3ROLA

Murine class i major histocompatibility complex h-2kb in complex with post-translationally modified lcmv-derived gp34-41 peptide, comprising a nitrotyrosine at position 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
271
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 75
structure length 271
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rolA01
1W0VA 4TRPH 2GUOB 5KJRL 2QQKH 4U3CA 1KG0B 1A4JA 4G9FE 4L4TB 5HY9B 1IAIL 4DZBA 2EEAA 5ICZB 1EAJA 4I5BB 4MWFB 3LVEA 4X5WB 3MODL 4MZ3A 1AGFB 4M9OA 2YEZA 2KQNA 4XPTL 5DJ0B 1B2WH 2AK1H 2VZ1A 4P9ML 1MOEA 1D5MB 5E8PA 5IJKA 4PJCB 2AI0L 4Y4FC 1NAMH 4HFWB 3KPRB 3K7UA 2F53A 2V5RA 3KVQA 4JDVB 3G9AB 5DMYA 3DMMC 2Z93A 4YPGB 4K55A 4YX2H 1IL1A 1K8IB 3LEXB 4LFHG 5ESQB 1UQSB 3VCLA 1X5XA 5D7KD 3D25A 3BP7A 3LIZH 2VWEC 2J4WH 1UB5A 4PJHB 4Z5RB 5FA3A 1A6WH 1R3HA 3U0PB 3MCKA 3IAGC 4B7LA 4NP4H 4J12A 1BQUA 4FQLL 4M62H 4YQXL 2D7OA 5HHVH 1TZGH 1CYGA 2P48B 4P4RB 1JZ2A 4X6DF 1NBYA 5ANME 4S0TD 4TSAH 1P5VA 5FO8B 3SJVD 1T1WA 4EUPB 1JHTB 3E6FA 3QDHA 4JHWH 5E00A 1J1OL 3QXWA 3UPAA 1PG7X 3BKML 1HHGB 5JIIA 3I3BA 1Q9WB 2OZ4H 1FNEA 1IC4H 1UM6L 3OF6A 4IMKA 1MFDL 2YA1A 2G2RB 3EZJB 3KPRD 1JFQL 2A6JB 1WJ3A 3CX2A 4E42A 3FT2B 2P7TB 2HJFA 1JI2A 4JPKH 5F1OB 1B0RA 2Y06L 4JZJA 1N4XH 5GISL 4PGDA 4Y4HC 4Z0BL 3N1PC 2APWA 1JHLL 3V4VH 3A6OA 4HUVA 1T03L 1C08B 1NCBH 5C6PB 5EFIA 5DHXB 1E4XI 1CS6A 4HS6A 4XP6H 3G5VB 1JUFA 2WW8A 1KXQE 2OP4L 4BH7B 1D6EB 4EKXA 4JG0L 5HXMA 1A14H 3GMOB 4KK8D 3WO4B 3IVKB 4P5KB 4R3SB 3STZB 2IALA 5D96B 1NUFA 1OTSD 4NM4H 1KJVA 2C3XA 1DANU 2AJZA 1I8KB 5LQBH 1JZ7A 2E9IA 4S1SH 4ZNEA 4TQEH 3PIQA 5F3BA 2QSQA 3OTTA 1U3HA 3P9LB 2WK2A 4YBQD 3Q3GA 4NCC2 4CJ0A 5BCAA 2X5PA 4LLVB 4NOFA 3S4SB 2F19L 4F58H 3GUTB 2A0LC 5E7FA 4PGEB 1Q1JH 4HFUL 1I8MA 4TUOB 5FHBH 5DJYB 5K93A 1UVQA 2OTUB 1F3RB 2NX5E 1N8ZB 4KJYA 2AVGA 2HT2C 4AZ8A 5GS2H 4NUJA 1INQA 4ZS6C 3C5SA 3GI9H 3TPKA 5CBAA 4XZUB 3KPMB 3RNQA 5LGKA 1P69B 2XZZA 3BW9B 1X9QA 5DUPH 2MNUA 1TZIB 3KWWB 1QOKA 3P9MB 5ANMB 3R8QA 4ODHH 4OB5H 9CGTA 5E94B 1IGCH 2FEEL 5BO1L 3G6JE 1QA9A 3WNMA 2F54E 4G9FD 5E8OA 2O5YH 4HWBL 2AJVH 5F9WC 3HTLX 4QRRE 2ICWA 3LRSA 1T0PB 1HCVA 3QDJA 5IHUH 2P42B 3VG0H 3JZ7A 1IEAA 4F9LA 5IHZB 1WAAE 2UY6A 3M17B 4XRCA 3SE8H 2DQUL 3TIEB 5IW1B 1HKLL 1R5IA 4NHUE 4DGVL 3D18B 4KZDH 5JMOC 4HW6A 2FIKA 4ZAKA 3IYLW 3PXJA 4LCUA 4EI6B 5KVMC 2AJYL 1QRNA 4YFEA 1AE6H 4YPJA 3MRFA 1CFBA 2CKNA 2DBLH 5I73C 4APQB 12E8L 1QQDB 2C7UA 2AJ3A 4DKDC 3R06A 3MBEC 4G8EB 2YD8A 4K9EC 2AQ1A 4YHOL 3FT4A 1UKQA 2CLZA 2CDFB 5E5UB 1EHNA 2GFBB 3T2NH 3WN5B 1YJDH 4EVNA 3NFPA 1W8OA 2H9GA 2DQJL 3QUKA 1KB9J 4FQ1H 4WFED 1ZA3A 2DD8H 5L7XL 2ICEB 5GQBA 5JXEA 2YPKB 25C8L 3CFJB 4AIOA 4XP9L 1MCCA 1Q8MA 1RQ5A 1WICA 4PJ7E 1WAAF 4FFWC 4F7TA 4OLEA 4KVNH 4AH2B 3O2DA 1GSMA 2MTPA 3IDJA 4D0BB 2BFVH 4Z7VE 1XF4B 2QQNH 1AGBA 1MRCL 2W9LA 3O2WH 3NFSL 4FQIL 4CVZA 2ZCKH 4PY8I 3IFNH 4LKXB 3BZFB 5D4QA 1QLEH 5J3HD 5D7IA 4HJ0D 2FJHB 3W11C 4KJPC 2N56A 3SQBA 2M2DA 3ZE1E 3I3DA 5TQ0H 3HZYB 3BP6A 2NX5B 3G08B 2MOVA 1HHJA 2ZOKB 3KPSE 1W72H 5CZXC 1BZ9A 2NY3B 3RTQA 1TDQA 1JPTH 3GO1H 3NABH 1HH6A 3LQZA 4APQD 4U0RC 3SE3C 2VQUA 2YD5A 4JLRA 3BRDA 1CD9B 1S8DB 1IM9D 3CVHL 5HHNB 4PLNC 3ARWA 1WC7B 2M8XA 2VL5A 1REIA 1RURH 1YEHL 5K59E 4OCXL 2R69H 3DUUA 3I3EA 2D7QA 2CMRH 1I1RA 3G6JB 1FDLH 4H25B 4QF1B 5EOTA 3QNZA 4P48A 4Z7VF 1FIEA 4ALAL 1F8TL 1EHXA 4Y2DA 2AEIT 4QRRB 3BH9A 4M1DL 3X11A 2EYTB 1EEYA 2FEDC 4JG1H 4KI1A 1A2YB 1NGXA 4MD4B 3QUYB 2HLAB 2DF3A 5KVGL 3IDNB 4IMKC 2R1WA 2NLJB 4H20H 3I02A 4C4KO 4WU5B 3U7WL 4EDXB 5IB1A 3OR7B 4R96A 1P7HL 1WWWX 3VRJA 2VABB 1GZPB 5T5NG 1T20A 2P5ED 4JZJC 4NO5A 1NPUA 3F7QA 3QQ9D 4QHNB 2NX5D 3U4BL 1KCSL 5ID1B 4KRMB 2LAAA 4G8FA 1IGIH 4GXVH 3I6GA 1G6RL 2AK4A 5HYJE 3BKYL 4GMTH 1J8HB 2H2PD 5ENWB 2XWBB 3OKDA 1KCVH 3RI5K 2X4NB 4N8CH 1KTDB 5EB9A 4Q97A 1RZKH 4O00A 1MAJA 4YBLC 4LSSL 3MUGB 1MHPL 1L9MA 1G9NL 4HGWA 3TPUA 2VO5A 3HAEG 1NCCL 4PJ7B 1M6OA 2F54D 2FR4B 1SEBA 4KDTA 5T3XH 2ARJQ 5I71B 1A9BB 1IFHL 4GRMA 5HDBF 1DDHA 3G5ZA 1T83A 4GSDH 5TQ2H 4NKQB 1YNTB 5GGSB 2QSCH 4OV5A 5DFWH 2R2EB 1UG9A 3IJHA 4R4BB 3MLSL 3QSKB 1U3HC 2DQFA 5F7FA 3DROB 5I76A 1KLGA 3EW3B 3HZVA 3AAZB 4XVTL 1H0DA 1LDPH 2XA8L 1G9MC 5H35B 3B6SA 1HXMB 2PXYB 2FRGP 4J4PA 2FHFA 3T0DA 3QG7L 3CC5A 2XQYG 2I27N 1N6QH 3KPSB 4ZDHB 1VFBB 4Z7QF 3OB8A 2HT3D 5TE7L 4G8IB 3BIKA 3REVA 5DHVH 1E4WH 8FABB 4OCSL 3Q6GH 4XVJL 4FZEH 3EJYC 4XGZB 1IT9L 3GIVB 5DD6A 5BRZE 4OQTL 3I6LE 3BSZL 3O45B 3AXLB 4XXDB 2J5LB 3U46B 5FA4A 5T3ZL 3MUHL 1Z0NA 1D5ZA 3SE9H 1R3JA 1U91A 2AJUH 1QBML 4GBXA 4KI5E 1U8IB 4MB3A 1ZSDA 2DYPB 3FAXA 5HGDA 3KYMB 4ZG1A 5DMKA 4G3YL 4NDMA 1CDUA 4Y0GA 2FGWH 3CCHB 1QTYT 1I4FB 2UZXB 5DMGD 3WXVL 4D0CB 3V95A 3BVNA 3QUZB 1V7NL 1NGPL 4FG6D 2ATKA 3AU1A 3ISWA 3NAAH 1XF2B 1M7XA 1AGDB 1CF8H 4F9LC 4G9DA 5I1LB 4XCCL 5I1AB 3O8XA 4CU8A 3WIIH 5E0QA 3F12B 4AQ1B 3CK0L 3NH7H 4P4KD 4OUOA 4ZAKC 2LE9A 2FO4A 1BPVA 3MGTA 5E24E 4K94L 4JO3L 3B4NA 2PXYD 1D5BA 1H15B 3BQUA 5HHXL 3SKOA 5JOFB 3HPJB 3W9EA 3PGCA 4UV4H 3KPSD 1JNHB 1YY9C 1OGTB 3QJFB 3KLHD 5HYJB 2BK8A 5KVEL 2WNGA 2PYFB 5B8CA 5IW6B 4KI5F 1NJ9B 3RZCB 1FGVH 1NEUA 3BT2H 4LRNL 3OBAA 1FFRA 3BWUC 1KTKE 5JDSB 4H1LG 3PWUB 3NFNA 3CFDA 3O6MH 5LGHH 5GS0H 1A6UH 4L8CA 1N0XL 4NZJA 4FQJH 1I1AA 1F02I 5IMLB 3HG1E 4QRUA 2CDEB 2DYPD 2RR3A 5DC4B 4U1KA 1F4AA 1YMMD 4GS7B 2OMBA 4YNYA 4ZO7A 2APFA 1BQLL 2HWZL 5I1JL 2IFFH 1RAMA 3EUUA 4LLWA 5L9DH 1VGEL 5EN2B 1EO5A 4WY7H 3LKOB 2IBZX 4KMLB 3BGMB 1U8HA 3HMWL 1WVZA 1IGTA 3CZFA 2G5RA 3O3DB 4XCFH 2I9LB 4N0CD 4G43B 3T4AA 3ZKMC 1BF8A 2XPGB 2Y23A 1TJGL 3I85A 4JO4H 1FZOA 5IF0B 2BSTB 1I7UA 2WIMA 1U3YA 3L3IB 5EWIL 4DW2H 4DCQA 3RTQC 3HAEB 2H6PA 5FCSH 3LKPA 1FVEA 2HFEB 3GIZH 3EYFA 2APVA 4KJQD 1UADC 3CVHB 5HYJD 1P2CB 4Z95L 3KPLB 5BRZB 3T0VA 4R4NC 1P4IH 5TPWL 1OAYL 4OTXL 3EZ8A 4PPTA 5BVPH 4K7PL 2FO1A 3FZUC 5F1KC 5A2LH 3LH2H 3RVVC 5IMOB 2YPLA 4WEBH 1J8KA 4NRXA 4MCYA 2VXQL 1S5HA 2OI9A 3GSVA 4WHYG 5DEFA 4FQXA 6FABH 5IB5A 5E6IA 4PJ5A 3ULUL 2BVQB 1ZHKB 3KHQA 2NY6B 1D6VL 1HI6A 3ARZA 5IR1B 3DGCR 4UV7H 5LCVL 3MJ9L 4Y16D 3V6BR 3UTQB 5CJXA 1CLZH 1TQCB 1IILE 4Z7WE 3MLRH 3QFJA 4OZFH 2Z4QB 4HCRL 2ZUWA 5DQDH 1VEMA 4QTIL 3BESR 3UTSE 4JPIB 3I84A 1G6RB 1V7MH 1DBAH 4XBEL 5GRUL 3C09C 3HC3L 3MLWL 1I1FA 1U3ZA 3LEVL 2VOTA 4JKKA 4OGZA 3F62A 4FQ2H 5BRZD 3I6LD 3TC9A 5KANI 4QLRA 5CJQL 3DHJA 1VGKA 3ZT7A 3MRQB 3WEXA 4KI5D 2JF1A 3HG1B 3LB6D 5LBSL 4MMXC 3NGBB 4W6WB 1HKFA 1UWXK 4R8WH 4MCZA 5IGXL 4N9GA 4UTAL 4KDTC 3VE0B 3ZKNC 4N1CA 4R7DA 4HXAL 1FL6A 1T83C 4Y4KB 5AZEL 1U2HA 4PJGE 4IOIA 1PAMA 4JZNB 3HLAB 1MH5A 1SYSB 3PGFH 2E8ZA 4ZQKA 2YRZA 1YZZA 3PWJB 2JELL 5E2UH 3CDFA 4YGAB 4ZUWB 4C55A 4DOHE 3RGHA 3MLVH 3RWEA 3GJFH 1RV6X 4M03A 5I74C 4M8QB 4KQ4H 4H1LB 2DM2A 4M7KH 1WQVT 1IMHC 4YHMH 5B21A 1PY4A 1JP5A 1XCTA 4NQDE 1CZ8L 4BSVB 4IS6A 5FGBA 1HK6A 1J0IA 3GGWA 4PD4J 3LKQA 1RUMH 2ITDA 3KYAA 1FN4B 3O3BB 1NSNH 5DD0H 1A7QL 3KLAB 3BXNB 3RDTD 1FLRL 3AGVA 3Q5TA 4HJJL 2AXHA 5F70A 1ZLUH 4U6HA 2LFGA 5D1XB 2AGJH 5MENB 4GBXC 1RJZA 5C70A 4GW4A 2AEQL 1EVUA 1BD2E 1FYTA 3UJJL 1QSZA 4PJGF 3X12A 3T3MF 3ZHDA 3Q5OA 1A7RH 3HG1D 1B6UA 2I07A 2FX7L 3UPCA 1SJVA 3ULUE 3INUH 4Z7OF 5FUZH 2Q8BL 4FQCL 4XI5D 3LS5L 1CFSA 4Y4KD 3IXAB 1MAML 1T0NA 3VXTA 1YYLL 4DN4L 1XH3B 3O8XC 1BJMA 1NLDL 1TPXC 1BF2A 4JZOA 3MRBB 2W0PA 3ES6A 2BC4B 4IEFB 5J1SC 1CGXA 5DJ8A 4UAOC 4Z7WB 1SJHB 2WUBL 5ABDE 3ARBB 5CIPH 3BQUC 3WFHA 4UOW0 3UTSB 5HHME 4BM7A 4PREA 3MYZA 3T0EE 1QEWB 35C8H 5E6ZA 4JY5L 4LKCB 1G84A 5DRWB 4L9LA 5B8CC 4D8PA 4NO2A 1NCNA 3QI9B 1NMAL 4PRHE 1YNLH 1BIIB 1ZE3C 4L8SA 2PCPA 1OY3B 3FQWB 3HR5B 4NT6B 3BI9X 2ZUXA 3EO0A 4P3WA 4CVXA 5D1XD 1I1AC 3ULUF 2Q7YA 2BVTA 4MJIE 5EU5B 1MFBL 1II4E 5TFSL 5IBLC 3JWOC 2AXFB 1ED3B 3TO4A 4L8BA 3DETD 4Y5XA 3VWKA 2NXYC 4UOJA 2HH0L 4Y19E 1OOAA 1QVOB 2EZ0C 4LSTL 2EDFA 3P73A 4X8XA 2NXZB 2Y72A 4MJ5B 1IE5A 1T66D 2ORBH 3FFDB 3UMTA 2ERJB 3M07A 3QISA 4PR5A 4DOHB 2W92A 1NC4A 4F57H 3QPXH 4DAGH 2FLRT 3BPLC 2AEPL 2YD7A 3IU3A 2HKHL 4HAFA 2HVJB 4NQDB 3VU2A 2EH8L 3K1DA 3ARBD 1EEQA 4JFZH 3ESUF 4CGTA 5DF0A 1PZ5A 4CAGA 3UTSD 1PW3A 1IJ9A 2CD0A 1NAMA 1PX3A 3V52H 4HUXA 1ORSA 2EKJA 2YD4A 1OWWA 4LHUG 4HUWB 3HE7A 5GRJL 3UAJD 2HFTA 4GG6F 2VDOL 2YK1H 4HC1H 3K2MC 1A3RH 1U8LB 4BQ8A 2JJVA 1IGYB 5TE6L 1CICB 3FRUA 4GUPA 4OF0A 3QZWG 32C2A 4KRLB 1BD2B 4U7KA 1K4CA 3MA9L 3UYOD 5SWZA 1SEQH 2OI9C 2F8OA 5CEXA 1GOFA 3EO9H 4FQXC 2HKFH 3PL6B 5IFJB 1EVTC 2VXVL 4HQQL 4MQ7B 5F7NC 1XF3A 5FOBB 4BH8A 4HK3N 1Q72H 3OV6A 2VAJA 1H8NA 3B8YA 1A3QA 4NUGL 1S5IH 3KJ6H 4P99A 5DFTA 5HD8C 3IKKA 3MV8A 2VR4A 5CEZH 3QDGE 2VDLL 4O4YH 5MHSE 4NM8H 2EIDA 5CJXC 3RRQA 5EU7E 4RA0C 3MMEB 2Z9TA 1MAKA 1IAII 3C2AH 3QDME 1CL7H 1EO8H 4X4YB 4NQDD 5DEZA 2OL3H 3L7FB 4K8RH 3T0EB 5FFLA 2NY7H 3LAFA 4WTZG 2RFXA 5A3IC 4E0RA 3FRPG 4FFYL 1KSRA 1A64A 4PRHB 3FQUA 2ZPKH 2XACC 1UXSB 3O6FB 1I8LA 4QRQA 1YUHB 3K8MA 1CICD 4RMWA 4UQ2A 1LO2H 1MVUB 5J12C 5L2KE 1BD2D 4NO3A 4U1GC 1QLRB 5DJDA 5GSVA 1JBJA 3FQXB 2H32H 4RWHA 4X99A 1J0HA 1MCQA 3W81A 3PL6D 4OSUH 3T0XA 5JNYB 1RUQH 5CILL 3ULUD 4Y19B 3QH3B 1RZ7H 4G5ZH 1GXEA 2MJWA 4IIQB 3BFOA 4HBQA 2QHRL 2AV1B 2NY5C 5EZJB 5FXCH 1YQVH 2IADA 4NQUA 2V17H 4KPHL 3CLEL 2J1KA 1MIEH 5FGBC 4HKJA 2OJEB 3TP4A 4OLXH 3PDOB 5IMKB 5DC0A 1DQTA 5HHMD 1MFCH 2DL9A 3SGJA 3T0ED 4CMHB 4RNRA 1RZJC 1DSFL 4KMTH 3X3FH 1PLGL 2JTDA 3FQNB 4LVEA 2LAGB 4PRHD 4YFLF 2IPKB 1NFIB 3TVMD 3ETBF 1ZLVK 4N9OB 1EHLH 1K8DB 5ADPH 1A9EA 5I15H 5HGAB 3PQYE 2GAZA 4MJID 5JO5B 4IRSA 2CDGA 4UB0H 4HIHA 1ADQL 4QOKE 5DZLA 3K3QA 3SO3C 1FNSL 1S7XB 3O4LE 5CGYC 1BGXL 3QDGB 3EGSB 4Y19D 3N9GL 4LHUB 4ZSOB 2YOCA 3IDYB 1MUJB 4XP5H 1IEBB 5A2KH 3O2VH 2D0GA 2G75B 4Z8FH 1U58A 3ZSSA 2MHAA 4Q74A 1CT8A 3QDMB 3QZWB 2HT2D 4EXPX 2IGFH 5GZOC 3JWDL 3CLFH 3BPNC 4H0HB 4ZS6D 3U1SL 4X6EA 2Q7NA 1YEGH 1JE6A 1K5NB 4LCIL 4L9LC 1YEDB 2R15A 3VMOA 3EOTL 5HHQA 5DDHA 2GKIA 1U8OA 4I3GA 4PRPE 1L6XA 1RUAL 1MREH 1YPZE 3MLZH 2PN5A 4BK5A 3P77A 1AO7E 3IKCA 1X4ZA 4N8VG 1DLFL 3MREB 4MJ6A 1NL0L 5L2KB 4NJ9H 4ODXB 4C56A 1K6QL 3QO1B 1AQDB 3TH2T 4NO0B 3L3GA 5IV2A 1I3GH 1KIRA 3CDGA 4N90D 4LSUH 4X6FA 1JRHH 2V7HA 1IVLA 1A3LL 4Y5XC 3IS1X 2IQAA 4HS8H 3VWKC 3H42L 3QA3B 1B6DA 1OSZA 3QFDA 1DP0A 1N64H 3MUY1 1E6OH 1BFTA 3QDGD 5CHNA 3IDGB 1PG7L 4AEEA 4LHUD 2YXFA 1A7PL 1AIFB 4JFYA 1EJOH 2OR9H 4Q0XH 4YDJB 3QDMD 4WHTB 1CLCA 3FO9A 3BO8A 4GQ9L 3AROA 3A6CL 1XGRB 2NTFA 1AR1D 2X70A 4ISVA 1UH4A 3RAJH 2ESVA 3HE7C 4D9LH 2ZKHH 5DTFA 3HCVA 4GXUM 4XPGH 1BZ7B 3D87B 4LIQL 1JGLH 1DZBA 1MHEA 5F7UA 3U79A 2HG5A 2FYYB 2PYEE 2YC1B 4LEXL 1Q0XH 5FYLL 2KKQA 2X89A 2WP3O 4QHMA 4Q9QL 4ODWB 3PQYB 2R0WL 3RP1A 1T7XA 4FFWD 5L2KD 3RWDB 4XCNA 3IGAB 1CDJA 1RVFH 4MX7A 4NO0D 5C0ND 4LSVL 4OCRH 5CP7B 5T33L 2P24B 4WCYH 2PF6A 2N7AA 3O4LB 3KPPA 3AMKA 4TVSa 3LHPL 3ZTJH 4NBZB 4NQVA 4PGBA 4KJPD 2QL1A 1MCFA 4RFNC 1BFSA 4Y5YB 3OKNA 5FECA 2CRYA 4EI5B 4ZXBB 1JWSB 4JFQB 4WGWB 5B38G 5CP3H 5LWYH 2AKRA 3FQTB 5CZXD 2DS4A 4J23A 2OYPA 1WGOA 1T1YB 4NQSB 4HG4K 2KDGA 2Q3AA 4OLZL 2NW2A 4MQXD 3U30B 4C59B 1ZTXH 5IMMB 2EIBA 2UWEB 3A0OA 1MFEL 5D93B 1S9XB 1RJCA 3UJIH 4PRPB 2XWTA 1I8LC 1YPZB 1U6AL 3NTCH 3OZ9L 1AO7B 3CGTA 1AGCB 1DANT 1I3UA 2NYYC 4DGIL 4LP5A 4YBHA 1A1MA 1RMFH 2J8UA 3ZO0A 1FFOB 5INDB 5IEKB 4I3SL 4S1QL 1N59A 3MJ6A 3QXTA 2Y07L 4FS0A 4QOKD 3ILQC 1GGTA 4LSPH 3S5LA 3I9GH 3O4LD 4LASL 1JF1B 4TOYL 4M5YH 3CFEA 1X4XA 4JM2B 3U2SB 3MJ8A 3EJZD 1EK3A 4MA3A 2E7MA 1DQJA 1OW0A 4M7JH 5GGSY 2D31B 4N8VB 4EI5D 4ZXBD 1MJJA 1RJLB 2CQVA 2XTJC 3SGJC 2YUVA 5ETUB 5T1DL 3OJ2C 3LDBB 3WXWH 3GDBA 3HFMH 4LIQE 2R56H 3EFDL 1Z9SA 4LL9A 1R24A 3LRGA 4PRPD 3STLA 5EIVA 1A5FL 2WANA 5DJXA 3P11H 4JO1H 3T1WA 2VDQL 1X5FA 4ODBD 2JK5B 5FYLE 5KAQG 1AO7D 3HMXH 2AJXL 3K4ZA 5CJOH 5KS9A 2AERT 4IRSC 4RISL 1I7ZB 1A1OB 1WCBB 3QEHA 3BDBA 5F1NA 3VGBA 5D7IF 2YSSB 3MRKB 1BAFH 2O93L 3JTTA 4ERSL 4QRPE 2DQCL 2NY4B 4R26H 1FZKB 4LCYB 3PGDB 2VZUA 3WFDH 5CKAA 2C4XA 1KIPA 3PWLB 4JRXA 4GAFB 3L3KB 2FHCA 3RWJB 3IETB 4JM2D 1OTUC 3S3SA 1UM4H 3B3IA 4I0PB 3U4AA 2C3WA 1FAIL 4LCWA 4XCYA 2L4OA 4ODTH 4JFDE 1WFUA 5C07A 4C83B 3SDCA 1Y0LB 5MEOB 2BSED 4OZ4A 4JHAH 2BHYA 3MFFA 4LEOA 5GIRA 4KROC 3EJYD 4WHCA 2XNAB 5DJCA 4BQ6A 5AYUH 4YZFE 1KUMA 3ZE2E 1L0YA 1MHHA 1OP5H 1FVCB 3GZKA 4X80H 4WI6A 3VXPA 4WJ5A 2PYED 1IGFL 5IG7B 5LKNA 2WINB 5B38B 1W2KT 5FHAH 3PHQA 3D69B 5KSAB 3QIUA 5BQ7A 3MX0A 1DLHA 1RUPH 4J3UA 3IB4A 3HNSL 2A1WH 4OCNC 4WW2F 1SMOA 2Q86A 3FN3A 3C60A 4H5SA 2EDEA 2NY4D 1CDYA 4PJ8C 5TDNB 3ARPA 1KTRL 5DD3L 4NNXA 4DVBB 1GC1L 4XWOD 1FH5L 4JFOB 5JLZA 2CLRA 1DBJL 3TESA 4YZFF 4O9HL 2AABL 5I18L 3ZE2F 2JCCA 3BE1L 3S36H 4JN1L 4WWID 1T22A 2KPNA 1PSKH 3MNVA 3MODH 4XPTH 4P9MH 2E6JA 4RRPA 7FABH 1KCUH 2Q6WB 3TN0B 3PDGA 2CO7B 3GJFK 3PWNA 2P43B 3EFFB 1OAUH 1NMCC 3VXUA 1PG7W 4L3CB 4BZ1L 5INCB 2CK0L 5KSAD 3PNWA 4GW5A 4QRPB 4XNYL 4OM1L 3P0VL 3CXHJ 2WWKO 1F6AA 5KVFL 2BNRA 1RZ8B 1MLBA 3OR6B 3REWA 2WZPD 2DRUA 4XAKE 4WW2B 1ZLUK 4PRAA 4YQXH 3FB5B 1AI1H 4QTHA 3DO3A 4EN3B 3ARVA 1V05A 4JFDB 4XMLL 1J1PH 3AB0B 5BV7H 3QPQC 4P5MB 1UZ8B 2UYLA 4MNGE 3BPCB 2J6EL 1G7HB 3WLWD 3VXQA 4CVWA 2YD2A 4NNYB 2QHLA 2YBRB 1EEUA 3BKMH 1NCAH 2OTWA 4MVBA 1FZJA 4WI8A 4UIKL 2OCFD 1A6VL 1UM6H 4XB7A 5C0JA 2XKNB 3SBWA 3RGVD 1A1NA 1X5HA 1BWWA 3TN0D 4G6ML 5FYLD 2R0ZL 3VFGL 1M71B 1YN6A 1TZHA 5DEGB 1ZHLB 3U82B 1FL3B 2B5IB 2V5TA 5BJTA 4GXUN 4QRPD 5C0CA 2Y5TB 4L1HA 4QXGL 5IFAL 3H3PH 5ALBL 2ZUUA 3BX7C 5JOEA 3HN3A 1MJUH 4L8DA 3PWPB 1Q9LA 4NCC1 5EO9A 1OW0C 2DQHH 4XAWH 4WW1B 5EO1B 1JWMA 2ADJA 3M1BB 3VI4E 5J6HA 3VFMB 3QJHA 4JFDD 1KN2L 2AXGB 3MRLA 3MRIA 4DKFL 1YYML 5FV1L 1DBKL 3D0VB 3MZTA 4LSQH 1CFQB 2C3VB 3P4NB 3TT3L 2VH5L 3FQRB 3BEVB 1DN0B 1B0GA 1WTLA 3EJJX 4XC3H 5GRZA 4A6YA 5C8JB 2VNCA 5DRNB 5DWUH 5CGMA 3HC4L 1TXKA 3DVNA 1G7JB 3TWCL 3U9UB 1OAXH 2EDDA 3G04A 2F19H 2B4CL 1L8JA 5EU6A 3GMRB 2F5BH 5TE4H 2XRAL 2X4TB 3L5IA 5AD0B 4HFUH 4JREB 5E6YA 1A7OL 3GJEB 4HUUA 1UACH 1NDGA 4DK3A 2AV7A 4FQQB 3VXNB 1FC2D 3SDAB 2D03L 4JJHA 2E7BA 2KZWA 1VADB 4OI9A 3B9KA 2VZVA 4GAGL 3HZKB 4ZMAT 4QGYA 4OFIA 4D3CL 4WI3A 3VXRA 3MRMB 1CCZA 3GMMB 5TF1L 2LU4A 2OXHA 3HRZB 1LO0H 2PW1B 3C8KB 3FOMA 1XF5B 1X5GA 1WWBX 3EYOB 3SDCC 2IAMA 1FVDB 5E8NA 4X7TA 5BO1H 2OS7A 1MWAL 1MCKA 4NRYA 4U05A 6CGTA 4KMQA 4MNGB 3SDDA 3DXAB 4RAUB 1KC5L 1Z5LB 4JM4H 1KJ2H 4OFKA 4CN6A 3TNNB 1KGCE 1QSEE 1NGZB 3PABB 3L9RB 4IDLA 4GBXD 2A74A 2JJTA 4H88L 4OLVL 2I9TB 2FDBP 4Q9RL 4CADA 1HKLH 2EE9A 4KKBC 1GGIL 5CWSA 1XR9B 1D5XB 1IAKB 3QIUC 2ZCLL 4HV8A 1LO4L 1WUNT 4GKSB 4CVUA 5IQ9B 3R8BB 1WK0A 1SY6A 12E8H 4FN0A 2ID5A 1MFAH 2WIIB 3JWNC 2PTVA 3JV6A 3VD3A 5E7BA 2R0LL 2X4SA 1ZT4B 3QEQA 4X5XB 1YC7A 1R5WA 3RNKB 2MWCA 4DJMA 4LF3A 3BQUD 1ERNA 4K23L 3DOSA 4Z7UA 1BJ8A 5IB4A 2VXTH 4FXKA 4P0DA 4JFEB 5I66A 4XP9H 4PRDA 5F6IC 3C08L 4FNLH 3O6KL 3W0WE 3U4EA 4PV8A 4ODUB 1MEXL 3U6RA 4I9WE 4JPWH 3FFCE 5EBLB 2X05A 4XVSH 3L3HB 3QP3A 5EA0H 4KVCL 2I5YH 1LEIB 2EYRB 3D9AH 3NFSH 1HNFA 1CQKA 1LK2B 1HWHB 3DVGB 5IB3A 4AYFA 1WZLA 1YEIL 1FQ9C 3IXTB 1XGYH 2O61B 1JHKL 5DJ2A 3KG5A 4ORGB 4NWUL 1J12A 4UT7L 4MAYB 1JK8B 5GHWH 4KKAD 4ELKB 4A2LA 2WQRA 3OKKB 3SQOL 5F21B 3WKNA 2VTFA 4PGZA 2HMIC 4XVUC 3KNBB 1BBDL 2VZ3A 5EBWB 1JN6A 4XT1C 3ZMRA 1TVHA 2GQHA 3ULVL 3VWJB 3WIFA 4P5TB 2D0FA 4TUKL 4NZUH 2A6IA 3V7AG 1RIUH 4YDLB 4ENEC 4F9PA 1KPVA 2RCSH 3MJ7B 3L6FA 4ALAH 3QIBA 1F8TH 3ARXA 2A6KB 4KRNA 3IU4L 5IKCB 2DMBA 4PJFA 1QSEB 2BNQE 1F90L 2EDNA 2ZUSA 4MVBC 3ZLQC 4QNPE 1DUYB 5D7LE 3OGCB 3ARGA 1G7IB 4UDTB 3SBWC 1GGYA 3OKYA 4XMKH 1KV3A 4PJIA 1YEFL 3WE6B 4L3EE 1ZA6A 1RY7B 4NYLB 2W60A 5I1KL 3RWFA 3G5YB 3V5KB 5K9OA 3DSNA 4LLMB 3V7AE 1XIWA 3BISA 1AHWA 1FCGA 3ZE0E 2W59A 5HD8D 4O58L 4N5EA 3F58L 3U4BH 2VLJE 3RJQB 1QFOA 3NIDE 3K2UH 2NZ9C 5F71A 4KY1H 4OT1L 4OGXH 2IG2L 3BKYH 3HA0A 4PP2B 3DGGA 1JF6A 5T1KA 3WIHA 4XBPA 3MOBL 5CINH 3SKNA 5IUSA 5EBMB 4ODVL 2DWEB 5KVDL 4M5ZL 4J3VA 1BVLB 4PUBH 4YE4H 5BS0E 4RGNC 3VWJD 4GMSL 4P5TD 3LKRA 3WCYA 4PLKC 4QNPF 3V6OE 2C1PB 5SWQA 3LPGA 2BOCA 2A9ML 3W0WB 1ZK9A 2B1HH 1ITBB 2HA1A 4Z78A 1HHKA 1IFHH 5CD3A 5DK0B 1EA9C 3HI1A 1QSED 1DEEB 1E6JH 2WBJC 1HINH 3VG9B 5FYKL 3DV6B 3QNYA 4X6CA 2F8XC 3MNZB 3ZE0F 4UILL 4YH6A 4GAYB 4KK5D 2A9NH 2GTWA 3F7VB 5ITBH 1EJ6A 3C5ZB 4QY8A 3NIDF 5F1IA 2CO6B 1BFOB 3MRNA 4BFEA 5TE7H 1NBVH 5CJ5A 1GGCH 3BP4A 3TJHD 3CFBB 3OL2A 2DQTL 4TSBH 2WBKA 4OQTH 3G9VA 3BSZH 3EYUH 4MD5A 5I19H 5HGHB 4I3RL 4U1LA 3QHZL 1A6AB 3L5WA 2IAMC 3HI5H 1MWAB 3H6JA 5ESVB 3KYOB 3SDDC 4G3YH 2W65B 2YUZA 2VQ1B 5E2VL 1IKNA 3W0WD 5I8CA 2R8SL 5I6XB 2BNQB 3OMZA 3O11B 4I9WD 1T5XA 3FFCD 5D7LB 3G6AA 1IBGL 4Z7NE 1KYOJ 5FGCE 5MERB 1QG3A 2H1PL 4AEFA 3BYTA 4DN3L 1CFNB 2EH7L 3TZVB 4FXLA 4NQEE 2ZSVA 5CBEB 4R4FH 2EDJA 3LZFL 3TBSA 3TFKD 2DLFH 1DBMH 4F7CA 3VD4A 2VLJB 2GSGA 2CIKB 4X9HA 2IBBA 3TV3H 3FO2A 4MS8D 2IJ0C 5JW4Q 1P7KA 4F15B 1BQHA 1HE7A 5KVEH 2J88L 5D70L 4MA1B 2XZCH 3TT1L 3UTPE 2IEPA 5E8EB 5HDQL 2B1AH 1DUZB 1UXWB 4G6FB 3T1FA 4LRNH 3UCRA 3LRHA 4LOUC 4L5FL 4R2GD 5BS0B 2FX8H 3PP3K 3WLBB 3C6LA 1BOGB 1I85A 2X7LB 4LPVA 3DRQB 4UQ3B 3VXSB 1QO3A 3BUYA 2HWZH 4KHTH 5I1JH 2R2HB 2BNQD 3V79C 1QBLL 2BSRB 1A6ZA 3QRGL 1TVDA 4R97B 5D7LD 5FYKE 1DN2A 1J0KA 2XFXB 2GUOA 5TDOB 2A73B 4ZOCA 4W68A 15C8L 1KG0A 4L3ED 3BZ4B 3TZVD 5HY9A 4MDIB 3GKWH 4XNUL 1TJGH 3ZHKA 2K3TA 4P3CL 4B5EA 5ICZA 1KULA 4I5BA 4MWFA 4X5WA 1I1CA 2Q1EA 5H37H 5DJ0A 4FABL 1D5MA 2VLJD 4PJCA 1Q9OB 5F7EH 4HFWA 3C8DA 3STBA 3KPRA 1MHCB 4JDVA 2HJLB 3E2HB 3MQIA 3KPTA 4M7LL 4YPGA 1QBAA 4OTXH 1JNNH 4YHKH 4G6FD 4K7PH 1K8IA 5ESQA 3LEXA 4YFDB 5DVLA 4AEHH 4UIMB 5BS0D 4F9PC 2LTQC 1AXTL 1D9KB 1PKOA 4Z5RA 1XGQB 5AG8A 2IANE 1GCFA 3MV9E 3PV6A 3RQ3A 3ULUH 1RZIA 1J10A 1VENA 2E9BA 4HPOL 5FGCB 3EBAA 5DD5H 2GT9B 4P4RA 5LCVH 2VDPL 3MJ9H 2CPCA 3V6FB 1S78C 3HZMB 5L88L 3P0GB 4K8RC 3SCMC 3V0AC 2DLEA 1H3XA 3WJJA 5FO8A 4GRLB 1E4KC 5HVFB 3JTCA 3D6GA 4EUPA 1JHTA 5LAXB 1XIWC 1AHWC 2UUDK 2J8HA 3KXFE 4HCRH 4N5EC 3MV8D 4QTIH 4P9HC 3QG6B 3GMQB 1HHGA 1M05B 3SGDH 1Q9WA 2CIIB 3PJSB 5GRUH 3HE6B 3HC3H 2G2RA 1ZT1B 1Q9KA 1R3LB 3LEVH 2F74B 5F96L 2A6JA 1MCIA 3FT2A 2P7TA 3CH8A 5F89B 5GRYA 2QADC 1HZHL 4OLUL 4ZUTB 4AQOA 2HAZA 2VUOA 2E3VA 3U0TA 1NH6A 2Y6SC 1D9KD 5BMFH 4HXAH 5GXBB 1JNJA 4MHHI 1C08A 4KGJA 2Z31B 3P3YA 4IJ3C 5I30L 1TJHL 4JQIL 2XZQL 2EE2A 4OJFL 4ZTPH 2HRLA 1MLCB 2JELH 2D7TH 3G5VA 5ERWB 4HKBB 1YN7B 5E2TH 4BH7A 2ZJSL 1D6EA 4P49A 4EDWH 1MRDL 4G9FA 4TTDC 4NQED 3MUJA 1B3JA 4NQCE 3QUXC 1CGTA 1LDSA 3GMOA 4GRLD 4DTGL 4E9LA 4HGMA 3IVKA 4P5KA 1CZ8H 4WTXA 4QGTA 4TPRL 2CGRH 3O3EA 1FNGB 4U6TA 1I8KA 2BVUA 5GRVK 1YNKH 3TBVB 2HLFD 2XI9A 3P9LA 1A7QH 4CN4A 4LLVA 1EBPA 2QEJA 4EQ2A 1FIGL 3HMXA 4DEPC 2EE3A 3OXSB 4HJJH 2YD9A 3UTPD 3HE6D 2H3NB 3RHWF 5MEQB 5I1CH 3CNKA 2X9WA 2WUCL 5DJYA 2OTUA 2DTML 2AEQH 4K2UL 3AY4A 1T4KB 3QWQB 4OBRA 4HH9B 4LLQB 1IKNC 1TTUA 2FX7H 4WUUE 3MV9B 2C4FT 1OQXA 4MA7L 5DK2B 3SKMB 3KPMA 1OM3H 2Q8BH 3RY5A 3OKOB 3LS5H 1MAMH 2D3VA 4M8VA 2VITB 2Z31D 1PKQE 3BW9A 5FYKD 4HK0B 4OF5A 1JZ5A 3RL1B 4PIRF 1TZIA 3KWWA 1ES0A 3P9MA 5ANMA 4IRJB 1NMBL 5E94A 5CGTA 2R1XB 3NZHH 1OARL 4LBEA 1BLNB 4BKLB 2YMXL 4M1CC 1NANI 5BXFB 5E8DL 1CBVL 1OGAE 4UNVA 4OCMC 3D5OF 5IHZA 3GK8L 1QFWH 5DA0B 1DQDL 4TNVF 5IW1A 3V8OA 4YGVA 3D18A 3KJ4C 2X1OA 3L7EB 1F3JB 1FG2B 4HJGB 3C6LC 1I85C 3UYPA 1FGNL 3W9DA 4APQA 4CL7A 1QQDA 1I9JH 2J8UF 4J3TA 2X09A 2R23A 2IAND 2LQRA 3VXME 1AP2B 3LPWA 1YEEH 2CDFA 3MV9D 2G60H 2GFBA 3WN5A 2Q3ZA 1TQBC 5LGJA 3MNWB 3ZDXF 1JGEA 2ICEA 4Y7MA 1J88A 2YPKA 3QWOB 2CKBL 4KDVA 4YAQB 3CFJA 4S2SB 2ZSWB 5KSUB 2ENYA 4IRJD 4NQCB 4PGJA 3B83A 3KPQA 3U7YL 2DKUA 5IVXE 3PP4H 4AH2A 4MD0B 4K07A 3KXFD 4TULL 3OPZL 5DUML 4D0BA 3VD9A 2V5MA 3IFOB 4PJ8D 4D9QE 5EORL 1XF4A 2QKIB 4P2YA 4FXGA 5JR1H 1BJ1J 2VDOH 3BZFA 1R3IH 5TE6H 1CXFA 2DKSA 2FJHA 1F45A 1F58L 4HF5L 2NX5A 3G08A 4PG2A 3MA9H 4UT9L 2ZOKA 4DZBB 4RGOL 1R6VA 4BZ2L 2D7NA 3T2OA 4M61A 2YEZB 3N85L 3O2DL 4WUUB 2VXVH 3TA3B 2CUIA 2APTA 4CNIB 1WWCA 1S8DA 4WV1B 1OD9A 5HHNA 1U8JB 2R4SL 1WC7A 2Q87A 3JV4B 3JTSB 1CGVA 5FCUH 5IVXF 5C9KA 2XZAH 1VDGA 1FBIH 3WJJC 5C7XL 5JHLH 3G6JA 1XEDA 4UINL 4QF1A 2F54A 3MRPB 3KLDA 1OTSC 4GKZB 4QRRA 3GSOB 1R3HB 2EYTA 1OGAB 2R2CA 4MD4A 1A2YA 4JDTH 2GJZA 2X42A 3QUYA 2HLAA 4LNRB 1EIBA 1WAAA 3FB8B 3IDNA 4LARL 2JB5L 1ZHNB 1S7TB 4ONGL 3UZEA 1GAFH 2NLJA 4R0LB 4NHUA 5DK3A 5HI5D 2F5AL 3MXWL 3RL2B 4EDXA 5B3NA 2YUXA 5FUOH 4X4ME 3OR7A 1A0QH 3FKUS 4Q58C 4V1DE 1K85A 1GZPA 1XGTA 5C3LD 5D7JB 5C0DA 1UCBH 2UZIL 3TBWB 4QHNA 3ORJA 4XCEB 1IC7L 5ID1A 4XC1L 1O0VA 1EGJL 3VXMB 2E27L 4WUUD 5ENWA 1FNEB 4ZO6A 4DUXA 2X4NA 5J89A 1KTDA 4UBDC 1M7DB 1G9MH 2XWJB 1H5BB 1P7QB 4JVWA 3MUGA 4HXBL 2QHRH 4H26A 1N3NA 3N1GC 1B0RB 4JZJB 4CJ1A 3WO4C 5IVXB 5GGQL 4PJ7A 2V2TA 2W1NA 4PV9B 3T65B 3ZZ1A 1A9BA 4QEGA 4QHLB 1YNTA 4F7PB 4Z7VA 5GGSA 1N5YH 4S0SD 2R2EA 3MV7E 4R4BA 1G0YR 1DSFH 2JCCF 3S37H 4ELME 1PLGH 2YUWA 3DROA 5ADOL 4HKXB 4EIGB 3D0LA 4HS6B 5AEAA 4OD1H 5H35A 4RIRB 1JUFB 2ZUVA 4FOMA 1HXMA 2PXYA 5BZDB 1IZJA 1Y6NR 4O51B 3AY4C 3X14A 3KPSA 4ZDHA 1VFBA 4NN5B 5D7JD 3MA7A 1PQZB 2JB6B 3CZJA 1CIUA 2CJUL 1MY5A 1C16B 4MYWB 2BVEA 4NJAL 5EH1A 5A2FA 8FABA 3NN8B 1FNSH 3AC0A 3VXMD 4PJXE 3GIVA 3NIFF 1LP9E 4J8RA 1HHIB 3AXLA 3N9GH 4XXDA 3U46A 5DZOA 5FGSA 4MXQD 5EC1B 5T5FL 2D7MA 1U8IA 4KTDL 5C0IB 2DYPA 3GSXB 1P7QD 1UVQB 4KJYB 4HWBA 4I77L 3JWDH 4ELMF 1KJ2A 4HWEL 4D0CA 1INQB 3C5SB 3BP5B 1NFDE 1XF2A 3QCUL 3CU1A 1AGDA 2G5BB 4D9QD 4RAVB 5I1AA 5C1MB 5J3HC 1O7SA 2EO9A 3EOTH 3VDCA 5AAWA 4HJ0C 5CJBA 4LCWD 4N0CA 3F12A 4OM0L 4Y1AE 1I7RA 2YHGA 1RUAH 4V1DB 1S7SB 1DLFH 1RHHB 5IBTL 1AJ7H 1FYHB 3HPJA 4APQC 1CGWA 4PJXF 5FYJL 4N0YL 1JNHA 1LP9F 1E27B 1OGTA 3QJFA 5HYJA 3S35L 2PYFA 3T2PA 1NJ9A 3GNML 3WN5C 4W6YB 2D2OA 2VDKH 2JJUA 3AMLA 5JDSA 1R5IB 3PWUA 1IQDB 4RMRA 3H3KA 5F7KC 3VRLE 2BRQA 2CKBB 3LEYL 2FIKB 5DQJB 4ZAKB 3C9NA 3F7PC 1A7PH 5IMLA 2CDEA 3WFEL 1NFDF 1UC6A 5E4EB 2EKSB 3K46A 3MPCA 4M48L 4P46B 5DRXB 1F97A 4U1HB 2VERN 2EYSB 4J2XA 4GRWE 2BMKB 3A6CH 1A21A 3MV7B 5E2WL 5EOCJ 3TO2B 4ELMB 3ARTA 3KYKL 4Y16A 5EN2A 3BH8B 3LKOA 5FM5O 3BGFB 3BGMA 4LPUA 3QUKB 4LIQH 2B8OT 3O3DA 2I9LA 2V9RA 2VDNL 2K9UA 2F58L 4G43A 4XNXH 3QQ9C 2XPGA 4V1DD 2BSTA 1UT9A 4PG2C 5FYLH 5IF0A 2EEDA 1Y18B 4F33A 2R0WH 2NY3C 3A6BL 3HAEA 4Z76B 1LHZA 1JV5B 1WFNA 2H2PC 2HFEA 2UVFA 4LSVH 4EOWH 3FO1B 5JDJA 3CVHA 3VRLF 1P2CA 4CKVX 4PJXB 3KPLA 5BRZA 3LHPH 1QR4A 3M8OL 1LP9B 1Z3GH 1PX4A 1DE4A 5CMAB 5IMOA 1MI5E 1JYXA 4HMDA 3C6SB 2DQEH 1OL0A 4DWHA 4HKZB 2BVQA 4P46D 1ZHKA 4XVUD 1NFDB 1YQ2A 2GSIB 2FJFB 2V2WB 3QUYC 4OLZH 1NC2D 4MB4A 5IR1A 3CMOH 3MV7D 4IOFD 4ODSL 1MFEH 3UTQA 2APXA 3DUUB 1M4KA 1X44A 4Y1AB 3OZ9H 4YC2B 3VMNA 5HGBA 3RKDD 5DD1L 2HT3C 3QNZB 1FORL 1JNLH 2Z4QA 3L3DB 1UZ6F 1J0YA 4KHXL 5FOJA 4Y2DB 3BH9B 2O5XL 3MO1B 4I3SH 4S1QH 4BQ9A 5JXAL 1F5WA 5FGRA 1EEYB 5HHOE 2Y07H 5JW5A 2GYSA 3RDTA 3TJEH 1NGXB 3L5JA 1TTGA 2DIBA 4IHOB 1IARB 4WTWA 5IVZB 3MV01 5A1AA 4ACPA 3RIAK 4TOYH 1I1YA 1OAZH 5IB1B 4RGMB 4XX1G 3MRQA 3BD5A 3HG1A 5EUOE 3UYRL 3HS0B 2IC2A 4HX1B 5DMGC 3VE0A 5E2JA 5I71C 4M02A 4Y4KA 3QIWB 4GRWB 5T1DH 3LQAL 3HLAA 1FCCA 2VB5A 1SYSA 3V4PL 3T08A 4J6RH 3NCJL 3PWJA 1AGEA 1J18A 3BEWB 5D8JH 4M8QA 4RGND 1SYVB 2PXYC 4Y1AD 1KTLA 3KPNB 4XX1E 5FM8A 2HFGL 2AJXH 4BSVA 4ZPTB 3VXOB 4EXKA 4RISH 3KLHC 4P2CG 5TGBB 3K1KC 1FN4A 2DQCH 2YKLH 3KLAA 2WBJD 3BXNA 5IWLA 1OLZA 1SBBA 1Z0MA 4OQTA 2DQIL 5EZIH 5I16B 1KLGB 4HT1H 5EU6D 3NCCB 2J5LC 2VC2L 2AXJA 4OZHE 3LMJH 5D1XA 3R1GL 2PNDA 1GL4B 3G5XA 5F7LB 4ZD3H 1MI5B 2GCYB 3RI5F 3TCXA 5I1DB 5KSBE 4JHBA 1H3GA 2R1YB 2W0KA 2ZWLT 1FJ1B 3QUZC 2H41A 3MRGB 1RIHL 3IXAA 5SX4H 3QIWD 3GKZA 4U1SB 2Q8AL 2X44D 1XH3A 1I9RH 1LEGB 2DM4A 3UROR 3FB7B 4N0CC 4EBQL 1QPPA 1AFVL 4PJFF 3MRBA 2BC4A 4DVRL 4Z7WA 1SJHA 4DZ8B 2ZZUT 3SDDD 3ARBA 1NQBA 2Z92B 1IGFH 3JWOH 4PJIF 3UTSA 2EDYA 2NZIA 1FRGL 3QNXB 1CFVH 3P4MB 4KJQC 1QEWA 2FWOB 1RFDL 4PLOB 5HHOB 3OG6B 1KXTB 4LKCA 1PZUB 5DRWA 3SGEI 3HNSH 4FP8L 3VD7A 3QI9A 3RZCC 2V9QA 1ETZB 1BIIA 4CRPA 4IBLT 1DR9A 1KT2B 5F1SA 1LGVA 1SBSL 5KSBF 1B4RA 3EDDA 1D3CA 5JW3H 5EUOB 3TGXA 1CD1B 4NPYA 1MI5D 5HGGS 1D5BB 1DTUA 4RA3A 3W9EB 4WFHE 2AXFA 4GS7C 1ED3A 4KXZI 1DBJH 4WIQA 3DX7B 2IWGA 2OSLB 3HNTL 2AABH 4PJGA 3J7HA 3BE1H 1A6TB 1QVOA 3QEQD 4XNMB 3RJDA 3H9SE 4U2ZA 4JHZA 4MJ5A 4GOSA 4OGAC 5BW7C 1UGNA 2EE6A 1S3KL 5D72L 3VGAB 3OSKA 4S1RL 4L8CB 1DFBL 2BRRL 3CVIL 1BEYL 4YIQB 4KKLC 2NW3A 2HVJA 4NQDA 4X6CF 1JGVH 4GLRI 4QWWD 3OB0H 1SM3L 4M3JA 4OCLC 1JPGB 5LJYH 2CK0H 3LY6A 4U1MB 1YY8A 5HHOD 3MACH 4XNYH 4HUWA 4POUB 1IM3A 3P0VH 2PETA 4QHUA 3B9VA 1U8LA 1CI5A 4TRPL 3ZKXB 1CICA 1FNHA 3B43A 4OZHB 1ND0B 1T80A 1KB5L 1AD9B 4XHQA 2QQKL 3T4AB 1BD2A 1J0JA 4HEME 4TVPE 1NGQH 1N5AB 1N7ML 2VZTA 3EOAB 4YJZL 4MLSA 4XMLH 5KSBB 3GMNA 3PL6A 5IFJA 1B2WL 2AK1L 2XG4A 4MQ7A 1LD9B 3QO0B 3EYFB 4DKEH 3VFTB 2NY6C 2P46B 1NAML 1CGSH 2J6EH 3MJ9A 2P8LB 5F8RC 5J9PB 1CQYA 2E6QA 4YX2L 3PHOB 4X9GA 3CSYB 4D2NA 2Y1VA 3MMEA 4UIKH 3LIZL 1TQCC 1A6VH 1S9WB 3MFGB 2CRMA 2OM5A 4HCRA 4MCYB 3NA9H 2RBLA 2OI9B 3GSVB 3VFWB 4X4YA 1T3FB 2R0ZH 1WIUA 5HHMA 4FQXB 3L7FA 3T0EA 5E6IB 3L5HA 3W39B 2M1KA 2X6MA 3KDMB 1C5DB 1KF9B 4O2FB 5HHVL 4PRHA 1KELH 2FJGB 1TZGL 1FE8H 5I9QB 4QXGH 5IFAH 3TVMA 5ALBH 4YEEA 3WNLA 2NY1B 1UXSA 3O6FA 5C0EB 5KN5B 1YUHA 3IFPB 3SCMD 4L4TE 2NY5H 4U6VL 4AMKL 1H3PL 1ZS8B 3RKPA 1G9NC 5DGRA 2VJXA 4MJIA 1LO5B 4JFXB 3ARDB 1HHHA 1MVUA 2ZUQC 1XIWD 2YZ1A 1QLRA 3CU7A 5IT2L 4JHWL 1LMKA 4XNQA 3S7GA 5C86A 3QDAA 4NC1E 3RIFK 4XI5C 3BOVA 4Y4KC 5E9DE 1RZJH 4DKFH 2OZ4L 1IC4L 1T21B 4Y19A 1DBKH 4DFIA 5J56B 3QH3A 4AM0B 3H9SB 4Y8AA 1RK1A 5D5ME 2VH5H 4XTRD 2ICES 2DMCA 1L0QA 4IIQA 4PBWD 2AV1A 1YDPB 2YD6A 3HC4H 5EZJA 1VGKB 2X1XR 4LLDB 2R29H 4PJHE 5IK3B 4JPKL 3FO0L 3KYNB 3TWCH 2ADFH 1C7TA 2DWDB 4M9PA 4U2YA 3MRJA 4Z77B 3PDOA 5IMKA 3V4VL 1MCPH 1GOGA 1MJ7H 4IOIB 1NCBL 4U1IB 5IWLC 3FQNA 4Q6IA 4ZQKB 1DQQB 4XP6L 1IC5H 5D1XC 2IPKA 1NFIA 5F72S 3RWEB 4YHIA 1MQ8A 3T8XB 2NY1D 1K8DA 4PJCF 3E8UL 5TF1H 4TTDD 1A14L 1B88A 3QUXD 4EEEA 4ETQB 5JO5A 2VUYA 5I1GL 5IB2B 1G0XA 4NM4L 3DETC 3ROOB 4WFHD 5LQBL 4S1SL 4UT6L 4FMFA 4MNHB 4YHKL 2Z35B 4CW1A 1FFNA 3QDGA 1T66C 3EGSA 2FZ3B 4PJHF 1H3TA 4LHUA 4PTUA 3H9SD 1MUJA 5E08H 5FHBL 2G75A 4H88H 3SDXE 3B9AA 4GW4B 4K94C 3OAYH 2ARJB 3QDMA 4Q9RH 1CDGA 1T6WA 4WU7B 5CSBA 3ARBC 2P5WE 4F7EA 1C5BL 2VIRB 3GI9L 2DLIA 2BDNL 1NCDH 3SO3B 4ZO9A 2A77L 1LO4H 3UAJC 1K5NA 2BNUB 1CFSB 1YEDA 5HYSA 5JIPA 3QI9C 4ZPVB 5DUPL 5SX5H 4ODHL 2R0LH 4OB5L 3MLUH 3A67L 1U36A 3BHBB 3MREA 5FKPB 5L2KA 3WKMH 4ODXA 3QO1A 4TVPD 1AQDA 1LWRA 4NO0A 5ECJE 4K23H 5GJTH 1UWEL 1TITA 1PFCA 4M1CD 5IHUL 5E9DB 4JKLA 4YDVB 4JQXA 4WTZA 3FRPA 2RJMA 3SE8L 2NXZC 5D5MB 5KSVB 4L8SB 1H8OA 1VCAA 2ERJC 3Q1SL 3DWTA 4I8DA 4W4OA 4KZDL 1P4LB 3BKJL 1UKSA 4RFOH 3EO0B 4S0UC 3E3QE 3C6LD 1AIFA 1AE6L 4XBGB 2DBLL 4JPVH 4ZYKB 3H7LA 3RWIB 3SE3A 4WHTA 3BUTA 1YEIH 3TO4B 1ZEAL 3DUHA 4NIKB 4JCLA 1XGRA 1NCTA 4NWUH 1YJDL 5SWSE 4OCWL 4TYUA 3P73B 2BXZA 4U1JA 4LGRB 3E0GA 1BZ7A 1CICC 3SPVA 4AENB 3GSRB 1KB5B 1QYGL 5J0BA 1NC4B 3UZQA 4B0MM 1BBDH 2YC1A 5FUCE 1A7BA 4L4TD 1RK0B 5MEPA 3QEGL 3PQYA 1UA6H 3RWDA 4KVNL 3PL6C 4QOKA 4PJEE 3ULUC 5CP7A 3V0VA 2P24A 1NAMB 1ONQA 3T77B 3I6KA 3O4LA 2QQNL 5FK9B 5E9DD 1AXSB 2ZG3A 3EYVB 1MIMH 2ZCKL 4PFEA 4HULB 5DJ6B 5HVGB 4OF7A 4X98B 1QLEL 2R4RL 4QO1A 3MUZ1 1F90H 1JZ8A 3U0WH 4DUWA 3SDXB 4HG4J 3DBXB 2VLRE 4M4PA 4WHDA 4EI5A 4ZXBA 5I8OL 1JWSA 4C4KT 2OXGA 1K4CB 2UVEA 3FT3B 4KAQH 1W72L 2P5WB 3FQTA 1JPTL 3GBNL 3GO1L 4X83A 3NABL 4ZUSB 3QYCA 3T0EC 5I1KH 1T1YA 2DJSA 4HBCH 4BH8B 1RI8A 5IMMA 3V5HB 1A4KB 4O58H 1RURL 1S9XA 5H2BB 4PRPA 3TVMC 4NGHH 2E8YA 3O6FC 4OT1H 4N68A 1YPZA 2GITB 2IG2H 1AO7A 4DGYL 5HVHB 2FGZA 3N1QC 4PJEF 5CSGA 1FDLL 3MOBH 5IESH 3OXRB 1ZLWH 4ODVH 1FFOA 5FDYA 4M5ZH 4M00A 5J11B 4U33A 5INDA 5IEKA 1H8SA 1KPUB 1S7WB 4OI7A 2C3GA 2DMKA 3CPLB 4JG1L 4ZFOA 2RFXB 4WEMB 2J8OA 4NFBA 4OFDA 4H20L 1SVCP 1JF1A 1O5DT 3U2SA 4JM2A 4QRQB 4IIQC 3S36X 1GZQB 1WSST 4YUEL 3VFSB 5FYKH 1HOCB 2D31A 4N0RA 43C9B 1VERA 1NLBH 3EO1B 1RJLA 2P5WD 1IGIL 4GXVL 2BY3A 2UZYB 2OK0L 5ETUA 2CUMA 4CMHC 4I13B 4JR9L 5DLMH 5SWSB 1KCVL 5FYKU 4Q6IC 4UBDD 5K9JL 3DTXB 1RZKL 4OFYD 1I9IH 2PYEA 5F9OL 1MCBA 4HD9A 3WBDA 2JK5A 4N1HB 1OAKH 3DX9A 1X3DA 4I3RH 5T3XL 1A1OA 3QHZH 5HI4D 1U93B 1ADQA 4PJEB 5H94A 2YSSA 3MRKA 4GSDL 5TQ2L 1JGDB 2QSCL 4LK4A 1K4DA 3UTZB 4LCYA 3PGDA 2OQJA 4NC0B 5E2VH 3QQNA 5L8LB 3S88H 3IDYC 3PWLA 1LDPL 4KXZH 4MA8L 5C6TL 5EU7C 1CDHA 1IBGH 3DLQR 3L3KA 3RWJA 3IETA 4Q6YA 2VLRB 1EZVY 5DGQA 4I0PA 2H1PH 4F37F 2X40A 4HDIB 4RZCB 4TUJB 4OLYH 3FHQA 5ACMA 2EH7H 4C83A 1Y0LA 4HIHB 2VISA 1J8HE 5MEOA 1GYAA 2O5ZL 3LZFH 1AR1C 4NN7B 3VDAA 4ZTOH 4OIIH 3Q6GL 3G6JF 4FZEL 4AL8H 2XNAA 1HNGA 5SWSD 1RU9H 4K71B 2H8PB 1G1YA 3SE9L 2AJUL 3HC0B 3BJLA 1FVCA 2XA3A 5D70H 5T1LB 3TT1H 4V3DB 4LFHD 4FQPA 5HDQH 5IG7A 3VFOA 1U42A 2WINA 2FGWL 5F6HI 5C0NC 2P8PB 1V8HA 5B38A 4MXWH 3SO5A 3D69A 3OG4B 5KSAA 4J7RA 5C0AE 3CUPB 3NAAL 4JQXC 1OAQL 2V6HA 1H3VA 1CF8L 1G9EA 2ITCB 3VFNB 1KFAL 5ICXB 5I17A 3WIIL 1XMWA 3WFBL 1AD0B 5DI8A 4W4OC 3NH7L 5TDNA 3E6HB 2R0KL 1BOYA 5E70A 1KIQB 5BVJB 3WDIA 3RFZC 2X4OB 2IPUK 2GTZA 4DVBA 2VLRD 5AUMB 4JFOA 2WSKA 4O2EB 4UV4L 2YXMA 5GGUB 1ZHBA 3CDGB 4MQXC 1X5YA 4XNUH 1CE1L 2VMFA 4P3CH 1OSZB 1FGVL 4PJ7F 3ZHLA 5L2JA 2E7LE 3O6ML 4JFFE 5GS0L 3RGVA 3GFUA 2P45B 2Q6WA 5D2NE 1MF2H 3TN0A 4KQ3H 4FQJL 2BVPB 3GM0A 4DFHA 3L1OL 5T1LD 1KJMB 3EFFA 4M7LH 5T3XE 1OP3K 5JPMB 5DYOB 3H7BB 1DCLA 4L3CA 3X13A 5INCA 3OAUL 3ZE1F 4QRPA 5L9DL 2NR6C 2X1QA 2X70B 2ESVB 5DTFB 1B9ZA 4ZNCD 1RZ8A 2ED9A 4FA8A 3EJZC 3OR6A 5DHYB 4XCFL 2C26A 4WW2A 3B5TA 3FB5A 1NKOA 4EI5C 4ZXBC 1FZMB 5SV4A 4GKNA 4EN3A 1W72B 4JFDA 3B2UC 4DW2L 5K59F 2X4RA 2NY3D 1OF2B 5DRZB 2VRAA 1CR9H 1UZ8A 1ZV5A 4WGVB 3U30C 3BPCA 4F2MB 1G7HA 2Q76B 5D93C 4XPBH 4MMZC 43CAB 2YBRA 2X4PB 3QQ3B 5BVPL 4JGUA 4D9RE 3LH2L 4PGBB 2CR6A 3QEUB 3KGRA 1DL7L 2XKNA 5ESAB 4HK3J 5F96H 5DEGA 2GJ6E 4QRRD 5EIIB 2OMNA 3WNPA 4P59H 1RIVH 1ZHLA 1FL3A 5C0AB 3NCEB 4K3DL 5EZLB 1GOHA 2FL5B 3QUYD 2ZP0T 3GB7B 2Y5TA 4PLJC 1FFPB 2DTSA 5E56A 1ZWIB 4P3DA 4N8PA 4WI5A 4D0DB 4JM2C 3MGAA 1CLZL 1G6VK 3T09A 1G1CA 5I30H 2XY2A 4WW1A 3M1BA 2XZQH 4OJFH 3VFMA 1CLOH 3W2DH 3VFRA 4H8WH 1QFPA 2AXGA 3U48A 1JPFA 1V7ML 3BYYA 1J8HD 3D0VA 3LDBC 4QCIB 3QHFL 1CFQA 2C3VA 3P4NA 5T5NF 3FQRA 1C8PA 4I1NB 3DRTB 1LE9B 4FQ2L 3PUCA 3B2VH 1DN0A 1P4BL 5C8JA 3C87A 3CFEB 4JFFB 5DRNA 1JPSL 1WEJL 1JYVA 5D2NB 3D85B 3FOLB 1LNUB 1DQJB 4UU9B 3U9UA 1OSPL 1FO0L 1KBGL 3GMRA 4R8WL 3OWEA 2X4TA 5AD0A 5C0RL 3GJEA 2WUCH 2X9YA 5C0GB 4FQQA 4TNWF 3LS4H 2DTMH 3VXNA 3DV4B 1VACB 5DO2D 5C0AD 2Y7QB 3VW3H 2NY4C 4OI8A 4OAWA 4LSDA 4G42A 3HZKA 1BECA 5DMIL 3EYSH 3MLVL 3MRMA 5D2LE 4KQ4L 2D9CA 3CFIC 2AJSH 3FN0L 1CVSC 2F9BT 2OLDA 3QAZB 4YHLL 4XWOC 4L1DA 4I0PC 2ATPA 1NBQA 3JWDC 3HRZA 4HZLB 5KS9B 1BP3B 3T0BA 4QT5B 5DHVB 1F3DJ 3QEHB 3EYOA 4UDUB 1V3MA 1INDH 1N6VA 1WFOA 3IFLL 1NSNL 4MNGA 3DPBA 4WI4A 4P2OB 4RAUA 2E7CA 3K8KA 1U9KA 1OT2A 4LCCB 1Z5LA 5IHLB 1NCUA 3TNNA 3DX6B 3GBMH 2AGJL 5E8DH 3L9RA 4OZFG 2QR0B 4JFFD 2I9TA 1Z9LA 3GK8H 1XCQB 1CD0A 4NKIL 5HPMB 3D85D 1JVKA 4LMQE 1A7RL 1QNZL 4XCYB 4RMVA 2GJ6B 1XR9A 5DS8B 1D5XA 5T3XD 5KSAC 5DMJB 1IAKA 4LDEB 2MSPA 3INUL 3QUZD 4OZ4B 4GKSA 5IQ9A 5C09E 5D2LF 1FGNH 5GIRB 3V5DB 1TNMA 1MCSA 5CD5D 1HH9B 3ZTNL 2WIIA 3VA6A 5A2JH 1DQLH 5M7QA 1SJEB 1WFTA 1ZT4A 3G6DH 4I48B 4X5XA 2VQTA 3RNKA 3IAPA 5F7YC 3VFVB 2AEWA 4NFCA 4ZODA 4ZFFB 4PP1D 4E41E 5AYQA 2CKBH 5BQ7B 4HGKC 4MJ2A 3WLWC 4NQXB 3U7YH 1WBYB 4ODUA 4LSRH 3C60B 4H5SB 1PJ9A 1YNLL 5T3ZE 3RZCD 3W5MA 4P2OD 3DURB 2DQGL 2J2ZA 5EBLA 1L7TH 3EOBB 5MENE 1LE5A 5DUMH 1OCWH 3L3HA 2VXUL 3RGVC 1QKZL 4D9RD 3TN0C 1LEIA 2EYRA 2UV3A 1E4XH 4LLYB 3MRHB 3DVGA 3L5XL 5JLZB 3CSBA 3IXTA 2GJ6D 2O61A 5FEBA 4ORGA 4MAYA 1JK8A 1WCQA 4ELKA 4BZ2H 4NQTA 4OGAD 1T7VA 3OKKA 2ORBL 3N85H 1JWUB 5CAYB 4G6JL 1F4XL 5J06A 1ZANH 3QQ4B 5D2LB 4F57L 3KNBA 4WW2C 3QPXL 5ILTL 4KKLD 2R4SH 4OZGE 1QHOA 4EJ1C 1GIGH 4EN3C 1T2JA 3VWJA 1FFQA 4P5TA 3BD4A 4R90L 2IFGA 3AB0C 1JTPA 4WUKH 2PR4H 5C7XH 2NY0B 3PG2A 1NCWH 3MXVH 2BHZA 2J6EA 2QV2A 2R9HD 1P84K 1BHGA 2YK1L 3IDXH 4FZ8L 1A3RL 4HC1L 1F6AB 5E5MB 1WBXB 5IKCA 5IQ7H 2Z0BA 3HI6H 2VSCA 5E1AB 1ZT7A 1QSEA 3P4OB 1DUYA 1HCFX 4JB9H 3OGCA 2W91A 1G7IA 4PRAB 1S7VA 4LARH 5I1HH 5DJZB 1FL5B 3S8WA 4ONGH 3H0TB 2VLKE 2DAVA 1SEQL 3OAYK 1GJIA 3WE6A 3HPLB 3MXWH 4TSCH 3EO9L 3G5YA 1BIHA 3FHAA 3V5KA 3DUSB 1Q72L 4LLMA 2NY6D 5C09B 2DDQH 2B5IC 4Z7WF 4UUJB 5F7MC 4OZGF 1IC7H 2F15A 4MJ4A 3VXQB 4NM8L 3TJHA 1HQ4B 3S3JA 4A6YH 4OQ1A 3OGOE 1EGJH 2FB4H 1FZJB 1HN1A 4NKOA 5HYIA 1VPOH 2E27H 4PP2A 2FD6L 4KTEH 1NGYB 5C0JB 3MLPA 3T4YB 2GY5A 5E4IA 4OZFB 5EBMA 5E99H 1CL7L 1EO8L 2DWEA 4NZRH 1BVLA 5GJSH 2EC9U 4E41B 2OL3L 4K8RL 3I50L 3LCYA 2NY7L 3IF1B 1TVBB 1UWGH 4HIEB 2C1PA 2IMMA 2NY0D 3W0WA 2A83B 2QQLL 4OF8A 5BJTB 2W0FB 5C0CB 3FFCA 3DO7B 3O3UN 2EXWD 1R0AH 5DUBB 4YHZH 5DK0A 1PY9A 4YLQT 3S34L 1DEEA 5ISZE 1Q9LB 4HAGA 5EO9B 3DV6A 5ADOH 1FO0B 1LO2L 2DI7A 3RA7L 5J6HB 2H2SC 4JREC 4GAYA 1KEGH 3F7VA 3TFKA 5DJAB 4AT6B 4M6NL 4OSUL 4U0QB 3SDAC 1BFOA 2CLVA 2VXSH 3WD5H 1RZ7L 3IDMB 4MS8A 2ICCA 4QYOB 1MJ8L 1QSFE 4JN2B 4K7PX 1WBZB 1OD7A 3GJFB 4OGYL 5EZOH 3IRZA 1B0GB 4NJAH 3CFBA 5L8KB 3H2WA 3DVNB 1YQVL 4OZGB 5CUSL 2GY7B 3JXAA 5A16B 5HGHA 3LPFA 1ZOXA 1MIEL 2WM0A 2H26B 3BAEH 3IDUA 1A6AA 1BJ1H 1X4YA 5T5FH 4HUUB 1MWAA 2RB8A 1MFCL 4E41D 1MCJA 4ZS7H 1INEH 3KYOA 4KMTL 5HJ3B 3X3FL 5F9JB 2YN5A 1C1EH 2W65A 4NSKB 1EH9A 1SY6H 1HILB 3LKNB 2P44B 3B9KB 3QUML 3QR2A 4O02L 5JUEL 5T3ZD 2BNQA 3BDXA 3O11A 1IQWL 1GGBH 5D7LA 5JORA 4P23B 3CX5K 5MEND 1EHLL 5MERA 5F7DB 5ADPL 3HNVL 2HRPH 2VLKB 5I15L 4LPXA 4L3EA 3TZVA 1F4YH 1MCOL 1J0ZA 3QXAA 5CBEA 1IAOA 1I8IB 4KKAC 3VJ6B 3H8NA 1BBJB 1CK0L 3TBTA 3WHE1 4K3HA 3OKEA 4Q9BA 2VLJA 2CIKA 3EDJA 3CSGA 4XP5L 3S35H 2O26U 3O2VL 4RDQG 3U9PL 4Z8FL 2BJMH 1GGUA 2FSEA 5IROC 5E8EA 1DUZA 3GI8H 1GC1C 1UXWA 1YEKH 5CIPB 2IGFL 4JY4B 3CLFL 4AEIL 5BS0A 5FYJU 1ZLWK 3LEYH 2J7LA 3WLBA 1BOGA 5JQ6H 2X7LA 1ORQB 1VFMA 3V6OA 1Z6JT 2HJKB 3QI9D 3DRQA 4F7MB 2DIAA 4KRPB 3T2QA 4M48H 4UQ3A 4P57A 4GW1B 2MKLC 5IP4A 1H9VA 1VFUA 2R2HA 3JV6B 3MROB 3FCTB 3MLZL 5BZWB 2V5SA 5ISZB 1PYWB 2P4AB 4P23D 4M3KB 4X0KA 5F8QC 1WWAX 1LEKA 4ONFL 3N1FC 4NJ9L 2BCKB 2XFXA 2D0HA 5TDOA 2VLKD 3ULSB 4KUCF 2A73A 2ZOLB 1GHFL 1I3GL 3CDYA 5IB4B 2F58H 1JRHL 2CXKA 2HVKB 1G7QB 2WP3T 3BZ4A 4MDIA 4HS8L 4I18B 5D1QB 2HT4D 5DSCA 4OZIE 3V8CA 4YHPB 4MAYC 2FH8A 1N64L 4ZSOE 1E6OL 1QSFB 2NXZD 3A6BH 5CSZB 5EUKB 5IW3A 1LILA 3SN6N 4Z9KB 3UX9B 3GSNL 3R0NA 1Q9OA 1WLHA 1O7VA 1MHCA 2VAAB 3E2HA 1EJOL 4OKVA 2OR9L 5FM5M 1MFNA 3VWJC 4P5TC 4ZUVB 3NZ8B 3V4UH 3VRIB 3DECA 1YMHB 1VESA 4UIMA 5D6CB 4YDLC 1HQRA 4AG4H 3K80A 4HIXL 3FB6B 1D9KA 4P9HH 4IMLA 1F4WH 4RDQF 5FKAB 4XPGL 4MNQE 2Z8RA 3NIGE 4YK4C 1JGLL 2LVCA 3GHEH 4LVOB 5IEHB 3WIHH 1TENA 4MZ2A 1MNUH 3IRPX 3P40A 3TBYB 5ISZD 5J6GB 3V6FA 4KK5C 3HZMA 4OIBA 3WIFB 4U6XA 5C0FB 1U8PB 4J3SA 2P8MB 3HUJE 4NQEA 1RVFL 5I1EH 4GRLA 4KV5E 4OCRL 2BVOB 5C08E 4BZYA 4AIXA 4GAJL 1J05B 3ELAT 5BOPA 5DD1H 5LAXA 4MQSB 1KN4H 5D1QD 3QIBB 4RX4D 4GT7A 2O5XH 3GMQA 3TJHC 1Z9MA 1QSFD 2VE6B 4BK4A 5JXAH 4RMQA 3TYGL 1WV7T 2CIIA 3PJSA 4HHAA 3ARGB 3HE6A 2F74A 4D94A 5J4MA 4PTTB 4HZAA 1ZA6B 2OL3B 4PGCB 5MP6H 5F89A 4PP8C 5IFHH 3NIGF 4WO4B 4LQFH 3MLYH 5F9DC 5HYEA 2WLZA 4NHCL 1A8JH 4RWYL 5ICYB 1ZTXL 4HLZG 4JKPH 4J1UB 1U95B 4UI2A 5KOMC 3ZDZE 4K3JL 3RWCB 3O6FD 4MAUH 3NTCL 5B3JE 3HUJF 4NCDA 2FX9L 1L7IH 1VFOA 2MKWA 2Z31A 5T1KB 4KV5F 3VG9C 1Q94B 2B4CC 2EDXA 1RMFL 3MLTB 3C5JB 3NCJH 1MLCA 3GEWB 4QRSB 4Z0XB 5ERWA 4L29B 4HKBA 4QXUH 3WSQH 4PJ9B 4OLWL 2H32B 3HB3D 3C5ZC 1ZGLM 2IQ9H 3TFKC 2W9DH 2EDLA 1C12A 4S11A 4OZIB 2BSSA 4LSPL 2V7NB 2CH8A 3I9GL 4MS8C 3N0PB 4Z78B 1FNGA 1CLYH 4KUCD 5CZVL 2ZCHL 4M5YL 3B9DA 5CD3B 2E5EA 1OHQA 3ZYOA 3TBVA 3JVGA 4XP1H 4XMPL 4G8GE 4M7JL 4ZOBA 4G6KH 2DQIH 3OXSA 1FSKC 4R2GC 1I7TB 2GW5A 2H3NA 2VC2H 5MEQA 3TYFB 5EOCH 4G80B 3SJVE 2GTWB 4KUZH 4L9DA 3ZDZF 3CMGA 1U8QB 4TVPH 2UWEE 2H45A 5B3JF 3WXWL 4HH9A 3SKUD 4M6OH 3QUMB 4LLQA 2DLHA 2IANA 4TNVK 4MNQB 4RQQA 5I6XC 3MV9A 4U7MA 4M1GH 5DK2A 1U8KB 3SKMA 1RIHH 3P11L 5A40E 3OKOA 1QFUL 1AKJB 2VITA 1XF1A 2HTLD 1VSCA 4DEPB 1CFTB 5F88B 4HK0A 4WRLA 1RZGB 2DLGA 3RL1A 3Q0HA 2MQCA 3O6LH 4NNPL 4U1LB 3TZVC 2CRZA 3HUJB 4IRJA 5T1MA 1BM3L 3CXDH 2YD3A 4PJ9D 5C08B 4X8JB 1BAFL 2R1XA 2AAVA 1IKFL 1KENL 1MCEA 1G7MA 4R26L 3KXFA 4B50A 5B39G 5CJ8A 1BLNA 3P0YL 3CFCH 4S1DD 4BKLA 5MHSD 3WFDL 4PJ8A 1FRGH 4W4NA 1RFDH 5ID0B 5CEYA 4F15C 3MGOA 4N0FB 4MA1C 3VGDA 2HN7B 1LO3H 5B4MD 2UWEF 5FO7A 4JY6B 3ECBB 2IMNA 3L7EA 1FG2A 2FCBA 1YPZF 4HJGA 4AK1A 1HSAB 2DBJA 5J13C 3V6OC 2K1MA 2EICA 2XG5A 4XP4L 5HHPB 1QLFB 1B90A 5JW4M 5C9JA 5KG9B 2D9QB 3EKCA 5AYUL 4C58B 5TF0A 3AFLA 4HWNA 1AP2A 3PE9A 4M93B 1Q0YH 5DR5H 4X80L 3EDEA 4R97C 3GMPB 3MNWA 1I75A 4UTBH 5JA8B 2YA0A 3RWHA 2YPVH 5FHAL 3QWOA 5D72H 4DQOL 2N4IA 5I1IH 4JM2F 2DB8A 2ZSWA 2B20A 3CVIH 1UWXH 3S37X 4NQCA 4YDIH 5L6YL 4HPYL 2RQ8A 2A1WL 1JYNA 5C08D 3NPZB 3UPRB 3DX8B 5ALCL 2ADGB 4MD0A 1SM3H 5GS1B 4JAMB 3GSNB 3BUYB 1TIUA 3IFOA 4LVNC 2WWKT 2QKIA 5TH2B 3TEUA 4G8GB 1KNOB 1FNLA 3E2HC 3ULVC 3OJDB 1X5LA 5HVWA 3SJVB 3NMEA 1KB5H 3BIAX 4Z6AT 4EUPH 5FDWB 2DLTA 3S36L 1N7MH 1D9KC 5GRVL 5I8EA 1XR8B 1IGJB 1PSKL 4X6DE 1S7RA 1RUKH 1CU4L 4WUUA 3TA3A 4CNIA 2XQBH 4WV1A 7FABL 1KCUL 1U8JA 1EAPB 4PS4L 1S7UB 1X5AA 3JV4A 3JTSA 1PKQA 3DIFB 3PQYD 1KXVC 1OAUL 4M4RA 3RBSA 4GRLC 5JPNB 5E1HB 4YHYC 3MRPA 2NR6D 5GSRB 2P49B 4GKZA 5JTWA 1TETH 3KAAA 4WWKB 3O0RH 4Y5VB 4PRIE 3GSOA 4OCYH 1EBAA 1OQOA 2HLFC 3PV6B 4NOBA 1HEZB 3BN9D 5C3TA 5E95B 1OGAA 1RZIB 4LNRA 4GH7B 1MQKH 3FB8A 4U4BA 3HE6C 1ZHNA 1S7TA 3MLXL 1AI1L 4WFEE 1I3VA 3L3JA 4G8GD 4R0LA 3QULB 3RL2A 4JRWA 3B2UD 1J1PL 4U6VH 4AMKH 5EPMB 5BV7L 1H3PH 1K9TA 3CFKB 2R2BB 5D7JA 3TBWA 5IT2H 5KW9H 4XCEA 5DT1L 4MHHG 5B39B 3BMVA 2X4UA 1NCAL 5DFVC 3VXMA 2GK0B 1GRWA 2Z31C 4P2RE 1KOAA 4C57C 1NEZG 4MXQA 2ZUTA 2VR5A 1Q9KB 1M7DA 4HIJA 1A7NL 3RX7A 3NPSB 4JO2H 2XWJA 1H5BA 1P7QA 3S6CA 3IAQA 2DICA 1FG9C 2MCG1 3UTTE 2EIEA 3LN4B 4OD2B 4YHNB 3FO0H 1X5KA 5IVXA 4Q9CA 4W6XB 3AREB 1HSBB 1MVFA 4PV9A 3T65A 4PLJD 3U0TB 3DI3B 3H3PL 4X4XB 4WWKD 4QHLA 1MJUL 4MLIA 4F7PA 2AS5M 4B53A 3JVGC 3SOBL 1U3JA 2DQHL 4HKXA 4LMQI 1JF5A 4XAWL 3K4DA 4PB9H 1KJ3H 4XWGH 3BPOB 4RIRA 5CLTA 1FPTH 5BZDA 3E8UH 2ZNXA 4G9FB 4O51A 1QR1B 1P1ZA 1CXKA 4LSQL 4LVHB 4X6DB 5IOPB 5I1GH 1YECL 4LU5H 1PQZA 2JB6A 3GSQA 4FQHB 2OBGA 3HHRB 3O3EB 1C16A 4XC3L 4QHKI 1HIML 3RWGB 3NN8A 4UT6H 5DWUL 4POZD 2VZSA 2YZ8A 1OAXL 4OF6A 1HHIA 1KPRA 2F5BL 5TE4L 5EC1A 1OPGH 2FBOJ 2EDRA 4IRJC 1UACL 5C0IA 3GSXA 1BZQK 2P5EE 1ZGLB 5ELIA 4R9HA 4XPHH 4ONHB 3P30L 1HWGB 4NN6B 3N06B 1U8NB 1C5BH 3QHTC 4PRIB 3VFUB 5KAQF 3NACL 2XXMB 3ARED 4O5LH 3PWPE 2BDNH 1RULL 4NC2B 3BP5A 3GSUB 1VKXB 2A77H 2EDBA 4Y89A 1HXYB 1K2DB 2G5BA 4RAVA 2PO6B 3L95B 4I0PD 2JLLA 4ETYA 1LO0L 5KJRH 3KS0J 1ACYL 4X4MA 1ES0B 4O2CA 4V1DA 1IAIH 1S7SA 3A67H 4E5XB 1RHHA 3IJYB 1IGML 1U8MB 4LAJH 4LBEB 4JM4L 4YWGL 1KJ2L 1UWEH 3ILPA 2OTPA 1E27A 2AI0H 3GRWL 3TM6A 1R3KB 1MSPA 4P2RB 3RVUD 1S9YB 1FHGA 4RBPH 1IQDA 2Y36L 4YGVB 3Q1SH 3ROLB 2CKBA 3BKJH 5DQJA 3ZT5A 3D1MC 3RVTD 5K9KB 3QRFM 4M7LT 3FONB 5EDXA 3UTTB 3W9DB 4LPTA 1BX2B 2EKSA 3GM8A 4MSWB 3VH8G 4P46A 2B0SL 3W5NA 2EDQA 5DRXA 2R23B 1ZEAH 1MFAL 1IM9B 3QXDB 1NC2A 4PRID 3MRRB 4U1HA 2EYSA 4FQLH 3RU8L 2BMKA 2WWMD 3SY0B 1NDMB 3MV7A 1OLLA 3TO2A 4ELMA 1J9CT 1P6FA 3BH8A 4OCWH 5HI5C 1CG9B 1MPAL 4CU6A 5LGJB 3WV0A 2PO6D 4RMSA 1NEZB 4QXTB 1CXLA 1JGEB 4GFTB 1NBZB 1QYGH 2VXTL 3RZWA 1ZLSL 5FO9A 3DXAE 1I3RB 3RVXC 1J1OH 1Y18A 3KPQB 3QEGH 4FNLL 1EHAA 1ODAA 4Z76A 4JPWL 1JV5A 3UDWA 4IM8A 4XVSL 3TA3C 3FO1A 5IJKC 3MR9B 2BERA 3GMLB 1AY1L 1MFDH 2I5YL 1KEML 4WV1C 5EA0L 4FXGB 4PJXA 3D9AL 1JFQH 2PTTB 2EC8A 1LP9A 2B2XL 4P2RD 1ZLVH 2R4RH 5CMAA 1F13A 3LN9A 4POYA 3UP1A 1XGYL 1TMCB 2P5EB 2Y06H 3EDKA 4JCMA 4M43L 5I8OH 1N2RA 5GISH 5JW4N 5GHWL 4I4WB 3UTTD 2SEBA 2HFFB 4Z0BH 3C6SA 2FNBA 1DQML 1JHLH 3GBNH 3O9WB 4M61B 3BWAB 4HKZA 1T03H 4NBXB 3O4OB 3UO1L 1NFDA 2GSIA 4KGLA 2FJFA 2V2WA 5MI0B 5GRXG 4ZO8A 4EN3D 4R0LC 2OP4H 4MDJB 2BOBB 4Y1AA 4HIIB 4NZUL 4JFEE 5BV7B 1DBBL 4JG0H 1RIUL 4DGYH 4IRZL 4UZGA 1HYSC 1KCKA 5D7JC 2RCSL 2F54B 3LSOB 3L3DA 4IOSD 1YMME 3V6ZB 3OKLB 3MO1A 1EGJA 2WBJA 4N0UE 4LLAA 4AJ0A 2V2XB 2GJZB 4IHOA 4WDIB 5IVZA 1FAKT 4XMKL 4MXQC 3LN5A 5HDBE 4NHUB 4CBPA 4H8WC 4JRYE 4NKDB 1H5BC 3OHXB 2IH3A 1OWRM 3KR3L 2X1PA 4YUEH 1XGTB 3HS0A 5C0DB 2NY2B 4HX1A 5F3HA 4K7FB 1WZ1L 3F8UB 3QWRD 1JMXA 3VI4F 3OX8B 1C5CL 3K2UL 4KY1L 1C7SA 4OGXL 4YDKL 3QIWA 3O9WD 2OK0H 3PWPD 4JR9H 4R7NB 4Z7QE 4RAHA 5CINL 2QTEA 3S9DB 4JDZB 5K9JH 3BEWA 4PUBL 4YE4L 3DSFL 2DM3A 1SYVA 2VL4A 3GHBL 2XN9E 5F9OH 2A6DB 1S7QB 2W0LA 4H26B 3KPNA 1N3NB 4HWBH 4XPAL 4U6YB 3IDIB 2B1HL 4NN5C 4ZPTA 3VXOA 3FTGB 2V2TB 3LD8B 1UJ3B 1R5VA 1EPFA 1T2QL 3BZDA 3VH8B 4GG8B 5TGBA 4Z7VB 5D1ZB 1IAMA 5EG6C 4CUCA 1E6JL 2DQUH 1HINL 1CL7I 2AQ3A 3UC0L 2EXYD 4DGVH 5I16A 3D0LB 4P4KB 3JV5A 4BJLA 2H2SD 2A9NL 4MA8H 5C6TH 5ITBL 5EU3B 2AJYH 1MI5A 3X17A 2G9HB 2GCYA 3SDAD 5ITFB 3X14B 1F00I 1V3LA 5I1DA 5DXWA 2NY2D 1NBVL 3MA7B 4YHOH 2R1YA 1NUGA