3ROLA

Murine class i major histocompatibility complex h-2kb in complex with post-translationally modified lcmv-derived gp34-41 peptide, comprising a nitrotyrosine at position 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
271
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 75
structure length 271
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rolA01
5EOCL 2XOTA 4M7ZB 3CPLA 1X4XA 1XF2A 1NAMA 4QXWA 2FX9H 5D2NA 5FO9B 3ZE2F 3QUYC 1QVOB 3D2UA 2D4FA 3OJMB 4FFEX 1T5XB 4UNUA 3V4PH 5TDNA 2QSCL 1SY6L 3SQOL 2XN9D 3T0EA 1YUHA 1DVFC 3TNMB 4PJDE 2B0SH 3DIFA 3MUGA 3BP5A 4ZMAT 5TPWL 1KGCE 4K07A 3GO1L 1R24B 2W60A 4PGZA 2A6DA 4Z7WF 4KKBC 1T66D 3HN3A 1UT9A 3AU1A 4QTIL 4OLZH 1KOAA 4JJHA 1NDGB 3V5HA 1GGBH 1MFEH 3MACL 4ZUVB 2DMCA 5FO8B 4LDLB 3SCMB 4HIIA 2G9HA 1V3MA 4JY6A 5CKAA 4HEPG 4M1GH 5HHNB 4JM2A 4CW1B 3MODH 2R23A 5IUSA 4B53A 4J3VA 1QNZH 2VR9A 1P84K 2VTFA 3FO1A 3RWEB 4ZOCA 2WWMC 2V6HA 4TSAL 1WK0A 4L29B 4RMVA 4X9IA 3V4UL 2PW1A 4JQXA 2Q86A 2KZ1B 4WRLA 1RV6X 1YMHA 2HFGH 3HAEH 5BOPA 3PWNA 1WC7B 3QIBA 1K6QL 2QBWA 4TULL 4RMUA 3O3UN 3O0RH 3QJFA 4HUWB 3E2HC 4LPWA 5JMOC 4WDIA 3U0WH 3MRCB 4NM4H 3VG0H 2CJUH 3K2UL 4ZDHB 3C5ZB 1IAII 1KJ2L 3BN9D 5FDWB 4WWKC 1RK1A 1VKXA 3UO1L 2JJSC 4HUKB 3T77A 1I8KB 5E4EB 4JGJA 3O8XC 4WI6A 3V8OA 5BW7C 4R97B 2QQNL 5I1AA 3ARUA 4NRZB 1K4DB 1ZT7B 4OCNC 1LO4L 2DM4A 4HIHA 2RQ8A 1CLZL 3TBWA 5ADPH 1ZGLA 4A2LA 3IDIA 4G7VH 2BNUA 4YHYB 4GG8B 4M7LT 4FFWC 4ZQKA 5EZJB 4EXPX 2VDRL 1A6VH 5GGQH 5F8QC 2UVEA 4KRPD 5ITFB 1WBXB 1MQ8A 2H6PA 1R5IA 2OZ4L 2WW8A 4P5KA 3VFSB 2FNBA 4EIGB 2XWJA 3O11A 1F3DJ 3MJ7A 5EBMA 5HPMB 1QO3A 1UZ8B 2FCBA 2GYSA 4M1GL 5D93B 2NY2D 4I9WD 3DO7B 4YHNA 4D8PA 3S36H 3UJTL 2P5WA 4EQ3A 1DZBA 2WIMA 2BC4B 4AL8H 3RWFB 1OAXL 3CXDH 2FEDC 3QI9A 5F8RC 1G9EA 4FXLA 2ADIA 4XBPA 3ZDZE 3KPLA 1DN2A 2HFGL 4MHHI 3I3BA 4R2GC 5K59E 4KRPC 3QG6B 4NQCA 5D1ZA 2BY2A 1WGOA 3B2VH 3EJYC 1ORQB 2V2WB 5CCKL 1RHHA 5I8EB 3ZT5A 5DJ0B 3MZTA 3SKMB 1T1YB 1ZANL 3NIFF 3DLQR 4JB9L 3T4AA 4PP1C 1UA6L 4LPVA 4TUOA 3BP4B 4LRNH 1ZKAA 1WZLA 1ZA3B 4LHUD 4NQUA 3P9LA 1CDJA 4MJID 5EG6C 4LAQH 2PUQT 4X7CC 2GAZA 3MLRL 5TE7H 2OR8A 4WEBH 4S1QH 2CKBA 2EDYA 4MNHA 1OSZB 4YFLF 5IMLA 2H26A 1L9MA 2E9BA 1P7KB 1QSFD 3PL6A 5IHZA 1ODAA 1NCUA 4OM0L 3LRGA 3PG2A 4OD3H 5MP6L 3C5ZC 2PYEB 1JCKA 1Y6MR 3GRWA 1OGTB 3ZYIA 5C0BE 3QXWA 4BJLA 1F4WL 4JG1H 2XTJC 2X1OA 1JHKL 1EJOL 3SDXB 3T1FB 4DZ8A 3O9WB 4M62H 1FN4B 1G7IA 2PO6C 5JA9A 1FFPA 4NKIH 4QO1A 5EUKB 2CPCA 1FYTD 3HPLA 4U0RC 2Z91A 2NY2B 3P4NA 3IXTA 5TE7L 1PG7L 2Y4SA 5FYKE 1FH5H 2Q20A 4FNLH 1HEZB 2ADFH 2HJFA 3S34L 2ZOLB 2X4RB 3FO9B 1DQQA 1KENH 3RKPA 4LQFL 4OM0H 4YZFE 2F53A 4TQEH 1L7IL 4U1MB 3SCMC 4UQ3B 5HGDB 3EDKA 4U7SA 4WHTB 1AFVH 3HMWL 1CFNA 2PW2B 1JFMA 4DOHE 5F6HI 4HLZH 5HDQH 1S9YB 5DRWA 3HR6A 3T0VA 1RPQA 3Q1SH 1C7TA 1MCWW 4AZ8A 1KNOB 4WW2B 1NMAH 4X99B 3MXWH 3TF7C 4MNQE 4YIQB 3T0AA 3QUYD 2XWTA 5EU5B 4QOKB 3HS0A 1NCAL 3PUCA 1AE6L 2MHAA 1EJ6A 2DLIA 4WEBL 4WENB 1E4JA 5DEGB 3RPIA 3WFHA 1S7WB 4LSQL 2AJVH 3QFDA 4LF3A 1M1SA 4NZRL 3TFKD 4EUPG 4NRXA 2ZNXA 5DF0A 1LEGA 4HS6A 4E41B 5JQHC 4OQTH 4IOSD 1JZ7A 1CGVA 1BWWA 4FFYH 2AABL 5GGUA 1DQJA 3TIEA 1C5CL 4PTTB 5LKNA 2V17H 1JGEA 1RZ7L 1OAUL 2AJZA 4ZUWA 2QLVB 5E2WH 2EYSB 1H15A 3EYUH 5GGRA 4KDWA 5ADOH 1HN1A 3S34H 1KBGL 1FYTB 1XAUA 3GNMH 3LKNB 2OL3L 3EHBD 1MRFH 3UJIH 2DOCA 4KZEH 4EDWH 3H42H 2VZOA 3U9UB 3B5HA 2CMRL 3H3BC 2VERN 4KTEL 5TDPB 1JWUB 4ZTPH 1CQYA 1U8NB 1U3HD 4G5ZH 5HGGS 4GG6E 4ETQB 3PWPE 1U6AH 3LEVH 4NCDA 2C3VB 3LKQB 5F6HJ 4JANA 5FXCH 3CUPB 2DLFL 3GSOA 3V4UH 2ERJB 3EKCA 7FABH 1ONQB 3MJ9H 4PGCB 1TZIA 1VGKB 3OJVC 2QKIB 4JE4B 5FUCE 2UZIL 2EH8L 2H2PD 4S1DC 1GRWA 3ZKMC 4IRSA 5FDYA 1F4AA 1TIUA 4PJIA 1LDPL 1F4HA 3Q6FB 5FA4A 2B1HL 2H2SC 4ODSL 5HHOD 1DQML 5C09B 1E6OH 1MUJA 3UBXB 5GS0C 4PJ5B 5INCB 2VDPL 2YMXH 3E3QA 3SKJL 2ESVE 5KSAA 2DKSA 4GUPB 4NJ9H 5K9QG 2X70A 2WWKO 1CVRA 4LHUA 3LZFL 3MLZL 2BRRH 4IIQB 5CZVH 4RAUA 5JUEH 1AXTH 2L4OA 4ZFZB 3IDXH 4HG4J 1CL7H 3FN0L 3KXFE 1JHTB 2AEQH 3RWGA 3OX8A 5D7JB 3IDNA 3HNTL 4OKDA 3ARRA 5IBUB 2I07B 3SKJH 1FVDB 1C1EL 5DC0A 5I1IL 1SJHA 2IANB 1XH3B 5TE6H 4KWUA 3LKOA 3EDDA 2NNAB 1D5IL 4NN7B 43C9B 3EDFA 4OJFL 5CZVL 4QXUL 1ZVYA 4ODBD 1OSPL 3KGRA 2R4RH 4YEFA 3UPRB 4TSBH 3TA3D 2ZSVB 5CBAA 1ZV5A 2DQCL 1U92A 4ONHA 3MCKB 1EO5A 4ZDHA 2ERJC 3GI8H 5EDXA 4PP8C 2NTFA 3SJVD 4JFQB 4MJIE 3HC0B 4P2RD 4RAVA 4ZXBB 2E7LA 2ZUSA 5DFVC 3ZDXE 2HMID 5I15L 2B1HH 5EU6B 3MV8E 1VB9A 2UUDH 4FQXB 4GKNA 2A9ML 4XH2B 3WE6A 1VACB 4KXZI 2H32H 4NRZA 2Z31C 3LQZB 1A4JA 4GG6F 4IJ3B 1YQ2A 3QUXA 4YDKL 4YHKL 4UBDC 1JIBA 2DQFB 2XRAL 5CEXA 1WFNA 2VZTA 2ZSWA 5JQ6L 5J1TC 1ZVSB 1OB1A 4H88H 4ELKB 5CEYB 1KIRB 4L9LB 5FYLD 4M1CD 3EYQD 1LO0L 1UJTA 3NIGE 3N85H 5D7LD 2E9JA 5GGTA 4QRPB 2R2BB 2WV3A 5EN2A 2Z93B 1RIUL 2YBRB 3LRSA 4EOWH 3DRTB 3CDCA 3AS0A 5JHLH 3UZVB 5C0CB 4JO4L 1D5IH 4ZPVA 5H94B 4AQ1B 4HFWB 3EO0B 1A3RL 1TLKA 1YNLL 4GAGH 3BYYA 2HG5A 3E0GA 5I1GL 4DCQB 5HHQB 1IZKA 4YHIA 1RY7B 1KUMA 1X5FA 3HRPA 3HCVB 3WUWG 3MSPA 1LP9E 2ZWLT 3UROR 3MBEA 4YXKL 3GMQA 2XFXB 4MMXC 1TJIH 1UB5B 5CSZB 3NCFB 2VMFA 1OP3H 1QOKA 5C9JB 4EOWL 1JNLL 1UJ3B 4LVNC 1IKNA 5SX5K 3V6ZB 2BVTA 3TNNA 3RU8H 3P9LB 2DQTH 4MXVE 3B9KB 5T5NG 5HHVL 2A73B 4NWUH 5D8JL 1PEWA 1U3ZA 2H3NA 4NHUB 1LK3H 5BRZE 5GZNC 3N06B 5IROA 3MXVH 2QADB 5JPNB 1AKJD 1S7RA 2MQ3A 9CGTA 1I9RL 4RNRA 5KSVA 2YEZA 2HT3D 3K1DA 2Y1VA 4PJ7F 1RZKC 2D7PA 4ONOA 4BK5A 5E8NA 2VLKB 4LSUH 3AUVA 3G04A 3NPSC 4TOYL 4O9HH 5ESVB 1CQKA 2BFVH 4V1DA 3T2NH 1XT5A 4OLEA 2DJSA 1DL7L 1WAAA 1G84A 2I26N 5C0BB 1RJZB 1OQOA 3P4NB 3MA7B 5DURB 2DMKA 1SY6A 4X4MA 5TFSH 1CZ8L 4Y5YC 4AEHH 3B5GA 2OK0H 4D3CH 5H35B 1IC7H 2WUBL 1A7NH 4ISVA 4K23H 1FCCA 1JTOA 2X42A 4N8VG 4DKAA 3B9DA 1OWWA 4PJ8D 4LSPH 2CMRH 5LGHL 5KVEL 1YN6B 4RIRB 3P77A 1FSKB 5IIEB 1ULVA 3MRQB 1IC4L 1IAMA 3LV3B 3HI1A 3BH8B 3HPJA 1KNOA 4MVBD 4RX4D 2NY1C 3BHBB 3RNKB 1OGAD 4K7FA 4WUUD 1JVKA 3ROLA 3GMMA 1UJ3C 1S9VA 4JM4H 4PBXA 3WN5A 2IH1A 1DBJH 3GBMH 4RBPH 4X7DC 1HK6A 2CXGA 1UVQB 5DJ2A 4WHCA 3T3PE 4NM8L 1FZOA 3GSNA 4HUVA 3OAZH 1IQWH 5AYUH 2NQCA 5E8EA 4XNUH 5GSVB 3HUJE 3M8OL 4POZC 2FJHB 4BZYA 4DUWA 1NGXA 4J3WA 2EE9A 3IAGC 3QHFH 4PJEA 4XC3L 3SDAA 4L4VD 2ZCLH 4G5ZL 1CLZH 5ADPL 2YMXL 2DQJL 4UU9A 3SDCA 3FQUA 5BO1L 5FUOL 4Z77A 1I1AC 4OM1L 3LDBC 4WFFD 3BP7B 2EYSA 2DLFH 2GK2A 4N1CA 4IMKA 4YZFF 4OZGA 3QWOA 4OI7A 5DD1H 3C5SA 3G9AB 1HH6B 1JYWA 1NAKL 1P2CA 1EPFA 5FYJU 1JMXA 1UC6A 1BOYA 3DBXA 3G6AB 2IPKB 3HE6A 4KTDL 1KB5L 4PJGF 1JV5B 2AK4A 5SV3A 3DNKA 4O2CB 3ULUC 5D70L 3D69B 5I30H 1X5ZA 3QHFL 4GRWE 3W9EB 4OGAD 1LE9A 1UM5H 1BIIA 5C09D 3GKWL 1T22B 1I3UA 4XNYH 5IW1B 4PP1D 4PD4K 5GGVH 4LCUB 2BHYA 1YECL 4F3FA 3O3BA 3U2SB 1S9KC 4ORGA 4W70A 1FG2A 1ERNA 4L3CA 5BS0B 5B38A 1OTTC 1NBVH 1PZUB 2X89D 5C8JA 2AS5M 3BKJL 3ZE1E 1F4WH 2YUXA 3AROA 4FXGB 2Q8AH 3EOAA 4JHAL 2J7LA 1BQLL 3MROB 3LPWA 4QRRB 1GZQB 4KC3B 4NJAL 3V6OA 2Q3AA 4QT5A 3HRZB 4R90L 1G9NL 1E4WH 1Z9SA 4YHMH 5J9PB 3KLDA 4LCYA 3MOAL 2E27L 4G6AC 3QEGH 3TPUA 3FT3A 4BSWA 4HAGA 2BOBA 1KEGH 5DRXA 3IFNH 3X14B 3D6GA 3KR3L 2AJ3B 5ID1A 4OBSA 4LGRB 4JFYB 1O0VA 1PYWB 3CSPA 1IGML 5KSBB 1TPXC 1E4XL 4YPJA 5CJBA 3UAJC 1KB5H 5GS2H 4ELMB 3IDMA 4K8RH 1OL0A 4QHLA 2FDBP 3MRDA 4NHUE 2ITCA 3VFVA 1BREA 1HILA 2IG2L 4H1LB 2L7UA 2XPGA 5ANMA 2Q3ZA 5HHXL 2C3GA 4LFHD 3PQYE 1WUNT 4AMKH 5FYJD 4YC2C 5EPMA 3KPSA 1X5YA 4KRLB 1IAKA 5J1SC 1MHPH 3QJHB 3MNWA 3BW9B 2GIYA 5LQBL 5CGTA 1RFDL 1BZ7A 5JNYB 3UC0L 1J1PH 4POYA 1FFNA 3MV9E 2X4TA 2AJXH 2WUCH 3WIFA 3VD4A 1BLNB 4C83A 4YDJB 4M3JA 3DX8A 3ZZ1A 1TJIL 3WE6B 3U83A 4N0CD 3UP1A 3O9WC 4JM2C 1SBSH 4ZS7H 4MAUL 5I71C 3VXMA 3T0WA 1CICA 2DAVA 3HR5B 1AH1A 1I4FB 3MREA 1IM3B 3OKLA 3BXNB 3E6FA 3QUXB 5I0ZA 4MD5A 2DQFA 1MCHA 4H5SA 1K4CA 4KV5E 5E2VH 2EXWC 3SGJA 1MCWM 5CEYA 5I2IA 3ZTJG 4D0CA 4MXQD 4XAKE 3IDYB 4Z18A 2XQYK 4OZFH 3QFJE 2VDQL 3V5KB 2D03H 5F1OB 4E0RB 4JRYA 2G75A 5DHYB 1IEBB 1NC4A 3HAEB 4P0DA 1MF2L 5CINL 1U3HC 5F88B 2DWEA 3QWRA 1DQDH 4AIXA 1GC1L 4WJ5B 4ALAH 2BVPB 1B2WL 1FCGA 2F15A 4JRXB 4OB5L 5JIIA 3K81A 2P49B 5ALBL 5DVMA 1EXUA 4KVCL 4TNWF 4DVRL 3OXSA 3EHBC 5KJRL 3V0WL 2OJZL 4DKEL 2E6JA 4G8EB 5EULV 3JTTA 4NQVA 4PJDA 2Y36L 4X6FA 4I3RL 5C0IB 1NANH 4F7TA 2D2OA 3L7EA 4ESKA 3O2DH 1E28B 3UX9B 2OSLA 3CFDA 3BP6B 4IMLA 1NLDH 3ULVE 4XCFL 1DLHB 4KUZL 4OLUH 4EBQL 4M43L 1QR1A 2KL6A 1YEJL 5AAMA 1BWMA 3AY4A 3VWKA 2X1WL 2XQYG 3WKML 2AEQL 3H0TB 5DJYA 3STZA 4OIBA 2VB5A 5D1QC 4YX2L 3F7YB 5EB9A 5K9JL 5H2BA 3VMNA 4OZIF 5E99L 5JMRA 2F19L 4OUUA 2VZ3A 5ESVA 1U93A 3MRNA 1A6WH 3ZO0A 1DVFD 3MFGB 3TM6A 3RKDD 1D5BB 4HFUL 3NZHH 5I1DB 4HWZA 5FUOH 4X80L 3REWB 4EN3D 2V9TA 5H35A 5LGJA 5C6PB 1OPGH 4X4YB 5GRYA 1PBYA 3ARWA 3BKML 4O4YL 1IL1B 3H3KA 4JFZL 3P77B 3IAPA 1A5FL 1MVUB 1QLEH 1A9EA 1AIFA 2BERA 2RHEA 3GJEB 3EYFB 4M8QB 5F7WC 1YNKL 3S97C 2JJVA 5CS7A 3SDXE 5CP7A 5BZWB 3LQAL 3SKOA 4KKAC 5DQJB 4TUKL 4PRDA 1PKQA 2E7MA 2PO6A 3VFRA 1AGCB 4L8CA 3GMMB 4XTRC 4YFLI 5IQ9A 3EGSB 5I1AB 1BFVH 4GRLA 1BD2A 4R6UA 1JPFA 3D48R 4L5FL 3OKYA 5C07B 2DTML 4AENB 2APTA 5EC2B 4Z7UB 2E5EA 5HHMA 4J4PA 1CXHA 4MX7A 2EDFA 2YRPA 3U4BH 4M61B 1OLZA 5C0FB 3TBYB 5LWYH 5DVNA 4N5EA 3ZKQD 4PGDA 2IANE 4PY8I 3O11B 5KBNC 1UM5L 5BJTB 1QO3B 1KYOK 4I0PA 3H3PH 3GIVB 1T0MB 3DVNA 4Y19A 5I1KH 2X2YA 4X5WB 3MFFA 4Y4FB 4LIQL 4WU5B 1I1FB 4PRID 2IGFL 5EWIL 3VXQB 3QG6A 1A0QH 3TPUE 3HZYB 4XPTH 2R2EB 5DEZA 1E4XH 1A9BA 1KELH 5DJXA 1RVFL 4FG6D 5T33L 4OBRA 4D9QD 1N5AA 3CMOL 2AK4D 2YHGA 3CFKB 2O5YL 3HE6D 2AKRB 4P9HL 2OTWA 5IESL 3VW3L 1OGAE 1AKJA 1T1WA 1Z9LA 4Z5RB 1ZVHA 5AZ2L 3EO9L 4PLJC 4O2FA 3U7WH 1LO2L 1G7PB 1KJVB 3WSQH 4BKLA 1MHHB 3TC9A 4ZSOA 5D7IB 1EUTA 4I3SL 3VXOA 4YXKH 1TETL 2YK1H 3BI9X 3CH1B 3O6MH 4P23B 2MOVA 3U82B 2B4CL 2FSEB 1NDGA 2VQUA 4G42A 3HG1D 1FO0A 4NO3B 1NGQH 4OCSH 5K59F 1U3JA 4Z7UF 2KPNA 1QFUL 4P2RA 3MRGA 4L4VE 2R1WA 2ED7A 1CK0H 1U8LB 1QG3A 3DMMA 3T1FA 5HHXH 1LEIA 4EN3B 1WTGT 2Z91B 2HN7B 1NCDH 4OD3L 2B2XH 1YMHB 4FQQB 3LS5L 4KQ4L 3OJDB 4XXCA 1QA9A 4MQXC 4QGYA 2HVKA 3B2UC 3QJFB 3QEUB 4ACPA 4FQJH 4RFNC 4EEEA 1GGIL 3GSUA 4U1MA 1F4XH 2SEBA 3V79C 3IFPB 2Q6WA 5CJ5A 3FT4B 2ZUYA 5I76A 3PWJA 4CJ1A 5ILTL 1UWEH 1KXQE 5DK2B 4JQIH 5BZDB 3MLWH 1XCQB 5KSAC 3ARED 5IB2B 2HTLD 3LKSB 1XGPA 3OGCB 3E2HA 1U95A 1IBGL 1I8MB 2VKXA 1TCRB 3FB8B 3DI2B 3WEXB 4J1UB 3JVGC 4PJ9A 2AEPH 3ULVH 1IGFH 3C6SA 5I8CB 3CK0L 3QUYB 5HYJD 2Y07L 3OPZL 3FHQA 4PJGE 3TBTB 3KPNA 3WIFB 2YS4A 1J5OH 2XI9A 1J0KA 1AO7D 5ENWA 3D9AH 5JW5A 1S7UA 5J13B 3ARBD 5CJQH 2XWJB 2OL3A 4ODWA 3C8KB 5MHSD 3T4YB 5KG9B 2DQEH 1NLDL 1IMHC 4NNYA 5E5RB 4ODUB 1TVBA 4PTUB 4DWHA 5HYSB 4KI5D 1FL5B 3ULUD 4RRPG 2EE6A 2NY4D 5C3LD 4ZS6D 4QTIH 1FZKB 1YNTA 5IB5A 5IVXB 5DGRA 2Y36H 4LRIC 4R7DA 4G3YL 1CD0A 2DB8A 1WBZB 4MA7H 5DD5H 5F44A 3RWIB 4N5ED 1IGTA 3SDDB 1MCCA 4JQIL 4KI5F 4S1RL 2WSKA 4QGTA 4TUOB 5CSBA 2B1AH 1XGUA 1Q0YL 1SMOA 3U30B 5J57B 2J8UA 1R3HB 5HHMD 2HFEA 3QULA 1INQB 2E8ZA 5T1DL 5DJAB 3O6FB 1UH4A 3WMSA 5B8CB 4Z7OE 5D70H 1M7IA 3FB5B 3RBSA 3JV4B 3CGTA 4P2QB 4YHML 3KLHC 5D96B 1KPUA 1NCWH 2NXYC 3MQIA 3OKNB 2W0LA 1EEUA 4HC1H 4HWNA 4P4KB 3DX6B 2X1XR 5D7LA 5IVOA 1VFAA 4JY4B 4DK3A 5KTEH 2CXKA 5CAYB 4Q0XL 5F7DB 2CUHA 1R3JA 3MLXL 5J6HA 5LCVH 4MVBC 1Q9OB 5IJKC 2ZUUA 4D0DB 4K3GA 5DDHB 4LLWA 4JFDB 4XRCA 4X8JB 3PL6C 1CFSB 2JB5L 5TQ0H 2VXVL 1NEUA 1G7LB 4R9HA 4LOUC 3GMRB 3BPNB 5ICXA 1RZ8B 1T2QL 4JFZH 2CDGA 5JO5B 4PG9B 4Z7WE 5SWZD 1Z5LB 3RWHA 2YC1A 3DYMA 1AGBB 4F2MA 2NW2A 2Y06H 3CVHL 1QBLL 2E6PA 4UDUB 2IANA 5MERB 1ACZA 1VFUA 2QSQA 4TTGA 1LK2B 1NFDA 3LEYH 4N0FB 1T21A 4Z7VA 4N0UA 1DBAL 3L7FA 1N8ZA 2PTVA 4FQCH 2G9HB 1S9WA 3T2QA 5T3XH 1HZHH 3NBNA 4QXTB 1CDHA 1Q0XH 5C71A 3S3PA 3C5JA 3ETBF 2NTFB 2QR0A 3O41B 5FECB 4DW2L 3DV4B 2APXA 3MC0A 3O3DB 4L8SA 5TQ2H 1IAIL 1UZ6F 3T8XA 1MAJA 3MV11 1DN0B 4DGYL 2NXYB 4OZIB 3VGDA 4FS0A 3FCTA 4BSVA 2O5YH 1EEQA 4MJIB 4TSCH 3F7PC 5F1SA 2W9DL 1T4KB 3W5MA 4GMTL 3SKUD 2JCCE 3N1PC 2CH8A 2A74A 2GITB 4YE4H 4MXWL 1HHIA 1CVSC 3REVA 2P8MA 2UY7A 3QRFM 5CJXA 2YK1L 2ADJB 3MPCA 1K8DA 2M8XA 3GSVA 1T3FA 3M45A 4W81A 1ZT7A 3IJHA 4HMCA 4NDMB 2Y9RT 3VGBA 5I1EL 5T33H 1G7JB 4I4WA 3ZE1F 3D5OF 2B7DT 3ILQC 1LP9A 2VZ1A 5D1QB 3RJQB 2QHLA 3KYMB 5D7IE 1EAPB 2EO9A 1QLRA 2DQDL 2H1PH 5CD3B 3V4VH 1S8DA 4HUNB 2BNRE 1CIDA 2XYCA 1M4KA 3BPLC 1T20A 1IGIH 3K74B 4HFWA 3W9DA 5EC1B 1XGRB 4JLRA 1S7VB 1GZPA 3CVIH 3FB7A 1LO0H 1W0VB 1RK0A 5I73C 2LFGA 4U1KB 4OZIE 4GO6B 3BPNC 5IBTH 3O2DA 4EI5C 5I1HL 3U9PH 1FVEB 5I19H 4LVNB 3VXSA 5JTWA 3GGWB 1TXKA 2VIRA 5EORH 3ZTJH 4XX1G 4YWGH 3MRJA 5F1NA 4GW1A 3MXVL 1JK8B 1UKSA 3TNNB 1E27B 3WIIL 4FXKA 5BV7L 5TF1H 1C12A 3RHWK 1BZ9A 4BQBA 3CVIL 4NT6B 1OOAA 3LS5H 4WCYL 4GAJH 4P4KC 2N7AA 2XWBB 1FE8L 4HKJA 2JJSA 2DJ4A 5E2WL 3GSWB 3ARGB 3ZHDA 5ELIA 1AHWB 1X6LA 2GAZB 4HX1A 2FO1A 3KPRB 1KEMH 4OZFB 4X7SH 4OLWL 1U8LA 4JVPA 5EORL 2P7TA 1RU9L 3EJZC 2E9IA 1UWEL 3DMMB 1JNHA 3QPXL 5E7FA 1KB9K 5HVHB 1UB6A 1DUZA 5DD3L 5J0BA 3MRLA 2FL5A 3SDYL 3UO1H 5LGHH 4NQEE 1OGTA 4M7KL 1T7WA 5MEOB 1U8JB 1A8JH 5DI8B 4K3EH 4OZHB 5CLWA 1OAXH 5AG8A 4S1SL 1E4KC 4OD2A 4X6CA 1GL4B 4RAVB 1NGZA 2EECA 3TYFB 3GZKA 2ED8A 4GXUN 4KDTC 4ZD3L 4X8XA 5IIEA 3L3JB 3KJ4C 3TO2B 5IB2A 2JIXD 5JOFB 4MLIA 5DD3H 5DMYA 4JHBA 2YD9A 2X89A 4F7EA 1F13A 1YEIH 4PJHE 1A6AB 2FO4B 3NGBC 3B9KD 2FECL 4JDZA 3KNBA 4QY8A 4IRJC 2OLDA 3C6LA 4Z7WB 4I5BA 12E8L 4N5UA 4LKCA 3F7VA 1RZGB 1H3TA 2F54A 2V7NB 3QAZC 1NCWL 4Z7UE 4FRWA 2XG4A 1PSKH 3I6KA 1LGVA 3LDBB 2IAND 3PWPA 5GSVA 3RL2A 4GFTB 3T4YA 4OAWA 3TYGH 3KYOA 3K2UH 4PRPB 2FJHA 1TITA 5H8DA 1YEGL 4IOIA 1UM6L 3BKYH 5KSBF 1DE4B 4IS6B 1H0DA 1RZKL 1U8HA 1WAAF 3G5VA 1U58B 4G8FB 4JPWH 3MRKA 4LCWB 3U46B 5FOJA 1I7RA 5I18H 3GHEL 4E9LA 3RTQC 2W9LA 4FFVD 5FHBL 2GJJA 5KANG 4P3CL 5I74C 3Q3GB 4U1LB 2A6DB 4DKFL 2VL4A 3TEUA 5E9DB 4I48B 4MQTB 1PLGH 2FLBT 4R4FH 5HGHA 6FABL 1FAIH 5T5NF 1NAMB 3DSFH 1S7SB 5DQ9A 3HMXA 4GQPH 2JELH 5IW6B 4KK5D 1RULL 4M3KB 5F89B 1BVLA 1CICC 2BNRD 2J5LB 3KJ4B 3QO1B 5FK9B 1INQA 2D9QB 3DUUB 4I0CC 3HMXH 1H3VA 2H3NB 1RZJH 3MLTA 4NQSB 2J88H 2V2XA 3QDME 3RNQA 3ILPB 2HLFD 1UCBL 1Z3GL 1KCRL 3BD3A 3QNYA 4DEPC 5LJYH 1ZHLB 3L5HA 1SJVA 5FYJH 3NCJL 4ZXBD 2JIXB 4M4PA 6FABH 2CUIA 1X5KA 4TPRH 2FWOB 4K2UL 3B6SB 1ZSDB 4HCRA 5E1HB 2HRLA 3NH7L 4PJXF 5AD0A 4F33A 4ZO8A 5C0BA 1D9KC 4OQTL 4JM2B 3THML 3C2SA 1HQRB 3D0LA 5DEFB 3EOBB 2Q8AL 1W8OA 2A2QT 3ARGC 4XWGH 4HS3B 3TBSB 1TPXB 2BNUB 1ZTXH 5ID0A 1QP1A 3PWNB 4R90H 3MV8A 4HF5H 4WDIB 4FQHA 3STBA 1CG9A 5AUMB 1I85C 4GBXC 1FAIL 2EXWD 5HYJE 1IQDB 3MRDB 1MJUL 3P4LA 3DSFL 4QYOB 1CGYA 1A1NB 1MY5A 4P2YA 3D18A 3OX8B 3VGGA 1N8ZB 2MFNA 2P43B 2QQKL 4XP6H 5C70A 3S6CA 3AMLA 2ZKHL 4LLDA 3NIFE 3PV6A 5EZLB 3QZWG 3QR2A 3U4EB 1PX3A 3NAAH 1FVCA 3TZVA 4PJAF 1C5CH 4PJ5D 3IJSB 1K8IA 4CVZA 4RWHA 2AERT 3QUZC 2BRQA 3DV4A 4NN6C 1IC7L 3C9NB 5D2LB 4YO0B 1OTTD 5DYOB 3X12B 1NGXB 2EDRA 4NWUL 5D8JH 4N1HB 4UU9B 2CLZA 4A2MA 4YHPA 4HBCL 1ZA3A 4PJXA 4ZFOA 4E41E 4LDOB 2AXFA 3LD8C 2NLJB 2WUCL 2FEEI 4GKNB 4MA7L 3RGVD 3TT1H 2A6JB 3TJEL 5I1LA 3GBML 4U1JA 4EVNB 3T3ME 2ATPA 2GTWB 3NCMA 3OKOA 4WVRA 4DQOH 4KK6D 1TJGL 4KJWC 4K23L 5ALBH 5AYUL 1LE9B 4B7IA 3VDAA 1Y0LA 4IMKC 3KAAA 2IJ0C 5KJRH 1WBYB 2DWEB 4RBPK 3DUSB 4CDHA 1U8IB 4NN5B 4NO2B 4B41A 1OP9A 1BGXH 4ZNEE 4YDLB 1KACB 1KSRA 4WO4B 5ISZA 2C3HA 2Q7YA 5HVGB 4QRPA 3SGDI 4Q0XH 2P8PB 4UAOB 4X6BA 4TVPL 1IC4H 1OSPH 1XGQB 2I24N 1KJMB 2H26B 3U48A 2OL3H 3ULVD 3JWOH 2VAJA 3BD4A 3VFTB 1ETZA 4CN4A 5D7SL 4MB5A 2OTUB 2VN4A 1CN4A 4HLJA 4HH9B 3A6OA 3DHJA 7CGTA 4OZHE 3IU3A 1N7ML 1KIUA 2DYPA 5B38G 1OTSC 2VKWA 1X7QA 3NN8B 4R4NC 2VLJA 3HS0B 4U0QB 2E7CA 5CILH 3TO4A 2DI9A 3QCUH 3W0WE 4K3EL 1TQCC 1EGJA 5HHNA 4G7VL 2X6MA 5LCVL 2R4SL 2NY3C 1QPPA 4WFHE 5D9SB 2BNQB 4YHKH 1IGJB 2R4RL 4U6HB 3O3AB 2ZOKA 3OAYH 4LOUD 4M5ZL 1HDMB 1EV2E 4NRXB 4O2EA 3MCLL 1G6VK 3VGAB 4PLKC 1DTUA 3VFVB 2HH0L 1HILB 4BQCA 2VDLH 4KDVA 3QDHA 1S7TB 3G5YB 5FYLH 4J4PC 2GTZB 1JNNH 2NPLX 3VG9C 3F7RA 4KROB 5K93A 1T80A 1N5YL 3O2WL 1U8JA 3H9YA 3L5XH 2X4QB 2J6EH 4OFIA 3UJTH 3V7MA 3MRMA 3MNWB 2F19H 4KK8C 3ULVF 3SCMA 4NQCE 1X5HA 1T04A 1LILA 1FSKC 1VERA 1KEGL 2B5IC 2JB6B 4N0YH 1YNLH 4PRHD 4CW1A 4NNPH 4PJEE 4KJYB 1A7RH 4ODTH 2VAAA 2YSSA 3QEQD 3L3IA 3B9VA 1AIFB 1UH2A 5DJCB 5F93C 1DANT 4OV6F 3OZ9H 4JKLA 3NMEA 4GRWH 1MCQA 1WC7A 2ICWA 3QIBB 5FF6B 5A2IH 2EYRB 4GKSA 3X3FL 4P2QD 2F53D 4XP9L 3U4BL 4PTTA 3GM8A 5KAQF 4NSKA 3WNPA 5B3JF 1O7VA 3HB3D 2X4UA 4LPTA 2LQRA 2Q8BH 8FABB 2ICEA 1FHGA 3PWPB 1A3RH 1OARL 4Y2DD 4PLKD 1MJ8H 1QFHA 2KBGA 3MGOB 2AAVA 4QRTA 4Y89A 5DMKB 4PB0L 4LPCA 4TPRL 1U8HB 4Y1AA 3C8DA 5IEKB 4XC1H 3G5VB 4Q2ZB 3HNSH 2AK1H 3QUKA 4JN1H 1AI1L 3S96B 5HYEA 4L8DB 2BXZA 3A67L 1BF8A 1INDH 1QSVA 2P5EB 4PJEB 1EJOH 3KJ6L 1BIHA 3DURA 5HPOA 4IEFB 3HAEG 1A6UH 4HXAH 4KKLD 4Y4HB 3R1GH 1KCUL 3LHPH 4X6FB 5EOCH 3S5LG 4LSSL 2QKIA 2YPVL 2HT3C 3WFEH 4F7TB 1IC5L 4H8WC 3L7EB 2Q7NA 3NZ8B 3IFOB 3QCVL 3X13B 4PJEF 4HK3N 5K9OA 5EA0H 1MEXL 5JW3H 4UAOC 1UQSB 5EU3B 3RZCD 1BFOB 3MUHL 5IMLB 3BJLA 1R5VA 2VITA 1JV5A 1EEZA 4OZGF 4D0BB 2AJYH 1QEWA 3IF1B 1NMCC 4O9HL 1DEDA 1G7PA 1SQ2N 1MH5B 2RB8A 4NNXA 4UIKH 3P0YL 3RAJH 3WS6A 4ZUSA 4M6OH 4WUUB 4P23C 2VUOA 3UPRA 4K9EH 1ED3B 3MOQA 4CU6A 2Z8RA 5I71B 4F3FB 5BVPH 1N3NA 1FH5L 2V5SA 4WWKA 4QHUB 4S10A 4G42B 2IFFL 2UVFA 2NZ9D 3FQXB 4GMSH 3VA6A 2X7LA 1P53A 5JW3L 1W72B 1C16A 3RX7A 2HTKC 4QTHA 5J06A 1E6JH 2VDQH 3FQNB 1R3KA 1F11B 3DVGB 2EEDA 4F7PB 1MOEA 3BD5A 3D3VB 3IDYC 4U1IB 3WBDA 4WTXA 5GIRA 3C09B 5CGYC 4O51B 5SV4A 4PRAA 2VSDA 3ROOA 1A64A 1QRND 4JREB 4UINH 5CMAA 1FBIH 2PYEA 3O0RL 1AO7A 1OAUH 43CAA 1KV3A 1MHEA 1BJ1J 3NABH 1CXEA 3MLWL 3JWNC 5CBEB 5EO9B 3CFIC 3W2DH 4OF7A 4M8QA 4D9LL 1F6FB 1NKRA 5DUML 4MYWB 4JFQA 3SJVE 4KZEL 1VGEH 1KTDB 1B0RA 1X5XA 4M5YH 2AJ3A 2FHCA 5ID1B 5I8OH 2HJFB 2BVQB 1TENA 4MQSB 4UV4H 1GHFL 5HI3C 1EA9C 3VE0A 1FNFA 2X4NB 3DWTA 3VWJB 2E6QA 1BGXL 4GOSA 3IXAA 1KULA 3UBXG 3HE6C 2NY0D 5GGRY 3PHOA 2MWCA 4KHXH 1GXEA 2GHWB 3C9NA 1RZFH 5JXEC 1P7QA 3ZSTA 1BQHA 4XNQA 4L3EE 5HI5C 2EDQA 3BKMH 4O4YH 4BQ8A 5F7FA 2XZZA 1M6OA 3UTTD 1W0WA 3BZFA 4MHHG 5TJWK 1CD1A 3T0BA 5C9JA 2Y5TA 3BPCA 2O5ZH 3SEPA 5FO9A 3CH8A 1QQDB 4YDJA 4TUKH 2CIKB 1GGYA 5GRJH 1H5BB 2C3WA 3MBXL 4H25B 5C2UB 1BFVL 3MV7E 3PJSA 1YNTB 1OY3B 1YUHB 3WJLC 4RQQB 3QEGL 1B9ZA 3I85A 2WY3A 2DQGL 5DJXB 3VGEA 3GMLB 1I4FA 3MREB 4OD1L 4OFVA 3MGAA 3LY6A 2E8YA 1P9MA 5E2JA 1WWBX 5FAAA 4GW4A 3ESVF 1VGEL 2EICA 1ZLWH 4MJ2A 4JVWA 2F9BT 3RX5A 2ICWJ 1FIGL 2R0ZH 5LGKA 1JGDA 5DJ6A 4WO4A 5ISZB 4JZOB 1NKOA 1C1EH 4EIZC 2R23B 4JDVA 4OGZA 4UV7L 4NWTL 2BJMH 2R2CA 3VXOB 2IQAB 4TTDD 5GRWA 1G0YR 2ORBH 1YMMA 3PWVA 2QV2A 2NXZC 1U42A 1ZHBB 4YQXH 4H0GA 1DFBL 4LVOC 3UEZA 4KTDH 1NFIB 3HC4L 3VWJD 1MCKA 3VI4F 3SGDH 1XGYL 1O5DT 5I30L 3KPQB 5D5MA 1MWAB 3PL6B 5IHZB 2XKSA 4UIMA 3UTPE 2ARJQ 1DBML 4R0LA 2DL9A 3RWGB 1OAYL 2DIJA 4NUGL 1MI5B 5D7JA 4UT7H 3IDNB 5LBSL 5D93C 4FN0A 5J11C 4EUPA 5I17B 1F6LL 2GJ6B 2M1KA 3L3OA 3ALPA 4QXUH 1FZOB 1NBVL 3CU1A 3RVTC 3V0VA 5EWIH 1OP3K 3DPBA 3PWJB 3O4OC 3OR7A 2BOCB 3IFLL 3DMMD 4UT6L 1XF3B 1HZHL 4BK4A 2EDDA 4WNQB 1AR1D 4U1SB 3SDCB 1XIWB 3PGCB 4TVPE 4CVXB 3AXLA 1CK0L 5ANME 4OSUH 4XP1L 1BAFH 2Y72A 1IJ9A 3GDBA 4PJFB 5KVFH 3M07A 3WFEL 1S5IL 2PR4L 4NP4H 3OHXA 2A6KA 3SY0B 2X4OA 3DRQA 4GXUM 3Q0HA 3FCTB 4LF3B 5CUSL 2CK0H 1NPUA 3RIFK 1ZVSA 3Q5TA 3UTSE 1SY6H 4JN1L 4X6EA 4PJ8A 3BVNB 1YEEL 3QXDA 5E2TL 3DROA 5IK3B 3QNZA 5AG9A 1RURL 3O6LH 4HS6B 3GNML 1EHXA 1CU4H 5EN2B 4DGVH 5M95B 5DVKA 2RCSL 2GJZA 3OR6A 2ATKB 2VWEC 4KTEH 5T3ZL 2F8VA 2EEAA 2RFXB 2W38A 2AJZB 3EOAB 1G7JA 5I1GH 1EBPA 3BKCL 5GGRB 1QZ1A 1U6AL 4O2CA 2EE2A 4QRRA 1AHWC 3T0DA 3W81A 3QYCA 5CEXB 3LCYA 2Z8WC 4WHDA 4OZFG 1NFDF 4KFZC 1N0XL 3SHSA 5GISH 3GMQB 4HLZG 5JXEA 3O6FA 1FFPB 1UACL 5D1ZC 1MLBB 1UB5A 5CSZA 1G6RA 1K6QH 3L5IA 1FZMA 3DARA 2KQNA 1OQXA 4PRHE 1ZT1B 4JANB 3RVWD 5E08L 1OP5K 4JRXE 2DQDH 2A73A 4A6YH 1NLBH 3LH2L 1UENA 4G3YH 3MBED 1HQ4A 4HD9A 1OF2B 2QQQA 3NA9H 4M7LH 35C8L 2PW2A 1G6RL 5IBLC 1NQBA 2G2RB 1EHNA 4XRCB 1FO0H 4V3EB 2NY1D 3AU1B 5EUOB 1YEDB 4WW1A 2VL5A 4XBEL 3JV0A 1B2WH 3GSXA 2X10A 4M6NH 5GGTH 1YEKH 4PJ5A 3M17B 2HKHH 1EMTH 1U2CA 2C4XA 4JFYA 1OAZL 4MAYA 3QCTL 2VXTL 2WUBH 3HZMA 3RWDB 1N2RB 4R2GD 1AXIB 4MA1B 1I9IL 2Z9TA 2WWMD 3X11B 4E41A 2ZUWA 1RIVL 2OMNA 4HUWA 4N0YL 1GH7A 2IADA 4R2GB 1S5HB 3MV9B 3P9MB 3PDGA 1B0GA 1CDIA 5SWQB 2KUTA 3R06B 2GT9A 3FJTA 2EH7H 3O9WD 1IAKB 2VISA 3ARFD 5JORA 4C59B 2QR0B 3O41A 3BGFB 4HWBA 1MCRA 4PREA 1GGBL 5ESQA 2PYED 4YX2H 4HKZB 3WHXB 3RVXD 5IV2A 5K9QI 2BVQA 5EOTB 3V5KA 4TNVK 2HJLB 4M9OA 5CIPA 2BSTB 2ZUVA 4PV9B 2G60H 3D25B 1FP5A 1WWWX 4YHLL 4HUVB 3QPQD 3EYOA 4ZQKB 5F72S 4S1SH 1P4BL 5CZKA 3PHOB 4JM2F 5D7KD 2H8PB 5C0JA 4WI9A 1MCOL 1JNJA 5BO1H 2APVA 3MV7D 4M9PA 1M7DB 2BCKB 2YPKB 2UYLA 5MP6H 1FJ1A 2P8LB 2DKUA 5EUOF 2CKNA 3KLSA 1KPVA 1SM3H 5EU4A 3AFLA 2WQRA 4N8CL 2MPAH 1S3KL 1HOCB 2VE6A 4PY8J 2C7UA 3UTSD 3LQAH 3QZWA 4PS4H 4DN3H 1KT2A 5CJOL 5E6IB 1HYRC 1DVFA 3CAFA 2P4AB 2OMBA 4ODXA 2YPVH 2VDML 4U31A 3WFCH 5GPRA 3VWKB 4X4XB 3C8KA 4L9DA 3TZVC 3B2VL 3QHTC 1N64L 3T1WA 3PP3H 3MOAH 2WZPD 5J12B 3N50A 4ZO7A 1KN4H 4Z8FH 3VRIA 4HPYH 1ZHKB 4ZFZA 3OKKA 3BP4A 5H94A 1R3LB 4XHJD 3TN0C 2DTSA 3O6ML 3KPPB 5E8PB 5EO1A 1G9NC 2V5RA 1TJHL 1LO5B 3E1F1 5IW6A 4APQD 1G7HB 3ARXA 3HCVA 2VXSH 3V0AC 3LN9A 4PJBB 2I07A 3U4AA 3SE9L 4JQXC 2O61A 3OMZA 4FTVD 3RY6C 1HIML 4A6YB 3KPSE 3AREC 4ENEC 2CLVB 5F7HA 1DBKH 4UILL 4YDVB 1QVOA 3B5TA 3ARYA 5EIIB 3QULB 3D1MC 3QQ9D 3C08H 4HGMA 5HYQA 1KELL 2JLLA 4OGYH 2AQ3A 4L29A 1G9ML 2ZNWA 3MLPA 4TNWK 2HFTA 5T5FL 4NKDB 1U93B 4CMMB 2XTLA 3D9AL 1G0DA 2R9HD 1F90L 4XPHL 1UWGH 1UB6B 3FT2B 1DUZB 5TH2B 4P4KA 3LIZH 1CZ8H 2VDOH 2C9AA 5GGUB 4Y7MA 4S1QL 5IB4B 5HJ3A 3ZL4H 4BFIB 4BZ1L 1CR9L 5GGSY 4H1LA 5DDHA 4OD2B 5CHNB 2IAMD 4LEOA 3LKPB 2H1PL 1W0YT 1QFWL 1GGUA 1BBDH 4QOKA 2R0LH 1OAQL 1J1PL 3WXVH 1CDYA 3HA0A 5I73B 5DD5L 3RVXC 1XCTA 5IKCB 5E8OA 4V1DE 1NMCB 3CXHJ 4WUUE 1DBJL 2PNDA 2ESVD 4JDZB 3DRTA 4LVEA 4QY8B 5ICYB 4LRIA 3RBGA 1UWXK 3EOYG 3GO1H 4WY7L 3F7VB 4K94C 4PJXE 2HTLC 5C07A 3UZQA 3MJ7B 4M7KH 4YR6A 2N56A 4QNPE 3RRQA 3TWCL 1VSCA 5JLZB 2R2EA 4FP8H 3VDCA 4XAWL 4I13B 2H2PC 1WIPA 4YHIB 1ZHNB 3VXME 1AR1C 1L7TH 3MLYL 3TN0B 3TBYA 4QXTA 4OLXH 4U6VH 1K4CB 4KMLB 4TULH 2PETA 3V4PL 4IOFC 3HI6L 2A83B 3L1OL 1UYWL 4UDTA 3GIVA 3FFDA 4Z7VF 2OTWB 1FGNL 1GOGA 4XCNA 1EBAA 2AQ2A 4HV8B 1I7TA 4MCYB 5HHPB 2W65A 4U3HA 3PDDA 4MD0A 3TT3L 2ATKA 3PGDB 1PKOA 4L3ED 2FJGB 1T89C 1EZVY 1T83A 4RGND 5I1LB 1KFAL 4KQ3L 2PTUA 4ETQA 4PJ5E 3QCTH 1J0JA 3AM8C 1CFQB 5F7KC 5JXAH 1XFPA 1N6QH 4H1LH 4P46A 2BDNL 4R96A 2CKBH 1L9NA 3RVUC 3MRGB 3KPLB 5E8NB 4C56D 3CFKA 5F9OL 4PGCA 3TT1L 5HHOB 2PF6A 4ODHL 4PGEB 1WT5A 1XGTB 3L3KB 4X80H 3SE3A 1RHHB 5I8EA 4F15B 1BIIB 3RA7L 2PKDA 4KKCC 4JFEB 4NQCD 5D1ZD 4Z9KB 3MYZA 2DRUA 3BZEB 3QEHB 1QR1B 4HKXA 3VXRE 2H2SD 2WNGA 3W9DB 1HHHA 2BVOB 1FNAA 4HCRH 4BM7A 3VFTA 4NBYB 1FFRA 1QHPA 3JWDL 4LSTL 1RJYB 4P5TB 5JOEA 1IKNC 3TP4A 3ZKND 1A3LH 2R1WB 4G6FD 2ZUQB 4XVTH 1FNSH 5C0IA 1VACA 1BD2E 1NEZG 3KWWB 3UYPA 2DM3A 1MCOH 4M03A 4L8SC 4ZTOH 5F1KC 3Q6GH 2DI7A 1IGYA 5E6ID 1CBVH 4IMLB 4M48L 3MV8B 3UTSB 1I1YB 4OI8A 1JRHL 3GHEH 1IFHL 3DX7A 5A1AA 1BM3L 2YN5A 4ODSH 3P4MB 4Z95H 3O9WA 1QD0A 3NCYS 4LAQL 2ZOKB 4O58H 4R8WL 4XPGL 3FT4A 3GJFA 5F9JB 4BH8B 2XACC 3QDJD 5DEGA 1Q1JL 2ICWI 1CF8H 3RUGA 5I75B 3PQYD 4LHQB 4ODVL 1CXLA 1OW0A 4ELMA 3CJJA 3LKRB 3GSQB 1MHPL 3H3PL 1MVFA 4Z7VE 1NC2D 2FBOJ 2NW3A 5FCUH 3UTQB 4HPYL 2Y6SC 5ESQB 3GMPA 3TBVB 3WHXA 3WV0A 5DD0L 1RAMA 4YDIH 3GBNH 1FORH 1JPFB 5ETUA 4OIIH 3RL1B 1RUML 5DI8A 1N26A 4JEGB 4DAGH 2MHAB 2XFXA 3D69A 4Z6AT 3ZT6A 3U79A 3W9EA 4M61A 5FUZL 2ZCKH 3V6ZA 1A9EB 3L3JA 4XCEB 4ENED 1ZWIB 3BDBA 1RFDH 5DRZB 1M7DA 5BV7H 5F71A 5BS0A 4X6CF 2ATPB 2GTWA 4I2XA 3VFRB 5IVXA 1H3PL 3EGSA 1PVHA 4K71B 3KYKH 4RFNB 3BP5B 2NX5D 1AQDA 3OKEA 5E00B 4H5SB 5SWSD 1R3IL 3QA3A 4KZDL 3L5WB 2EC9T 3MROA 1XIWC 3SDDA 5DFTA 4K7PX 2H9GA 3H9ZA 4ZUVA 4DCQA 4NO2A 4HJGA 1XGUB 3WLBA 5GZOD 1AE6H 2NXZD 3V6FA 4DKEH 4BYHA 1MY7A 4GSDH 1XF4A 2V7HB 4P48A 2OYPA 4GG6A 3RUGF 2AVGA 4TVPD 1JWUA 1JBJA 3R8BB 4JY5L 1MJUH 3DVNB 1P7QD 5J4MA 1R3LA 3LMJH 3U46A 1A6TB 4U05A 1AP2B 3OAYK 2OS7A 3F8UB 3LKQA 5DHVA 4GUPA 5JPMA 1EXUB 4Q6IB 5E8PA 4WV1C 1TQBB 4TVSa 4PRIA 5IF0A 5KSBA 3ISWA 4S1DD 2BY3A 1FNEB 4GT7A 4BKLB 3VFUA 4P3DB 2AABH 1JI2A 2OBGA 3VXQA 4B50A 4EDWL 2O5XH 2ENYA 3NAAL 3S9DB 1R5VB 2VITB 4YPGB 1T6VN 4A6YA 4ZO6A 3EZJB 3VDBA 4D0BA 2YXFA 4X4ME 4QRUA 3DHMA 1K5NB 3H8NA 4WY7H 5T1MA 5C7XH 3SDDD 3B8YA 5F9WB 2LU3A 5KANI 4JN2B 1BVLB 2VLKA 3FZUC 4GS7B 5DJ8A 3WIHH 3FHAA 3TBWB 5CEZD 5INCA 1XH3A 4P46C 3ULUL 1V3LA 4M7LL 1BZ7B 5AYQA 1RJZA 4LGPB 3SDCD 3RDTA 2FBJH 1PAMA 3B9EA 3SGKC 1NBQA 3QXVA 4JKKA 4UIKL 3W39A 4XBEH 3HI6H 1U92B 4ONHB 3MCKA 1A6VL 5H2BB 3AAZB 4YGAB 4Z76A 3X17A 3OSKA 2FB4L 1ZSDA 1TFHA 3WIIH 4Z7VB 5DUBA 4YHNB 5INDA 3RIFF 1MHEB 4OZGB 1F58L 4LEOB 3BWUC 5GGSB 1FVDA 3LMJL 1Q9WB 2X4PB 3FRUA 1MSPA 4CVWA 1LEIB 4K71C 1JUFA 4J1UA 4ZTPL 2R4SH 2I60L 3QUMA 3WJLA 1KEML 1KXTB 1TZGL 4HKBA 4JM4L 3OTTA 2J8UE 5DLMH 5FYKD 3PV7A 4MXVF 3U36A 5J8OA 5F7LB 4PJHA 3SDYH 4TUJA 4P57B 2VZVA 3HI5L 5ACZA 2ED9A 4PRDB 4N8CH 4R3SA 1X4ZA 5HYSA 4JGUA 1ZS8A 5KVEH 1I8IB 5I18L 1KGCD 2R39A 1HHGA 3CZFB 3EO0A 2I60H 5D2NC 4ZUTB 4NKQB 3PWLA 5B39G 3TH2T 4FQIH 1ORSB 4AEIL 4KHXL 4YO0A 5DYOA 2DQGH 1VADB 3VXRB 1A6ZA 3X12A 4CL7A 3MLZH 5KN5A 2IBZX 1H3UA 2AQ1A 1YN7B 1D5MA 4I18A 4Y4HA 3PL6D 2NY6B 3E6HA 1PGRB 3X14A 1KCVL 3PGFH 3C6LD 5ECJE 5KS9E 3H7LA 3INUH 2VDLL 3MFFB 4P46B 4MLSA 1F3JA 1U36A 3E8UL 5DR5H 3ZT7A 4R4BA 1PG7H 5B8CA 3CFBA 3MLSH 4EVNA 1FL6B 1U91B 5FHAL 1LO3H 1CDBA 3OB0K 3CX2A 4KGJA 3FN3A 4NN7C 3W0WA 2DQUL 4LKXA 4FXGA 1MH5A 3AVEA 1WBZA 5C0DB 1DLFH 3KPSB 1TDQA 1YMMB 3G04B 3CU7A 2JKXA 2VC2H 2J3SA 4M02A 3ZKNC 2AJXL 2EDJA 5F7NC 3WFZA 1A14H 1CFSA 4Z95L 2A1WH 1I8LA 1S7WA 1W72A 4NUGH 1AHWA 1NL0L 4X7TB 2Z92B 1T2QH 4XZUA 3WNNA 1BJ1H 2KZWA 5GSRA 1NC2B 2FYYB 3VFPB 5IQ7H 3TGXA 3ARQA 3KPQA 2FSEA 2Q86B 4XCYB 5CKGA 3JVGA 3QXAA 4PJ9C 3SKOB 3VFOB 4L3EB 5E4IA 1OM3L 4I9WE 2FL5B 4HH9A 5KAQG 2CRZA 4KI1A 2IAMA 3LEYL 1RMFH 4OCWH 5FDWA 1JP5A 3CCHB 2DQTL 3F6IA 1TTFA 3BGAA 4KAQH 3G6JB 2VLJB 3I84A 4D0CB 3LKNA 3JTCA 1M05B 3BQUA 3RHWF 5C0FA 2LU7A 1AY1L 4L4TE 1IC5H 1RIUH 4DW2H 4FFWD 1MI5D 3DUHA 3ZHLA 4GH7B 4HWEL 1CDCA 4PGDB 4WGVB 1ZA6B 3EYSH 4GRWB 3C87A 5ICXB 4U3XA 4HUMB 3R4DA 4FQXD 4PJ7B 3RP1A 3D39B 5E8EB 1MWAL 5I76B 4RA3A 4GAGL 4UUJB 5DXWA 3SDDC 4RIRA 1I7RB 1VESA 3DX8B 2XN9B 3CSGA 2IBGA 5DA0B 1BQHB 5CUSH 3X3GL 4K8RL 4LLYB 2X4OB 3DRQB 4LLQA 3HE7C 3BP7A 4TOYH 5DHVH 3OXRA 4FTVB 1P4LA 4K94L 1CTOA 4QRPE 1QACA 3NFSL 4OSUL 2P8MB 2CUMA 1CD1B 2VXUL 4RDQF 3QG7H 4MZ3A 1B4RA 4KZDH 3MYJB 4NKMB 2OSLB 4FFZL 4MD4A 3Q6FA 3L3IB 3VFMB 2YUZA 3GSNB 4BQ6A 3BVNA 4ZOEA 3M1BA 1K3IA 3DBXB 1RZJC 1U58A 3W0WD 3BMWA 3DYOA 1A7NL 3LRHA 4NQSA 5IWLA 1WFOA 2CRIA 3H0TA 2D7TH 3STZB 3SKMA 5D7IA 5CILL 1F5WA 1J1XH 4JFOA 2RFXA 3BRDA 4XVJL 2VZSA 4JJ5B 4JRXA 5DUPL 4UOW0 5F7EL 3D39E 1MRDL 3SDAD 1A1OB 2UZIH 4JRYD 4YUEH 3CDGB 4MWFB 1YC7A 5JW4M 3MO1B 4P5MB 3N9GH 4U2ZA 5DEFA 1LHZA 4XCCH 1OPGL 1RJCA 3MR9B 3QUML 1BFSA 5IEKA 1EK3A 2GSIB 1I3RA 1P9MC 5E8DH 2ZCLL 3GSRA 1TTUA 1E6OL 4GQ9L 43C9A 4ZYKB 3VXSE 5CZXC 5GS1C 5H37H 4XMLL 4QOKE 5F21B 5ALCL 1UFUA 3GK8L 3ME0A 5L6YH 2ZSVA 4LK4A 1A7OH 2IALB 1VHPA 1HXYB 3ZKSD 1PD6A 1FG2B 4XXDA 2BOBB 4S1RH 1SVZA 2EDBA 3TH3T 3JV4A 3U0TA 4U1GC 4WTWA 4HW6A 4AY0A 2K7PA 3ZLQC 1ZLVH 1CWVA 4LSRL 5CWSB 2PO6B 1AGCA 4XH2A 3WO4B 5IGXH 3S4SA 4U0RB 3MGTA 2A38A 1YY8A 5GJTH 3PABA 3ARSA 2VOTA 1JNHB 5HXMA 1UWXH 2D7TL 2F54E 4G7YL 4PJ9B 1I7UA 1NFDE 1JK8A 4AT6B 4X9FA 5LWYL 5EOQL 4XVTL 2C4FU 2Z4QA 4WW2A 4X99A 4Q97A 3JWOL 1N2RA 5GRJL 5D7IF 1CFTB 4X4YA 1YEHL 2OZ4A 5A3ID 3CFCL 4J8RB 4U1SA 4LSVH 3GSWA 3ARGA 4M48H 4MNQD 4JFXB 2R69H 2JB5H 3CFEB 3TVMA 4PJGB 5CJXC 5DUBB 3QFDB 1CD9B 3MRRB 1FORL 3F12B 4U49A 5E6IC 4ZFOB 1FL5A 3N85L 1CE6B 1M7XA 3U4EA 1JF5A 3BE1H 3IDMB 5ABDE 1Q72H 2B4CC 4HJ0C 4ZPVB 1L6ZA 5GRVL 5E5MA 4LU5L 1PW3A 3NCBB 4PYHA 1IGCL 3OKMB 4YNYB 4GAYA 3TO4D 5FHBH 1J10A 2FH8A 1F2XK 1K3ZA 5JA8B 2NZ9C 1MCIA 3VD7A 5EO9A 1MCSA 1WIUA 3TJHA 4PR5A 1H15B 4PGBB 3MBEB 2XQBL 3C60A 4Y4KD 1JZ6A 4L8SB 3IGAA 4XVSH 5FYLL 3KYOB 1SM3L 3ZE0F 5EIVA 3CC5B 4O2FB 4X5XA 4IOIB 1YJDC 2YN3A 1T03L 2J6EL 3KHQA 1RZJL 2DLEA 5SX4H 1S3KH 4L4TB 5F88A 4W4OC 5AWNH 4OF0A 1ZGLP 4G8FA 3L9RB 2VDKH 4ZFOL 4G6KH 1G9NH 5FYJE 1DBMH 3C6LB 2ADJA 1NAMH 3BPLB 5DZLA 5F7MC 1DQTA 3HZYA 3ARFC 1JGVL 3I6KB 5E9DA 4HS8H 2WK2A 5FGSA 4PRPA 3RJDA 1DLFL 4HIXH 2NY1B 3CFDB 3MZGB 3HE7A 4NCC1 1A7PH 4UT6H 1JWSB 3DUUA 4H25A 4PB9L 3MRKB 5D5ME 3SPVB 1T1ZA 1MFBH 3CFBB 5KSAB 3CSYB 3KPPA 3F58L 4LHUB 5AZ2H 1YA5A 3IDGB 3D87B 1L0YA 3HE7D 1XCQA 4LPUA 4I48A 3QIBD 1E6JL 4WCYH 3SBWC 3OGCA 2FD6L 5D1XA 5A16A 5IOPA 2AV1B 4QHNB 5JHDA 1Z9OA 1T7ZA 3V52L 1A47A 3HC3L 5AWNL 4KDTA 1UACH 4QOKD 1F3DH 1A6UL 1DCLA 3QO1A 4HXAL 4BUHA 1D6EB 3TBTA 4KRNA 2VXSL 4F57H 4RGOL 1KN2L 4DUXA 4KVNL 1GAFL 5DMGD 4MVBA 3BN3B 4F9PA 3O3DA 2OK0L 5FIEA 1EO7A 2YD8A 5ID0B 4L4JA 1Z0NA 1NGPH 3P0VL 1ZHBA 5DUMH 3UJJL 5GXBB 3EYSL 4L3EA 3C6LC 5DWUH 4Z7NF 3LS4L 4YGVB 4MNQB 3RGVB 2NY4B 3TESA 4YBHA 3ZYJA 3FKUS 1YYML 4QWWC 3F7QA 3MJ9A 1IQDA 4XPBH 4NSKB 5A2JH 1U8KB 2ZG1A 1IC1A 1DBBL 1NUFA 5D5MB 4Z77B 1BMGA 5F9AC 4OLUL 1KCGC 4NGHH 1YYLH 3GB7A 4MDIB 2XICA 3G6JA 5MENE 4NHCL 4R0LB 2O26U 1RZ7H 4XPHH 4HPOH 2FR4B 2D03L 3PP4L 4HGWA 4LLDB 4PJ9D 5EZLA 4EUPB 1U95B 4NDMA 1KJ2H 4JFDD 4RGMC 3F58H 5C2BL 2JE8A 5C3TA 2W1NA 4Z7UA 3D39A 4OCXH 4IRJB 4GKSB 4E5XA 2GUOB 3KPNB 2B2XL 5J56B 1QLRB 4XCCL 5CEZH 4IDJH 4CNIA 2J8UB 4IJ3C 3TF7A 1T0NA 2HFEB 5C0AA 1QFWH 3V52H 4ZFGH 4NRYA 4YR6B 5DT1L 1XMWA 3TYGL 5CJ8A 4ODUA 1TVBB 4PTUA 1RK0B 3K3QA 4JO1H 1YEGH 1A6WL 3JUZA 2XIDA 4APQC 3DECA 3QDGD 4JFFD 3B43A 3MBEC 3PV6B 4KMTH 2YD4A 3CVHA 3FO2A 2ZUXA 1I9JH 1P6FA 1VFAB 4JQVA 4I0PD 1YMME 4Y19D 1NGPL 1FL3A 1CLYL 4XPAL 3VXSB 2LE9A 5FGBA 3UAJD 3MLVH 2UZYB 1EEYA 2FZ3A 5L9DL 4QT5B 1IGFL 1YYMH 1MELA 4D0DA 4LCYB 4PRNB 4HHAA 5HVHC 1LO4H 2XTJD 1A7QL 1QSZA 3GKWH 3DUSA 1ED3A 3EIFA 5J6GA 5GRXG 4DZBA 1YNKH 4TN9A 1B6UA 1UYWH 5C86A 5E95B 1V7NL 2I9LB 4P2OA 1NBZA 2EDOA 2B1AL 3G6JF 2W91A 3ECBB 3KS0J 4HEME 1RUPL 4HX1B 3SOBL 5DJAA 4OGXH 3S7GA 4F2MB 1H3WM 1FYTE 1N4XL 4RGMB 2VC2L 3P9WB 5HHOA 3TIDB 2VDNH 2OXHA 1S7RB 1AGEB 5DR5L 1A7QH 1Q72L 1Y0LB 5C6TH 1JZ5A 4YAQB 5EIIA 3BZEA 1UG9A 3BN9C 4MQ7B 3BGMA 2ZUQC 4HIEA 5LBSH 2EC9U 1RUKH 3MLUH 4HMEA 5E24E 4EN3A 3VWJC 2AEWA 1A7RL 3ARZA 4ONGL 2X7LB 5L88H 4CUCA 2Z31A 2P8PA 2V9RA 4GLRI 4X6BB 4BSVB 1KCKA 3GMNB 5IBUG 2XQBH 1RMFL 4UTBH 1HCVA 1NDMB 1JRHH 4P23A 2JIXA 5FYKU 3AY4C 4M00A 3BT2L 4DFHA 5I9QB 2CDGB 5JO5A 5AAWA 4UMGA 5DD6B 1X4YA 4WU7A 3QDJB 1HHIB 5HYSG 4P9HH 4RFEB 3UTSA 1I1YA 1KENL 4LU5H 4QRQA 3W11C 3IVKA 4LKCB 1FLRL 1Y6KR 4J7RA 4QEGA 4UB0H 4MA1C 2DLTA 4TQEL 3FFCB 4G9FA 2N4IA 1GGCH 1LK2A 1NFDB 3GSXB 4ONGH 3BX7C 2VQ1B 1MWAH 3MX0A 5FYKH 5BMFH 3G6DL 4U1HA 5F9JA 5I1CL 1MQKH 1LP9B 3BKCH 4JFXA 4FFVC 2BMKA 1KB5B 1LO2H 5T1KA 1EO8H 4EKXA 1Q38A 3QEUA 1ZEAH 3BDYH 4PJCE 4IS6A 1IGIL 4LNRB 2AEIT 1U41A 4ZAKD 3ARGD 4OIIL 2VABB 4ZFFB 4WJ5A 3L95A 1OAYH 1EERB 5KS9A 1BZQK 1T5WB 3HG1B 4AJ0A 4QYOA 2GQHA 3KYNB 4MA8L 5T3XD 5TQ2L 4UB0L 4XNMA 5C0EB 5BS0E 5D72L 1F97A 5E0QA 4HUUB 2RCSH 3VXNA 2E7LC 3NFPA 3I9GH 1WZ1H 2EIBA 4HBCH 3OF6D 4XMKH 1CLOL 1FPTL 3RZCB 2A9NL 4HKZA 1HSAA 3JWDC 3VRLE 3MRJB 5F1NB 5T5FH 3I75A 4FMFA 2D0HA 5IB1A 3DXAD 4LLUB 5CIPB 2VLMD 4R7DB 1UWGL 5FB8B 3RWIA 1QRNB 3PF2A 1L6XA 4FQJL 1JNLH 1OD7A 4Q2ZA 4KUZH 4EBQH 2V2XB 2W9EL 3STLB 4WUKL 1HCFX 2H8PA 2X44D 5C0JB 4HKJB 1T22A 3FONA 4U7MA 2HKHL 1S5IH 5D6CA 3AMKA 2ZCKL 2HWZH 1NFKA 3MCG1 3I9GL 4JGMA 4JKMA 4RGNB 4FQ2H 3MACH 2DKMA 2D0GA 3K8LA 2P7TB 3QDMB 4JKPL 3JSSA 1KPVB 4HWBH 4P2QA 4YE4L 1QBML 4WFGE 4LHJB 3VXRD 1T0PB 3RTQA 1MI5A 2DM2A 3GM0A 3D0LB 3WNMA 3S5LA 3OF6A 7FABL 3S3SA 3QZWB 3GGWA 2WAHA 1F4XL 1FG9C 4MS8C 3HRZA 3RAJL 4UT9H 3SPVA 3MRHB 4PRHA 4BFGA 3OKDB 1REIA 4YWGL 4X6DF 4K3JL 2BOCA 2LAGB 3DURB 3QEQE 3EYFA 5L8KB 5AEAA 1LP9F 2VLRE 5DRXB 2ADGA 1UXSB 3DVFA 4U6VL 4KJPC 4F37F 4U6TA 5HD8D 4UIMB 4Y4HD 4CVXA 3O2VL 2X1QA 2NY3B 1A7OL 3B83A 1BD2B 2V9QA 1MCPL 3EW3B 4HK0A 4KPHL 5C0AE 1FVCB 5IVXF 1U8PA 1FV1A 3K4AA 1ZLWK 1I1RA 4Z78A 3UTOA 3LPFA 4DFIA 3V0VB 4PRAB 1H8SA 4MX7B 4WUUA 2AV7A 3G5ZA 4C57C 4JFPB 4Y16C 3IU4H 3R0MA 1NBYA 1V3KA 3L5JA 5D7JC 5A3IC 2BNQA 1QPXA 5A2FA 4LSPL 2VDPH 2DF3A 5D7JD 1SYSB 1MAKA 3ZHKA 4OFYD 3FQTA 5BJTA 3A6BL 3GB7B 1KTLB 4PG9A 5INDB 3I50L 3ARDC 1S7TA 2AXFB 1AR2A 2MCPL 1R3KB 1MCLA 5EOCJ 2Z31D 3VWJA 2GJZB 3OR6B 4DKFH 4U3CA 4U1IA 2YR3A 4GBXA 1I8LC 1GJIA 4O51A 4YHOL 5B4MD 1DANU 5I66B 4Q6IC 1JUFB 5C08D 4F80A 4N0FA 1T21B 2VUYA 3L7FB 3KNBB 1FZJB 5HD8C 1C5DB 4P59H 1DDHB 4MJ6A 2EXYC 1RZGA 1WF5A 2FGWL 4XNQB 2OR9H 1F3RB 2MPAL 4LRNL 3A6BH 2VXVH 4TSAH 3JV5A 2O5ZL 3QDGE 2WANA 2VDKL 4ZO9A 4EI6A 5BW7A 3BZFB 1MLBA 2WQ8A 5HYFA 2Y5TB 1MCPH 2VDMH 5CZXD 5J13C 3QNXB 1D5ZB 1KXVC 5F96H 5DHYA 1L0QA 3VW3H 4F9LA 2AGJH 1WSST 2EC8A 4WGWB 1ZHLA 3UPAA 3ABZA 3O3EA 3CVHH 4MB3A 4AH2A 4NQXA 3JXAA 4LCWA 4W6XB 3JV6A 5DRNA 1J0ZA 3L6FA 5JLZA 3BKJH 2EDWA 1U3HB 3D0VB 4OGXL 1D3CA 4PFEA 3GKZA 4F58L 3SDAC 2OI9C 2XN9E 3WXWH 5IHBA 2XTJB 1Q1JH 1YEDA 2I9TA 3BEVB 1U8OA 1T1XA 2A83A 4U6XB 4BELD 1FIEA 3PWUA 1CGSH 1RJLA 1BEYL 2F5BH 2F5AL 4WFED 4XNYL 5ITBH 5MEND 3VMPA 4L8DA 4M6AA 3ZL4L 5F89A 5JPMB 1MIEH 3GUTA 5CCKH 2YKLL 1PX4A 2DD8H 5GS2D 1CICD 5DD0H 4NT6A 4Z7NE 4CADB 2SEBB 1S7VA 2NMSA 1RUMH 3DI3B 1NSNH 3U1SH 3V95A 1BVKA 4EDXA 4YLQT 3WXVL 1MFNA 3WXWL 3S36X 4JRYE 3G5YA 1YEFH 2ILLA 4M7JL 2V17L 4GW4B 1NFIA 3VJ6B 4PJHF 1GIGL 3LN5A 5DQDH 4JZJC 1CGSL 2W0KA 5EU7E 4MQ7A 2VIRB 3QIWB 4M6MH 4RSVA 3MLSL 3P0VH 3SE4A 2EZ0C 1ZLUK 5FKAB 4DGYH 5EZIH 1FFQA 2WINB 1I3GH 5D2LA 5FUZH 4XZUB 2BSTA 5LG1A 5IT2H 1NC2A 2FYYA 5BRZB 3KLHD 5DJCA 3ARFB 2BSRB 1MQKL 4GRMA 3ORJA 1JHKH 3PQYB 1DL7H 1ZEAL 3N1MC 3OL2A 4NN6B 4NNYB 1NGZB 3SGJC 4HQQH 1BQHG 1CYGA 2DLGA 3NABL 5KW9L 1MLCA 4NO5B 2GT9B 5IMKB 3BH9A 2F5BL 4JFHE 5IBTL 4MA8H 2PN5A 4MAYD 2IG2H 4NPYA 3VCLA 1MWAA 1VEMA 2K9UA 1EIBA 3EO1B 3WS3A 5C1MB 2YKLH 3UZEA 1F42A 1LQVA 4XX1E 4KQ3H 5IQ9B 1XR9A 2AEPL 3QQ4B 4NC1C 1HHKB 5D6DC 1FE8H 4JREC 2YRZA 4PV9A 3TZVB 5E7BA 4WEMB 2NY5L 4TUJB 1BOGB 1G7MB 2BY0A 3PDOA 4ODHH 3ALWA 2C4FT 4WNQA 5FCSH 2IC2A 1CR9H 5DS8B 1GSMA 5D7SH 4YHPB 3ARDD 3O6FD 3M8OH 1WISA 1MFCL 3WHE0 4Q58C 2AXGA 2IF7A 1P7QB 4WU5A 3I75B 4CVUA 4ELMF 4XP5H 3F6LA 1XR8B 1Q9KA 2AJUH 2V7NA 5I1IH 1V7ML 4Q9QH 4U1JB 5LVEA 5E6IA 1NC4D 2ZPKL 2R2HB 3OBAA 3T65A 4LLAA 2E7HA 3KLAA 3V6BR 5LXGL 5JOPD 4XHQA 1KIQA 4UQ2B 1AD9B 5IHUH 1KJ2A 4LLWB 4PRIE 1NJ9B 1VEPA 4JZJB 4XGZB 4YDVA 5DSCA 1A4KB 1H0DB 3A6CH 4ALAL 4G6AD 4JFHD 2VLLB 1ITBB 3J7HA 1IQWL 3WKMH 1ZWIA 4G6JH 2EDEA 4G80A 2J8HA 3QQ3A 5HHME 3QUMH 2OI9B 3RIAF 4O2EB 3N1GC 1D9KA 4KJWD 4BSJA 1FYHB 2DDQL 4OLYL 1G7HA 3W0WB 2VLRD 5KVDL 1TZHA 3S5LB 4NZUL 4TVPH 1R5WA 1HH9B 5E56A 1I3RB 1SEBB 1JGLL 1OTSD 2XV6B 2Y06L 1RQ5A 3EYUL 4HMDA 4NBXB 1OF2A 4BFIA 4LPXA 4J3UA 4TSBL 3IU3B 3CFJB 2X4SB 2G2RA 3MRFB 4U2YA 4F8TA 3BPOB 4KJYA 3WO4C 1O7SA 3QPQC 3H9SE 1HXYA 4YXHL 3MLTB 3VFPA 3ULSA 2APBA 4LPYA 4OGAC 1KTDA 3O8XB 3RY6A 4CMMA 3QXTA 3TO4B 4YBQC 3VFOA 4Q6IA 2OP4L 2J6EA 3MA9H 2HKFH 2XZQH 4MXQC 3BZDA 5KVMC 1U0QA 3S4SB 3VXTB 3O6KL 2C1OB 5J7CC 1VFOA 4EJ1C 3H7BB 4U33A 5L7XH 5IMMA 4MNGA 2AI0H 3QDJE 1AGDB 1XF5B 2L0DA 5DK2A 4QRUB 2YUVA 5IJVA 1IT9H 4C55A 5IVZA 4FQIL 2AV7B 3LKPA 4JR9L 1ZHNA 3EOBA 5HDBE 2QEJA 4QHMB 4FG6C 1H3PH 1A14L 2P47B 1KTRL 1V8HA 4GBXD 5HI4C 1MIMH 3WD5L 3BPCB 2OR9L 4N0UE 3RU8L 4XCNB 2DYPD 5EOTA 4PS4L 4DN3L 2WP3T 1LEKA 1S9XA 1WQVT 1JF6A 3X11A 5LQBH 1UCTA 1YPZF 3PGCA 1XIWA 1VFBA 5KG9A 5I66A 3SN6N 3MNVA 5FHAH 1BF2A 1FAKT 1PLGL 3VFNA 3TA3A 5IBLD 3I02A 1I3VA 4Z7QE 1I9RH 1IFHH 5SWQA 3IRPX 1ZMYA 3GIZH 4DKDC 1CGTA 1IAIM 3VGFA 3G08A 3VXUD 4PR5B 4KI5E 5DVOA 5GS0L 3M1BB 2YD3A 4WUKH 2R1YB 4N8VB 3FFDB 5JDSA 2J88L 2O5XL 3MUJA 3TV3H 1HWGB 4XT1C 5IV2B 2W0FA 5CJOH 1E27A 1MHCA 2D31B 5T3ZH 5L8JB 4PLJD 3O4LB 5D71H 1QRNE 2PR4H 2VLRB 5HDLA 3OQ3B 5F97E 4LQFH 1MCFA 2IFFH 2WBWB 1CLOH 3S96A 4KK5C 2QADC 4X4XA 5DRNB 2XWBA 4S2SA 2AK1L 2Q7YB 4RMQA 5MEPA 1K2DB 2IH3B 2CK0L 4Y5XB 1A1OA 3NFSH 4LSUL 2B0SL 1MAML 1II4E 3U30C 2UYLB 3OKKB 3VD9A 3FQNA 1OCWH 4I0PC 2I9TB 4RWYL 5B4MC 5EFIB 3OKNA 4KVCH 1QFWM 3WJJA 5GRUH 1KLGA 1NGWA 2H32A 4MCZA 3SGKA 1HOCA 3RZWA 4FNLL 3VXPB 43CAB 3GMOA 1JI1A 4WI8A 4H88L 3HLAB 1L7IH 4JQVC 4KQ4H 4LQ1A 4PRBA 1G6RB 4RZCA 3K4ZA 4KXZH 3DGGA 4QRRE 3UTZB 4BH8A 4C58B 3VRIB 2VWEE 4NQEB 4L3AA 2B4CH 2HLFC 1G7QB 1DQDL 3VJ6A 1KJMA 1IGJA 4N90D 3TV3L 1A2YA 3GSQA 1NMAL 1AGFA 4NFBA 3NACH 2FHFA 3KWWA 2KH2B 3MV01 4JPVH 4Q9RH 4DVRH 1C16B 3K1KC 1LO5A 2FB4H 3VD3A 4O02L 3IETA 1AGBA 4LKXB 4PLOB 5GRZA 2WINA 3T0EC 5K9JH 3Q2CA 4DN4H 1EGJL 2DYPB 5ETUB 4YH6A 1I9IH 2DWDA 2A6KB 4QWWD 2CLVA 3SY0A 5HJ3B 1AD0B 1IZJA 2EDKA 3I50H 1TVHA 4OLXL 5GJSL 4XP5L 1PZ5A 4KUCD 4YGVA 3RGVA 1OHQA 4HUXA 4K7PH 5TE4H 1YEJH 1YECH 2XKNB 1LE5A 3PNWB 2J8OA 2EKSB 4OV5B 3BAEL 1AJ7H 5A40E 2BXYA 3SKNB 2JJTC 3N9GL 4WFEE 4MDIA 3KPRD 5C7XL 4U6YB 3S8WA 2IADB 2EIZB 3EJJX 4XB7A 4PP2B 3BZ4B 3IXAB 5IB4A 2BX5A 3Q3GA 4U1LA 5FA3A 2WP3O 3INUL 1GPOH 3QA3B 1N6QL 4WI2A 1AO7E 3ZE0E 3KDMA 4HIJB 2OX5A 1HHJA 1G1YA 1XF1A 5FM8A 5ERWB 4JZOA 3IJHB 3E3QE 4OF5A 1LD9B 4W6WB 5ALCH 5C0AB 1J18A 1BQUA 1UM6H 1V3JA 4JFFE 3O81A 2IPUG 3LSOA 1WLHA 3HZVB 5JW4N 1JZ3A 5GJTL 3WN5C 5T1LB 3BRGC 4JPWL 3C60C 4G43A 3K0WA 1PY9A 5HI3D 3V6OC 3VU2A 1X44A 4NCC2 4PJCB 4CKVX 3C2AH 1PKQE 4M1DH 3IDUA 1N7MH 1DQMH 5TGBA 4IDLA 4PJ7E 2Y7QB 4DGIH 3OXRB 4FTVA 4W4OA 5MEQB 3WS6C 2P5ED 2NXZB 2N1KA 2NY6D 2YUWA 2R29H 1KJ2B 4P99A 4K2UH 1K5NA 1V7NH 4KV5F 5GGVY 4I8DA 4J3TA 3FTGA 4ODTL 1QSFA 5JUEL 3ELAT 1JWSA 3NPZB 4NM8H 1ZANH 4OZ4A 3L3OB 4G80B 3SO3C 3AC0A 4B7LA 3K8KA 1XZ0A 4MAYB 4Y2DB 4KJQC 3VFUB 4FQHB 5J12C 4L4TD 2DN7A 2VSCA 4M93B 2HT4C 4JFFB 3ES6B 3AAZA 5T1LD 4WWKB 3TIDA 4HC1L 4J3OC 5BS0D 3HFML 4E41D 3JBG7 5DMIH 3NZ8A 3P40A 5HGBA 1NUDA 5IEHB 4I1NB 3O6KH 2BNRA 4NO0B 4WEUD 5EU3A 5FOBA 5HYJB 2VISB 2O61B 2GKIA 3Q5OA 1OGAB 4U1GB 5GHWH 3FOLA 3BMVA 4PREB 4PDCE 3H9HA 5C08B 5I15H 4JFEA 2HJLA 1JL8A 1CD8A 3ZMRA 4DGIL 5JHLL 1NGYA 4Z76B 2VLME 4PJ8B 2UWEF 3CZJA 3L3HB 4LSDA 3QNZB 1N6VA 1B0RB 3MOBH 5F3BB 4QCIB 3FT2A 1CTNA 15C8H 3CD4A 3IRZA 4OCRH 1EHAA 5GGSA 3RDTD 1I8IA 3MGTB 4G59A 4L9LC 5JQ6H 2NYYC 1WV7T 3AB0C 3JTSB 4LASH 1URLA 3Q1SL 1JGVH 3ROOB 3QH3B 4QXGL 1PG7X 1AO7B 3IKCA 4FQPA 1MCJA 3QUMB 3GMPB 5KOMC 3P0GB 5BQ7A 3RL1A 4IOFD 5E1AB 5ITFA 1WBYA 4I3GA 2VABA 2BP3A 4LL9A 4NFCA 5IMOB 5JW4Q 4LSSH 2Y07H 5ACZB 4JHWH 3DO7A 4NZJA 3AREB 5CLTA 4BZ2H 4WW2F 1FFOB 5BVJA 3RWFA 4GW5B 1RZIB 2WBJB 1ZHKA 4HGKC 1Y18A 3DSNA 1J0YA 1G1CA 3L1OH 3RZCC 5JR1H 4NQDE 1J1OH 4XI5D 2NR6C 4JFED 4NQCB 5D1ZB 1F8TL 4HWUA 1ETZB 1WT5C 3SE3C 3TBVA 3RX8A 1UZ6E 4FQXC 5I1HH 5IVNA 4EQ2A 5I1EH 1QKZH 4WO4D 5IB1B 4PRNA 3DTXB 4PJBA 2X5PA 32C2A 2RBLA 3BUYB 3L5WA 4AEHL 1JYVA 4NKOA 4JHWL 4DVBB 15C8L 5BVPL 4V3DB 2UWEA 1JWMB 1D7FA 4NC0B 2BSSA 4LVHC 1S7SA 5DQ9B 5I74B 3LEXA 4N9GA 2CGRL 4JVUA 1ZOXA 5KVGL 4HBQA 2V7HA 2ICES 4NJ9L 4KHTL 5D9SA 1HI6A 2CKBB 4MNHB 3NTCH 2FATL 1EVTC 3LZFH 3GK8H 5L6YL 5JHDE 2C1PA 2HLAA 1IE5A 1KJ3H 5GISL 2OQJA 1SYVA 2YD2A 5EFIA 4F7MB 4Y4HC 4RMTA 3GMLA 3IYLW 4MSWA 2FJFB 3MCLH 2VH5H 3OJ2C 5I1JL 1AQDB 3OKEB 1F6AA 5E00A 4PRPD 5KS9F 5D7KE 3ZSSA 3GHBH 3UTTE 4WW2C 4ZS6C 4RMRA 3EFDL 4P3WA 4BZ2L 2CGRH 5B8CC 4LARH 2BY1A 4UNTA 2JJTA 5DT1H 4POZD 1MJ7H 5JZ7D 1BD2D 4XVJH 4NZUH 3ARDA 4X98A 3ARBC 4LCCA 2IQAA 5EOQH 1N0LA 1VEOA 1ZA6A 1P4BH 4PYGA 4KPHH 4AEFA 4XCYA 2DQCH 1QKZL 3CDYA 5DHVB 4Q9CA 4PRIB 5DO2D 3OZ9L 5J89A 2J12B 4NZDA 3OR7B 4LP4A 4O5LL 1RJYA 4Y4FD 1CG9B 5AUMA 4ZAKB 4LIQE 2DTMH 3RUGE 3QUZA 1V5JA 3CCHA 3HI5H 5SWZA 2V5TA 3VRJB 2CQVA 3BE1L 4AM0B 2Z0BA 1P4LB 2DQHL 2FIRT 3O2VH 3U0PA 1CF8L 3MLXH 4PJ8C 2HFFA 5EU6E 3RWJA 2IQ9L 4OIAA 5JORB 1A6PA 4YHZH 4NBZB 3AS3A 3U0WL 2X9WA 1QTYT 2Z35B 3S3JA 3QO0A 4MQXD 3KPMB 4XC1L 4CMHB 5C08E 4X83A 3BEWA 3IU4L 2XNAA 4PP2A 4PJIE 4J6RH 1ACYL 1B90A 4G8IB 4X6DA 4UTAH 4NN5C 4YHLH 1RVFH 2Q76A 2NW3B 4JO4H 3UTQA 3S37H 4JAMB 4R3SB 3IFOA 5FYKL 3T3PF 1Z2KA 2F58H 3DXAB 1WEJL 4HFUH 1X9QA 3ULVC 3OHXB 4XI5C 2DICA 5GS1B 2OJEB 1MCEA 3MMEB 2ARJB 3MR9A 3EO9H 3LD8B 4PJAE 3BSZL 1JFQL 5EU4B 4APQB 5C0RL 3KXFA 3LN4A 1QEWB 1D5ZA 3KR3H 3FQRB 1LNUB 4JZNA 3GI9L 4P4RB 3NCYP 4OTXH 4XP4L 2W07A 1UA6H 4HIXL 1JGUH 4JFOB 1INDL 1DVFB 1QLEL 4ODXB 5EH1A 2XY1A 4JO3L 1QSEE 4PJHB 3LPGA 5HPMA 2A1WL 4F57L 4WI4A 5GZOC 1NL0H 5C0CD 4P5TA 1VFMA 2KQMA 5IWLC 1I9EA 1S7QB 3CVHB 3FO2B 4XMKL 5KSBE 4KKBD 1BPVA 1TNMA 4R4BB 3CDGA 4MWFA 4PJIB 4MNGE 4XXCC 3FTGB 3DVGA 3TH4T 1CFVL 4Y5YA 5C09A 1U8OB 4ZUTA 3WO3B 3CIQA 3UBXA 1LQSR 1NCDL 2P24B 5E2TH 3UTPD 1ADQH 3FRPG 3MRHA 4KI5C 5FV1L 1YPZB 4DUVA 2BFVL 3RKDC 1ACYH 3T2NL 2OR7A 5KN5B 1T1YA 3RQ3A 5EUOA 1YN7A 4I18B 4JCLA 4KAQL 4GG6B 4CU8A 1X7QB 3NN8A 5EBGA 4EI5B 1DUYA 4FZ8L 2DIBA 5D2LE 3KS0H 3P4OA 5ILTH 1FNGB 4MJ4A 1G0XA 5GRUL 3GJFB 2X40A 3U0TB