3ROUA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 63
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rouA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rouA01
4L9VA 4HAMA 1HXDA 2MA3A 3WGGA 4LTAA 2PJPA 4IEOA 3RYPA 2LF7A 4HVQA 1FBQA 4P96A 5ERIA 2XLGA 3LWCA 3H7JA 4YRDA 1W4MA 3BY6A 4LB5A 2HFHA 2VECA 3GFIA 3I5UA 5KHGA 2W25A 4RB0A 5ILUA 4HN0A 3C18A 1J59A 2WTEA 3J7AO 5ICFA 3L00A 2IXHA 1S8NA 2EB7A 2IPQX 3G73A 2Q2EA 1FSHA 4XF0A 4P9UA 1P4AA 2M1BA 1EH8A 4JTNA 1FYMA 1FBUA 1J1LA 3MQ0A 4KA4A 2GXGA 5BMZA 4MGRA 3LZZA 4E70A 5DUIA 2ISZA 3EDPA 1ODDA 3F22A 4MGKE 1XGOA 3HOSA 4EM1A 4ESBA 2D5HA 2L02A 1J9IA 4S05A 1KQ9A 4PDKA 1LNWA 4MV2A 3PVBB 3M9AA 1SD7A 4EGZA 3RKXA 2VE8A 4KIFA 1HQCA 4L5IA 2KXLA 1IN7A 5E16A 3K1NA 3MEXA 3K1PA 4IEVA 2EFQA 3RYRA 1W7PA 4WF2A 5E20A 3GW2A 1Z05A 3WODF 5HLHA 2CW0F 3LOIA 1BIBA 4AVCA 1PP8F 3K2ZA 2O1QA 3M3IA 4FAHA 1ZG3A 2DK8A 4EWDA 2QZ8A 2DK5A 3D82A 2G7UA 1PUEE 2ESNA 2GXBA 3JW4A 3GF2A 1HSTA 5E1XA 4YFKF 1JUHA 1YFWA 1YW7A 2VONA 1ZZ8A 3O14A 2ISYA 3PFIA 3GWZA 1JGSA 3M1EA 2R7FA 2FMYA 4CO8A 1OMIA 4KNYA 1Z6TA 5EEHA 4AD9A 3RI4A 4ZZLA 5LGUA 5JCTA 1R1UA 3O2PE 1HW2A 3H7YA 2IC1A 4PJYA 3ELNA 4E2QA 1R58A 3E5UA 1CF7B 1QGPA 4OOIA 1P4XA 1UIKA 5BPIA 1QO0D 3HHGA 2QBYA 3SZTA 4WVZA 2Z9OA 2MH2A 1B6AA 1B1BA 3EYIA 1KA8A 1FOKA 4QXKA 1TQMA 2QWWA 5H20A 1TQ5A 1WA4A 2JRTA 3DP7A 3BU7A 4Y15A 3MCZA 4KMFA 1XSXA 1VP6A 2DT5A 4QGNA 1J0RA 3KETA 3MYXA 2VODA 5BPXA 3DKWA 3KP7A 5JR7B 2IXKA 3RPUA 4HN1A 1VR3A 4FBFA 1LDJA 3WW4A 3ZMUA 1J3RA 1PMIA 3F8NA 2E1NA 4A6EA 2F5FA 4XSXF 3U0ZA 4HVOA 3F8CA 4Y13A 4BH9A 5FQ0A 2UXNA 1XDUA 1RUNA 2Q30A 4EJUA 3U1DA 1U5TC 2XUBA 3C3VA 3K9TA 3F6VA 3LWFA 1OKRA 3BWGA 3MZHA 2QBYB 3GX4X 2IA2A 4IF4A 4EQQA 1SEFA 3WW2A 1O57A 3CUQB 1SMYF 5LEKA 5K8SA 1OPCA 4EJOA 4QLCU 4WX9A 3C1DA 1HBXG 3H3ZA 5HOOA 3FM3A 1RC6A 1CAUB 2RC4A 1KQ8A 2P7CB 4ZU7A 4Z07A 3HTSB 3R4KA 2P5KA 5LLQA 2IXJA 2D93A 4RAYA 4XSZF 4O5VA 1LQ1A 1FT9A 4I98B 2VQAA 2FMLA 3EUHA 2O6GE 5LBQA 4MGZE 5HI0A 2RQPA 3K0LA 5AIQA 3WTZA 5FPXA 5FLXK 1W5SA 2NNNA 3BPVA 4YIFA 1XGSA 3JSPA 1WWXA 2P4WA 2D1VA 4ZYHA 4XFIA 5H6QA 3S0MA 5AONA 2DPUA 5K1YA 2ATFA 3ECOA 3RYKA 2KIFA 4B8XA 3J81Z 5J3UA 1PDNC 5DD4A 2V1XA 2CAVA 3E5XA 4WCGA 3EO6A 1YTYA 2XL7A 2BGCA 3I53A 2E7XA 4Q0SA 1ZZ7A 1FNNA 3JZVA 2ZFWA 1YFUA 4LK1F 1V70A 3NQOA 3RDIA 4IEQA 5I8SA 1ONVA 4A0ZA 2Z3YA 4M73A 1F1ZA 3BZ6A 3TO6A 1DGWA 1IPKA 3FZVA 3DF8A 1CAUA 1LDDA 5CVVA 2XV4S 1U2WA 1YLLA 1XSVA 5I8YA 1UIJA 3WG9A 5FD6A 4HSJA 4HX8A 2EAAA 3HQXA 4BHBA 2FQ3A 4P5OA 4UXAA 4HOBA 3P9KA 3VOEA 2HDCA 1FI2A 4ONUA 1CAWA 2V79A 2QENA 2NAZA 5CVUA 2PA7A 3KFWX 4HQEA 3WTYC 1K79A 3L09A 4U0VA 3TOAA 4LUMA 4KL1A 2Z2SB 3QU6A 3WTVC 3F21A 2IXCA 4CYDA 4MGIE 5JSRA 3WW3A 3CJXA 1O7LA 3T5XA 3DEUA 1I1SA 4K2EA 2LF8A 3FHIB 4MNUA 4IEXA 1U78A 1Z6RA 4DINB 4META 4L9JA 3CLPA 2VC0A 1DZRA 2DCTA 3SCGA 3GO5A 4F8AA 1J2XA 3R0AA 1EH7A 3H92A 4MQ9F 3I54A 4HDUA 3OTFA 2ET7A 3V7CA 3ZMSA 2HR3A 3SXWA 3I59A 1UHMA 5E1WA 1EYBA 1XGNA 3OF1A 3KE2A 1K78B 1YS7A 2CYYA 1FX7A 2O8XA 3ERED 1ZX5A 1O3QA 1VTNC 3TNPB 3ZMDA 3TOBA 4N9IA 3COAC 3HHHA 4KN7X 3RIRA 2BNOA 1UHWA 5T3NA 1IN6A 3FF5A 2QJVA 3KCCA 1U5TB 4AIJA 2L54A 3RPQA 4GYIA 4YNIA 2CWEA 2PAMA 1T39A 3R61A 2PQQA 3TO9A 4IJAA 1GHCA 3IDBB 1QPMA 3QAHA 4KUMA 4Y17A 3WGIA 3TO7A 4ZYEA 1LKNA 4XFGA 3TDZC 5FQ0B 4I09A 4DNCA 4OINF 3V8KA 3ZMTA 3OOPA 1G3WA 2FRHA 4XF4A 4ZH4F 4HSLA 1VJ2A 4WXDA 2QYOA 4BIFA 3NL1A 1UB9A 3L9FA 1X8MA 3CUOA 2EA4A 2EV6A 2PAKA 4BHPA 4EMSA 5A2QK 4L0YB 3I7DA 3DFGA 4Z2YA 1YFHA 3MWMA 1CAVB 1CAVA 2K86A 1QXJA 3I71A 5KVRA 1YLFA 2RNJA 5JVTA 3Q9SA 1W7PB 3DQVC 3ABUA 1SFXA 1OYIA 1YUDA 3NEUA 1USSA 2ZKLA 3FXQA 3I4PA 4HQMA 2ZMEB 2BNNA 1SQ4A 1LVAA 1OI6A 1T6SA 4RB2C 5I0RA 1W5TA 1QY4A 3BJOA 3HIFA 1EH6A 2D45A 5BS6A 1IUYA 4XFCA 4JBAA 2QDRA 1BI0A 2KRFA 4MEYF 1XGMA 2XIGA 1BM9A 1S29A 3VODA 1KU2A 3FM5A 4N0BA 4Q0QA 2JPBA 1YHFA 2HQRA 1TW2A 2Z33A 2B0LA 4Q0VA 1I6XA 1ZRCA 3GZ5A 1SD6A 3TNQA 2VOOA 4Q5SF 2ZKZA 5LGNA 1FWZA 2FU4A 2V1UA 2FE3A 3VEPA 1Z9CA 1YFXA 2QQ9A 1MKMA 1IW7F 4LLGF 1HKSA 3V8LA 1O3RA 2K4BA 2K27A 3MDPA 4HF1A 2M45A 3QP5A 1XMKA 4UHTA 3H50A 4Q4ZF 5K5RA 1Q3EA 4UVAA 3GFLA 2XHKA 1WKMA 3H9AA 5DD8A 3PQJA 1BI1A 4GXOA 3QRFF 3QACA 4RGXA 5ILSA 4A6DA 4YARA 4ON0A 3S7EA 4IRHA 4LMYA 4RB3C 5KHHA 5KHIA 1ZREA 1NE6A 3S7IA 1OD5A 1S7AA 3FFQA 3E3VA 2K7LA 3WTTC 1U12A 4MGYE 1TQIA 2MPFA 2DI3A 3WGHA 4DQ2A 2X4HA 1MJAA 1PP7U 2XRNA 4U7BA 3F8MA 3H8UA 4N9HA 3M70A 4KWLA 4OIRF 1FXZA 3CUQA 2F5CA 2H6BA 5HDNA 5EFUA 3T8TA 4MHGA 2CFXA 4PIXA 3LA7A 1BI2A 3NJZA 2NNYA 2RDPA 4BAYA 4CXFA 3M8FA 5L3DA 4OIOF 1F4KA 1EV7A 4CZZA 5HS8A 3UKVA 4M71A 2A6EF 4AXOA 3HSEA 4XFHA 1LJ9A 1REPC 1B9MA 3CUQC 2IJLA 1NXMA 3LAGA 1F5TA 4J1XA 2XAHA 2CV6A 2H94A 4EROA 5TRDA 4EWAA 4A5NA 1RIOH 1YWKA 2DFIA 1H0MA 2Q8KA 3DV8A 3VFZA 3KP5A 3NRVA 2ZXJA 3VHRA 1XDSA 2A5YB 5HS9A 1L3LA 3HUGA 1O5UA 1SFEA 1OR7A 2GZWA 5HS7A 3SCFA 2H0VA 1O3TA 4AQ6A 3ACLA 4B09A 2STWA 5ICCA 2OQRA 1J5YA 5F6FA 4S04A 2AS5F 1NYWA 2IA1A 2UYAA 4XF3A 4ENKA 1B4AA 1ON2A 5AVPA 5I8TA 5LHHA 2A69F 4PCQA 3KGZA 1JHFA 5FGMA 4QWQA 4BYYA 5EEGA 1V3FA 3E6DA 5J6XA 2BE5F 3MPBA 1XMAA 5J8FA 1QXRA 2E9QA 1NHAA 3G7DA 3L2HA 4KT5C 3L7WA 5D8LB 4XFBA 5KHJA 4D7TA 5D4RA 2FA5A 2MLGA 3JSOA 1ZN2A 1JXSA 2Z99A 1YFYA 4LG0A 5KHKA 2XKOA 1D8KA 3E5QA 2ELHA 3KSCA 2HTJA 4WWCA 1Z91A 1U6GA 4OU0A 2P17A 4IRIA 4RAZA 1SD4A 4XLPF 4ZZDA 1FSEA 2A68F 1WLTA 4RS8A 4UXNA 2CG4A 4M9ZA 1XD7A 4AQ2A 1GQHA 2Q1ZB 2FBHA 4ESFA 3HRSA 3RKWA 1K6OA 4Q48A 2IVMA 2IW5A 3P9IA 2EK5A 3O6BB 3ZMVA 2VBYA 2ZO4A 2Y48A 2ZNYA 5JAXA 1QBJA 1UCXA 2IXLA 1CAWB 4G8XA 3WTUC 1IRFA 1X7NA 3CO7C 2L3DA 3KLOA 1K7AA 5CVJA 3Q5FA 1B59A 3T1BA 2VBXA 3N4MA 2D5FA 3BPXA 4RGSA 3HSRA 1DZTA 5BPDA 3WTWC 2XASA 4LG0B 3CEWA 2Y0OA 3NVCA 5IT9Z 2EWNA 1XSDA 1L3JA 3ZP5A 2O8QA 2DBBA 2VT2A 4O9GA 3GVAA 1ZG5A 4KU8A 2ACJA 4UUVA 5L3FA 4WBBA 4FX0A 3ES4A 3E6CC 4G7OF 1IF1A 1D8JA 3ABTA 3TKYA 2PG4A 1QNTA 3U10A 1LEBA 1Q43A 1GQGA 1SD5A 3KZZA 4ZU4A 3ELKA 2O0YA 2FQPA 4X6QB 1ZARA 5JHUA 1AWCA 4HF2A 1RNLA 2BYVE 2PMHA 2PQ8A 4J1WA 4O6JA 4LJZF 3KP4A 4RB1A 1WRJA 3ZN1A 4BHCA 4QM8A 1T0FA 3BOQA 4LLOA 5JFRA 4RD7A 3OV8A 3TQNA 4HBLA 4F7ZA 1CF7A 2Y0MA 1EPZA 1G3SA 1ZLJA 4OIQF 4KMUX 5L3EA 3ZDSA 2K0GA 3KZYA 3FZ3A 4UBHA 4TLFA 2QQAA 3FMSA 1GXQA 4LLLA 1HSJA 1T98A 1E17A 1BOAA 1YIOA 1A04A 3JTHA 3IHUA 5FDBA 1ZZ6A 1BIAA 2L4MA 1O7FA 4Q47A 3EBRA 3RTRA 3USSA 1IRGA 1TNTA 2QLZA 1GVJA 5DUKA 4B29A 1P92A 3CLOA 2PLYA 2DU9A 4L5JA 1MJBA 4LB6B 3KGLA 1TTYA 3VB2A 3D0SA 4HBNA 5ICEA 4IEYA 5E18F 1JE8A 5K5QA 5J48A 1R1VA 1KYZA 3H1YA 1ULYA 4KWJA 1FY7A 2HS5A 1ON1A 4GGGA 4IXAA 3NW4A 4MUVA 2XLFA 4P9GA 1I27A 4XRFA 5D5XB 1H9TA 2ZMEA 5DDGA 3KLNA 5CVRA 4IEWA 1R7JA 5LHIA 4JK1X 3RNSA 3E6MA 1J58A 3IIAA 5I91A 4EM0B 3KP6A 5BOXA 2XROA 2ZCWA 3FXRA 4XLNF 1DGRA 4WZCA 5FLJA 4HZFA 2M8EA 3KEQA 4FAGA 3I58A 3HRMA 2FBKA 1QZYA 5DCFA 4H0EA 1Q5OA 1WGPA 4IEUA 1UCRA 5BQTA 5FPZA 1BJAA 2HYGD 2EFPA 2RN7A 5FLIA 4HYEA 1Y3TA 3LA3A 1XCVA 5E8IA 4BNCA 5EZWA 3BP8A 2V09A 2WC2A 3NSTA 5D6EA 1CAXB 4X6RB 2HKXA 1FP2A 3BDDA 4PZJA 2V9VA 3QOPA 3V8JA 4BXUA 1XB4A 4M72A 3QPTA 1H1IA 4G6QA 4G6DA 5D8KB 2CO5A 2DTRA 1IXRC 1R5HA 1R00A 4L0ZB 5DEQA 4E2SA 1R36A 3E6BA 2QUFA 5FLHA 4XF9A 2GU9A 2IXIA 2F4PA 1KU7A 1ZVFA 3W6JB 2ZJ2A 3QP6A 4I2OA 1SMTA 5LGTA 2GQQA 4ENJA 3ETQA 4D7SA 5E1ZB 2B5HA 1U5TA 2XVCA 4FHTA 2OZ6A 2G7HA 2YSRA 4ZYDA 1MGTA 2X0LA 4GULA 1ZYRF 3EHKA 3I64A 4L18B 1U8RA 1XCBA 4I02A 3H1WA 3MZYA 1ZRDA 4ORFA 4ZYGA 4M6YA 1G3YA 4QGMA 3WE3A 2IT0A 3IL2A 4QM9A 3T0YA 4IERA 3LA2A 4P9FA 2IA0A 4Q29A 3LFKA 1IZ1A 4WXCA 3IWZA 3HSFA 3OCPA 1MDMB 2HTSA 4OLLA 1RI7A 5FCCA 2V6CA 3AAFA 2XLAA 2UYBA 3SZPA 1Y0UA 2LNBA 1FPQA 4O3MA 3PLQA 2W84A 2HGCA 2DQRA 4MZUA 4EVIA 2CSOA 1RTVA 2ZBKA 4JVAA 3S2WA 1ZZ9A 3ES1A 3UKNA 2EJRA 5JSOA 1IPJA 2Q0OA 1SFNA 1DPRA 2K9ZA 2FOKA 4WXHA 1UFMA 3F8BA 4R52A 2XAQA 3FXUA 2R3SA 4M9SA 1TNSA 4KIGA 4UVCA 1TLHB 3SQNA 4PIYA 4NVPA 1HKTA 3LQRA 5CADA 1YS6A 5ICGA 5A2QZ 2VT3A 2KIUA 5C6CA 1G3TA 2MC3A 1NE4A 2VOPA 3KMHA 2Y75A 2FNAA 2W85A 4IRGA 2A6HF 1WQ2A 2BEOA 5HLGA 1KU3A 1UW8A 2VBZA 5ED4A 5D5WB 1ZRRA 1P6RA 4XFAA 2OQGA 4IETA 4NB5A 2YPRA 3N97A 2XGXA 3CF6E 4A0XA 1YQAA 4EGYA 1YO5C 1ZLKA 1NZCA 3H3UA 2RV8A 4LGWA 3WU0A 4ENMA 2GAUA 2O3FA 5HLIA 2FEZA 4EWEA 3R60A 4YYOA 4IEPA 5F1RA 4NHJA 2JTVA 2EA7A 5TJJA 3U2RA 2P6SA 2AXLA 2H09A 3IDCB 3UKTA 2PMUA 1KU9A 1ZRFA 2OAZA 2KJBA 4EJTA 3MFKA 3CDHA 2D1HA 4ZU5A 3GYDA 2O61A 3FMQA 1IN8A 4EJWA 5L3CA 1S7OA 4U0WA 4XF1A 4IVNA 3V4GA 2OA4A 2HWVA 2GH2A 1FZPB 2EV0A 3TGNA 2W57A 4ENNA 3DL3A 2OPKA 5BUVA 1UD1A 5BXXA 5CVIA 2XAJA 2V1DA 1FC3A 5E8GA 4G94A 4PGGA 3GUDA 2OU2A 2XAGA 2GWRA 3FJSA 3R6SA 4QGLA 2M87A 3JAMK 1XE8A 5C8WA 2RGVA 1S3JA 1K78A 5CU1A 3MAJA 4ASNA 1R23A 4QX5A 3HT1A 2N7GA 1QZZA 5D6FA 1F9NA 4HW0A 1LEAA 2RKHA 1CX4A 4I01A 2UY9A 1EP0A 2UXXA 5FO5A 4QMAA 2NS0A 2L4AA 4LULA 5L3BA 1G4DA 2OZJA 3IRQA 4I3PA 2FSWA 3O3KA 4GCVA 5FFZA 3G3ZA 2VN2A 1YYVA 4U7DA 2HOEA 1P4WA 1STZA 1XRUA 2P6TA 3EJKA 1BC8C 4LD5A 2WWYA 2UY8A 5ILVA 3C7JA 4YFNF 2D40A 1H1MA 4OFGA 1DDNA 2LDUA 1J75A 3CTAA 2C0ZA 4JV4A 2EA2A 1KYWA 1SFUA 1MZBA 1KGSA 2FBIA 3ML6A 3EQLF 1RL3A 3KP3A 4MQVA 2CQKA 1OFNA 1Y9QA 4YIIA 1ZHFA 4Z82A 3LQQA 3IWFA 3B02A 1LR5A 1HKQA 1YG2A 2K02A 4HDVA 4U88A 3FE5A 2NRAC 5DCMB 4UVBA 2YX4A 3SCHA 3D5LA 4PGHA 1X82A 2J5OA 4AVAA 4HV6A 2DO7A 4KIBA 5CYVA 5D4SA 1RGSA 3RKYA 1TBXA 4UV8A 2F5DA 4A2UA 4R8HA 2CAUA 3FMRA 2Z69A 3SXYA 4R79A 3HTUA 2B8MA 2GA1A 1G6NA 2OYZA 2WFPA 4M6XA 1BBYA 2OD5A 4L9TA 4L9NA 3T8RA 3J81K 3GLXA 3CJNA 1D5VA 3BB6A 3BJAA 3IKVA 1IXSB 2PTMA 2PFBA 4HA8A 1IAWA 4MTDA 3SMHA 1CGPA 5D5UB 3J80K 3J80Z 5AIPA 5BV6A 5CJ9A 5HDKA 4LA2A 2UWMA 2LKPA 4HV5A 4I7HA 2FXAA 2HYFA 2EV5A 3H1MA 4YSFA 2JSCA 2XAFA 3DN7A 3NKTA 3HT2A 5J7MA 2ETHA 4HX7A 5JR3A 2VC1A 3M8EA 3OGJA 1YW8A 4PIZA 2L01A 3DPTA 4UNOA 3IRRA 5DYMA 3REOA 3GZ6A 2GA2A 3U9GA 1LDKB 2HKOA 1EY2A 2MLKA 4G7HF 1DUXC 4LK0F 3V7SA 2YX7A 5I93A 2PHDA 4U0YA 1MD0A 3HRTA 2R7DA 4XETA 4A12A 2CGPA 4OMZA 3W6KB 1X3UA 4ESJA 3L2CA 1T38A 3BROA 3U11A 4A5MA 3CO2A 1WSUA 2PN6A 3ZPLA 1GXPA 2HZTA 5J8CA 3K69A 2B9UA 3ISPA 4AVPA 2STTA 3GBFA 3EYYA 1H9GA 4ETSA 1XN7A 4MH0E 4MX3A 5LEJA 2EFWA 2EVXA 2PFWA 3WW1A 2O03A 1J3QA 2Q0AA 3FX3A 2OA2A 3ST7A 1OYWA 1FBSA 5I0SA 4M9XA 1XE7A 2MD5A 3I59B 3F8FA 4HLXA 4FX4A 2LSOA 1DPUA 3QPHA 4GO1A 1D3YA 3GFJA 2VPVA 2YR2A 5LHGA 2DAOA 4I0BA 4WK8F 1QQIA 3BJ6A 1J7KA 4IHTA 1LRHA 4LUKA 1OYYA 1RZ4A 4Q0PA 2D2WA 4AIKA 4GYGA 2MHFA 2DQLA 3GFMA 3DPLC 3EQEA 1R22A 3B73A 4EM2A 1FLIA 2DW4A 4JTOA 5I0TA 3LAPA 3ULQB 3SFZA 1O3SA 2F2EA 4L11A 4IPAA 4P55A 3F6OA 5F64A 2DLLA 2GC1A 2M5WA 1B9NA 4H7LA 1IN4A 2JZYA 4L2NA 3SHRA 4HLYA 1T2KA 1YW9A 3ROUA 1E2XA 4CDGA 3PQKA 2KKOA 2OZUA 1FP1D 3F3XA 1DP7P 2IP2A 1TW3A 3JAMZ 1UPIA 3LAJA 4IEZA 4HX4A 1ZH5A 4CHUA 2QQBA 2G9WA 2RVCA 2HQNA 3BCWA 3ZMZA 2QM3A 4UV9A 3ZN0A 5DCMA 2H27A 2H6CA 2P7VB 4NQWA 1PM7A 1J3PA 2P5VA 2ADUA 4MTEA 5CLSA 2M30A 1X8EA 4R1HA 3Q9VA 2P5LC 2IRFG 2BNMA 5IT9K 1FYKA 4LEJA 2GIVA 2PYTA 1I1GA 2VE9A 1ZZBA 2FNPA 2E7WA 1MJ9A 4CICA 2J5PA 4MEXF 1I5ZA 2A3SA 1TQPA 2Q4SA 4HMZA 1JHHA 3C3WA 1R5GA 5DV5A 3HOTA 5FLXZ 3IKTA 5KBFA 4OIPF 4KN4X 5E17F 2BBYA 5HDGA 1L0OC 2E1CA 4KDPA 3OD0A 2QCSB 4HVRA 1O4TA 1S6LA 3HRUA 2BV6A 2A61A 2K4JA 2COMA 4KICA 4RGRA 1HW1A 3RJPA 3F23A 2KJCA 4K8FA 3R0JA 2UZKA 3KP2A 3WTSC 5E1RA 1IXCA 1W7PD 2XL9A 4A0YA 2PAEA 4JQFA 2C6YA 5JSPA 4D0PA 2XKPA 3E97A 3BALA 2DPDA 4LFUA 2GC0A 1C0WA 4YG2F 1Z1DA 2QVSB 2MH9A 4KYWA 4RGUA 2FF4A 1SAXA 1U3EM 3GYHX 4HF0A 1BN5A 4KFCA 2HEOA 4XFFA 3HYIA 2QNKA 2JT1A 1FYLA 4O9EA 2PBIA 2GC2A 2ZNZA 4EJVA 1WI9A 3SHFA 3K1MA 3ZQ7A 3QU3A 3LSTA 5D1IA 2ETEA 2MBFA 2W24A 2ET1A 1P2FA 4G7ZF 2PHLA 2EFNA 6PAXA 4XEZA 3IC7A 3EETA 3WE2A 1IN5A 3FWEA 1BI3A 5LRSA 4AWXB 5KK1A 1BC7C 5L3GA 3WTXC 3PNAA 2JPCA 4TV7A 3DXJF 5JI6A 4LLNA 1MDMA 3D0JA 3P7NA 2A07F 4KWKA 3FHZA 5H6RA 4AIHA 4OMYA 2WV0A 2ESHA 3JTGA 4HLTA 2PEXA 2GC3A 5FFXA 3P9CA 3IBMA 2KIMA 3I0TA 1LB2A 5BY5A 4UBGA 3V7RA 2Z5UA 4IHSA 5FD5A 3M7GA 1V4RA 2VXZA 1ZNPA 4M74A 3BPZA 4AVBA 4LA3A 5K5OA 2YU3A 1KQ0A 1R1TA 2TDXA 2MNGA 4E2GA 2OBPA 1Z7UA 2VBWA 2I45A 1ZGAA 1HW5A 4XBFA 2EFOA 4EV0A 1QWRA 2F5EA 3F72A 1AOYA 1USTA 2QVOA 4I0AA 5HVQC 5FB2A 3TDUC 2NYXA 2HJIA 1ZAOA 3CO6C 3GXOA 4FT8A 4Q0UA 1Q1HA 2PI0A 1ZZCA 2P8TA 4KU7A 4G9YA 1ZGJA 3RZZA 5D5VB 3WU1B 1O5LA 4BQAA 3GEZA 4YFXF 3ECHA 5IT3A 3CL1A 1CAXA 1ZG1A 4CGZA 4IESA 5LRRA 5I0UA 1RUOA 3KEOA
chains in the Genus database with same CATH superfamily
1XE0A 4HAMA 2O8KA 3W6VA 1N1TA 1LOBA 4IEOA 1IV8A 1Y9GA 1G8XA 9ANTA 2LF7A 1W0PA 3FXLA 5DDJ3 3H7JA 2W82A 1U0JA 3BY6A 2ZGQA 3ZFFC 3RWKX 2WS93 1XNBA 3GFIA 4RB0A 5ILUA 3LSPA 1SACA 1J59A 2X85A 5ICFA 2GALA 3L00A 1DQ5A 3GLLA 1S8NA 3G73A 1GICA 1RUE1 3BR2A 2G9FA 4P9UA 1P4AA 4UB6C 2M1BA 5HNHA 4JTNA 4OHXA 1R49A 1XSRA 2GXGA 2QGUA 1BBT2 2GNDA 4AOCA 1A8DA 1R091 5DUIA 2VUJA 3ZXDA 2FDKA 1R64A 1ODDA 4AI0A 1OLME 1JUMA 3F22A 2CHHA 3BPSA 4ZZ5A 3FISA 1KQ9A 4Q4X1 3VD7A 2WYFA 1A6IA 3TBIA 3UT0A 3PVBB 2DDBA 4AAXA 1X3ZB 2D43A 3K1NA 4BQYA 5AC91 4X6AJ 1H8TA 2ZGMA 3CC2I 5E20A 3GW2A 1HQWA 3WT3A 1Z05A 3WODF 1O6UA 3OJBA 5JLWA 3ZFGC 2O1QA 5FY8A 4EWDA 3BQYA 3D82A 2X53S 2GXBA 3JW4A 1JUHA 2GH8A 5IVYA 2VONA 2XJQA 3OUHA 1T0FC 3M1EA 2VZRA 4BDVB 1PX3A 3T0BA 1WH7A 2GXAA 1OFCX 1OCTC 4GAZA 2E31A 5JCTA 2WAEA 5DM7F 2NQYA 3O8HA 3ELNA 5EDNA 2VASA 4LHNA 3B93A 4QXCA 5T55A 4QB1A 1QGPA 1UX6A 2JUCA 3VBSC 2PHFA 5C9AA 2QBYA 3SZTA 5A7NA 2VOKA 3ZYGA 1ND2C 2PMZA 4CP2A 1FOKA 2KZGA 1TQMA 2QWWA 4JOMA 4YFZA 3EUKL 2JRTA 4AIDA 3THPA 1D2SA 3S8PA 4QB2A 1KFXL 3CDZB 2DT5A 4XMIA 4QGNA 3BYWA 1SBFA 4GZ9A 1TME1 3OY9A 4AGVA 3DKWA 2IXKA 1MH4A 1NG6A 4IV3C 1S2EA 1J3RA 1WJ5A 4PJJA 3F8NA 1COV2 4GALA 4G4FA 1QQP2 4HVOA 4Y13A 4HSTA 1W8WA 3O1SA 4R9DA 4EJUA 2L7KA 5GP9A 1U5TC 1QJZA 1OLRA 1REEA 4IV1C 1OJLA 3C3VA 2A6ZA 3MUZ1 1AR71 4CXWA 1OKRA 4P9WA 4XKBA 2VW2A 5GALA 3GX4X 5FLMJ 4IF4A 1O57A 4B7KA 2VVEA 1SMYF 4HNVA 5LEKA 3F95A 2OCCH 3VBFA 4AEDA 1OPCA 2M0MA 4EJOA 4QLCU 4F91B 4WX9A 4QXBA 3C1DA 4ZU7A 3MO4A 4Z07A 3GMEA 1Y39A 3R4KA 2P5KA 2IXJA 3I2GA 2D93A 4DY3A 1P7IA 1ULDA 4YW7A 1LQ1A 2VUCA 2VQAA 3ME2A 2FMLA 3Q3SA 4K6BA 1Q8VA 4PHZA 2O6GE 5LBQA 2XJRA 3AJYA 4R9CA 2XJTA 4Q4V1 4W8JA 5AIQA 5FPVA 5FLXK 2V9PA 4V2GA 3S3NA 1ULCA 3NNGA 4YIFA 5M3MJ 1I9RA 2QQLA 4MGTA 3LIHA 5GZFA 1HN1A 5EF6A 3POGA 2E7QA 3NNMA 3U37A 5AONA 2DPUA 3ECOA 3RYKA 5J3UA 5E79C 1W6MB 4WCGA 3VD5A 3HWJA 4GA9A 1ZZ7A 3JZVA 3PUAA 4XHXA 3WDVA 1UMHA 2RJ2A 2JJ7A 1LHUA 1F1ZA 1RUF2 3BZ6A 3TO6A 3MF9A 1UMQA 1X1AA 4ATEA 2B42B 5GLWA 4URAA 3OYKA 4X1EA 3WUCA 3LSIA 1YE9A 4BHBA 2FQ3A 3ACGA 4P5OA 2E1MC 4ONUA 1NA1C 5FKNA 2BY3A 1HIXA 5CVUA 3VKFC 5FR3A 5JVVA 3ZQQA 4KL1A 2Z2SB 4LUMA 3F21A 4GXLA 3BTLA 2IXCA 2JG9A 2R063 4XDQA 3CJXA 1O7LA 1T6BX 2FDHA 3SITA 1MZEA 4CP9B 3FHIB 1C8M1 5LATA 5FYCA 4DINB 3FXMA 4META 4JGYB 3CLPA 3ABLH 3FFZA 2WO1A 2DCTA 3VDDA 2ADEA 3KZIC 3A7QA 1WBFA 1EH7A 3H92A 3I54A 2XONA 3DXTA 1SVOA 3V7CA 2HR3A 3JREA 1UHMA 2BW3B 1XNAA 4OAYA 3KE2A 2G0EA 3TW7A 2O8XA 3DKXA 1IC8A 1VTNC 2RJLA 3K3NA 3TOBA 4BXSV 4DOUA 4N9IA 1VB2A 1RXGA 3HXLA 3RIRA 2L7ZA 5T3NA 1IN6A 1W39A 3KCCA 1U5TB 5F7UA 2L54A 1REFA 2E34A 2DUPA 4GYIA 2O9LA 3IZOA 1QHDA 2RS31 3NJXA 1AYM3 3G6EI 2CQ7A 5FROA 4NROA 4BMEA 4LBOA 3CJTB 2AQFA 5JLXA 1RUF3 3VZLA 1RMU2 1GHCA 3MW2A 2W1SA 4NC6A 1BOBA 2DDAA 1I6HJ 1GANA 1H88C 5DAWA 5JR2A 3J8F3 1LKNA 1WZ2A 2R92J 4ZYAA 5FYZA 4I09A 2R49A 2EF6A 3ZMTA 4QPOA 2Y33A 1G3WA 1XMXA 1UMIA 4ZH4F 4M3FA 1ND2B 3MEPA 3SEEA 3SNMA 2OC6A 3VYSB 1OCCH 1T8IA 2KP6A 4QQOA 4URTA 1X8MA 1N1SA 3CUOA 4J01A 3MW3A 2PAKA 1V9U2 2QZ3A 1BVVA 1YEWA 3NV1A 1W5CC 4FQGA 3MWMA 4EN7B 4K7JA 3ZPYA 3H3LA 1Z0XA 3MGUA 3MLJA 1VQ8I 4SLIA 5KVRA 1YLFA 5HCBA 1W7PB 5HV0A 3LEIA 2Y0SA 3ABZA 3BCBA 1USSA 4HQMA 4P5YA 4ISRA 2X6OA 1OLTA 1LVAA 4JCKA 1T6SA 5J37A 4RB2C 2R5YB 5I0RA 4QPYA 1QY4A 3HIFA 3KZ4C 4Q5OA 2HI3A 1BBT1 3VV1A 1EH6A 3LEGA 1C1FA 2AQEA 4XFCA 1HLCA 2KRFA 4AI9A 2B7YA 1XGMA 1TME3 3MLKA 1GKBA 2RS11 1BM9A 1S29A 2XMLA 2WSUA 5FPBA 3QPSA 3OYLA 3ZFFA 1DDLA 1HRI3 4KT6A 4IHWA 2EZKA 2D6KA 2YMZA 4F93B 3MBWA 4UW3A 2XBO3 3GZ5A 1SD6A 2QSFX 3TNQA 4OWRB 1DZQA 1JYTA 4Q5SF 3MKWB 4GDFA 1W2TA 1FWZA 2FU4A 4A6SA 5F32A 4RGAA 4XUTA 3VN4A 3PIOF 1IW7F 2GOXB 5J1XA 4Y22B 1OF3A 3MDPA 1X1PA 2LYCA 2BGOA 1ZGWA 3ASNH 3A0KA 3DEEA 1XMKA 2R7ZJ 3BI3A 4Q4ZF 2JB8A 2TCTA 5CG9A 3JRFA 1VQKI 1GQPA 3GFLA 2J1VA 4LE4A 2XHKA 1UZYA 1PZ9A 3IB3A 2B39A 1GUIA 2ZXHA 4RGXA 5ILSA 2WFF1 1LCLA 4Y1VA 4A6DA 5A3PA 3VBFB 3HN3A 4H4KC 4Q26A 2XWJB 3T1LA 3VBSB 1HC8A 1KGYA 4I76A 4AEDC 2MPFA 2DI3A 5LBBA 4UF0A 3CMAI 3U78A 1BJQA 1BKZA 4U7BA 5IHRA 1RC9A 4P14A 1SBDA 1SDWA 4QPIC 3CUQA 1V5GA 2QZ2A 4XMYA 4XJ9A 3T8TA 3I8TA 5FYIA 1UO9A 4EEFG 5L9BA 2YV8A 3QWLA 3M8FA 4QSHA 4JP0A 4CZZA 4PF5A 3BC8A 3LE0A 1W0NA 4RGGA 1LJ9A 1FOWA 5IAXA 4AR2A 4CEWB 2W00A 2YU9J 3ZO0B 4B1LA 3PL8A 4J1XA 3VKOA 5TRDA 2TEPA 1ODMA 2ZMKA 2DFIA 1H0MA 4GFBA 3DV8A 3NRVA 2JE7A 1YXWA 3TB0A 3SJMA 1XDSA 1SPPA 4BK5A 5HS9A 2R7OA 3PVOA 1OOPC 1NT0A 1LOEA 2H0VA 3O12A 5DDJ1 3FDYA 1WI3A 4D7MA 2OQRA 2AS5F 5JOYA 3I56I 3ESWB 2IA1A 4ENKA 1F43A 2VXDA 1B4AA 5EQUA 5AVPA 2DV9A 3HKZN 4ES9A 5LHHA 3TN93 1TMF3 4YW5A 2MW8A 1DFQA 3VBHB 1JHFA 5JZGC 3OGGA 3RS6A 4XN0A 4CDWA 4N43A 3MPBA 5J8FA 1F5FA 3FXJA 1AYN2 3BR5A 3L2HA 4LITA 3L7WA 4XFBA 2RS51 5D4RA 2ZHKA 5T5OA 2D6MA 5DUVA 2ID6A 4CCDA 3BIEA 2DYCA 3THDA 3VBUB 2ZAHA 2DVBA 4LG0A 4LXLA 1B72B 4WM7C 3DLAA 3RFRA 2A5ZA 3I3LA 4YFWA 1AKHB 1IRXA 2P34A 4FQZA 4IRIA 1WLCA 2L7MP 4XLPF 2WZ8A 1WLTA 5T52A 4Y5SA 4UXNA 2F5VA 4M9ZA 3ZQGA 2K3PA 2PJRA 2WR9A 4AHXA 5C3OA 1D1AA 3TP3A 1K6OA 1RUD3 3GZTB 1XTAA 2JIGA 2IVMA 4AVZA 4M6VA 3NAUA 3P1IA 3CQOA 1CAWB 1DGWY 1VRH1 2BWCA 1IRFA 2L3DA 3KLOA 2E36A 1NY72 5DXDA 4GB31 1B59A 4YW1A 1NCQA 2VBXA 2D5FA 5D8AC 3DKQA 4ZXEA 3WTWC 1X9TA 1SEUA 2G9ZA 1C8NA 2Y0OA 2KDZA 1IQAA 5GKAC 3AXDA 2AO9A 2DBBA 1JJ8C 2VT2A 4QDRA 3GVAA 3ZYRA 2A6YA 2WN2A 4CDQA 5JMOA 4CEYB 1YC61 3U75A 4XRSG 5C33A 3KZZA 4ZU4A 3ELKA 4M4RA 1FNZA 4X6QB 3Q9OA 4FOYA 1AWCA 3KT4A 4QX2A 4RM2A 2A3WA 3OYIA 2EZHA 3KP4A 2QE3A 3AK0A 4QM8A 5A7PA 1UOFA 2RM21 2Y0MA 1EPZA 1G3SA 2Q2EB 5FZHA 4OIQF 3CP8A 4NHXA 1YNAA 3MV11 4HRIA 4AFBA 2HWF2 4LLLA 3TRSB 3CJIB 1HOMA 1HSJA 2WJSA 4YZ2A 4XUQA 1T98A 5BNNB 2ZGNA 1A04A 4YW6A 2Z4FA 2XGEA 4RLQA 1ZZ6A 1HB2A 5JZGB 2L4MA 4HG6B 2EXJA 5C8CC 2EPFA 3A22A 1LPQA 2VXRA 5E3LA 2W52A 3USSA 3V56A 2XJVA 3CBNA 2VULA 4AI8A 5FAXA 4BACA 3L1PA 5KXDA 2CQNA 4CH7A 1YRNB 1PJRA 2WA0A 3HQUA 4L5JA 2W9XA 4FFFA 2BY2A 1DYOA 5L7OC 5JI9A 2YY1A 3KGLA 3CMGA 2B9VA 1I3QJ 1ODNA 1E3PA 1QA6A 4IEYA 3GXUA 2EIMH 2OTJI 2WUHA 1W8UA 5BNOC 4KQ7A 3NW4A 1MZFA 2XLFA 3GALA 4FASD 2WZR2 4IEWA 1IGOA 3KLNA 5CVRA 2WNUB 4JK1X 3RNSA 3IIAA 3ZSEA 1MS3A 3FKJA 1QJY1 1YQ5A 1DLLA 5FLJA 4JX0A 2O8OA 2KD7A 3I58A 1TNFA 1EA3A 2D98A 1QZYA 2Y2ZA 1JYXA 3I3BA 1MIJA 1C57A 3NARA 4C90A 3QYFA 3K4KA 2ZGOA 3K4JA 1UCRA 1PZ7A 2RN7A 5FLIA 3LDBA 2VMEA 4QQ2A 4BNCA 1W8ZA 3PHMA 2CW8A 3OYFA 2OTLI 2K3FA 2VC9A 1RJ8A 1ENSA 3VGIA 4PZJA 4PDWB 2V9VA 1AA7A 1RUD2 2M4GA 3QOPA 3QPLA 5EZGA 3V8JA 4BXUA 3QPTA 4ZTFA 5IVJA 1H1IA 4DW6A 1UOJA 2E6VA 1R00A 5K7FA 4OHYA 1GU3A 3AP7A 4A3IJ 4WM8C 4WM8A 3E6BA 5CFDC 5AFBA 3OBAA 3OEAA 4XF9A 1ZVFA 5FKKA 1Z3YA 3W6JB 4DEVA 1RUG2 2YGMA 1NZIA 2ZJ2A 4E7SA 1O4XA 4I2OA 3FHNA 4P00B 1SMTA 5FPUA 2GQQA 2VTFA 1ND3A 4M3CE 4XIDA 5C3PA 4FHTA 2OZ6A 2VQHA 4ZYDA 1IS4A 5FY7A 5JHFA 4HKWA 3EHKA 4L18B 5F04A 1U8RA 1NX9A 1UJ8A 1CZTA 5GTHC 4GKXA 3H1WA 1GOHA 2CY6A 4BXFA 4ORFA 4ZYGA 3AFKA 1QVUA 3KYDB 2W92A 1G3YA 2JVGA 3IL2A 4QM9A 2XWBB 4HKLA 3ASOH 4P9FA 1TZOA 2E2JJ 1XQNA 2KRHA 3AG1H 3OYJA 3VZNA 3EUHC 4OLLA 3J8F1 4DS0A 4FPLA 2Y6GA 2P3KA 2W94A 2LNBA 3HBZA 4H55A 3C7EA 1XNTA 1D7PM 1X58A 2BVBA 2LTPA 5FRAA 2ZBKA 5FP7A 4PUSA 1ZZ9A 2DCZA 3ES1A 2EJRA 5GLVA 4BEHA 2VMHA 2FOKA 3Q0UA 1UU5A 1E3HA 1L7QA 2R071 4FXKB 4M9SA 2WO7A 1BMV1 1OOPB 1TLHB 3SQNA 3X29B 3C8XA 5CQEA 1U5IA 2KIUA 1MEC1 5LD2C 3DCFA 5KXBA 2MC3A 3KMHA 3I55I 3RI9A 3ZQHA 4E7KA 2I10A 2ELJA 1P6RA 3CF6E 1YQAA 3D6EA 1ND2A 1ZLKA 4RN5A 1D4M3 5J98B 3H3UA 4Y24A 5FUIA 3AKQA 2VG9A 3WU0A 3R60A 2E53A 2LP0A 2DFBA 5TJJA 1TP4A 1VBA1 3U2RA 3WQ7A 5F5AA 3KLSA 2H09A 4BDYA 4TZDA 2KISA 2YC2A 2FDJA 5H2FC 4DXRA 3SKVA 5LY1A 5FYYA 3PU8A 4N4NB 2NS8A 3DTEA 1TWGJ 2ZGTA 1VFCA 3RKQA 4QDQA 3GYDA 1LHVA 3A03A 1S7OA 1E5HA 1CWPA 1W36C 3TAYA 4R9AA 2W57A 4ENNA 5BUVA 1Z7S3 3IKWA 2V1DA 2OU2A 2W0XA 5C9AC 2GWRA 1OSGA 3IMNA 3PNYA 4FPJA 2BOIA 1XE8A 2RGVA 1K78A 3GTKJ 3MAJA 4ASNA 1R23A 1VQ6I 3GHNA 4SBVA 3HT1A 1QH7A 2N7GA 4HW0A 1LEAA 4G12A 1CX4A 4I01A 4JAAA 4GJZA 2DDUA 4NR1A 2UXXA 3DTIA 4XJWA 4M3EA 4QMAA 2NS0A 2L4AA 4J19A 2WN3A 5GZDA 4LULA 2OVUA 3IMMA 2W08A 4I3PA 4GCVA 3G3ZA 2RR13 2VN2A 4U7DA 2HOEA 1GP4A 4FOVA 5FZBA 1STZA 1XRUA 1W6NB 3VZMA 1PUFB 4W6YA 1LJ7A 4LD5A 4YFNF 2RE9A 4E4DX 2XRLA 4IQJA 2EH3A 2ZKNA 1X9PA 2EIKH 1LOGA 4FTEA 3FKIJ 1MMSA 1SFUA 2FBIA 3ML6A 4YGDA 4WV8A 1OISA 2VBBA 4MQVA 4BBRJ 5B4NA 3WHUA 4C30A 4YIIA 1ZHFA 4GWIA 3K4NA 3IWFA 3B02A 3FE5A 4MO7A 5FXXA 4U88A 5DCMB 3ZN6B 2HWB3 3SCHA 3AX4A 5EEAA 2VI6A 4AVAA 5EYYA 4HV6A 1BR1A 4KJZA 3FMRA 4DUVA 4HL0A 1CR7A 1R081 3G2BA 4M3CB 2ZSIB 4KH9A 2K9QA 4IOCF 1DQ0A 3J4UH 2EALA 2OD5A 4L9TA 3VBRA 1WMFA 2ZACA 3BB6A 3LFMA 2PTMA 3MKLA 1RUC3 3RGBA 3AZYA 3ZMOA 3BKZA 1W6PB 4NHYA 1CGPA 3J80K 1WLDA 1Q8QA 3V0BA 1W9WA 2VB6A 5BV6A 4LA2A 2UWMA 3R4SA 1LHNA 4HV5A 4I7HA 2FXAA 2WZR1 2XQRA 2XUMA 3H1MA 1W9FA 4UAPA 1R092 3DN7A 2I74A 2ETHA 3BG6A 3GNEA 4XNFA 4CA9A 4WZFA 2VC1A 1YW8A 2L01A 4BB3A 3VDDC 5DUUA 3IRRA 5DYMA 1GZWA 1PK6C 2GA2A 3OYCA 3CDLA 2RQQA 3VYTB 1HCRA 3LD8A 3R05A 1LGBA 1QU0A 4AC0A 1MNEA 1GV9A 1MD0A 4QWNA 2JDKA 5F5QA 4A12A 3HOBA 3FHQA 4OMZA 1PK6A 5T50A 1T38A 3U11A 2YFUA 4QX1A 2OXBA 2KIQA 3KIOA 3VSLA 3C2GA 3ZPLA 3JRBA 5A6YA 2HZTA 4QU2A 5CFCB 4LQRA 4LR4A 4NN0A 2L9SA 1JGGA 2B63J 1XN7A 3GJBA 3LSMA 2EFWA 2V4VA 4YVWB 2PFWA 2E63A 5KC5A 2O03A 1J3QA 2NP0A 2NOJB 1OYWA 1MR5A 4L92A 5KCMA 4QX7A 1CQTA 1XE7A 4LO5B 3N9PA 3I59B 3WP4A 3F8FA 2MG4A 1DPUA 3WHBA 1JYCA 2ZXWH 1V6OA 3E1F1 4GO1A 3GFJA 2FQ4A 2VPVA 1K12A 4CU7A 2QKLB 4Q4W2 3WG2A 4LUKA 1RZ4A 2GDFA 4GYGA 5E88A 4ITCA 1R22A 3B73A 3KQRA 4JTOA 3GTMJ 4GB33 5FP9A 3H3VK 4C0BA 1DQ6A 3ULQB 4MFEA 3SFZA 1EF4A 2R073 1XNDA 1YX5A 4L11A 2GC1A 4P55A 3DYMA 4JGZA 5IVEA 1FMD3 5J4VA 2DA4A 1XC6A 3SHRA 1YJWI 3A21A 3Q8CA 4HLYA 5F5IA 1YW9A 2HDDA 4JQRA 1E2XA 3CDIA 4XK4A 2OUJA 5FKLA 4GB32 2XSJC 1NY71 3LDRA 3O1PA 2DF7A 4QB6A 2IP2A 1TW3A 1S2BA 1ZH5A 3J7MA 2VIXA 2P1BA 3DWLE 2Y26A 2HQNA 3ZMZA 3WUDA 4KGQA 1MSFC 3OIOA 3HOWJ 2H27A 1MQTC 4F55A 1PM7A 1HB4A 4AYBA 5C4WA 4OUEA 4MTEA 1O8PA 1ZKGA 2KLOA 3Q9VA 2P5LC 1IDYA 2BNMA 1MS1A 3JB8A 4Q4V2 1N1YA 5FTTC 2YU1A 1ZZBA 1RVF1 4F92B 5C4XJ 1MJ9A 5C7GA 1STMA 3CZ6A 2A3SA 4XXAA 2G4IA 1JHHA 2QQWA 1R5GA 2E51A 4A3LJ 3HOTA 4UFMA 2DOAA 3IKTA 5KBFA 1XU2A 5FYVA 4RFRB 5FZ9A 1CN1A 4OI1A 1O4YA 4KDPA 5GZEA 1XOYA 3KV9A 3FXKA 4WM7B 2RS52 1O4TA 1LECA 2COMA 4Z2AA 3R0JA 3I4NJ 3AYCA 3M8JA 5E1RA 1W7PD 3NJYA 1PO13 2QQOA 5F39A 4A0YA 2DU1A 4JQFA 4L9BA 3OYBA 2E32A 3OS1A 3BTCA 2AREA 2QVSB 4RGUA 1SAXA 1U3EM 4Y20A 1W8HA 4XFFA 3O0XA 3WR0A 1W6OB 2R0QC 5BNQA 4AF9A 4O9EA 3ZN5A 1XYPA 2OUMA 4EJVA 5DABA 1POV3 3ZKYA 1ZA4A 5HXMA 1BJZA 2BW8A 2WZEA 2E1OA 2W24A 2TRTA 2ET1A 1ETWA 2LROA 1EUUA 3N7LA 3A1YA 3CCRI 1IV6A 1H30A 5KK1A 2VQGA 4Y1YA 3PMEA 3I3EA 2CUFA 2JPCA 4E27A 4LLNA 1MDMA 1DGRN 3OS0A 3ZYBA 1WJBA 4KWKA 2X6WA 3FHZA 1U0AA 4OMYA 1S0BA 5ACA1 2WV0A 3AB0A 4GMP3 2PEXA 2GC3A 5FZFA 3AP6A 2GNBA 1W6OA 5GPAA 4BJ0A 5A1AA 3CMYA 1V4RA 4M74A 1SANA 1FAYA 5K5OA 5FY9A 1ETKA 1E5RA 4E2GA 3C2HA 4XR6A 2CNAA 4ASKA 3RZGA 2WT0A 1VQ9I 4EV0A 1QWRA 4L8QA 2PXJA 3B01A 4XAAA 3F72A 4XW3A 1USTA 4XILA 4CP1A 1ZAOA 4UFKA 4Y52J 1H8VA 4FPGA 3CO6C 3OYWA 1WCQA 3GHMA 3OOXA 4A44A 3HJEA 1JXNA 4XCBA 4KBBA 3VDCA 4YPJA 4BBSJ 1CPNA 4YFXF 3ECHA 3A02A 1OA2A 4AEKA 3CF2A 3POFA 2XOMA 1IS6A 4L9VA 3WGGA 2PJPA 4CPBD 3ZR5A 4BE0A 3TOJA 1B35C 4KMQA 4P96A 1RUF1 5FY0A 4YRDA 1LNSA 1W4MA 3T1MA 1LEDA 1WZXA 4JGYA 1A36A 1PVC2 4HN0A 2KR2A 3LNQA 1UWWA 2WTEA 2KZVA 1JTXA 2Q2EA 3K48A 1EAH2 4XF0A 2HYXA 4QHBA 1GWKA 4IUGA 4BGDA 1UYPA 4XZPA 3VBOC 3J7YJ 2YHJA 1MW7A 1WJCA 3SZGA 3EDPA 3DTKA 4LKSA 1XGOA 5A80A 4XJAA 5C3SA 4EM1A 2D5HA 5IPAA 2WQZC 3AMNA 4MV2A 5EYXA 1F5JA 5C8CB 2PJRB 1DLCA 4ISQA 1POV0 2VNOA 1UPSA 5KNLA 1W2NA 3RKXA 2VE8A 2ME6A 5E16A 2RM22 3MEXA 4IEVA 1HN0A 3RYRA 1LTEA 3ZSLA 3FUOA 1UG0A 2OS2A 2IUWA 1W7PA 3ZIWA 1ENRA 3W5MA 1I39A 5HLHA 2CW0F 3E0JB 1GDTA 1QQP1 4BQWA 1FMWA 2DA1A 3K2ZA 2DK8A 2QZ8A 3LEKA 2G7UA 4NHKA 1N78A 1NUKA 1TME2 4HNUA 1PK6B 2ARBA 3PFIA 4HT1T 4W4ZA 5FZOA 1T2XA 1QJFA 1APNA 1OMIA 1Z6TA 1T6GC 3RI4A 4N53B 2YB7A 4BE2A 1IKQA 4ZZLA 5HV4A 1V55H 4BOWA 4UWDA 5DG2A 4PJYA 4YZ5A 2V6EA 4ET7A 1ENHA 3VKMA 4B1RA 3G1LA 2EIJH 3WNOA 3MHZA 4E2QA 4PSXA 2FZ2A 5FZEA 2OKXA 1CF7B 1OLMA 1UIKA 4ASMB 2Q8EA 3HHGA 5BNNC 4AQSA 4X0GA 2X5IA 4XABA 2HXOA 2MH2A 1B6AA 3MIBA 3PVNA 1B1BA 1MACA 3BZCA 3OMYA 3EYIA 2FBEA 1KA8A 4QXKA 2VNGA 3QYBA 1WA4A 3BU7A 1RHI2 3N9NA 5A32B 1XSXA 3HGGA 2JDAA 1VP6A 3H0DA 1S4CA 3KETA 2ZABA 3S32A 5EJCA 3TYJA 3I49A 2LM3A 4JRLA 5BPXA 4M4PA 3KP7A 5JR7B 3JRIA 3RZKA 4Q4V3 4FBFA 2EIGA 1OURA 4M00A 3ZMUA 4E7IA 3GZEA 4A6EA 5HCFA 2F5FA 1EAH3 4XSXF 3U0ZA 4MADA 1WVRA 3F8CA 5ABJC 4A7YA 1RUNA 1O8SA 2R062 3ZN6A 4RQPC 2XUBA 3S14J 3BTJA 3FK7A 1AHSA 4CUGA 1B8IB 4AFMA 1ZBE2 3CUQB 3H0OA 5KC6A 3GZAA 3N7JA 4LKFA 3VKNA 4ZDLA 1YJLA 3FM3A 1CAUB 1VAMA 2YBSA 3WNXA 2XGCA 4RAYA 4XSZF 1QVTA 4I98B 2JG8B 1AX1A 1DCSA 2NZ9A 4KNCA 3N9LA 4MGZE 4QPGA 5E8AA 5FYMA 3WXPA 1JZ5A 4IGPA 2XQXA 4M3CF 5A3TA 3JSPA 1WWXA 3I9V2 2QF7A 4G6TB 2X6YA 4I30A 4JKMA 3S0MA 3HM5A 2ZEZA 3KVBA 1LULA 4K8RB 4OQ9A 4BUPA 4M01A 1XPXA 2V26A 1AJKA 2ZFWA 2ARXA 5G04L 1YFUA 4LK1F 3IDAA 1TC3C 3CZJA 1ONVA 3IH3A 2Z3YA 4M73A 4N90A 4HKOA 1POGA 2JSPA 1IPKA 5CVVA 4LORA 2M4KA 2Z5WA 1YLLA 1UIJA 3WG9A 4HSJA 3SH5A 3JXSA 4LG3A 4HOBA 5B1AH 3P9KA 1F31A 3S93A 2RS53 3SEQA 3INAA 3NJVA 4ZHNA 1WBLA 2NAZA 3LSKA 1G9FA 4LJHA 3KFWX 1H2KA 3L09A 4U0VA 3TOAA 1EV13 1K45A 4GWNA 2FUG2 3QU6A 3POYA 4TXWA 4CYDA 4K21A 1Z3XA 4MGIE 4AYUA 1Q8OA 4OVEA 1I1SA 2NVYJ 1W1WE 4NHLA 2LF8A 2ZJRF 1SC7A 1UY0A 3DPRC 4P08A 1DZRA 1OLQA 1Y0NA 5A3OA 1BK1A 2NPIA 2PHUA 2YYOA 1JN2P 4F8AA 3ZPOA 3ZXKA 3R0AA 4ZKTB 2DYSH 3IP4B 1AJOA 1GYKA 3P5JA 1FEXA 3FK6A 4IOAF 3OTFA 3ZMSA 5K0UB 3ZXLA 4P9YA 3OYDA 2JA8J 1HX6A 2BNOA 2QJVA 4YM2A 5ACA2 2I07B 5EYRA 4LLFA 5K7ZA 4AIJA 5F0FA 1K5JA 2W3JA 3ZOIA 3RPQA 2XC7A 4YNIA 5F9TA 2CWEA 1RUE2 4DUWA 4FETA 4XAEA 4BQNA 2RAEA 2VMGA 2YS9A 3LDKA 1QPMA 3MD2A 2W1WA 4KUMA 5DG1A 5DN2A 5EPAA 2WWJA 4ZYEA 2KL4A 4BJ6C 4A7ZA 1BBT3 4CEWA 4BLIA 1PO22 3PNTA 1GBGA 2OPTA 4DNCA 4OINF 2W5FA 3WEZA 3OOPA 4LKEA 1G59A 4XBQA 5KHDA 2PHXA 1YI7A 4S2FA 4HSLA 3BTZA 4WXDA 2QYOA 3POBA 3IV5A 2WL1A 4BIFA 1R093 1PIV2 1UB9A 3WF0A 2QQUA 3KT1A 4EZ4A 2CSGA 4BIOA 3OPZA 4NE9A 4BHPA 4EMSA 2HPMA 3BR6A 4ES8A 1CAVB 3KEYA 5A32A 3RJRA 2K86A 1QXJA 2W95A 4O65A 4OZOA 3ABUA 5GTIC 1SHWB 1SFXA 3CMEI 1YUDA 3VBSA 4NOTA 2XJSA 4JZRA 1ZBE1 2ZMEB 2F4LA 3UJOA 4P9XA 1CPMA 1RUG1 2V4AA 2JA7J 4MHUA 4NRMA 4BM8A 2VQCA 2ZHLA 3QCWA 4B7EA 2ARAA 3PVEA 3VL8A 4N53C 1IUYA 1XSQA 2QDRA 2W87A 1FIAA 2BVLA 1AUYA 5CFDB 1UY3A 3WP3A 4U87A 3SFIA 4N0BA 2JWTA 2JPBA 2HQRA 1M1EB 2B0LA 3WDWA 4Q0VA 4YG0A 3AC0A 2UUZA 5IYBJ 1TWHJ 1ZRCA 2VOOA 2ZKZA 2CQXA 1RR8C 3PUQA 4RS5B 1QDOA 4OI0A 1Z9CA 1YFXA 5JZGA 2QQ9A 2I2SA 1HKSA 1VZ0A 2ZPXA 3LSRA 3DBHB 4B3AA 1VLNA 4HF1A 3M2MA 2M45A 5A7QA 1Q3EA 2H0BA 1WKMA 5DD8A 2BV4A 5FZ0A 1BI1A 3U07A 4QKFA 4AZZA 3QACA 4BLJA 3TN92 4LKDA 4NIAA 4RA2A 3OY8A 4XKVA 2V5YA 4IRHA 5TSWA 5KHHA 5KHIA 1JKOC 1NH3A 1MS0A 1PGW1 2VJ4A 1U12A 4P1WA 1SLIA 2DYRH 1SPPB 2X4HA 1MJAA 3TEDA 2D3SA 4N9HA 1PIV3 1EKEA 3M70A 4CEYA 4KWLA 3I2JA 2H6BA 1HLVA 3BTYA 3ZQCA 2CFXA 3LA7A 5IFPA 1BI2A 3FLRA 3IH4A 3NJZA 2NNYA 2RDPA 1W9SA 4BAYA 4CXFA 4CDUA 1OKOA 3HEFA 1F4KA 1JOPA 1BW6A 1K4SA 3TN91 1BA5A 3NKGA 4M71A 2A6EF 4Y4RA 4DUXA 5FZCA 1DGRM 1JMUB 3HSEA 3KWVA 1KZHA 2LK2A 1REPC 3C7OA 3URFA 2QQMA 2IJLA 2V7FA 3D8CA 3OL3A 3Q8BA 3HL2A 2DCEA 2CV6A 2H94A 4EROA 5BNNA 2MGQA 4EWAA 3SH3A 4A5NA 2ECCA 1RIOH 2WNVB 2O7OA 1F9KA 3RSJA 2J22A 3CCMI 2VY0A 1L3LA 3HUGA 3M4OJ 2O0OA 1ERDA 5C5TA 4AE2A 5CZKA 2R043 5C3EJ 1FX5A 4AL9A 2CTVA 4AQ6A 3ACLA 1B09A 4B09A 1J5YA 1NYWA 2BOLA 5F0HA 3O0WA 3ZIXA 2P0WA 3AZWA 4YW3A 5LK7B 4MXWA 3OUJA 2R7WA 3S1NJ 2WO3A 3ZX7A 2VCCA 3L2UA 3PNVA 4CXYA 1V00A 1ON2A 5FZDA 1ULPA 3T4HB 2A69F 4M0HA 2A7AA 5EEGA 3BR3A 2HVQA 5EGOB 5FOJB 3PMSA 2PMZN 1VRH3 2V73A 1XMAA 3TL4X 1WUVA 3UJQA 3HNMA 2E9QA 1NHAA 4XBNA 4CCLA 2LKSA 4KT5C 4XLAA 1NG7A 4L0PA 2FA5A 2WRAA 2Y31A 3K7AJ 2LMDA 1ZBA2 1UY1A 1VALA 5KHKA 3HN1A 3V42A 2XKOA 1VRH2 1JTYA 5CKMA 3E5QA 1NA1B 2ELHA 2CL2A 4PLMA 2HTJA 2VVFA 2E7AA 2LALA 1Z91A 1NCRC 5KR7A 1SD4A 2CG4A 3R0RA 3RPUD 4FI9A 4AQ2A 4FFGA 1G9BA 1RITA 3ZFGA 1TMF2 4CCNA 4ESFA 3ZFGB 3JRGA 2LUWA 3B00A 2EK5A 1RHI1 5JXHA 2VBYA 2ZNYA 2HWE1 3CIHA 2K5CA 1AXYA 1UCXA 1KITA 3TEYA 1WW5A 3WTUC 4XDPA 2DT6A 5J40A 3DF0A 1VAKA 3S15J 4P5HA 1ZK8A 2QFEA 2XPWA 3N4MA 3JQXA 4Y1ZA 4RGSA 3HPGA 2RS33 5BPDA 2JVHA 4LG0B 2XASA 2WWUA 4XMAA 3UGFA 3CEWA 1QPIA 3NVCA 2RDQA 1XSDA 1WMXA 4NRPA 4QPIA 3CMMA 1W8FA 4UUVA 5L3FA 2DMQA 1UOGA 2VTXA 2YBKA 3T0AA 2E5NA 3VBHC 4C8DA 4XC9A 2WO2A 4FISA 1Q43A 1SCSA 2O0YA 2UWBA 3JQWA 1ZARA 4MHRA 1RNLA 2BYVE 2E19A 4LJZF 3ZN1A 4BHCA 3BOQA 5JFRA 1MQTB 1E5IA 4F7ZA 3CCUI 4LOSA 3EUAA 1ZLJA 2FZ1A 5L3EA 2J7MA 1ZR2A 2NN8A 3FZ3A 2JE9A 3HVDA 4PQ9A 1UU6A 4CDWC 3FMSA 1GXQA 3NWKA 3MPPG 4FPKA 1E17A 3ZR6A 4OUSA 3JTHA 3IHUA 3HNBM 3AYAA 3KHBA 1UZWA 2VPRA 1BIAA 2WY7Q 2PN5A 5FYTA 2N8GA 1V6JA 2GIZA 2AGSA 3FC0A 3EBRA 3UESA 4YRVA 3BT9A 1TNTA 1GVJA 3KV4A 3PTYA 3CLOA 3QODA 2ILMA 4K20A 1HRI1 2HWF3 3AKSA 4LB6B 1TTYA 4L99A 4M0NA 3MIDA 4JGYC 3VB2A 4UW4A 3S5AA 5K5QA 2R93J 5IK7A 1R1VA 3K4MA 2D7FA 1FY7A 1ON1A 4MYEA 4MUVA 1Z77A 5DAVA 1QJY2 3ZFEA 3B3QE 2R7SA 5D5XB 5JWPA 1H9TA 5G05L 4Y33A 1WKYA 5L7OB 2G19A 4AFCA 5K9YA 4EM0B 2XROA 2ZCWA 3FXRA 2Y0IA 3ATGA 4HZFA 1DP0A 1H89C 1V6IA 2M7AA 2DXIA 3HRMA 1QJX3 1RESA 5CFCA 1SDDB 4MIMA 5IVBA 3HEIA 3WNKA 2JX9A 5B5EC 2KRCA 1SAUA 1YI2I 5BQTA 2R30A 4IE0A 3K6GA 3LA3A 5E8IA 2HPIA 2QKMB 3BP8A 3KF3A 2WC2A 2OQ7A 2J1EA 1A6QA 4JDNA 2ZGLA 4PI0A 5A7WB 1NTCA 1CAXB 1VBA2 4AG4A 1IUFA 1OT5A 3PIGA 1ZYBA 4G6DA 2HYKA 4ZDPA 1O91A 3B69A 1RXFA 3ZOBA 3ZCOA 1R5HA 3D5OA 3AG3H 3I3MA 4E2SA 1R36A 3AZVA 2LREA 4BQ1A 4Y1XA 3FBNB 3TP0A 2F4PA 1WJEA 3BCAA 3QP6A 1B72A 5JIUA 2D6NA 3V0AB 4B4RA 4D7SA 5E1ZB 2B5HA 1U5TA 2XVCA 3OGRA 4I99C 3M07A 2VJXA 4H7MA 2VW1A 1VQ7I 3OSFA 3VBOA 4BJTA 1HDDC 4C9YA 1ZYRF 3LEMA 3ENRA 4UUTA 2L9RA 1V0AA 4I02A 4BQ3A 4FTHA 2PELA 1ZRDA 4RS5C 2F4OB 2ARCA 2HWB2 4AFDA 4L97A 3WE3A 2IT0A 2Q5TA 2TUNA 3T0YA 4IERA 1WCUA 2K40A 4MOAA 4Q29A 4CDUB 3LFKA 2VKVA 3JBG1 3IWZA 2G1MA 3K75B 1UAAA 3PURA 2XLAA 2EQRA 1Y0UA 5BNPA 1FPQA 4A3JJ 1PVC3 4EVIA 1QMJA 2AYHA 1RTVA 1RPWA 4JVAA 1RMU1 2GNMA 4RA0A 3N05A 4IKFA 5IK5A 1IPJA 3KD4A 4A3CJ 1UNBA 1TWAJ 4WXHA 4COVA 1TVGA 3KHCA 1W36D 5C71A 2UU8A 2XAQA 4D7NA 2WNOA 1HKTA 4CTEA 5CADA 5FXVA 1YS6A 5A2QZ 2ZAAA 5CYYA 5C6CA 1G3TA 2VOPA 2IS4A 2Y75A 4A3MJ 2JD9A 2BBAA 2BEOA 1I3HA 2VBZA 1KJLA 3N97A 1RUG3 1D2QA 2Y6LA 4EGYA 1YO5C 1NZCA 4M3CA 2I8DA 2RV8A 4RLFA 2ZB9A 5CIRA 4EWEA 4IEPA 5F0CA 1OQDA 4XURA 2CV0A 3AL6A 2XF5A 4GH4A 3T09A 3OR1C 5EHDA 1V54H 2AXLA 1JOJA 1DU3D 1GOGA 3HQRA 4NPRA 1AYN1 1QOSA 1I5PA 3OY8B 4M3BA 2KJBA 3QOEA 3MFKA 4QQHA 2Y9ZA 2ECBA 3FBMA 3JB4C 3T2TA 2FX0A 1IN8A 3TMOA 4XF1A 5L9RA 2ZXQA 2VUMJ 1JOBA 3OYHA 2OA4A 1FZPB 4AYBN 2OPKA 5T5LA 1UKGA 4G94A 3R6SA 2HWB1 3JAMK 4FE7A 3GTLJ 3RCOA 5CU1A 2DWRA 4XDOA 2K9MA 3WNLA 4Q4W1 4QKDA 3VD3A 2DJNA 4QX5A 5D6FA 1F9NA 1ETVA 1D0ZA 1R082 4XIKA 4FTBA 2QKDA 4YVSB 3IRQA 5GPCA 3O3KA 3RMXA 1YYVA 3U1XA 1HDPA 3EJKA 2H8WA 3CCEI 1UZCA 4CYCB 2XG3A 1OQEA 4QPWA 3C7JA 3MFAA 1WCKA 5HPOA 1H1MA 3CKHA 1DDNA 4FE4A 3KB5A 1J75A 4JV4A 1FOXA 2EA2A 3SH4A 1FOYA 1MZBA 3W9AA 1KGSA 2R5YA 1ST8A 4PLOA 2IS2A 1W3VA 4U36A 2VU9A 5C4WB 1Q1VA 3BQZA 4Z82A 4HK9A 5FZOB 2LC2A 5IYCJ 1N3OA 2K02A 3N7MA 2NRAC 2X05A 3T2QA 4UVBA 2YX4A 4P9IA 4AAPA 3JRDA 2DO7A 4KIBA 1TBXA 4UV8A 1VF9A 1UN1A 2Z69A 2JMWA 4BQ5A 4A4AA 4DB5A 2BPA2 4YG3A 3ITQA 1SVLA 3T4VA 4A7KA 3DECA 3A01A 4M6XA 3S5QA 3J81K 4L9NA 3CJNA 2CS3A 2WFF2 3BJAA 3IKVA 4A41A 5LFAA 5LA9A 1CONA 4MTDA 1PMHX 3UNPA 3D5RC 5EWSA 5D5UB 5GAGJ 1YHQI 1V9U1 5AIPA 3ON7A 4JX5A 3AMHA 4CCCA 3KM5A 3ONQA 4OHWA 4YSFA 1K61A 4CP0A 2XAFA 3NKTA 3HT2A 3ZFFB 3ZXFA 4HX7A 3ZQIA 2F6BA 1CIYA 2L0KA 4XLCA 3OGJA 3MIHA 4PSWA 4D3WA 3D5SC 4UNOA 4CCMA 1RYYA 3REOA 3GZ6A 2X6XA 3MI8A 1MS5A 5ERLA 2MLKA 4G7HF 2XR4A 2C9AA 1FV3A 3ZR8X 4LK0F 2HDWA 3V7SA 2YX7A 4U0YA 1WW4A 2BP6A 1SFYA 2VNVA 4LBKA 4XETA 3OPWA 1X2MA 3PSIA 4CPBA 2CGPA 1AYM2 2WBKA 2VBDA 1X3UA 5E89A 1AKHA 2KA3A 5DM6F 1A78A 1GLNA 3CJIC 1RUC1 2J1UA 4LHSA 1W6QB 5K7HA 2PN6A 3O1TA 3TEZA 4IZZA 1K5MC 4N53A 1BHGA 5J8CA 3GBFA 1Y1WJ 2COBA 5A3NA 3J7ZI 1HRV3 3HR9A 2MEV1 1H9GA 4MFDA 5KAIC 4MH0E 3ABMH 5LEJA 3ZYJB 1M4WA 2C24A 3POWA 3FX3A 3I2DA 3AVRA 4ITVA 1W05A 4M9XA 1DP3A 3W3CA 2MD5A 2QQKA 1FJLA 3LSJA 4FX4A 2LSOA 1UL9A 1D3YA 3IAS2 1RHI3 1S0CA 3SQOA 4I0BA 2X09A 3BJ6A 1J7KA 1OYYA 2WS92 2VGDA 4AIKA 4QPGB 4ASLA 3GFMA 5F5CA 1N25A 3DPLC 2E1MB 4YVSC 1FLIA 2DW4A 1AF9A 5I0TA 1GP5A 1IKPA 2CFOA 3LAPA 2ORXA 1O3SA 2F2EA 3R4DB 1AHDP 1XBFA 2IWGB 1GSLA 3V64A 3VZOA 1LKXA 1SFPA 4Y7NJ 1JBCA 4LE3A 1CESA 1IRZA 1B9NA 3U4SA 4BKXA 4D9JA 1IN4A 4PBPA 1QXPA 5CKNA 1AYM1 2H1KA 2QQVA 4B4PA 3HOYJ 4AI2A 1FV2A 5A1FA 3PQKA 2KKOA 4F52A 3TW6A 2W4SA 4RQPB 2HWC3 3LAJA 4HX4A 2QQBA 2O14A 1JODA 3BCWA 1IS3A 4IE4A 1RETA 1Y56A 5DCMA 3H5AA 4CE8A 1SZBA 1K3IA 1EUTA 4GRIA 1J3PA 4EN0A 3I2HA 1I1EA 3UR3C 2K46A 1SBEA 2M30A 1X8EA 2VJJA 2IRFG 4CDQC 5IT9K 5C3RA 2QQJA 1X1CA 2GIVA 2BOJA 4IL7A 2PYTA 2BBVA 1I1GA 1OD3A 3EMRA 5F2SA 1AR93 2E7WA 3MZ8A 4CICA 4XLHA 4DNYA 3IM0A 5DPNA 4MG2A 2W48A 1OCZH 1TQPA 4QXHA 1PUFA 5DV5A 5BYNA 3E7LA 2VO5A 2XVKA 1QRYA 2JG8C 2DA5A 4OIPF 4KN4X 2JG8A 5GLUA 5F3CA 4Z6YA 4IDZA 3PJQA 3KF5A 2JKXA 1L0OC 2LKXA 2Y38A 3OWTA 2QCSB 5JXJA 2IZWA 2QQNA 1S6LA 1RKTA 3ABKH 2K4JA 4KICA 4Q4W3 3KP2A 3WTSC 4FFHA 4QQPA 4E4ZA 1Z0HA 1W6QA 2DCJA 4XRSA 4KG8A 2DPDA 4LFUA 1B35A 3WCRA 3AG4H 4A3XA 2PQSA 2MH9A 2RS13 4KYWA 5FZMA 2D6LX 5B3SH 2FF4A 1SFOJ 4RS5A 4DZPA 4V2FA 2VW0A 3HYIA 1RVF3 5FP4A 4JGZC 4UYBA 4YG6A 3P3NA 3P3PA 1FYLA 3H35A 4R4XA 3DBRB 2ZNZA 1Z7S1 5DDJ2 4E7JA 4XRMA 3MN2A 1FIPA 3D3AA 1R1A3 3JCIA 1V6MA 3U1KA 2A3XA 2YUSA 3IC7A 4XQDA 2DVGA 4MSVA 3FWEA 3OYNA 1BI3A 1TE1B 3MFCA 1JKPC 2P3YA 3W2VA 3GCMA 5BNPB 5L3GA 3WTXC 5IYDJ 3HBKA 2B7EA 1DGLA 3D0JA 2XB6C 5E3NA 5C4JJ 5H6RA 1RUH1 1VMJA 4QPGC 5K4LA 3FHAA 2W7NA 4C3JJ 2OJED 3P9CA 1VQOI 3L2QA 1OKQA 4N43B 4DZJA 2Z5UA 3ZSJA 2JQ7A 2VKDA 1AX0A 5L9VA 5FD5A 4IHXA 5D2AA 3BPZA 1JYNA 3S57A 1NCQB 2TBVA 1KQ0A 1R1TA 2TDXA 3NO8A 4YLZA 1LU2A 3QQAA 4FPYA 1W6MA 5H9PA 2VBWA 2I45A 1ZGAA 4XVHA 2AHQA 3ACIA 1F35A 2ZEWA 4A3EJ 3LMMA 1VBD3 3NRUA 3PUFA 3S1RJ 5H9QA 4OI4A 1SVMA 2QVOA 2AENA 1ZBA1 1GFF2 1ORKA 5IK4A 1D0XA 4LO8A 1WW6A 3K4LA 4B8EA 3HOVJ 3VSKA 1H2NA 1W0TA 5IY5H 1KDKA 1ZZCA 4K1ZA 1ZGJA 3OR2C 5D5VB 2QSHX 5ACA3 4B43A 2A5WA 3WOGA 2V4JC 1RUI2 3GEZA 3QYEA 2DMNA 4IESA 1RUOA 3FL7A 3WF3A 2MA3A 4LTAA 3NAPA 1C8M3 5FWJA 3NAPC 2LRDA 5ANNA 1FBQA 3LWCA 3UETA 3A01B 3MVPA 1JYIA 1H8TB 4A93J 1N75A 2X5IC 2VECA 5K0UA 2IS6A 5KHGA 2W25A 4YM0A 3C18A 2BY0A 3RQ4A 3AL0C 3J7AO 4XQ4A 1PVC1 2IPQX 5FO7B 4A3BJ 1RMU3 1EH8A 3ORJA 1FYMA 3KYLA 1FBUA 3I2KA 3TEXA 3MQ0A 5HBAA 2D3PA 1I3AA 4E70A 2HXIA 3OIQA 2ISZA 5FZIA 1J1TA 4XPVA 2WQ4A 4CP9A 4MGKE 5M0TA 1UZ0A 4ESBA 1E57A 4GH4B 5FZ3A 1LNWA 4TTGA 3M9AA 4D6QA 4UUSA 1AR72 4EGZA 1BLZA 4KIFA 1HQCA 4L5IA 1C4RA 2KXLA 3C2BA 2ZGPA 4HPQA 5C9AB 2CQQA 4WF2A 2FMDA 2CUZA 3OEBA 3H9JA 4Y22A 5DUWA 3LOIA 3CC7I 4UT5A 1JI8A 1MBFA 4QIWN 4OQ8A 1PP8F 3DLLF 1BCXA 1VBD2 5FYSA 1HA8A 4LBMA 5JOXA 2DK5A 1MS8A 4E9KA 5FZGA 1PUEE 2ESNA 3PDQA 2L9LA 4BS9A 4BY1J 1PGW2 2HQ5A 3J8F2 3GWZA 3IH2A 2FMYA 5JXIA 1NK3P 4CO8A 1LUJB 1GWMA 2XSDC 3AJZA 4KNYA 2H1LA 2ZMNA 2DURA 5EEHA 3O1OA 3B7MA 5IFTA 4ARYA 2JN6A 5LGUA 3VDXA 2IVJA 3O2PE 3H7YA 1LFBA 4NWVA 3WVJA 4BQQA 2PHRA 1PO12 1QJX2 1W9YA 2VMFA 3S6PA 1R58A 4M3DA 5CB7A 4QHOA 3W59A 1SMVA 2CUEA 1H6YA 5BPIA 3WF1A 1FTZA 3ALQA 2D5VA 3AYEA 4WVZA 4ZPIA 3ZFEB 1T08B 1RB8G 1APLC 2R7TA 4JX6A 4NC8A 3DP7A 4Y15A 3MCZA 4KMFA 4LIUA 2F48A 4IX7A 3USUB 3N36A 5FJKA 2D6PA 1C5HA 1J0RA 4Y26A 1JH5A 2DA7A 5FLVA 2VODA 2VZOA 1YRZA 4HN1A 2Q8OA 3WW4A 2OT7A 4QPIB 4E8DA 1PMIA 4FVVA 4XLFA 2E1NA 1H1AA 4FXGB 1PNFA 3P6BA 5FQ0A 5APAA 2VPLA 4AUXA 4U2AA 2UXNA 1XDUA 1FPN1 2GNTA 3U1DA 1BK0A 3RG0A 2Y6HA 1YJ9I 3K9TA 1E5SA 2VMDA 3LWFA 4MVTA 3MZHA 2VZ1A 1W9TA 4P02B 2IA2A 4EQQA 3WW2A 1KS4A 4Q4X2 1R1A1 2L7FP 1NG0A 3H3ZA 5HOOA 1RC6A 3WX5A 4DGWB 1OC1A 2P7CB 3HTSB 4GWMA 5J1UA 5LLQA 3B94A 2SBAA 1FT9A 1QZEA 2ZX1A 2IGMA 2FD8A 4Z1VA 1CJDA 4ZS3A 1OPOA 4RYDA 2E2IJ 1CVNA 5LA0A 2RQPA 3BG9A 3K0LA 3WTZA 5FPXA 2CH0A 5L36A 1SCRA 5FJ8J 4QKBA 3AKZA 1RVF2 2E26A 5KXCA 4JHTA 3BPVA 2JECA 3CU7A 1WMDA 4YGBA 3D4KA 3G4SI 2GMPA 3N7KA 2VD7A 2D1VA 2WB1A 1IQDC 5H6QA 3H1CA 3H8OA 1RJ7A 5K1YA 2ATFA 2KIFA 3J81Z 1PDNC 2V1XA 1QU3A 1POV1 3E5XA 2XPVA 3EO6A 5FBZA 1IO2A 5ANQA 3ACHA 5F08A 1V5EA 1ETQA 4Q0SA 1JJ6C 3EB7A 3NAPB 2W91A 4IEQA 1NCQC 4C1WA 2IGKA 5AVAA 2XV4S 1F15A 2ZX3A 2FD5A 1Z67A 2KMUA 4HX8A 1VBE2 2ZBJA 4UB8C 1NCRB 1GZWB 4UXAA 3BOPA 3VOEA 3CNAA 3HOZJ 2HDCA 1FI2A 1CAWA 5CKTA 3CQZJ 2QENA 3WTYC 2VMCA 2LLKA 2NS7A 5IK8A 2R5ZA 2VZ3A 3WTVC 4Y3OA 3PJRA 1NXD1 2P4EA 5JSRA 3WW3A 3T5XA 5HNFA 4V1PA 4JYKA 2MABA 3ZSMA 4IGOA 1LVKA 3M8LA 4EE2A 4MNUA 1MZ5A 4IEXA 3DU5A 4YIRX 2ZTNA 1FOD3 1NA1A 2FCTA 2CRGA 3MIFA 3SCGA 1YQ2A 1AR82 3T08A 2DUQA 4MQ9F 1S1AA 2J1AA 4Y5Z0 2QQ8A 4KISA 3L2WA 2ET7A 4N4OB 3SXWA 4QPQA 3I59A 2P5BA 3ZYIB 5E1WA 4CUAA 1XGNA 3OF1A 3KV6A 1ONAA 2V9KA 4YW4A 2ES3A 2HVSA 3ERED 1ZX5A 3SKJE 3VBRB 3ZMDA 3L2YA 2P6CA 3TBDA 3DYOA 1UYXA 5BNPC 1MH3A 1A8MA 2P3IA 2CV1A 1T39A 2HLEA 2PQQA 3VZKA 1JKRC 4LBQD 1TT0A 1LOCA 1F4AA 3QAHA 4P9LA 2WINB 1MZ6A 4QU1A 4Y17A 4YM1A 2VZQA 3M4FA 3TO7A 5FYHA 5IP9J 2WYSA 3K4BA 4XFGA 1WJFA 2HEYF 1RR7A 2IS1A 2CUJA 2PX9A 5FQ0B 2IVIB 2G9GA 2DFFA 1S0GA 5J1RA 1VJ2A 5FKCA 2XJPA 4C3HJ 5FZKA 3L9FA 5KXEA 4AM3A 2EV6A 1O59A 1IHMA 4DFSA 1N1VA 1AR91 2XF7A 2HWD3 5C5UA 2QCOA 4ATFA 5KAFC 3DFGA 4Z2YA 1C8M2 2RJKA 5FUPA 2ZA9A 2CV2A 5JVTA 4A3DJ 1NKGA 3Q9SA 2VH9A 3DQVC 5FRMA 3LKJA 5FZ6A 1ASJ2 3I4PA 2BNNA 1MMAA 2HWD2 1OI6A 1FATA 1G7YA 4XUNA 3BJOA 2VM9A 1AL21 1UQXA 2D45A 3QLQA 1R5ID 4UF0B 5BS6A 3M3QA 2VCMA 4EZHA 1BI0A 3BIWE 3VHPA 5JXGA 5L73A 1KU2A 1YHFA 1LESA 1W2OA 1I6XA 3CJIA 1WCMJ 5LGNA 1DF0A 1BVP1 5J09A 5GAHJ 2V1UA 2FE3A 4A3FJ 1JUIA 3DPUA 4FCAA 2R7XA 2OQ6A 3JBG2 2AXTC 3V8LA 3G1OA 3AVSA 1O3RA 3K51A 2K4BA 2LD5A 2K27A 1AR73 1D0YA 3QP5A 3H50A 3VYRB 3PU3A 3T0DA 5K5RA 1S55A 4IE7A 1RUI3 3LL7A 3H9AA 3DKYA 3PQJA 3QRFF 2VNRA 2W47A 5FPAA 2VLAA 3HUGB 1ENQA 1PYVA 4XQFA 1GZ9A 4ON0A 3S7EA 4LMYA 4HETA 2WZPP 3S7IA 1DGWX 1S7AA 5LWBA 1T33A 2K7LA 4BDZA 3THCA 4CEWC 2JXAA 1TQIA 5AFEA 4LBQA 5D21A 4DQ2A 1CIWA 2Y34A 2XRNA 3ZRGA 1G86A 2YDEA 3H8UA 2M2EA 4QHZA 3RMYA 5A7WA 4PJ0C 1ACIA 4C2UA 3GCXA 2GLOA 1ULFA 3AP5A 2J1TA 1FXZA 1L7RA 1DHKB 2F5CA 5HDNA 1X2NA 3MMYB 4MHGA 1QJY3 1ASJ3 5L3DA 4OIOF 3UNGC 2A70A 1MS9A 1EV7A 2ZX4A 4AHYA 3V0AA 1O4ZA 2LH9A 1WHUA 5F27A 5CFCC 4NAOA 5FREA 4LBQB 4AXOA 4XFHA 1OXCA 4B48A 2QDNA 5FKOA 1B9MA 3CUQC 3LAGA 2KFDA 1R083 2X1CA 2XAHA 2WNUC 3WDUA 3IN9A 1YWKA 3C7GA 1YI9A 4W6XA 5SV5A 3HZJA 5DZFA 4AVSA 1GVDA 3ZYPA 3VHNA 1HJGA 4DBQA 1SFEA 1OR7A 4HK8A 2GZWA 5HS7A 2BVVA 3SCFA 3K4CA 1O3TA 1OUSA 2DMPA 3CJQB 5ICCA 2HOSA 2STWA 4TN7A 4UY8I 1PIV1 2HQAA 5A33A 3A4UA 3DPRA 4B3NA 2FJ1A 2UYAA 2BHYA 3JBG3 4XF3A 2ENRA 4NMIA 2DBNA 3JRHA 2JDUA 1UAIA 1JI6A 1QJEA 3MLLA 1RUE3 1QHGA 2JG9C 3NMBA 1OR7C 4DIQA 2JE8A 2WAAA 4PCQA 3KGZA 4IE5A 5FGMA 4QWQA 3OUIA 4BYYA 4E8CA 3E6DA 2SLIA 2BE5F 4HPKB 4ZC3A 2JWPA 1QXRA 5CNAA 4DPNA 1UXZA 5D8LB 4D0QA 4D7TA 1RUJ2 3BR0A 3PUBA 4DRRA 2Y0SN 1KEXA 4CDXA 2MLGA 1ZN2A 4A69C 4QTRA 1JXSA 2Z99A 1VBB1 4A3GJ 4PJLA 3GGLA 3OG2A 2R041 1YITI 3POEA 1DG6A 3KSCA 3VDDB 4FPFA 5JOZA 2JENA 4WWCA 1U6GA 4OU0A 2ZJCA 3WP5A 3O0VA 2EILH 4RAZA 3OBZA 2C9KA 4ZZDA 4UFIA 1COV3 3W2AA 1RKWA 4XYXA 3RKWA 4BMBA 4FOWA 1DYPA 3BN6A 4QX8A 3I4MJ 4Q48A 3O1VA 2IW5A 3P9IA 3O6BB 4KWUA 4CEYC 3ZMVA 2Y48A 3J26N 5JAXA 3L2VA 4G8XA 1XYNA 1X7NA 1MNDA 1MBKA 3B9IA 1K7AA 5CVJA 3HSRA 1DZTA 1QF3A 1TNRA 1AL0G 2VQTA 1VPHA 2Z79A 5IT9Z 1L3JA 3V65A 4BQOA 5FXWA 3OL4A 2EAKA 1ZG5A 1DYKA 4KU8A 4WBBA 4FPHA 1AXKA 1D4M1 2ZOEB 2CDPA 4PT6A 2JDMA 4Q4Y3 1F36A 1IF1A 3ABTA 3TKYA 4BPZA 3F9KA 3BU0A 1QNTA 5FZLA 3U10A 1LEBA 3SYTA 4QX0A 2LBFA 1RUJ3 3K77A 4EATA 4XOGA 5JHUA 2JDYA 1WLWA 2PMHA 2PQ8A 2HWE3 4RM3A 4J1WA 4RB1A 4YELA 1WRJA 2AC1A 2OX0A 4LLOA 4RD7A 3CCYA 1CF7A 3PO2J 2RREA 5HCHA 2Y6FA 5IOYA 3NV3A 3ZQFA 4RQPA 3VZJA 4TLFA 2F6CA 4XHBA 4OI2A 1W28A 2X9DA 1ZBE3 3WDYA 2ZXIA 4CUCA 1S0EA 3W21A 1HJFA