4P57B 3TFKC 4QNPF 4LIQE 1IQDB 2J4WL 3G9AB 2GKIA 1JWMB 4MMXC 2X4QA 3LKPB 1J18A 1ACYH 1JF6A 3U7WL 5D2NB 1DP0A 3IU3B 2VDRL 1GJIA 1T89A 3BP4A 4I3RL 4FMKA 4ODVH 4V1DD 5K9JH 1P84J 4F57H 1EK3A 3M07A 5M94B 4NIKB 5DD1L 2DQTL 2B1AH 4MDIA 2VR9A 4B41A 3EIFA 4R8WL 4GRLA 3H9HB 2CUHA 3H7BA 2VMFA 3HMXL 3UEZA 4MA7L 3W11C 1TZGH 4XNQA 5IJKA 4JVPA 5KSVB 4ZFZA 1HHJB 4POUB 1D9KA 4M93C 4D0DA 3EFDH 4P9HH 4TYUA 1I1AD 5EORL 4Z7UF 3U30C 2IWGA 4PY7A 4XCCL 1BWWA 2P49B 4LHUA 4OZIB 4TVSa 2KL6A 3C9NB 2B7DT 1U93A 4P5TC 5CZVL 1LE5B 4X6EA 4PJFB 2FBOJ 2NNAA 1F11A 1CGSH 2HFTA 4BK4A 1K4CB 5GGRA 3VXTA 5MEND 1N59A 5HYQA 3UJJH 4R4BB 4HIIA 1R3IL 1S7WA 2VDKH 2VKXA 1FL5B 1IBGH 1J8HB 2H2PD 1HDMB 2FWOB 1I9RL 1HIML 2AJVL 4MAYD 3RJDA 4RGOH 3WO4C 3W2DH 4ZPVB 1ZA6A 2PW1B 5JMOC 3JV6A 4DOHB 5GRVK 1E4WH 1TTGA 2Q87A 2M26A 1NGPH 4LLUA 5HYSG 2IPKB 2X70B 3MLYH 5TQ2H 4K3DL 5IEHA 2YUVA 3ALWA 2HFFB 2WW8A 5KN5B 1XIWB 4Z7VB 2C7UA 5IB3B 1LE9A 1YNTA 2HVKA 4DZBA 1JHLL 4X83A 3FAWA 1U8MB 4NKOA 5EN2A 1X4XA 1AE6H 5L0QB 5FOBA 1N7MH 2H8PA 3V0VB 2X7LA 4XPAL 4OD3L 4OI9A 5EC1B 3RWGB 1NBVL 1I3GH 5HYJD 5GRJH 2ZOKB 1CK0L 2M8XA 3DI3B 5CBAB 1CFSA 3WDHA 2HLAB 4AL8L 2UVFA 1UH4A 3BJLA 2V2XB 3FQUA 5D6DC 2ZCHH 3ILPA 2HT4D 4K07A 43CAA 2D4DA 3GSRA 3PV7A 4ODSH 3HMWL 3V5HB 3CC5B 3MROA 4PLKC 3GMNA 5I1AB 4NQXB 4JRYE 4ELMA 5BV7L 1OSZA 1YY8A 3O2VL 5HDBF 1HILA 2WWKO 1QSFA 2FIRT 3GSWB 1XAUA 2XQYK 4HIHB 5I1HL 4FP8L 2RIKA 4M4RA 4AMKH 2DTML 5I8OH 3MLTB 1MEXH 3QUMA 3OPZH 4I18A 3HFML 3DROB 2NY7H 3QDMB 1B0GB 3JTSB 4NWTL 3PDGA 3GSNB 5FO8A 5J6GB 3LN4B 4PP2A 5LGHL 3QPXL 4RAVA 4JY4A 5JPMB 1MFAH 1A7RH 3ROOA 1HHIB 2X1OA 4MAUH 4OIBA 1CZ8L 3TPKA 4PGCA 1EH9A 5KSAB 3SO3B 4R2GD 3MJ8B 2A6JA 1GRWA 5D2NC 4KAQL 1GGIH 5J89A 1NH6A 2ICCA 35C8L 4M1DH 5FUCC 5IMKA 4ONHA 4BH8A 4U7KA 4IOIB 4G9FA 1JPSL 4POZD 4YE4H 5D72L 4O4YH 2AJSH 3CX2A 1GGBL 4GBXC 5IFAL 2IGFL 3MXWL 1CD1B 4PV9A 2E27H 4GAYB 2KPNA 1INEL 2CSPA 2VIRA 2CLZB 4LIQL 1ZWIB 3LOWA 1CYGA 4E0RB 3QCVH 2Z8RA 4HWEL 5DQDH 5DMJB 1R5IA 2VZ3A 3FT3A 1JNJA 4NQCA 4XXCA 4J6RL 2Y6SD 4H88L 4OZFB 2D7PA 3VFNA 5IV2B 4JLRA 4UILH 3SGJC 3KPMB 3ALPA 1H15B 4HWBH 4L3ED 4ORGB 4U6XA 4PJEF 3FFCE 3T0AA 1ETZB 3RVUD 3TYFB 2X1QA 3KPOA 2EDKA 3QDJD 1HSAB 3STBA 5DVOA 1C16B 4X7EC 3WIFA 1JRHI 4WHYG 1FBIH 4E5XB 3FT2A 3TVMA 4DKFL 3JUYA 4MXVF 1I85C 5HHOD 5CINH 4PRPB 3CAFA 1AIFB 2VQTA 4YDKL 3TO4D 1Z9OA 4GSDH 1C5DB 4JQIH 3TT1H 4PFEA 2EYSA 1NDMB 4HLJA 1OAXL 1A3RH 2R2BB 1MRCH 3MV8D 4J4PA 1F6AA 2GT9B 3X11B 5KG9A 4NWUH 5HHMB 4F9LC 2DKSA 1Y0LB 2EH8H 2JIXA 4K8RD 2AABH 5AYUL 5IB2B 4MX7B 3N85H 1KLFA 4PBWD 3IJHB 4UI2A 5BXFA 5DHYA 5FUOL 2Q7YA 4R26L 2A74B 4H0HB 4Y2DC 3LY6A 3MLZL 4NQSB 3VXUD 4EJ1C 2B1HH 2I60L 4ZXBA 1VKXA 3WKMH 4LRNH 5JXAL 2XQBL 1CFNA 3TJHD 4JFOA 5SX4H 4LBEB 3SDYH 3K74B 2V5YA 3IFLH 4FFYL 4HUUB 2BX5A 1NC4D 2C3XA 1SEBA 4JZNA 1A7OH 5F1KC 5IW1B 2AV7B 3GB7B 2FX8H 2GCYA 5IWLC 3O4OB 1JNHA 1AGDA 3S4SB 2VLJE 3FTGB 2C4FT 8FABA 2DMCA 5E9DD 3UTTA 5D6CB 1MCLA 2D7TH 4ZFOA 3TA3C 4M7LL 1V7NL 2IANE 3QPQC 4ZTPL 3U0TA 5EBMA 2BDNH 3SE3A 1MJJB 3WJLC 1YEHL 1JV5B 5DC0A 5C0BD 2C9AA 3EYVB 4LCWB 1AFVL 5DT1H 3G5VB 1UC6A 4Y4FD 4I0KA 2VXVL 3QCUH 3MLUL 2BJML 1FZKB 2LVEA 1JFQL 3M1BB 4AQOA 1UENA 2OTUA 4G5ZH 4HUXB 4K3EL 1WVZA 4NHUA 5J56B 1IZKA 3L7EB 5IF0B 3KHQA 3SKJH 2FZ3A 5F9WB 2WIIB 4ZFGH 1HEZB 3MRBA 1L8JA 1CD0A 1G9ML 4C55A 3BRFA 4F2MA 1SYSA 5ANMA 2ARJA 3PV6B 1SYVA 5KSAC 4KUZH 1F4YH 3SO3C 1YY9C 2V7HB 1UM6L 4OTXL 3SGEI 5CEZD 5IHZA 3IXTB 2X4RB 4WIQA 4AENB 1HQ4A 2Q6WA 2KZ1B 4YQXH 3P73A 3DMMD 1XH3A 4LSTH 1BOYA 1MRDL 2A0LC 3MLSL 3VFPA 5E56A 2C1PB 4JPKL 2O5ZH 4LEOB 4WU7B 1XCTA 1NGQL 2ZUVA 1TZHB 5FK9B 1CLCA 5MEPA 1FZMA 1QD0A 2G60H 1JL8A 4XWGH 1J7VR 1QLRA 3IU4L 5D1XB 4OLZL 3RWHB 3PJSB 4MQ7B 5JXEA 1CFQB 3ISWA 1R3LB 1W0VA 1EAPA 5TH2B 4XWOC 3O2DH 4ZS7L 3STLA 4HS6A 2EIZA 1LMKA 3V4VH 4WFFE 1V7ML 2ERJC 4OLYH 4P5TA 1S7UA 4HUMB 3UYRH 5IFJA 2XY2A 2VZ1A 3HI5H 4M6MH 2W60A 4UT7H 4F7PA 1G7LB 4ODWB 4PJ7F 5GISL 4ZNEA 1F3DJ 4OLVH 2IALA 2VDNL 1IL1A 4DGIH 5D7JD 5HI5D 5CJ5A 3RVXC 3ARFD 3SDXE 5C07D 4G8GD 2H32B 3DOSA 4KVCH 1KXTB 2IQAB 4HJJH 4XHQA 4NJ9L 3BKJH 4NBYB 1LNUB 5E4EB 1J0ZA 3AMKA 1WAAA 5DO2C 3BO8B 3WBDA 4D9QE 2W38A 2X5PA 4HJ0D 1UQSA 3GK8L 1KV3A 4WHTB 4GW4A 4YBHA 5HHQB 2ATPA 4HJGA 2PYEA 3AUVA 4JM4L 2BHZA 4RWYH 4MS8C 4OLEA 3OR7B 2G75B 4GKNA 5BV7C 2XRAH 4IRSA 1T1ZB 1BD2A 4M5ZL 5GRWA 4RX4D 4MGXA 5ICZA 2IC2A 4YHZL 2XPGA 5A40E 2W9EL 3QHZL 1VFBA 1YPZA 5IKCB 1OCWH 4I3SL 3T2NH 3HNSL 4J8RA 4QXGH 3RI5K 5GGQH 4JRYB 5SWZA 3G04A 3ZDXF 2OJEB 1A8JH 1G7HA 1RJCA 4LCUB 4G6JH 3MV9D 4XMPL 3QNXB 1A4JA 5BZWA 3GI8L 1KCSL 2WUCH 4ZMAT 7CGTA 2NY4D 1I3VA 1NLBL 4LAJH 5F1NB 4LARL 1TCMA 1IE5A 1WIOA 3UTPE 1IVLA 2GFBB 5KS9E 1PG7L 3TCLA 4ZFFA 5DMGC 1MCKA 4OD1H 2VN7A 1WISA 2VERN 1XEDA 4RGNB 3LEXA 3ARGD 3VFWB 2JJSC 3LPFA 2VTFA 1EFQA 1DSFH 5EDXA 5FKAA 4CVUA 3UJTH 3O41B 3L3HA 4JZOB 4IBLT 4N1CA 4F80A 3B9KC 4NYLA 4N0YL 3HUJB 4G43B 1YEJL 4JHWL 3U1SL 5F8QC 1FVCA 1TVBA 5F9WC 3WFZA 4ZQKA 2R2HA 1VGKB 3BP6A 2J6EA 3JV5A 1G0XA 1KCVL 3KWWB 4PBXA 2MMXA 2X10A 5CJBA 2IMNA 3AU1B 2D31B 4EQ2A 3BOVA 3SPVB 4U1NA 3DGGB 3RUGA 3MJ9A 5DS8A 2DTSA 1F4WL 5D2NA 3WIIH 1CI5A 5C0CE 3QQ4B 3FB7B 1NBYA 1XGTB 4UOJA 4F7TA 4GBXA 1KC5H 1YN7A 5EU6B 3F12B 4KZEL 3VFTB 4M9OA 4Z6AT 3DSFL 3IDMB 2GTZB 1F4XH 3O8XD 2WWMC 4JHAH 1JYVA 1OT1A 5HGHA 3I84A 1MI5E 3HR6A 1IEBB 1QKZL 3UTSA 3QI9D 4R4NC 4JM2D 1SEQH 2MFNA 3MBEB 2QR0A 2XZCH 4BQ8A 5GGSY 1UFUA 4GKZB 3DTXB 1CBVL 1YECL 1RULH 4OCSH 2D7OA 4Z7QF 1K5NB 3KS0J 2MHAB 1B2WL 5KW9L 5EO0B 2A6KA 4RRPA 3F7QA 4X4ZA 5DVMA 5CFHA 5KBNC 3FJTA 4ZUUB 2Q3AA 4D3CL 1YEIL 1WTLA 2PW2B 3PABB 4WI9A 1H3UA 4NKDA 3S36H 1RMFL 1CE1L 2FJHB 1CL7I 1RHFA 5E6ZA 4ZPVA 4YGVA 3MRNA 5C0DA 2D7QA 3D5OF 1X5LA 4QRQA 5JR1H 5E4EC 3WHE1 2YD7A 1LP9F 3CDGB 3V4PH 5CP3H 4YO0A 4NRXA 2AJZA 1ZHKA 1L0YA 4OIAA 5KN5A 2EDBA 2P4AB 4U0QB 3ZE2E 1OGAE 1N0XH 5DJCA 2CPCA 5I8KH 1RK0A 4M8QB 4Y2DA 4LKXB 1ITCA 5K93A 3TFKD 1KJVA 5INCA 4M8VA 2EIEA 3M8OH 4L8CB 1ZT4B 2BNRA 5ESQA 5LCVH 1ZHBB 4EN3C 3MLWL 2OXGA 5FHBH 4O51B 2WBKA 1PKOA 4QF1A 3EDFA 3GRWL 2IANB 5EZIH 1N6QH 1DBAL 2Y25A 1RUMH 4YHNA 2HLAA 1JFMA 4GG6B 5I8CA 3HCVB 2FGZA 5GS0H 5HGBB 5H8DA 1HZHL 3TA3A 3GJFB 1G9MC 1XR9A 3MRLB 4LLQA 3W11D 1NEZA 1LK2B 4WY7H 1Q9WA 1BFVL 2DD8H 4NBXB 1P6AB 3O4LA 1A9EA 1RZJL 5HHXL 1OM3H 1UM4H 2WV3A 4PJ8D 5ACZB 1GZPB 1TJIH 3ZHDA 3LEYL 4WVRA 1KIQB 1NJ9B 4OM1L 2PTTB 5IROA 1S5HA 1OQOA 4RGNC 1DFBH 1UXWB 2QEJA 4XVJL 4WI5A 1B0GA 1BZ7B 4Z7WA 5KZCB 3I50H 2HP4A 1I1CA 2AKRA 3TNMB 3ZKND 1T5WA 2QL1A 5LQBL 3MRMA 3MMEB 3HMXA 1R5WB 1QFUL 2Z8WC 1IGFL 4KJWC 2OXHA 4KJPD 4CU7A 1RVFH 2BNQB 4D9LH 1DUYB 4DFIA 3VCLB 1P5UA 2W91A 1BEYH 2FYYB 5DRZB 2GI7A 3DO7A 1INQB 1JZ6A 4OLUH 1KB5A 1A1NB 4X6FA 1AR1C 2V5SA 3BN3B 3IFOB 5CUSL 3KAAA 5GIRB 2YKLH 5I0DA 4EIGB 1YQ2A 1T7ZA 3VXPB 5E70A 3V0WL 4PR5A 3IDJA 2B8OT 2J8OA 4HZAA 3KPSD 5LXGL 2XV6B 1OAUH 3RHWK 5CEYB 3PGFL 4LPXA 3VFOA 2VZVA 1BOGB 3MBEC 3ULSB 5EZLA 2WBJA 1N2RB 4QT5B 5F6HJ 3MGOB 5D1ZD 3MFFA 1VFUA 2EEAA 3ZT7A 3UAJD 3AB0B 1EGJA 3E6HA 3C60D 2IPUK 5CS7A 1KJ2H 5E8NA 1KB9K 2WMPA 2P47B 2Z91A 1OQXA 4X5XA 3BGAA 4HCRL 5HHPA 1KEGL 4LSUH 5JW3H 4QYOB 2BSTA 4XVUD 3D85B 1QBBA 1MQKL 3CFBA 4JN1H 2NW3A 4L4TE 3NZ8A 3OKEB 5ID0B 3IJSB 1R0AL 3RTQA 5EUOE 4R4FL 1IGYA 2AK4E 5HHMA 4DCQA 3LN9A 1JPFB 1A9BA 4D0CB 4JG1L 3GSVB 1YNLH 3F7PC 4HIXH 1PZUB 1MHEB 5KVGH 5LKNA 4GOSA 4DGYH 5FYKH 1K3ZA 1XFPA 3LS4L 5HTSA 4MS8A 2W9DL 4O00A 1P7KB 4XT1C 2CXKA 2VXTL 4U1KB 3K4ZA 2VLKE 1JZ8A 4JO1L 2DQCL 4N8VG 2VL5A 1IM3A 5FO7A 3L3OB 4B0MM 2SEBB 4DW2H 4G8EB 4GG8B 3MZTA 3VRIB 3FT4A 4Y0GA 2FGWL 3VW3L 2Z9TA 1U8IB 3TYGH 5LBSL 3DXAE 3GNML 3S4SA 1PLGL 5FHAH 5KS9B 4L8SA 5IB5B 4CGTA 5EZJA 2BFVL 4G59A 3DLQR 1WZMA 4XPFH 3RX8A 4O2CB 1YEEH 3STZB 3FHAA 1T1YA 4NKMA 4PJHE 4HG4K 3HPJB 1QYGL 5J9PB 1BBJA 4S1SL 3A6BH 5HYSB 1FH5H 5ESVA 3MNZB 4Z77B 2ED8A 3WCYA 5IESL 4G6KL 4PJBE 3SE4C 1OTTC 4JY5H 5GS1B 3DI2B 4FABL 2ITCB 4KPHL 3MODL 3WKNA 4X5WA 3TT3H 1CFTB 4DZ8B 3B9KA 3HR5B 3P0YH 3CXHK 1J8HD 2ZSWA 2X4PA 5ICXB 3PQYB 3T0BA 5IJVB 2V9TA 2ZUYA 3ARWA 4JO4L 5B8CA 5ITFB 3C6LA 5K9OA 3RX7A 3HI1B 4JQXA 4YDJA 1N4XH 4LOUD 4XXDA 1ZSDB 2HMIC 2D9QB 1BJ8A 5F1SA 1U91B 1NBQA 2DQHL 1A7QL 4ZYKA 4PDCE 3Q6FB 3BP5B 1XIWD 3L9RB 5GHWL 3RGVC 3W9DB 4D0BA 3B2VL 1HQRA 5HVHC 3GBLA 1MCJA 1ZLUK 2YA2A 3RRQA 4Y89A 1JGLH 4OLXH 1D5IH 3SJVB 3ABZA 1UVQB 5IOPB 5AZ2H 5DK0B 1MAML 4GRWH 3QEQE 2LU4A 4NGHL 1ZLVK 3WUWG 4P5MB 3TZVB 3BKMH 3RWHA 2FL5B 3BDXA 3VXRD 3AS2A 4JO2L 3RVVD 3IDXL 5IBUG 4AQ1B 4UIKL 1RZ8B 1T04B 2XWJA 5HDQL 4FQ1H 3QUZA 2CDGB 4TVPD 1NLDH 2IAMD 3G9VA 5HXMA 2FIKB 2YC1B 5DD3L 3EYQD 2FDBP 3OTTA 3F65A 4PRNB 4KRPC 3GSOB 4Q6IB 1J1PH 1JGEA 4LVOB 3Q1SH 4PIRF 5DRNA 2OTWA 2A73B 1LVEA 3GM0A 1R3HA 4OGAC 3KPPB 2H9GB 5DJXB 1IAIM 2W59A 1ZEAH 4P4RA 1BQLH 3CFDB 3ELAT 2VAAA 3PP4H 3QFJE 1I3RB 2JK5A 1S7TA 4ZOAA 1DBML 1CU4H 1VEPA 1Q1JH 4K7PX 5T5FH 2XQYG 3CK0L 2VKWA 3MOAL 1Z3GL 3X14B 1JHKH 5CD3B 3QCTH 4A6YL 2E8YA 4N9GB 3OKKA 1OPGH 1L0QA 2HVJA 1DQDH 1P9MA 4M3JA 4EI5B 3E2HB 5DSCA 1FHGA 2AJUH 5TDNB 1U8JB 3OR7A 1SJHA 4LQFH 4O2EA 4X4XB 5F7WC 1ORQB 5EULV 4ZUTA 1M1SA 4OAWB 2FX9H 1CD8A 3BE1H 2WP3T 1RZJC 2FSEA 5GJTH 4PRHA 3ZDYE 4JZJA 4F7MA 3VXNB 4P99A 1X5AA 3MRKA 3G08A 4H1LG 4MCZA 1MCDA 4EN3A 2JJTC 5L88H 1NFDE 4X9BA 2Z35B 2A0LD 5JDSB 1AXIB 4Z8FL 4PB9H 5BVPL 2DQFA 2EDQA 5TE6L 4NM4L 1OAKH 2FEEL 1G9NL 2O61A 4XPHL 3VDAA 4NBZB 1KBGH 2R9HD 5I1KH 1C08B 5GRXG 1MH5A 2RHEA 2V5TA 3MV7E 5EPMA 1FYTE 4ZUSA 1M7DA 4OLWH 1YYML 3MREA 3SQOH 4P23D 1ZLSH 4I1NB 1CT8B 3KXFB 2P7TA 4O02H 4P5KB 5GS1C 3I6GB 2EDXA 4HH9B 4MA1B 2X89D 4ZAKB 4XBPB 4Y16D 4OCLC 1LQSR 2Z8VC 1BBDH 2B2XH 5K9JL 4G8IB 4GRMA 4M7KH 2QV2A 3H0TB 4G43A 4P46A 3BPCA 1JNNH 4KKBD 5IB4A 3NZHL 4J7RA 1JHTA 1UJ3C 3OKOA 2ADJB 3UX9B 5H2BB 4Z78B 5CJOL 1TZGL 4DTGL 2HJFA 5JO5A 4TOYL 5DO2D 1HHKA 1V8HA 2R0ZH 3EFDL 3MACH 4NCC1 3PWPE 4P9HL 1DUZB 1S7RA 2X1WL 4FZEH 1FL3A 2VN4A 4JPIA 5DDHB 1KSRA 1UADC 3KPRE 2Q3ZA 1WBZB 3QXAB 3EZJB 5E08H 2ZUUA 5AG8A 4NJAH 1FIEA 4K8RH 2PR4L 3B9DA 3BHBA 1KN2H 4JANB 2AJ3B 3FFCA 3RNQA 2FECL 2VDKL 3HZKB 2NY0C 4JDZB 2CDEA 1IBGL 1U8OA 4C58B 5MEQB 2DQUH 1MWAL 1IGTB 4CN1A 4RGOL 3W2DL 1U8HB 1FCGA 3DTXA 3EO0B 5F3HA 5DD5H 1E4WL 2ADGB 2DI7A 4WW2C 1QFHA 2EYTA 3WD5H 5CMAB 5CIPH 3VFVA 3C5JA 3VWJB 1U0QA 1NGPL 4XNUL 4LSDA 2VZTA 1GGCL 1NCAH 1UA6H 4Z18A 4P3DB 2YZ1A 1EA9C 3U4BH 4U1GB 5EUOB 3QR2A 2BVUA 3GMRB 4B5EA 3E8UH 4GS7C 1A2YB 4Q6IC 3SDDB 3OX8B 1AE6L 4UQ2A 2R23A 5F6HI 4HQQL 1N7ML 4ZUVA 4LGSB 1HH6A 3GO1L 5DYOB 1I3GL 1UGNA 1H8NA 3B6SB 1C8PA 5GRJL 1BIIA 4I77H 3VXSE 3WFEH 2E7CA 2QHRH 3VGGA 4KTDH 3QUYA 1TQCB 3PNWB 3DUUB 4EI5C 3E2HC 3V5KB 5FM8A 1CGWA 2I26N 4Z0BH 4JN2A 4BZ2H 3E6FB 1KCUH 4P2QA 1UKSA 3QULA 1CE6B 1HCVA 1KTRL 4IOSD 5EA0H 3DXAB 3ZMRA 4DK3A 1QQDB 2VLJA 4YHOL 1G7JA 4ODTH 2VUOA 1TXKA 4N0CA 1IEAB 2YWYA 4MD5A 1CDBA 3BT2L 3B9VA 3I75B 2YS4A 4PJAA 2YR3A 1RSFA 2NY7L 2XWTA 3QWOB 3GGWA 1J1OL 4EQ3A 3BGFB 2DQIH 4R4ND 1K6QH 4CNIB 5GSVA 1EFXA 2UZIL 5CEZH 3TF7C 1PKQE 1HH9B 3KPQB 4Q58C 5D1XD 1WAAF 4PJBB 5T3XD 1A7RL 4MAUL 5EIQA 1FNEB 1TZIA 2X4UB 2QQLL 3RWDB 4L4JA 4NN7B 1QPPA 4FQQA 2P8LA 3WHXB 4YXHH 2F5BH 4X7CC 4RZCA 3SE4A 1QA9B 2FEDD 4GAGL 3SEPA 2CGRL 4MA1C 3N1FC 4FQXB 1MCOH 4YE4L 2BRQA 5T33H 2AJSL 3OKNB 2AXGA 5IP4A 1LEGB 1YPZF 3ORJA 3QJFB 3U6RB 3QCVL 1MWAB 5DQDL 3NOIA 4KKLC 2Q86B 1QR4A 4PGJA 3BD3A 4Z76A 3SDCB 1JE6A 4LK4A 3BPNB 1ZVYA 1SVZA 4L9DA 2GSGA 1PEZA 3GSUB 4HWBL 4PGBB 1BVLA 3NACL 1FFQA 4EBQH 3O6KL 3QEQB 1KCKA 1A22B 4CN4A 4MNHA 3RGVA 5E2TH 3VWKB 4HUVB 3D48R 2AI0H 3LRSB 1FBIL 2VE6A 3GIVB 1XF3A 2EDLA 4H25A 4S2SB 1KLUB 4RNRA 4KROD 5E8DL 3MJ7A 5CINL 1IQWH 1GC1C 4JFQB 4F15B 1CLOH 4GSDL 4QO1A 3ULSA 1MCWM 5E8PB 1A3RL 2QQQA 4XP5H 4HDIB 2W0FB 4PG9A 5K59E 1J0IA 4BYHA 3VWJC 1YDPA 2EH8L 3MXVH 4N68A 5I1CH 3SDXA 2AABL 2Q76B 4XNZB 2G5RA 3AREA 1M4KA 3VGAB 3GUTB 5C09E 1G7IA 1OP3K 1MAKA 4HKJA 1QLEH 4U1GC 3L3JB 3B5HA 3B83A 2G2RA 4X6CE 4N1HB 4XZUA 5ERWA 3SCMC 3SDDC 4NRYB 2WINB 3WKML 5C1MB 3NA4A 3G6JE 4PJGE 5HDBE 3W0WA 4L1HA 3QAZB 5ID0A 4RGND 3WDJA 3GRWA 3UPRA 1EBPA 3IFLL 4C83B 2WBWB 3CXDH 3TBSB 5JW4R 3TN0D 1NANH 2HRPL 1A6VH 3QO0B 5AAWA 1A7OL 2A6DB 1CF8L 4P59H 2FX8L 1JK8A 3REWA 2CH8A 1IGCH 5DJ6A 1G9NC 1QFWH 5H35B 1C12B 3CVHA 3HNVH 1OARH 3QNZA 1ZLUH 4YHLH 2D7TL 2FEEI 1DANU 1RHHA 1NFDB 1B0RB 1ZHNB 1MRFL 3H3PL 4LP5A 5FUZH 3WNNA 3BPOB 4OZIF 1SBSH 3OKDA 1WV7T 4PJFF 4CVXB 4GMTH 1IC7H 1NFIA 4X4ME 1T5XB 1R3JA 1EO8H 1J05B 4G8EA 3P4MB 5D7LA 4ISVB 2ED7A 2X9XA 3H42L 4ODXA 1KIRA 4X4YA 1OTUC 4NQEE 5EU6D 3REVB 4FNLL 4Q9QL 3QCUL 3QDGB 3MV7B 2ITDA 3ROLA 4ZSOE 1S3KL 5IB5A 4UNUA 4ONGH 5AUMB 3CMGA 3V6ZA 4G5ZL 5TDPB 4MWFA 1RJZA 4M61A 3STZA 5BJTA 1KT2B 5A43C 3MBED 1D6EB 3OL2A 4YC2C 3JXAA 3P9LB 2YPLA 1CXEA 3CX5K 4TUKH 4P9HC 4NN7C 2DBLH 5FYLE 3SE8H 4MJ6B 4ONFH 5T1KA 4KRLB 1XGRA 2VLLA 1ADQH 1A6WH 4HT1H 1CG9B 1U8NA 5GS1A 3RZCB 4WJ5B 3HE6B 1QVOB 2UWEB 1ES0A 4PJCB 5E2WH 3BVNA 2O5ZL 5D9SA 4NRZB 5KSUA 5C0CA 5T3ZD 1UJ3A 1XGPB 3U9UA 3HC0A 3N9GH 3ZL4L 3P4OA 3MLPA 5GGSB 4NO5B 1AGCB 1X7QB 4PP1D 1TNNA 1NMBL 3S37H 1MI5A 5T5NG 4LHUD 1B9ZA 1MVUA 3FOMA 3V4VL 1SBBA 4R0LB 1U8QB 3P9WB 3CLFL 3HI5L 4M6ML 5JZ7D 4HCRA 3THMH 3LEVL 3FO9A 3NCEB 1G7MA 1YMMB 1A6ZB 5DK0A 2RJMA 3S3PA 1SQ2N 4ZUWB 4DGIL 3KYOA 5DEFB 3DVGA 1AJ7H 4Z7WF 3CSGA 3HPLA 4TSBH 2IAND 4KVCL 1PG7W 1A0QH 1L4IA 1T04A 3BKJL 1PGRB 4WW2A 4LASH 2DOCA 5IT2H 5DUPL 4UZGA 1RIVH 3NCCB 4XNZC 1MUJA 2AW2A 5E2JA 3VGAC 3NAAH 3OXSB 4MD0A 4RQQB 1VADA 3TBWA 5IVZA 4RWYL 2BVTA 2XRAL 5E6ID 4CVZA 5D4QA 5GPRA 4OBSA 4MJ5B 4OKVB 3VXSB 1I8LA 4PRDB 2ZUTA 1TMCA 1KPRB 4OKDA 1DQTA 3MA7A 3QAZC 2XKNB 3BPLC 1A21A 3TWCH 3LRHA 1CICB 5ALBL 1OGAA 4ZTOL 4YHPA 1CVSC 3UBXI 2MQCA 1I3RA 4QHLB 5I19L 2JB5H 5KZCD 1OCWL 1BQHA 3FMGL 4FQCH 1Y18B 5GGQL 2Y7QB 3X14A 2Z31D 2ICEB 2VZOA 1REIA 4OGXL 2YD6A 3DO3A 4Q9RH 4MXQA 4G6JL 1IC5H 4I0PC 4KTEH 4QRTB 3E2HA 2COQA 1PVHA 5JHDB 1T20B 5J6HB 2BNQD 5CD5D 1C5BH 2ZUWA 3ULUE 1A6TB 4YXLL 3FRUB 4JKWA 1OAZL 3BGMB 4H8WH 5HPMB 1EO5A 4UB0H 3DYPA 2JJWA 3LB6C 4HX1B 1AGEA 3IDIB 5C0AE 3FB5A 4OD1L 5GRVL 2ZCKH 3TO2A 1E6JH 4XMLH 4F58H 2QTEA 2A9MH 4JJ5B 2V7NB 3V9FA 5EUKA 2X40A 3QFDB 2BOBA 4KI1A 3UJTL 4OUUB 4PRAA 4JFEB 3VJ6A 4QOKB 4OT1H 4JREB 5E1AB 1H3VA 2FJFA 2X44D 4UV7H 3A6CL 4WTZG 5B4MD 3EJYC 3R06A 4HC1A 4HBCL 3NIFF 5IW6A 4Q2ZB 3CFEA 3IFPA 5BRZE 4P5KA 2DMKA 2E9IA 1AD0B 2LFGA 5GZND 3WIIL 3QQNA 5I8EA 3H9YA 1MJ8L 3CFJB 1I9EA 3HE6C 3NFPB 4XBPA 4Y4HC 3NFSL 5F8RC 4JY6A 4M3KB 5BQ7B 2DLHA 2YXMA 4GUPB 3WS6A 3H0TA 3FQWB 3GKZA 5ID1A 3IF1B 3D85D 5FYLL 1GSMA 2BNUA 4KVNH 2XA8L 1LO5A 4MJIE 1I9JH 2ZZUT 4HIEB 5GGTL 1HYSD 2BVPB 4WV1B 2G5BB 4OGZA 1W2KT 1UWGH 2W0LA 5D93C 5BZDA 4PJXA 1RZFH 4DVBA 1RFDH 3MRFB 3DV6B 5KVEH 3D39E 4QGTA 4QRUB 4I9WE 4K7FB 4R0LC 4J2XA 4AEHH 1GPOH 4OI8A 1WBZA 1RURH 5KOMC 5JPNA 1OWWA 3QXAA 1FZJB 1WBYB 4YR6A 4NC0B 3P0GB 1YN6A 5B3NA 1IILE 5ETUA 1K8DA 4OQTA 1DBBH 3S36L 3ECBA 1FPTL 2X4NA 1AQKH 5C09B 2NZIA 5SX4I 4J4PD 4XC1H 1A5FH 4MNGE 4M7JH 5JR1L 4APQC 4X6CB 3UTPD 2YA1A 4A6YA 2V5RA 2Y1VA 2FHCA 5EOTB 5IQ7H 5L7XL 5F7EH 3V4PL 3CPLB 2QADC 3RWJB 3HN3A 4IJ3C 4O5LH 2E6PA 4PJGB 3UBXG 4L4TA 1MF2L 4KU1A 3X3FH 3DV4A 1KIPA 4WTWA 4KMTL 5EUOA 4DK6A 2AK4A 1G0DA 5I8KL 1JWUA 5HGGS 5EU4A 3N06B 4NNXA 1JGUH 1A2YA 5F70A 3SCMA 3SDDA 4F9PC 2ZOLB 5DQJB 4NT6B 3M8OL 3NFNB 5CLWA 5HGDB 2A6IA 1YEDA 4OZGA 5B38G 3MGTA 3K2UH 1X5ZA 3LQZB 1CICC 5I76B 2YPKA 3R8BB 1FL6A 1GAFH 3OKLA 1UKQA 4V1DE 1K2DB 5EZIL 4JPWH 2VLKA 1N6QL 1TDQA 2HTKC 1RUML 2VXSH 4JQVC 1MCNA 4P2YA 3UTTD 1WT5C 4UU9B 1J0KA 3PQYD 3PWLB 3WUWB 1BFTA 2WWKT 3S35L 4NQEB 2IF7A 2ZJSL 5IBUB 3FFDB 4XCEB 2DD8L 2FLBT 4YXKH 4L9LB 2RB8A 4RMQA 5A2IH 3FN0H 4ZSOB 1UM4L 3K7UA 2HKFL 3MRQA 3QUXB 1TJIL 4CADA 3R1GH 1IEAA 5DRXB 2DQEH 1ZLWH 1AXSB 2OYPA 2ZUQB 4ENED 4PJHA 4CDGC 1ACZA 2N56A 5MENE 2FJGB 4Q9BA 3SJVD 3ULUL 4JKMA 1JI1A 4IMLB 2Z92B 5LWYH 1WLHA 5C0FA 4LNVA 1ZVSB 4JREC 1OP3H 3TZVD 3I3DA 43C9B 1Q0YH 3N1MC 1KPUA 1YUHB 5TE7L 1RVFL 4YGAB 5I1EL 1GH7A 4D9LL 1DCLA 4NNYB 1Z9MA 3OWEA 4EUPG 4TNVK 5HJ3B 1BEYL 4XNMA 3N1PC 2ZSVB 4GRWE 2N7BA 2DLGA 3FQNA 5EC2B 4OLUL 3V79C 1P7HL 2I5YH 4AYFA 1HHGA 3JTCA 3BZEB 1QP1A 5JHLH 2YKLL 3FAXA 2NXYB 4I4WB 3ES6A 1GGUA 1UB6B 2GTWB 4XCYA 3H9ZA 3IVKA 4RMUA 4LLYB 5C0GA 3QEHB 4H1LB 1SJXA 4M7LT 3ZKXC 3BEVB 5EBWB 4TVPH 4L29A 1OAUL 4WV1C 5JMRA 1MIEH 1WUNT 3KJ4B 1YMHB 2F5AH 5JXED 5HYJE 3RDTB 5I1IL 4UOW1 5A2LH 2BSSB 1I7ZA 4LPTA 5DTFA 3U7WH 2AK1H 2VDRH 2APBA 2NZ9D 3EYUL 2IJ0C 1QEWA 2XACC 4S1QH 4R90L 2OL3B 3MA9H 3RL2B 4B53A 4WO4C 3HI6H 3W39B 5L2KB 3EO1A 3PHQA 1BX2B 5DD1H 5IG7B 3GIZH 3NCYS 4G6FB 4NQVB 1VPOH 2A83A 3GSNH 1CXHA 1KLUA 4Z5RA 2CKBL 2EKSA 4TTDC 4R8WH 2ICWJ 4LSUL 1BVZA 2R1XB 3KR3H 4OF3A 5JW3L 1L6ZA 4G9DB 1D5MB 4JN1L 2IFFH 1CGVA 5CHNB 2OBGA 4DEPB 1VB9A 1R3KB 5JQ6H 1T66D 5FEBA 1XZ0A 4M6NL 4NO0D 3L1OL 3KLAB 5T1LA 4XCCH 4CW1A 5D1QA 1NGZB 3LKSA 4PG2C 3U7YH 3HAEG 1YNLL 4HIXL 4U33A 5E8OA 2HT2D 5KVGL 3WEXA 3WFBH 1J88A 4LLAA 2KH2B 3QFJA 1W0WB 1R3IH 2IFGA 2WINA 4J3SA 1U8KB 1I9RH 3MRIA 3S9DB 2O93L 1RJLB 3KXFD 5C0JB 2OM5A 3CH8A 4G7YL 4ZAKD 1S7VA 2JTDA 4YHYB 4DAGL 4OZFH 3D0LA 1NC2B 5ESAA 5DJ8A 4O2FB 3VXME 1TVHA 1MCPH 5EWIL 1C12A 3HZYA 5FHAL 3PGDB 4NO2B 1TLKA 4I0PA 2JJVA 4U1IA 3T0DA 5C0AB 2CDFB 4RA3A 1U6AL 4YWGH 4KKLD 4XPFL 4G80A 4HZLB 4IDJH 1YEEL 3MRCB 1JHLH 3GJFK 1KELH 3IJYA 4U6HA 3IETB 4L9LC 3BUTA 4L3EE 4R7DB 3EBAA 1EDQA 3ARRA 3QUXC 3HE7C 4CU6A 2C3VB 4HUKB 1NBVH 1FV1B 3C5SA 2ZUQC 4KKNA 4JY5L 3MV7A 1FYTA 1H0DB 3HC3L 3TIDA 5ADOH 4LSSH 2IBGA 4AL8H 4AEIH 3S98A 3QNYA 3BZ4B 3TT3L 3OJ2C 5HHOE 5AUMA 3P0YL 5C08A 4M6AA 5JORB 2XN9B 3ARVA 4HLZG 3QIBB 5BRZB 3HMWH 5E8EB 2BVOB 2N7AA 3MV8E 3ZTNL 1MCHA 2Y9RT 5A2KH 3BFOA 4U7MA 2WZPD 3V7AE 4HWBA 5D5MA 3VWJD 5I1HH 5EIVA 1D5ZA 2DTMH 4MJIB 2ATKA 3WFDH 4Y4HA 2NXYC 3GHEL 3VXUE 5GSRB 4R96A 1JGLL 2CKBB 3HLAB 3I85A 4IRJD 4OLXL 2AVGA 1D5IL 3PWPA 5HY9A 5I17B 5LGHH 1AO7A 1BECA 4WU5A 1KGCD 3P9MB 3UTSD 5FV2A 1XGPA 1FGNH 5AZ2L 4TNWK 3D39B 4KY1L 3RWEA 3QXTA 3KPRA 3KJ4C 4Y8AA 3RDTC 3BKML 1RZKC 1YJDH 4PJDA 5LGJB 4U2ZA 3GSQA 3T4YB 5ECJE 1PBYA 1AHWA 4YDIL 4KAQH 1OTSC 5CZXC 5E9DE 1S7XB 3JTTB 4R0LA 2X4OA 3JWOL 3EYFB 1AP2A 4GQ9L 4ETQB 1JPSH 1JPTH 1GGBH 6CGTA 5I15L 2IGFH 3MXWH 2FH8A 5M95B 1INEH 2L4OA 3B5GA 3D69B 3PHOB 5E94B 2WK2A 2R2EA 3NN8A 3U4EB 2C3HA 5C0BE 1I7UA 3LKQA 2R2CA 5KVFL 1UCBH 4G7VL 4QXWA 3Q1SL 5FGCE 2NCMA 4PTTA 2BVQB 4JHZA 2K1MA 5FM5M 4DJMA 4H88H 4LU5H 4DEPC 4YPGA 1LO2H 4QWWC 1VFAB 1N5YL 1ZEAL 4FQJL 1IFHL 1NCBH 1ZMYA 4APQA 2OI9B 1KCRL 5HI4D 1CU4L 2NY1B 1Q1JL 1A6AB 5T5FL 5CGMA 1VERA 1JHKL 3QCTL 1QSZA 3ILQD 2HLFC 3FRPA 5I66B 1OPGL 5F7LB 1DQDL 1EZVY 5HI3D 2UVEA 3ARDD 2NX5D 3WFHB 3MO1B 4E41B 2FX9L 4S10A 4OKVA 3BE1L 1GZQA 4PRDA 1TENA 1AGFA 2XKNA 3G5XA 4WI3A 3WE6B 4FQXD 1DQJA 1UWEL 3O3UN 3WNPA 4XI5C 5F9JB 3ULUC 2CLVB 2Q8AL 4OF5A 5KSBE 5ICYB 3P2TA 3PWNA 1A1MA 4PB9L 1X5IA 5AYUH 4JQVA 4XCNB 5FA4B 3R0MA 4P4KA 4LPUA 1OAKL 5EBLB 3C08L 4Y5VA 1TPXC 3MNWA 1IKNC 3V5DB 4QGYA 3L3IA 5I1KL 3ET9F 3SDCD 2I60H 4BSWA 2XICA 3O4LD 3SDXF 5HPMA 2Q8BL 3WLBB 3TNNB 2XZAH 1YYLL 2H32H 3QEQD 4Y7MA 1PKQA 3VWKD 3ZKSD 4MSWB 2D0HA 3BQUC 2NMSA 4YNYB 3QFDA 1I9IH 3VD4A 1BBDL 4YH6A 1MJ7H 4HUWA 4MCYA 5C07E 5DMKB 3QIBC 4G8GE 5HBBA 4FXKA 3OHXA 4HK3J 4WCYH 2ZG2A 5JA8B 5C6TL 3C2AH 1NGWB 5IK3B 4KJYB 5EOCL 2JELL 3PL6B 4OCXL 4QHKJ 2IG2L 3AY4C 2X1PA 4ZOEA 5I75C 1TJHH 2Z93B 3EYOA 4FZEL 5F7DB 4FTVA 3OGCA 2VXVH 3B3IB 2VQUA 4U4BA 1CCZA 2GK0B 5HYJB 4WWKB 2I9LA 2C1OA 5MP6L 1QBAA 4RCAA 5DC9B 1NCNA 5E08L 4X7DC 5HHNA 2QBWA 4NJAL 4K8RL 1FE8H 3BAEL 1EMTH 3QIUA 2G5BA 3W82A 5KS9F 4D94A 4ESKA 2CIKB 2Z4QA 1W8NA 3NCBB 4K3JL 5DD5L 2GJZA 4I3GA 3H9SA 1H3TA 5J12C 5IR1A 4XRCB 4M5YL 3MV9E 5ISZB 1MRDH 4WO4A 2OCFD 4H5SB 1NCAL 1UA6L 5MERB 3LQAL 1FZJA 4W4OC 3KNBA 1NDGB 4BFGA 1IAIL 1LDPL 1NGQH 2JCCE 3GZKA 4RMSA 1QRND 3T77B 3E8UL 1XGUB 3LSOB 5CGTA 2P8MB 4FOMA 3UC0L 3IU4H 1F2XK 4OLZH 4PTUA 4KHTH 5EU3B 5C09A 3VH8G 3BP7B 3QDGD 4X6CA 4JKPH 3TBYB 3B43A 4WHDA 4LPVA 2QQKL 4N5EA 1AKJB 1MPAH 2NY1C 1JWSA 32C2A 3SO5A 3WFEL 1V7MH 4KTDL 3RWJA 3G6JA 5FGBC 2YEZA 3UTZB 4AT6A 3F6IA 3FB6A 1ORSA 2ICWI 4Z0BL 2OQJB 3EJYD 4BZ2L 2NY3B 3VXMB 4QRPB 3OXRA 4IHOA 5EA0L 2X9WA 1NFKA 3K1KC 4KGJA 4ODTL 3RZCD 3NBNA 4NJ9H 1E4XL 3A0OA 5CGYC 4AM0A 5CCKL 4KQ3H 1FNGA 1FZOA 3HG1A 2GITA 3NPSB 4JFFB 1Z5LA 3WSQL 2DYPA 2VQ1B 4U31A 4CMMA 3HB3D 2YBRB 1P4LB 4X4MA 4X8JA 3L5JA 4OZHE 4PD4J 1QO3B 1K6QL 4JM4H 4Y19D 1P7QA 1T83A 2DS4A 4WW2F 3V6OE 2P8PB 4F7EA 2R4RL 4RMWA 3SE9H 2PCPA 1S9XA 4I5BB 4EDWH 3QG6A 1EVUA 3L5XL 3CVIH 2W9EH 3EOAB 4HAGA 2JB6B 3HE7A 2H2PC 5DRXA 3MRPB 5AWNH 2IEPA 5T3ZH 3MCKB 1BFSA 1RV6X 2FO4B 3RVTC 2F5BL 1PYWB 3HNSH 4WEMB 1OGTA 2ILLA 3MV8B 1YMMD 2VISB 2EDFA 1WWWX 1MCOL 2AEPH 4KKCD 1ONQB 3RWIB 3SKMB 3RWCA 4G6MH 4AJ0A 3ZE2F 2MJWA 2C4XA 2I07B 3EJJX 4XMPH 3E1F1 5KTEH 5GGTA 4LMQI 1FG2A 4ZDHB 3H2WA 4XP1L 3V6FA 1KJ3H 3C6LD 4UQ3A 4XMKL 1NLBH 3DSNA 6FABH 3PL6C 3VXUB 5L2JA 3BZDA 5H37H 1CGTA 1WSST 2HJKB 3JWOC 2HKHH 4U1JB 4S0SD 3RIFK 3RWFA 4BM7A 1K9TA 3SKNB 4EBQL 2W65B 5IVXE 3L7FB 1NC4B 3O6FA 5DJYA 5EU5B 5DLML 4CDHA 3VA2C 1F3JB 2LV4A 4JHWH 4RDQG 3BEVA 3U1SH 3QJHB 3I6KB 4OSUH 2HT4C 3BZFB 3GJFH 2UV3A 2YN3A 3ULVD 1CLOL 1KCVH 1BZQK 5CSBA 2BY3A 2X6MA 4XNYH 2ARJQ 1F4WH 5CP3A 3QUZD 5C0BB 4X80H 3DETD 4EIZC 4PJ9B 2F54B 3MXVL 5JHDD 5FGCB 1OF2A 5DJZA 4Y4FB 2GAZB 2HJLB 4U1HA 3ARBA 4MNQB 1MELA 5BS0B 5B39B 2AJYL 1QKZH 1M7IA 4J1UB 3CMOH 4NOBA 2VDOL 1V05A 4EZMA 4AIZA 1EERB 1HE7A 4V3DB 1YZZA 3T0EE 3D3VA 4UTAL 1R3KA 4ZO9A 1CBVH 3D25B 3UROR 4GW1A 4ELKB 4LLVB 2C3GA 3VRJB 4JFED 4QOKD 3G5ZA 2GY7B 3X12B 2X41A 3P77A 4GKOA 3HNVL 2NQCA 1ZS8B 3DMMB 4HKZA 4YHLL 4D3CH 1CDUA 4POZC 2UY7A 4N90D 5J1AA 4U7SA 4TUOB 2P1YA 5KSBB 2GIYA 5AD0A 1SBSL 4C56B 1LWRA 4GMTL 1T0MA 1IC7L 4H0IA 1GYAA 5F93C 3OG4B 1EO8L 1XR8B 5TGBA 4KK9C 2MWCA 2Y6SC 1U8PA 2R0KL 1O5DT 5C2UB 2K7PA 3KPSE 1A4KB 5C0AA 3BRGC 1DQLL 3RVUC 1OW0A 1IKNA 2XOTA 2D9CA 1QHPA 5ABDE 3RQ3A 3IETA 4EDXA 3JV4A 4TUKL 4D9RD 4JKLA 5HVWA 5IIEA 5D7IE 1DL7H 2DBLL 3LDBB 4YHIB 1CXKA 3SE8L 2BVEA 3TO4C 4JFDA 4ONFL 5EUOF 5K9QG 3O3BB 1B6UA 5C07B 4G8GB 1AQDB 1ADQL 3MCG1 3CDCA 1EHXA 3SDAA 5IM7B 1A6WL 1WFTA 1G7PA 1PX4A 4HT1L 1DDHA 1MLBA 5ALCL 1AH1A 1DBAH 3BQUA 5FXCH 3S34H 5E5RB 2BCKB 1D5XB 2GJ6A 2VC2H 4OM0L 4RIRA 2PXYB 3IAGC 4P46D 3MUGB 1U3HB 4X0KA 1HZHH 5C70A 5IEKB 5JORA 3LKNB 3C8DA 1RIUL 4YDVA 2VXUL 3O11B 5DJ2B 5SWQB 4LCYB 1MCEA 3N9GL 3GMPB 5MHSD 1RZJH 4HPYH 1HOCA 3KG5A 3HRPA 3U48A 4Y5YB 3C8KB 3AY4A 3VE0B 4OM1H 3RFZC 4XTRC 1S9WA 2NY5H 1NMAH 3LQAC 4L5FH 1NPUA 4XVJH 4NUJB 3OF6A 1KJ2A 3M17A 3O3AB 4LSQH 2FHBA 3V8OA 3DARA 4L4VD 2EDRA 4XBGB 3THML 1Q9KB 1K8IA 1Q94B 1QR1A 2IQ9L 2DI8A 4PJHF 1QFUH 1H9VA 1IGFH 4G6AD 3PWVA 1KJMA 1AJ7L 4QHKI 3F5WA 4TSBL 3MR9B 2NY4B 4HKXB 4OCNC 4NZUL 4UDUB 4JGMA 1T0NB 5I1LB 4KXZH 4PJBF 5JOPD 2CMRL 5CUSH 4PRBB 3BKCH 4M1CC 1DEEB 1U58B 4Y4FC 3U2SB 1ZA3A 1AGBA 4MNGA 3V0WH 4OV5B 1RIHH 1B6DA 2L7JA 5F1IB 5TF0A 4EUPB 4MXWL 5E94A 2EE6A 3O9WA 1T21B 4QRRE 3Q2CA 5INDA 2AXFA 3K80A 3PGFH 3F58H 4NSKB 2LQRA 3P4NA 3S5LA 4HWZA 3OZ9H 4PLOB 4KJQD 3QHFH 15C8H 3TWCL 3DNKA 4FFWD 1BAFH 4QHNB 1NBZB 1UKTA 5JW4M 2JB5L 4LCIL 1J87A 3O3EB 4NDMA 4JCLA 2MTPA 5ENWB 1P84K 1FLRH 2VUYA 5CAYB 3MYZA 1DQML 5FGBA 5I66A 1JNLL 4Q9RL 4HFWA 1IC5L 4KTEL 3DMMC 4AK1A 1OLLA 4TSAH 4P2QD 4V1DA 2PTUA 1KEGH 4RFNC 3SY0A 5DEGB 3PWUB 4H8WL 3O8XB 4LL9A 1KTLB 1MQKH 4MB3A 2WQ8A 5CEXB 4BFBD 1JZ5A 1MNUH 2WQRA 3QI9B 4N0CD 4OZHB 3WMSA 4Z7VE 1R0AH 2F74B 1IT9L 3QB7C 3DRTA 2ZCKL 4XMLL 3LKRA 1Q8MA 1NAMB 1I1AA 2A9ML 1KXVC 4XCNA 5GGUB 4HSQA 3T8XB 3DYOA 4FRWA 3LS4H 1FAKT 4NM8L 3RJQB 2LU3A 4OT1L 3L6FB 2W9DH 5FF6B 2D7MA 3RDTD 2VXTH 3VXRE 5MENA 5GGRY 3O45B 1M71A 3DURB 3IDGA 5E99H 1M6OA 3HAEB 3EUUA 2YK1H 3F7RA 3LDBC 3QEUB 5D7JC 5HI5C 4AZ8A 5FDWB 4MAYA 3VFUA 2OLDA 5EO9B 3U46A 5L2KD 2O5YH 2FGWH 4WI2A 1DN0A 2YRPA 3VW3H 1JI2A 1FNFA 3L3KA 5EIIB 3X13A 3ARYA 3GNMH 4G6FD 1PLGH 1NGYB 1CIDA 2BFVH 3KDMB 2H6PA 4JFYB 1CTNA 1FC2D 4HJ0C 1UH2A 2VDPL 1Q9LA 3ZDYF 1QYGH 4WDIA 4QWWD 2YHGA 4S1SH 5IK3A 1RU9H 4QY8B 2MSPA 5L8LB 3MJGX 4KH2A 1UWGL 4Y5YC 1RZFL 1SVCP 4RAHA 1NFDF 1RFDL 1SJVA 3GKWH 5F7DA 2E7MA 5DD0H 2J5LB 3G6AB 4G6KH 4HK0A 4TSCL 3BKYH 5KVEL 5HSFA 1T3FB 4WHYH 1FO0B 4FABH 3KPLA 4KPHH 3ARTA 5C9KA 1GPOL 5E5MB 3OKMB 1RURL 3VMNA 4H26B 3IGAA 4KDTA 2FR4B 1NGXB 2P43B 4G42B 2LTQC 3MOQA 4HHAA 1XGQB 4N0FA 5IMOB 4P3CL 4LHUG 4Z7UB 2IH3A 5LAXA 2NY4C 3VFMB 4UUJB 1WJ3A 3MLXL 4XC1L 2VXQH 4KRMB 2LE9A 4M7JL 3RL1A 1S8DB 2OSLA 3LZFL 1HI6A 1F2QA 1NANI 1UB5A 1TCRB 4JDTH 4MA3A 2YSSB 4E42A 5IQ7L 1WCBB 5IMLA 3RPIB 3B2VH 3EAKA 1QFWI 3ARGC 3T0EB 1MREH 3DX6B 5CP7B 4X6BB 1E4KC 2GSIA 3T77A 3FQTB 3KYNB 5DC4B 2XFXA 1MAMH 3ZTJH 3W0WD 4NGHH 2B0SL 4K2UL 2P5WB 5DRWA 1XF1A 1P1ZA 3K2UL 4IDLA 1IAKB 5F3BB 4OZ4B 4JO2H 4NPYA 5D71L 3IDXH 3OR6A 1GAFL 4MQSB 4UIKH 4RA0C 3RP1A 2K9UA 3EGSA 5HDQH 1F4AA 4PRIE 4JPWL 1BLNB 4TUJA 2OK0L 1AR2A 1RUQH 2YN5A 1MHCA 1GOFA 4U6YA 2VXSL 2XN9D 3QIBD 5BRZD 3DVNA 2XWBA 4XC3L 4QEGA 3DBXA 3DX8B 3VI4E 5DQ9B 5BVJB 3VXQB 3MV01 1N8ZA 1FC1A 1FN4B 2NTFB 3FB8A 1NEUA 4ZS6C 3VDCA 3FCTB 3O8XC 5ILTH 3VG0L 3HTLX 1GC1H 3QI9C 1BZ9A 1BFOA 1S7SA 4JM2C 3V6OC 4K3GA 4L8BB 3MGAA 1IGJA 1JCKA 4QHUA 3T08A 1DBMH 4XPGH 2Y23A 3CK0H 3MOAH 5D2LE 4L3EA 5D1ZB 1DN2A 5D7IB 4I48B 5LWYL 3D39D 2Y5TB 3BH9A 4I9WD 3WLWD 3QDJA 5DI8A 1SMAA 2VDMH 4L8DA 3JVGC 5JA9A 1KEML 3GMOB 1Q0YL 5D7KD 3D2UA 2YPLD 1MHHB 3VGEA 3P30L 4HEME 1TNMA 4K7PY 3VXOB 2DM2A 4LDEB 1H3XA 5KVMC 4RISH 3S7GA 5HHOA 1FJ1B 4MB4A 3TO4A 1EEZA 4XB7A 5C0ND 4RAUA 2BXZA 1V3MA 1PYWA 2BY1A 4X9GA 2I5YL 4HGWB 5BVPH 4OCYH 1I8MA 5DZLA 5TE6H 2AV1A 5I71B 3VGFA 1S9YB 5D70H 1Q9OB 2R1WB 4MB5A 3FZUC 3RY4A 4TVPL 2H41A 5FGRA 2F5AL 1J10A 5CBEB 2Q7NA 3B5TA 1YYMH 3TP4A 4J3WA 5CIPA 2NY1D 1T1WB 3WS3B 2N1KA 3T04D 3TJHA 1T7WA 1BVKA 2AK1L 1DVFB 3DGCR 4JG0H 4Y5XB 3CU1A 4BQCA 2PO6B 4S1QL 4F33B 1MCQA 3MA9L 1SJEA 1XF2B 3HI6L 1HWHB 1WC7A 1GGTA 4E41D 3MSPA 3AROA 1I8KB 4I2XE 3GIZL 4YDLB 1DLFL 2OR7A 5SWSB 1VPOL 3NZHH 5HVFB 3GSNL 1XF5B 5E9DA 3I6KA 2NW2A 3QIWB 1PQZA 3BZFA 4O9HL 3KR3L 2DWEB 4U1LA 5CJOH 1LEKA 1N5AA 5CGYD 2YUXA 4PJEB 3CSBA 4DTGH 2IFFL 4TOYH 1T1XA 1OB1A 5JQ6L 3BEWA 5DJ0A 4Y4KA 5JW5A 2X4SB 3JWDH 2J8UE 4PJ8C 4QRRB 4GW5B 4R7NA 3U7YL 1NL0L 3OJDB 2M1KA 2FO1A 2V2TA 3C5ZB 3T0EC 5T3XE 3UPCA 3IDYB 2IPTH 4FS0A 3WFBL 5C3LD 1QFPA 1EBAA 1CGYA 3CSPA 5B39A 3FL7A 2PR4H 4H8WC 1I1FA 1DQQB 2HT3D 3OKYA 2CXGA 3ZKNC 3SGKC 3DX7B 3WFCL 5I16B 4NP4L 4GXVH 1OAYL 4HV8B 1MWAH 3UDWC 3TBVB 1VACA 3RVTD 5JIPA 1KCGC 4ORZC 5MEOB 1RUAL 4KJPC 1NCCH 3G5YB 5DHVB 3LN5B 4C57C 4FQHB 2EDYA 1TTFA 4XNUH 1MCPL 1GGCH 5FIEA 4OJFH 1F3RB 2PYFB 3D18B 1AXTL 1ZGLM 4XP4H 4YWGL 3HA0A 4X6DE 2DWDB 4IDJL 1HHHA 4NKQB 1KELL 4M9PA 1I7RB 3ZE1E 3PL6D 3V7MA 3FQRA 1KPVB 3HZMB 2AQ1A 3VRLE 2XG5A 3CH1A 3ZYJA 3T4AB 1G7QB 4UIMB 3K2MC 4HQQH 4FA8A 2X2YA 2DBJA 5E00B 1DEDA 3GO1H 1LD9B 5K59F 2VYRE 5D8JL 4WWKD 2OX5A 5HD8C 1J12A 3VXRB 3K4DA 4AH2B 3BSZH 4N1EA 3L5WB 5CJXC 5ADOL 4LSSL 2J1KA 5D1ZC 4AEIL 4YEEA 3X3GH 2E3VA 3UAJC 1PSKH 5I1DB 4DKDC 5ELIA 3WJJA 3GFUA 5J06A 3VH8B 4B7LA 4X6CF 3F7VB 1KENL 2IAMB 3C60C 4PGDB 1EXUA 1MCFA 3IDNB 4IS6A 2HYMA 4LLDA 3G6JF 4PJGF 1M05B 4YHOH 5D7JA 4HXBL 1I7TA 4PGEB 1E27A 3ARFA 1JF5A 4XVUC 2O26U 3TPUB 5ISZD 3BT2H 3EFFB 1DLHA 3QDHA 1X5KA 2WIMA 2ZCLH 4HMEA 2DIBA 4AG4H 5J7CC 3WFDL 3LH2H 1UZ8A 5GJSH 5DD6A 5I71C 3K8KA 1J1OH 3CIQA 2AERT 2UZIH 1FDLH 1JF1A 2H3NB 4DQOH 1UXSB 1FGNL 4FQIH 4RGNE 5DJAA 4KK5C 4ODUA 3RY6C 3GMPA 2Y5EA 4MA8H 2MKWA 1YEGH 1S78D 3BW9B 3NIGE 2QQLH 5C8JB 1YJDL 1AKJD 4JRXB 4RX4A 5IB1A 1PZ5B 3HUJE 1G0YR 2CR3A 3BXNB 3OBAA 4KC3B 3VFSA 1BF8A 3CFKB 2VZSA 2HFEB 1DVFC 2XNAB 4GAGH 1IM9B 2CGRH 2CRYA 2ZNXA 4Y5XC 5CWSB 5JTWA 1ZXQA 4NO3B 1KG0B 5DUBB 1JPTL 1Y6KR 3A67L 3K8MA 2EYRB 3VFRB 4PV8B 2NY3D 1A1OA 2BRRH 3VXMD 4WEUD 2CIIA 4QRPD 4UAOB 1LGVA 3MV9A 4S1DD 2BOCA 3I6LE 1UCBL 2V2WA 4KK9D 1X9QA 3OV6A 4LF3A 3QH3B 5EU6E 1MFCH 2VABB 1KNOB 4JFFD 1EZVX 5EFIB 3RGHA 4LU5L 4PREB 4MVBA 5DFVC 1LO2L 4L3CB 3MRHA 2JCCA 4RGMB 1NCBL 2GUOA 4KQ4L 4K55A 4PJ7B 3NACH 3O6KH 2UYLA 4P23B 4JPVL 2IH1A 5T1MB 1H3GA 4U1MA 2Z0BA 2C26A 4HKBB 4WHCA 3C5ZC 3ARGA 3U2SA 1S9VB 3UZEA 3QZWA 2GW5A 1Q72L 3EDDA 1U92A 4X99A 5JOFA 5FA3B 4Y16B 2V17L 1UACL 1FRGL 2HFGL 5GRUH 4PRIB 1QSEB 1F8TH 3PWJA 5E8DH 2HWZH 3W9EB 4AIOA 4EVNB 1N3NB 4R6UA 3QSKB 2Q20A 4IIQA 3FOLB 2CUMA 1QUNA 2APXA 5T3XL 3MUJA 5EH1A 1DTUA 4LOUC 1ND0A 4QTIH 5T3ZE 2CR6A 1I1YA 3CZFB 2BMKB 2KQNA 3Q3GA 1RK1B 1XIWC 3DUSA 3SKOB 4FXGA 3PXHA 4P2RB 1ZT1B 3L3GA 5CSZA 1HXMA 2FCBA 4PYHA 3RNKA 1R24A 3WL9B 3O8XA 1KTLA 1VDGA 4XGZA 5D2LB 5FM5O 1R5VB 3ZT6A 1IAOB 1LDSA 2E7LA 2XZAL 3IKCB 1HXYA 1ADQA 2DJ4A 3QI9A 4XTRD 5L0QC 2G9HB 2ZUSA 4JM2A 3V6OA 1HCFX 2HRPH 3GJEA 1LO4H 4YBQD 1CF8H 3QQ9D 2BC4A 2QKIA 3RVVC 4K71B 3OMZA 4TRPH 4ZG1A 4JDVA 1I9IL 5SX5H 3L3DB 3QXWA 1IGML 1MJ7L 3CU7A 2OR8A 4BKLB 2IAMC 3MRRA 2RFXA 4GKSA 1MRFH 3FO1B 3H3PH 4WCYL 3TESA 1KTDA 3FONA 3C2AL 3EYQC 4GG6E 1QTYT 2HA1A 4UBDD 4BUGA 4MQXD 4PJ9D 2F54D 2EDJA 3H42H 4M1CD 1TJHL 5TFSH 2DDQL 4QCIB 4FNLH 5DR5H 5EIIA 4Q9QH 4ZPTB 1P2CB 4MNQD 5DHXB 4AEEA 5BS0D 1S3KH 4Y1AB 1DE4B 4PBVC 3KDMA 5FKPB 3BH8A 3S96A 3LV3A 4OCWH 3ULUF 4JB9L 4R3SB 5L6YL 1FE8L 3GMQA 1EMTL 3QG7H 3LKOA 3PDOB 1J8KA 5IVXA 4S1RL 1JUFB 3FO2B 3TFKA 5ACLA 2F53B 1U95B 1XF4B 4I2XB 3WXVL 1UCTA 3GMMA 5IMMA 4EXKA 3IB4A 3MNVA 2QSVA 4LLWA 1CWVA 2HG5B 4M7ZB 5DJDA 4BZYA 3PUCA 4F3FA 5BMFL 2BNQE 1G6RL 2B5IB 4ELME 2VLRB 1H5BB 4UAOC 1U8LA 1CFBA 5HDOA 1II4E 4C56D 2J8UB 5L8KB 4BH7A 3ZL4H 1RUPH 1S7QB 2R9HC 4RRPG 4KHTL 5FV1L 5GRYA 4IEFB 1VHPA 1FFNB 1SY6L 5A16B 4PJIE 2R39A 3CFIC 4RGMC 5T1LD 1NMBH 5DK2B 2EC9U 4RBPK 4P48A 3TIEA 4PJ8A 4JKPL 1RJYB 2ADFH 5GXBB 3K81A 1MPAL 4P23C 3HNTH 4FG6D 1QHOA 5K9KA 3CLFH 2EC8A 4WENB 3ZZ1A 3LEVH 3AAZA 3V52H 4NN6B 4Y16C 3NH7H 3DIFB 1MLCB 4MD4A 3SGKA 4XX1G 2EH7H 5E2UL 2VSDA 4KKBC 1LP9B 1ZHLA 4OZ4A 3IS0X 4G9FE 1PW3A 3CCHA 3IFNH 4NQDB 4X6DB 2P5EA 4V2CB 4KQ3L 2PXYD 5DUPH 3L95B 4ZNCD 4YHKL 4QTHB 3B2UC 3KLHD 3CUPA 1U3HD 1FVEB 2AEQH 5TDOA 1JZ2A 1LHZA 4PJ5B 4WW1B 1AY1L 1KYOJ 3GMLA 3SE9L 3QISA 1JTTA 1QLFB 4ZD3L 1NUFA 4WEBL 4C4KO 2P46B 3FCTA 2UY6A 4U0RB 4ALAH 4EDWL 3HZVB 2AXHA 3F7YA 1WBXB 3D87B 1LEIA 3KPSA 5C0IB 3QUKB 2NR6D 3CVIL 4KROB 5EZOH 5ALBH 3PIQA 1CLZL 4ZTOH 1T22A 3QXUA 5AWNL 5T3ZL 4WI7A 3HRZA 4X98B 5HYEA 5I19H 4JGJA 3OAZK 4QRSB 1NEZG 1BHGA 4RFEB 3FMGH 3UTQB 3C8HA 4K71C 5CJXA 1JGDB 5IQ9A 4Z0XB 3O4OC 1OVZA 1ZT7A 4OGXH 2AEPL 5C08D 5FO9B 5D6DA 4G6ML 1P5VA 5FB8A 5KTEL 4JR9L 4F37K 5JNYA 3C60A 3MRJA 1CDHA 1U3YA 1BJMA 1KJ3L 1ZTXH 3DX9A 4BQ9A 4YXLH 3IRZA 4LNRB 1OAZH 1YJDC 3FQXB 1AD9B 1F5WA 1U2HA 3HS0A 3GM8A 4N5UA 6FABL 3U9PL 3LIZL 5I2IA 3MUY1 4BFIB 3J7HA 3ZSTA 4RFOH 1D5BA 3U36A 2HKHL 1CTOA 1G6RB 3EOBB 1IGIL 4MMZC 1RD6A 1A7NL 4MHHI 2I9TB 3WIHH 3TN0B 4H20L 1U42A 1RAMA 4IMKC 2BSRB 1AI1L 4EI6B 2P24B 2BERA 2CQVA 4QXUH 4N8PA 3VDBA 5H94A 1E28B 1OD9A 2FBJH 4OFPA 5DMYA 1IC4H 1RZGA 3A6CH 4OSUL 1RZIA 4XH2A 4P57A 1TIUA 1IQDA 4HBCH 4F7CB 1JWMA 3LKPA 4XNYL 1CN4A 1IJ9A 1U2CA 2I24N 3BDBA 3UTTE 1KLGB 3PQYE 3IU3A 1L9NA 4X80L 3PGCB 3KYMB 3RAJH 1MJ8H 4M7ZC 3X17A 4CJ0A 4KKAD 2B5IC 3NFSH 5DVKA 1H5BC 4ZS6D 5FYLH 3RI5F 3TH3T 2XA8H 1NCTA 3FKUS 5C6WH 5GGTH 3H9HA 3CMOL 3MV11 5D1XC 3LD8B 4YPJA 5KSVA 1HHJA 3U0PB 5TQ0L 4HIJB 1FFRA 4GRWF 3SJVE 3SGJA 3GSXB 1MIML 2X4QB 4OZIA 3C9NA 1A02N 5C71A 3BX7C 5L9DL 4Z95L 1LE5A 4PJFA 3BP4B 1BP3B 2FEDC 1K4CA 5CKAA 4GMSH 2K7QA 4R4BA 4EXPX 1T80A 1I85A 1FL5A 4MDIB 1J8HA 4H1LH 1HDMA 2FWOA 1FPTH 4GRLB 2D4FA 1WIPA 3PDDA 2PW1A 5FGSA 3H7BB 3BIBX 4ZOBA 2FH6A 1RZKH 4ZFZB 4K3HA 1D9KB 3DWTA 1E0OB 3E3QC 1FVDB 4D0DB 4F9LA 3T3PE 1WFNA 2IPKA 2R8SH 2X70A 5F7HA 5L7XH 4P4KD 4PY7B 3T3ME 2HFFA 4UDTB 3FZUD 1ZKAA 3LPWA 4LHUB 1XIWA 1MF2H 2OL3H 4Z7VA 5IB3A 3EDJA 4X6EB 5ADPL 1MCWW 4KMTH 2NNAB 1F11B 1FNSH 2DWDA 3VXTB 5GGRB 1N59B 5HYQB 1U8MA 4HIIB 4U0RC 1IAMA 1S7WB 3S4SG 4CBPA 4NZDA 2ZWLT 4KROC 3V0VA 1DL7L 3OQ3B 1DANT 5EC1A 1RUKH 3RWGA 1LD9A 1ZA6B 3JV6B 2ZOKA 4JFHD 5F21B 3L5WA 4U2YA 5J1TC 4WUUD 3S34L 5CBAA 2VC2L 5IWLA 2V2XA 4LLUB 2LVCA 5IEHB 1CFVH 4KDWA 3TV3L 2X1XR 4KRNA 1QG3A 3S35H 2C7UB 2ZJSH 1LE9B 3V5HA 3CC5A 1YNTB 3ETBF 4NQXA 2HVKB 5I1AA 3LHPH 4DZBB 3WJLA 4B7IA 4NKOB 5EN2B 1P4BL 4HPYL 4K7PL 4YIQB 5E6IB 3GSWA 1XMWA 2HKFH 4HIHA 5B21A 2YD3A 4FTVD 5FOBB 4HF5H 2H8PB 2X7LB 4FHBD 2JE8A 2PYEE 2BY2A 2NY5L 1NMAL 3MLTA 3RVWD 5FDYA 3T0ED 5T5NF 4L5FL 3SKUD 4DFHA 3ULUH 3DROA 3QXVA 5C0EB 3TN0C 3QDMA 3JTSA 4LSQL 5AEAA 3GSNA 1CFSB 5J6GA 3LN4A 4YHMH 2XT1B 2Z31B 2P5WD 3KXFE 1UXSA 3ILPB 3QIUD 5JPMA 43CAB 1HHIA 2XZQL 3P40A 3GSRB 3P11H 5F7MC 1EJ6A 5TE7H 5I1EH 3MROB 3GMNB 5SWZE 4ELMB 1OSZB 1YY8B 5KSAA 1JVKA 1QSFB 3H9SD 3MJ8A 2PNDA 3KS0H 1T7VA 1UYWL 1DR9A 4IOIA 3BKCL 3ZKMC 2FLRT 3O6LH 2DICA 1XGYL 1CD1A 3QUMB 3AM8C 4I18B 4GAYA 3J8F7 4KHXH 4PJIB 1RIHL 2CLZA 4KK8D 1VCAA 3P0VL 1ZWIA 4ZODA 4E0RA 5FO8B 4PP2B 4RAVB 3F58L 4JY4B 1IKFL 1S5IL 3FHQA 3IAQA 3ROOB 4PPTA 1A14H 4R97B 5I1IH 3OZ9L 5HD8D 4OZFA 1ERNA 3QHFL 15C8L 5IV2A 4QXTB 1N6UA 3KPMA 1BAFL 1H15A 4N5ED 3GBNH 4PGCB 4EKXA 4ORGA 3BYTA 4XAWL 1ETZA 3EYUH 2OR9H 4P23A 3TYFA 2A6JB 5A2JH 4R90H 1FLRL 1HSAA 1C16A 5IMKB 4ONHB 4BH8B 4G9FB 4E5XA 2X89A 3ARUA 4Y16A 4TSAL 4PV9B 2CKBH 3WHE0 3O6MH 2VIRB 4PRPA 3W9EA 3RUGE 1AIFA 2DIAA 5AAMA 1BIHA 1C5DA 3UP1A 3VD9A 1R5IB 1NDMA 2ED9A 2IBZX 1MNUL 3FT3B 4NQCB 2R2BA 4DN3L 3HG1D 2GT9A 4M6NH 3X11A 3L1OH 1D9KC 3MZGB 4LSVH 3VFNB 2EIBA 2AAVA 3RZWA 1Y0LA 4PP1C 4JLRB 3G6DL 4OF6A 4V3EB 4U6XB 3KYKH 5IB2A 4MX7A 1KGCE 3IJHA 3UTSE 1KTKE 2VH5L 5B22A 2A9NH 1P7QD 4KK5D 3ARQA 3WIFB 2A74A 4NQSA 2EDEA 5JZ7C 3FT2B 3TVMB 2FB4H 3INUH 5D2LA 1R5VA 5E99L 4G7YH 4LBEA 1DVFD 1KIUA 2YK1L 2PO6D 4HUUA 2EYSB 4DAGH 2RGSA 3RHWF 2O5YL 4RBPH 1F6AB 1OLZA 2AV7A 3GB7A 5IW1A 5KG9B 5EWIH 5SWSD 1A47A 2JIXB 5MI0B 3FTGA 4PLNC 3QIWD 5D6CA 3GBMH 1U6AH 2EDHA 4JFPB 5BXFB 2OTPA 1WWBX 2Q7YB 4CAGA 2QSCL 1MJJA 3IT8D 1MFBH 5DFVD 1ODAA 3BRDA 3P4LA 1RU9L 1JV5A 5E6IC 3T09A 4ZXBB 1VKXB 3EYVA 4QRRD 5FFLA 4LCWA 2J88L 1CFNB 4JFOB 3BUYB 3G5VA 3GKWL 3BD5A 5DD0L 3C5ZD 5KSBF 3BKYL 4U6TA 2JJSA 2NY2D 1SEBB 3HC3H 4JZNB 1FZKA 2NX5E 4OFYD 3M1BA 3TH4T 2GCYB 2JKXA 2EZ0D 4HUXA 1JNHB 1AGDB 2Z31C 5I74B 1HKLH 8FABB 3L7EA 1MFDL 3UTTB 1PFCA 5IF0A 4ZFOB 2YPVH 2WIIA 2XTJB 2AGJH 1HEZA 2RAMA 3ZTNH 5CD5C 3U0TB 5EBMB 3UJIL 5F7NC 1BQSA 3PV6A 1A6UH 5GGVY 2VXQL 2V7HA 3VGBA 3IXTA 2X4RA 4AENA 4JDTL 3OAZH 4YFDB 1GGYA 1HSBB 5E7BA 4FN0A 2F8OA 3GHEH 2C1PA 1XCQB 4LEOA 1MREL 4I18C 5D7SL 3O4LE 4WU7A 4CMHB 1X5XA 2OTUB 1TZHA 2F15A 4LLMB 3HHRB 5FK9A 3AXLB 1YQVL 4KY1H 2DLIA 4NHUB 3WDIA 7FABH 1M7XA 2FZ3B 3D3VD 3R8QA 5D1XA 4R97C 3PJSA 4MQ7A 3C87A 4YLQT 1CFQA 4F2MB 1R3LA 1SYSB 2E9JA 3N1QC 5ANMB 1G1YA 4J12A 5B4MC 5TH2A 4YDIH 4LPCA 1RJYA 5GS0D 3AB0C 3JWOH 1X6NA 5IHZB 1CDCA 4GQ9H 1HQ4B 1RUQL 2Q6WB 5GZNC 3P73B 5I15H 1XH3B 4W6YB 1G7LA 2CO6B 2R69H 4ODWA 3VFPB 2YRLA 2WM0A 4PYGA 1XCTB 5J3HC 5KVFH 4G7VH 5ILTL 2H32A 5MEPB 1FZMB 5GZOD 3QEGL 1GC1L 1HYSC 1CXFA 1F97A 2IQAA 1QLRB 1N5YH 3S88L