3ROZA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nicotinamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Apolipoprotein A-I-binding protein
total genus 68
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rozA00
2DG2A 3RRFA 3RTBA 3RTGA 3RREA 2O8NA 3RO7A 3RS8A 3ROEA 1JZTA 3D3KA 3RRBA 3RSGA 2AX3A 3RRJA 3ROZA 3RTDA 3RSFA 3ROGA 3RT7A 3RTAA 3K5WA 3RU3A 3RNOA 3D3JA 3RT9A 3RU2A 3RSQA 3RTEA 3RS9A 3RTCA 3ROXA 3RSSA
chains in the Genus database with same CATH superfamily
2ZYUX 3B13B 5YASA 1IFXA 3BDVA 1MDFA 3KJEA 3TR0A 2JCBA 4U2EA 4Y2QA 2GETA 3RM3A 3GEMA 4MUGA 3AYZB 2BEJA 3ZW9A 3H2YA 4YLGA 1VJGA 3CUWA 2F64A 4OGWA 2IX9A 2H8KA 4C14A 3VA7A 4RD4A 3PPIA 4EEZA 4HLUC 4ZVLA 1MOSA 4Z7OB 4X8LA 2I4RA 2PWZA 5K3DA 2X4IA 4UUMA 1J2RA 3L6EA 4IKPA 4QA9A 4WMLA 2Y77A 1BW9B 4L3VA 3H9QA 2I78A 5DGTA 4RCVA 3MWJA 1I3MA 5EHXA 1FZQA 1O5IA 1UKCA 1WLYA 1WNFA 4Q9IA 4X44A 2J3MA 3B3JA 3ZH9B 2W83A 1CEQA 1DKQA 4L22A 1ONSA 4UASA 4BN4A 4EEXA 4F72A 2WB2A 4JYAB 3A2NA 5AQ1A 5CH5A 1KO4A 3WKAA 4X1YB 2B5WA 1LY1A 1PTJA 4XUGB 3HB7A 3LXUX 2AFHB 2RCNA 2ZIAA 1DEOA 4G4JA 4NDAA 5HCIA 4K5QA 4AZ3A 4O3FA 4M9CA 3KKKA 1Y8ZA 4JI5B 4M37A 3WMXA 3UJNA 2O7NA 1ECFA 3EBPA 3G5LA 4RK7A 4YAUA 1Y3DE 1OX4A 3EZYA 2OHGA 5ANRB 1GPMA 3NT2A 4GOOD 4ND3A 3HRKA 1TE2A 2GWHA 4KVZA 1CDOA 3UM9A 2DFKB 3DZBA 3EVTA 1RKUA 2WFLA 2ZBPA 4NU6A 3V1LA 1PE0A 1DBSA 3ONFA 5U4QA 3RVSA 1YL7A 3K9HA 4XCVA 4YX9A 3P9YA 5KQSA 2HTFA 1I1OA 4PSKA 4R2XA 4TV9F 5ALIA 2IWHA 2WLSA 3A7EA 5AW1A 5JECA 5U9CA 9MHTA 4C6TA 4QGHA 5B2FA 4JN6B 1U4OA 4KV9A 1Q74A 5IXSA 3FOFC 5DO9A 4HNAA 1WTCA 4RIHA 3H05A 3CRMA 3O4IA 3OF5A 1I80A 3RBXA 1WY7A 2BFEA 2DJIA 2C2XA 2FPUA 3TLBA 2EP7A 4G1BA 1Q7GA 2ZR9A 4GP7A 4JX8A 3TJRA 4KR6A 3CX8A 4QM7A 2XPCA 1N2BA 3FMPB 1T10A 4Q3EA 4QVKA 3TCNA 2I0FA 1M1NB 1Z28A 4D57A 3MJCA 1G17A 1X80A 3MJDA 3WWZA 4NRDA 2J67A 3S2UA 1B1AA 3TE6A 1D3AA 2UZ4A 1GPDG 4NZOA 1LLUA 1WULS 2V1UA 1ENYA 4AO6A 4BO7A 2R48A 4WWHA 1N5KA 1YFJA 1KHHA 3CPEA 4UFPA 2NT4A 4RABA 3SZOA 2IDMA 3WWYA 5IJ9B 1NL3A 4DMUB 1LBIA 3GQBB 2CJYA 4FB4A 4NLLA 5DJ5A 1Z63A 3QKSA 2X0EA 2QG4A 4OJQA 1R0BA 2KPOA 4N82A 3SC2A 9ABPA 1EM6A 5ILQA 1K8YB 3AJRA 2ILVA 3FB1A 4GZMA 3OPYB 4ZAFA 3JWJA 1O7JA 4C78A 2L2QA 3EXG1 4MDHA 2P9FA 3WO1A 3TBKA 2W0SA 3QPUA 5D51S 5EJ8A 3KQYA 4BZXA 2XMGA 2YWBA 2OXRA 1A5SB 4EB0A 4C7OB 4XFKA 2W6OA 1DI0A 1PP4A 1NQOA 3KZ1E 3RFUA 3SKVA 4AJNA 4DSZA 2O2CA 1HYQA 1JEAA 2NXJA 3ASYA 3QFCA 1V5EA 4HLCA 3I2JA 3PBKA 5UKDA 3ESDA 1T9BA 4YP1A 1M2OB 2GK3A 2PL3A 4NCIA 3BCRA 3WZLA 4AW9A 1RSZA 3JATB 5DNEA 2PQ2A 1U2SA 1VI2A 2YZMA 3I6YA 4IRXA 2X5JO 2YUIA 1KFBB 3KD3A 4E32A 4QT4A 2RC5A 3D3JA 5JSFA 5L53A 3O7MA 5KVVA 5JANA 2PO5A 3C48A 1H0HA 1P1IA 2FTKE 3ZU5A 1IBSA 2BLLA 1BROA 2EP5A 1TX4B 1K7FB 2AWOA 2Z8ZA 4LDZA 1FX0B 4MRVA 3OIDA 3I53A 5HJ5A 1BFKA 1F5SA 2QYSA 1KK1A 4I6JA 5BV2P 3THWA 1WOMA 3PDJA 2O3UA 2DB3A 1A1SA 1EE1A 1UFVA 2WSSD 4L16A 4PFJA 1XRSB 1L2TA 2CLFB 3Q72A 1W48A 4CLEA 5K0ZA 1U7DA 4ND1A 4AJIA 3I5UA 3P9CA 5FOUA 5KJFA 1NKVA 1TW2A 2QY9A 1YZUA 4LX8A 4TL6A 2M1ZA 2PMBA 4W7SA 2JBHA 1XRQA 1GUAA 3ND9A 3V34A 1VRWA 3G68A 4LNHA 2HPZA 3IAAA 4YRFA 2WVJA 3VNSA 3OQVA 4DG8A 3HXMA 4RK0A 2JGJA 1RC0A 2XVZA 1SIBE 3EGXA 3P8ZA 3JQ7A 1OE0A 2G72A 1F2TA 3UFBA 3KU1A 1MP0A 2HIAA 1JUDA 1QAMA 2OGUA 4XXHA 4KV7A 3AP2A 4BFSA 1Z4LA 1NXQA 2PUWA 4W8OA 4G5YA 4AXXA 5HKBA 4DT1A 1HY3A 3NEJA 5E3JA 3F8SA 1YRYE 2YZ2A 2D5AA 2RBGA 3TKAA 3BB1A 4L72A 1J2YA 3RE1A 3TXAA 1TQHA 1OB2A 2WD8A 4K9RA 5AXCA 5K3SA 3WQSB 1FTYA 4Z0NA 2FETA 4GU5A 5HRAA 2GERA 3DPUA 4CKXA 4LCJA 4RGBA 1Q19A 1XN1A 1TTPB 1S89A 4EQZA 2QQGA 4YJKA 1ZM2A 2R00C 3A10A 2I3AA 1G41A 2B92A 4Y9TA 1DV1A 3ZW8A 2NGRA 2P9BA 4C3UA 5LJIA 5LNK6 3IP8A 2ZRCA 3WLIA 1QJ4A 4JR0A 1GWNA 4TZTA 5ESRA 5HHTA 2H92A 4CKEB 2BMWA 2IYOA 2WTMA 2XKAA 2DUMA 1EUCB 3UGQA 1SZPA 1Z6YA 1N36B 4J0FA 5COAA 1UT5A 1UPCA 3OC6A 5CFRA 2PH3A 3GXBA 3IJPA 3MB8A 3RPEA 3WIDA 2Q5OA 3U6BA 2IHVA 3PNMA 4WAUA 1ST2A 5ETJA 1KQOA 2G1UA 4WN3A 4Y9UA 2VTDA 3KCNA 1R15A 1CJTC 4J75A 4P9NA 2CXPA 4Y98A 4LTDA 2GILA 1EEHA 4CQMB 3L41A 1JH8A 1VA5A 1B26A 2MSKA 1X74A 2WJVA 1EI9A 4GIBA 4OLFA 5KI6A 3WICA 4EJFA 4CRWB 4EMUA 3PV0A 4HOYA 4FP9A 2VJMB 2IF0A 4HH0A 2JFNA 1I1NA 4COOA 3TNFA 5IANA 1DDOA 2Q5CA 4ZZ3A 3IB3A 1YWGO 3B3QA 3HHPA 2IYUA 2VTBB 4CMIA 1C30A 1SUDA 1BE6A 1G3MA 2C03A 5F51A 2AQ8A 3IBGA 3M9XA 2A5GA 3ZQJA 3CVOA 3WA7A 5KIAA 5EG5A 3KOMA 4WOCA 3ZXSA 2CXRA 1RBYA 3VKWA 1IXZA 3ZNOA 2LRHA 4QU5A 3I2IA 1XZEA 1G21E 1X7ZB 3ZUGA 3KT3A 4UVEA 4MVJA 3QBVA 1YNOA 4EHIA 1X15A 3A58B 2FUCA 1PJZA 1XDZA 2REOA 3KSZO 3O4FA 4JQOA 1TQ2A 4MJ3A 4U7WA 1CEYA 2PL1A 3LGSA 4JV5B 3B6JA 3EDCA 2Q2VA 4JLOA 1A3CA 5AD1A 1X8LA 5GONF 4MIOA 5BW5A 4DLLA 3GGSA 3WLTA 1WXQA 3BZWA 4QO7A 5CEJA 1XL1A 2WIAA 3OZCA 5EMMA 2C92A 2F1KA 2ONYA 4FFMA 4G85A 2CV0A 3DWFA 2RK4A 2YXEA 4G24A 4YLYA 4CTJA 3PS9A 4CM4B 3P2EA 1CDDA 5AW4A 5CVDA 1FP6A 4B2PA 4L3OA 5E3IA 3VU1A 5JRZA 2I99A 1TYEB 4YJ2F 4OA5A 4RXMA 3T3IA 5CEFA 1H2YA 2PTGA 1OBOA 4Q9JA 2BEUB 2V6GA 3G2KA 3TW6A 1JQAA 2BEUA 3SU8A 2CLMB 2AZ4A 3NEYA 4M0KA 1TNDA 2G8LA 4FN4A 4NYJQ 3W6PA 5BWLA 4XSGA 4WBNF 2FWNA 4AG3A 2R85A 1Y1TA 4CETA 1IBRA 1BKSB 2BL4A 4MLDA 4R0VA 2A0XA 2CVOA 1C8BA 2HRBA 5HILA 1CJMA 1ZGBA 4IXTA 2NO6A 1QIEA 2ASVA 2ZRKA 1DLIA 2MMGA 3NNNA 5EZYB 4ACBA 3UIEA 4EHNA 4FWIB 3GH1A 1KJJA 3NBYC 4PGAA 4BCDA 1SQGA 4ZANA 2R8XA 4FHEA 3WK6A 3DO5A 3BOSA 2NUAB 1Q0ZA 1Z5GA 1DJMA 3SFZA 1PRYA 1T6XA 3GFBA 4KQIA 4AF7A 3N53A 3OX1A 3CZQA 1WCYA 1NBHA 5A9RA 5E3HA 4MAFA 3V8PA 2XGJA 4RA9B 1E2EA 1K7XB 4QXRA 4X91A 3AUJB 2H06A 2O07A 5CBKA 4YMGA 3KDAA 1YJQA 4AWBA 2NIPA 4UTPA 1QFSA 1FK8A 1HC7A 2JIBA 2ZR7A 5HE8A 5GV7A 1KEUA 4YWJA 4AMBA 5B2EA 1VL5A 3IILA 1PWHA 5CT6A 2GZ2A 4M54A 2IUUA 1T2EA 4JGBA 3UA3A 1OXSC 1TGVA 2IPAB 4JENA 1EBFA 3RTGA 2GZAA 5HM8A 2A5FA 3ZC3A 4KI0A 4OP1A 5L6MB 4NSNA 2WTAA 4GMDA 2AJCA 1HDYA 2QSUA 4ZZ0A 2CWWA 5CLGA 1JAXA 3G9UA 3X1DA 3CEHA 4ZOLB 5BORA 4LRQA 5ENVA 421PA 3RJMA 3U7GA 1OTXA 1Q0LA 2D2IA 3BEOA 1BE1A 4B5KA 5G0WA 3QSYA 2J33A 2C1ZA 5EKSA 1MB2A 3D8NA 5D00A 3AOEA 1Q83A 3QYFA 2IYSA 3SCZA 4BVJA 2EJUA 1C4WA 1NVDA 2O20A 4BO4A 2Z6VA 3HBLA 4IVQA 3V1YA 4I14A 1P4JA 2MDTA 3IDOA 3FW1A 4DNQA 4OHCA 3G7SA 1E32A 2AIRA 5A3SA 5KMGB 4B3GA 3C8DA 4CMIB 3OOYA 4CKBB 1AD2A 1N9ZA 2PFGA 1E1KA 3GG9A 1KVTA 1Z2EA 1ZIOA 2OC4A 4G0NA 3WA6A 1A9TA 3X43A 4BP9A 5K6TA 4AY3A 4KIUA 2X8JA 1EVYA 1YC2A 3PQ2A 4AKEA 3M49A 1A9YA 3HN7A 1XMVA 4GYJA 3C87A 3DFKA 3IBFA 3JQFA 4BNHA 1MTOA 4BMVA 5HBRA 3I0NA 4U7JA 1ZGAA 3EGOA 4U9IS 3DT8A 2ATVA 4D0NA 6REQA 4RMJA 1ZVJA 4JUCA 2P75A 1ORDA 3B1WA 2V55B 4JQYA 1KQPA 3LVQE 1QK5A 3DAHA 5DHPA 3JQAA 4HAOA 5KYKA 4OU4A 4G4SP 1RJEA 4ZALA 5L4SA 3C6QA 2ZRBA 2IHKA 2I1QA 1AN9A 3DMNA 1ISMA 1QNFA 3PFBA 3WWDA 2BDUA 3ILXA 4OB8A 2V7XA 3TRJA 1QIKA 2PMEA 2XCLA 1Q3HA 3ETHA 1A72A 1RLUA 3NHRA 1NXWA 1ZOOA 4NHOA 1A0OA 1ST3A 4NCJA 2AL7A 4EMTA 1LBEA 3CRZA 4AL4A 1CZUA 1R0CA 1YAHA 5HIKA 2DBYA 4MV1A 4YN3A 1IWOA 1O97C 2O6LA 2QZPA 5AVJA 3UJDA 4YAKA 2CYBA 3ER9A 3THYA 3VC3A 1GPAA 5BR8B 4IW3B 3IEUA 1ADBA 2WIJA 4O33A 3FHOA 3AHCA 4YLEA 4HRVA 4E12A 5AK0A 4FIZA 1WU8A 2PH5A 3WGQA 2CCJA 3OKCA 4UREA 1ZA2A 2GX6A 1Q0HA 5CA0B 2EL9A 4BVHA 1SA0A 3AINA 3LC1O 3E3MA 2P91A 4BECA 1ABBA 1L5RA 3EA0A 5DNAA 2ZR8A 3K9NA 2YY6A 2FN8A 2V45A 1OZ0A 1RKQA 4JP1A 3C7CB 5DLQC 3WMGA 3AVTA 4QJ3A 2H5IA 3BHIA 3PB3A 2JFPA 3KEQA 3IQXA 3H7AA 4EF5A 2AT1A 2G9NA 1U0BB 5LLSA 3T1HB 4LVCA 2J3DA 4QPDA 1RJ9A 7ABPA 1XN4A 1UDBA 3FNRA 4FCWA 4KR2A 4EW6A 2OECA 4YDHB 5A2GA 5HOEA 4P0PB 2IC5A 1IQPA 1V11B 3GZNA 3PK0A 3LIIA 1MX1A 1D1QA 4DWVA 3H4IA 4EL0A 3QA3E 1YXMA 2FRDA 3EQZA 3MM4A 2Q5HA 3JASB 4B2YA 1LBQA 3DUWA 4IFTA 1DKUA 5KDDA 3NTQA 2EP8A 3BH7A 2QXTA 4PY2A 2YRFA 3B82A 4L8LA 3NRJA 221PA 4RKQA 4F2WA 2WMNB 2JCSA 4G9BA 4BEWA 4N5LA 3ROQA 3S7ZA 3GIDA 2QPTA 2WM9B 3NPAA 1Z6ZA 4W5QA 1U1DA 1ZGJA 3QKSB 4LMAA 4KSCA 3PD7A 1U8FO 4TMZA 3LTEA 2JAWA 3SQDA 1YA6A 1EFRD 4X1IA 5ITSA 1JYEA 2HLDA 4F06A 4DB2A 5EYPB 1CS4C 1EE2A 3N0TA 2GM3A 1HE2A 1D9ZA 4J0EA 4YAIA 5LQRA 1IOLA 4CN9A 4TTIA 2QL5A 2NYUA 3X1XA 3ZK9A 1F2DA 1HI9A 4AJ1A 1E3WA 5K0FA 2HBYA 1SKQA 3DEKA 1I7PA 3EXHB 1T1JA 4FONA 1DZIA 3DONA 1VGQA 3GFOA 3ISJA 2ZE8A 4KQ6A 4KODA 4W99A 3RUEA 1QRSA 2PRYA 5HUHA 2EFGA 4JBYA 3N70A 4AROA 3AF0A 1REQA 2OB2A 4A8JB 3EA4A 3QP9A 1LQUA 3ZIUA 2O57A 1ORRA 4MQMA 3WZMA 3G9ZA 3C16C 2YFQA 3PVCA 1L3IA 3Q7RA 4GGPA 4A8JA 1L4GA 2FJUA 1R88A 4I55A 1N3YA 3GBSA 1IB0A 2VJMA 2DWUA 4LQCA 3KUDA 4XTRA 4OSPA 3WLRA 2PX4A 3O31A 5AESA 5F2EA 2LW7A 5T4EA 4UVIA 4ZZ1A 3TZCA 4OFBA 2IOFA 1XEWX 2CL6X 5G3YA 1QAOA 2Y71A 3W5DA 2GKGA 2PLNA 4FMPA 4QOHA 3RSSA 5DMHA 3VHQA 3ETDA 5E4YA 2B5OA 2VP5A 1FLNA 5A3JA 1AXRA 1XFDA 4HUJA 4JKIA 2AMJA 1N3IA 2EJTA 1IMJA 4HSEA 4B09A 2ZVPX 2ATXA 1TZCA 2I2BA 4MI1A 2HADA 1LDMA 1YBVA 3PNSA 2PR2A 2EEZA 2FFRA 4PCLA 4YTEA 2B83A 2JK0A 3W7AA 2HMTA 4RMGA 1MTZA 1N2XA 1RHRA 4PRKA 2IYEA 4RAQA 1VG9B 3FVQA 4Y2PA 5EXTA 2B36A 4R8LA 2J9GA 1EFPB 3B6ZA 5AMXA 2DU8A 5K3OA 4X62B 1LD3A 2PGOA 1QF9A 4BZZA 2OHOA 5DNCA 3HCFA 1Z38A 3NX4A 2R4QA 2FNAA 3I9V6 2KI5A 1YR7A 2JIDA 4Z4EA 4LRYA 2J0UB 1DZ3A 1R74A 1OFUX 4MUXA 4NV3A 3NDBB 1IK4A 1U3FA 1JHDA 1EP2B 3TTSA 1TB4A 5BV8A 1N2GA 2UXDB 1ULHA 2NTEA 4PAQA 4CT5A 1SCJA 2I80A 4KN6A 4FOOA 1NXTA 3V4OA 4BIIA 1BU8A 3OPYA 1K8QA 3ZHRA 5I9LA 1JMKC 4QZVA 2JFQA 2V4UA 1IHPA 1JDTA 2P3QA 4EBFA 3GW8A 1K06A 2CBGA 2AX3A 2NTJA 3BCHA 4FQ8A 5AVSA 5K7SA 1A04A 4IYRA 1FVFA 3NASA 3NHWA 2EFDB 5ELMA 4EPRA 4B3RB 2Y2UA 2FHSA 4KIWA 1U4SA 3VAYA 821PA 4Q7JB 2Q5QA 3KYIB 1W9MA 5H02A 4LGMA 3Q7QA 3VSAA 5EJEA 2YFKA 2DPMA 3LCUA 4HDKB 3A9UA 1U3DA 2FKNA 4PINA 5I7SA 1E3TA 2ZAYA 4R98A 3H99A 4KQKA 2PLRA 4RD2A 4UHBA 1WHSA 4M6WA 4D3FA 4PNEA 1YZLA 5CBPA 5H4GA 2QI9C 3DL7A 5T3UA 1ZMBA 2OCYC 2XCUA 5AW5A 5CYGA 1UM9B 2O1SA 2BGUA 2FMIA 1Z16A 3REFA 5HTOA 1I6MA 1KP3A 1JEJA 3WL6A 2NU8B 1JZTA 4WLOA 2NZJA 2IIBA 3TMAA 2B61A 3B6MA 3FZYA 1TUGA 4H18A 4R2JA 1E6WA 2SECE 1MNAA 2GB4A 5DN6A 4IIFA 2AOTA 1EFUA 4EABA 2P6OA 4KB5A 3JVUA 4M0UA 4PC3A 2XKJE 5T8KA 5TQVA 4ZV7A 2YJGA 1FYDA 1P4AA 4Z8XA 5A7HA 1AHHA 4QOEA 2L17A 4DM7A 4DREA 1K6IA 2EKLA 3OZSA 1J2TA 4JR1A 1SMKA 3MT9A 1UDXA 5ERYA 3R74A 5ICEA 3GG2A 2RGXA 1PJ8A 3RS9A 1M0SA 3EMVA 3C2QA 2OMEA 2OVFA 1ZZEA 1ABFA 2AJTA 2Z43A 4ZA2A 4DUYB 2FAXA 5CYFA 5JROA 1Y9JA 3GLGB 1G38A 4H1TA 3OQNA 4PG5A 3AUAA 1Z36A 1FY2A 1YZQA 2WKPA 4E94A 3NTLA 1FVXA 2JZCA 3I5YA 2HV9A 5CX4A 3WRXC 3MS2A 3ANNA 5LDGA 3W4IA 4CEJA 5ICCA 4NOMA 2TSYB 1VL8A 2ECPA 3L4BC 3OX2A 4MVYA 5C3UA 3RC2A 3SEFA 2B7CA 3WK5A 4BNYA 3KB8A 2WTXA 3T9EA 4ARAA 5FI3A 4PYQA 1UQRA 1FDTA 2PV7A 2QUZA 2CY0A 2NUTA 4QDJA 3TF5A 4U2CA 4HDMA 1PSWA 4MUBA 5CHEA 3ESZA 2J5XA 2YJZA 3DKRA 3MWFA 4ZCRA 2IH2A 4JX9A 2ST1A 4UCFA 1VCOA 3IIIA 3Q2IA 5LQNA 1KZ1A 4QYMA 3ZHZA 1IRXA 3QJGA 1C9DB 1DBPA 3C70A 4X1OA 1TYDE 2IHBA 3H1GA 2K2WA 2R84A 5C7IO 3DG9A 4BQFA 4YRSA 4MQFA 4TYPA 4MI6A 4NYIR 1YDWA 4B8ZA 2JJYA 3E9EA 1VZ2A 2WAYA 4X61A 3BFPA 3IO3A 3NWPA 4FDTA 4CM9A 3TLMA 1FFXB 1UZUA 4Z0TA 5K0TA 2P9QA 3DOFA 1KQGA 3HVHA 2X86A 1BXKA 3O94A 1JPVA 2HUPA 4M8SA 3CEAA 3IV9A 3FWHA 4H31A 1WCIA 1U8AA 3PLRA 4M0MA 5JS1A 4ECEA 3L8GA 3CS3A 3OZBA 3PNPA 4EA7A 2AE2A 2PXXA 1JR2A 1LV8A 1FFEA 2YMLA 3FGZA 2QD2A 5CX1A 3WIUA 1R00A 1NLMA 2R00A 3RBAA 4GLLA 2D13A 3N74A 2XMPA 4ZVRA 1Z82A 1SXJE 2FSHA 2VYCA 3FA2A 1YCDA 4R2WA 3T35A 5EUQB 2NUAA 4ZT6A 1OFGA 1PHPA 2VWPA 5K3AA 3WSVA 5AI9A 3F2IA 4TVBA 5EWJB 2QJWA 2N42A 1TEHA 5DSTA 2H9YA 5DLYA 5JT1A 2GYVA 3C97A 3O8NA 1IN8A 4YUWA 3HV2A 1NXOA 16PKA 1YD7A 5COBA 3U61B 3LDHA 5A7GA 2I6UA 4JOCA 4P33A 4JJEA 5FF9A 4DJ5X 1MB3A 2Q0QA 1W29A 2B8EA 1X7ZA 3FIJA 1YRQA 3SDZA 1KC1A 1ELOA 1NTRA 2R97A 2HLDD 3B9QA 3NHAA 4DA7A 3PX3A 4MR9A 3KWJA 4KX5A 5EIHA 3QX3A 1D7OA 4MB2A 3DVAB 3BMOB 3VU8A 3KELA 6LDHA 1WL8A 2WG1A 4D80A 1KMMA 1K7EB 1V26A 4BTLA 2HA7A 4II2A 2PS9A 1VJDA 2ZTLA 3FRHA 4OUKX 5F2NA 3L0ZA 5CCBA 3R7WA 1VLMA 2NUPA 3UC5A 4BATA 2NZ2A 2E4YA 1N5DA 4ETIA 2OHVA 2V6IA 2VHXA 2HW8A 1Y6JA 2VAXA 3DLTA 1K66A 3R2JA 4TXJA 3TLXA 3M8KA 3NTUA 3J7AC 1YR9A 3FZNA 1TMYA 1SJ9A 1T3GA 4LF7B 3IR7A 4U1RA 3UJ7A 3NW9A 5MHTA 1LSUA 2WC1A 4YJFB 4AYTA 3R3YA 4CFZA 4HDRA 2C07A 1DJQA 4R54A 3K9WA 5KTOA 3O3NB 3B12A 4LZZA 3F4BA 5THKA 3OETA 2V1XA 2Q3FA 4F6RA 1VYVA 3RUCA 1ESMA 2BMFA 2KBFA 1Q21A 2PX0A 1WETA 5KTYA 1I9GA 4ZCSA 1CUBA 5AVVA 1DG1G 3O8OB 1H93A 3A27A 5PGMA 2Y99A 1JILA 3P2OA 4KGXA 1G291 2X6TA 4FDVA 5KNBH 2GSWA 4CEIB 1C1HA 1MNQA 3L8FA 1S3FA 4YPVA 1M5RA 3W1VA 1XU7A 3BMXA 5L95A 1FLAA 3RFFA 1XCBA 3ICPA 3H1BA 5D1HA 1U0LA 3QBDA 2C7PA 4J7UA 4B3BA 1B76A 3UGJA 3PEEA 2FW1A 3TSOA 4GI7A 3FUXA 4X3CA 1O95C 2BGTA 4MUYA 2FQXA 2B4RO 4RDHA 1GCIA 5K6RA 4B7CA 4GICA 4LJYA 3KZOA 5DWQA 5KNDA 5I8WA 1N57A 3CLSC 1JHOA 2ONJA 4N0QA 1F48A 1W4CA 3A04A 4IJ6A 4M0CA 1LDEA 1HFWA 5EN4A 5FR2A 3SIWA 3WYBA 1ZR4A 2WUWE 4JC8A 1P5ZB 1RU3A 2HU8A 2XB9A 1XTSA 4ODIA 5JDCA 3EPHA 4JJFA 2ZJ7A 1O96B 4S1TA 4NK5A 4KYUA 2EKBA 1UAYA 1TXGA 2Y1OA 5ESXA 4RMHA 5DWDA 3B8HA 3PDUA 3PUXA 1L5VA 2PZMA 2O52A 2NLOA 3A26A 5DSZA 4JJ4A 1R50A 2Q3LA 2WB4A 4H4EA 4CR8A 4PLPA 4IH9A 3I01M 2VPIA 1E3QA 1IVNA 1GQYA 4DM4A 2OV1A 3ZWXA 3LHKA 1DTEA 2MU1A 4U5XA 5FV7A 1VKNA 3BXGA 5EQJB 5EIEA 2BTOA 2MJLA 4Q93A 4QHTA 3IAM6 1OBHA 4L4XA 1ZDMA 4ROTA 1OLXB 2B82A 3VC2A 2OZLB 2WPNA 3NHYA 1MJHA 3GAFA 4RE5A 4V24A 2E55A 1ZUWA 3H65A 3BXHA 1N2OA 4MYDA 5LZ2A 3D5EA 4G5RA 1KK0A 4IZIA 5ICSA 5F9HA 2JI8A 5ITZB 2EX1A 4BQOA 4UHDA 3EMDA 1KS9A 3H1TA 5B1SA 1QFZA 2BHLA 3IXMA 4KFUA 4Q19A 5DBEX 2I29A 4WOPA 3WY9A 3AR4A 3G82C 2UUAB 2GM9A 4Z8YA 4GVXA 3S0JA 4NTZA 4AP9A 2MSEB 4QTZA 2HK9A 1X39A 3Q7EA 3ZHXA 4C7OA 1Z3IX 2FRVA 3OAAD 3BE6A 1KH2A 3MCTA 2EF0A 1R0SA 4MPTA 2NPFA 5CFZA 5AKJA 3UAVA 3EZXA 1WB4A 3CZ5A 2YOHA 5AW3A 3K96A 1K0UA 2IIVA 2WJWA 4U9UA 3UWOA 2O7QA 5IT4A 4X92A 4EP1A 1EK1A 2I67A 4AF8A 2BGKA 2HF8A 2C04A 4EY8A 2O2EA 1T3ZA 1LCIA 1LLCA 5IBQA 3DDSA 3ZTTA 3TEMA 4FHDA 1I94B 2JCVA 1GL9B 4TLDA 2QQ0A 3FBWA 3JYOA 4MLZA 2JEZA 1Q0UA 5C8ZA 3FWPA 2Q3DA 2ZB8A 3H5WA 1AMNA 1SBIA 2ONZA 4NWIA 1SXGA 3AL2A 3IAXA 1XZCA 4DPKA 1L4BA 4WESB 3TQOA 2CFSA 2ZYSA 1W93A 2XZOA 2ZJBA 1XCLA 2FK8A 2ZBUA 3CQ9A 2J5BA 5L3SA 2C5LA 3Q7SA 3ZZMA 2C9DA 2D5CA 3B9BA 2OL4A 3T0IA 2PVPA 4EO9A 2CV2A 1Y7LA 1R4AA 3WLEA 2PMCA 5LL6P 3VDMA 4BGEA 2A0YA 1A77A 3QUBA 5KWJA 3H13A 4E14A 4KMSA 4RZXA 2VKTA 5IXJA 1IZYA 1U8ZA 3G9TA 4OBWA 2E5LB 4PSCA 1T5DX 4MWGA 3SSNA 3IR5A 1DL5A 4FNMA 4L57A 4TMFA 2ZRAA 3EGXB 3W7BA 2YV2A 3T7KA 1PWXA 2ODPA 3LW7A 5E9WA 4EKEA 1E2DA 4YP0A 5J40A 3ZD7A 3TMYA 1Z4JA 1T25A 2C3UA 3HACA 1NQVA 1E2KA 1W76A 3O73A 3TL2A 3KG2A 6ADHA 2YJTD 1GTG1 1N92A 2YH2A 4EENA 3K1ZA 5A6SA 2W2KA 1QG0A 4P3YA 3ZY5A 4NBWA 4US0R 3DBIA 3NAZA 1Z8FA 4LWZA 3KZNA 2I2DA 4KOEC 3MMSA 5TVGA 2FXVA 1W59A 4IR7A 2VQDA 1G8PA 3U5TA 3ICEA 4QPJC 1NHWA 1XFAA 3TH5A 3SM3A 5B36A 1UH5A 4UNIA 5IK2D 1XKTA 2WWWA 3MD9A 3CB2A 3CX3A 3FCXA 4TOIA 2PGLA 7MHTA 1CFJA 1RKVA 1HE8B 1TA0A 2FN3A 2ZJ2A 1OXVA 2JEOA 4E3WA 2R1TB 3EEBA 3H2GA 1IE3A 3C3DA 2BI8A 3I83A 4IIXA 2GEJA 3GZ4A 2DKFA 1H8HD 1C2TA 3WGLA 3EVBA 4AUNA 4IVRA 1G20A 4MYSA 3AZQA 4QYXA 5IVIA 1MA0A 4RQTA 3ZHQA 4F6RB 2I1WA 4OU5A 4IJUA 1NU6A 4BCBA 1NI5A 1OZAA 3D64A 3CLHA 1ZZGA 3ODPA 2F55A 2OWDA 1XDGA 3DMTC 2H1RA 1KSJA 1S7CA 2YJ4A 2IPMA 4TV8F 2C9ZA 3GUYA 4Z0HO 3R0IA 3B6EA 4YRJA 1AKYA 1KKMA 2AJLI 2V7QA 1SKAA 3NGLA 4WDRA 1ZH6A 3KTOA 4OLAA 2XUFA 4B7XA 4LFBB 2VHYA 2VJNA 3ITEA 2OUKA 3LM8A 4L6IA 4HXEB 3HE3A 1GG5A 3MTDA 3EULA 4XX0A 5D3MA 1RRGA 2DTDA 2C5EA 1EUDA 1XO1A 1QTNA 1NRWA 2C4NA 5SYAA 3EWNA 2GYWA 1X14A 2VRNA 2F9LA 2ORWA 1R5JA 4FX5A 4L4SA 3VKHA 5CDUA 1XXHA 4B3MB 3NNDA 3LDAA 2JJ1A 3DVAA 4X64B 4JJ8A 3IVGA 2IFTA 1PJLA 4IDHA 3ZGXA 2QB5A 3ZCVA 4FWTA 4QRDA 1OYOA 3ABIA 3OH8A 4UVHA 4A3SA 4A9AA 3F5FA 5EC8A 3AVXA 4IJWA 3GJZA 1J23A 1YRWA 2VQ3A 2QMOA 5EIWA 4PX5A 2PVCA 5KAPA 4WY8A 4LRWA 3WYAA 1RBMA 1NIPA 4N12A 3JU3A 1XVIA 2Y0PA 3NOQA 5LWQA 3OOEA 4EG1A 3F4LA 2P9ZA 5HM6A 1A8PA 4HLQB 3V97A 1FU7A 3KZXA 2JDIA 3JYHA 1SZCA 4Q4HB 3LUJA 3DV0A 4NG5A 2DRIA 1T9CA 4BFLA 4QBGB 2DYKA 4MA4A 1KMQA 3ZGVA 3IMKA 3MLEA 5D2CA 1GZVA 3CUSA 1D6SA 1JE1A 1YDHA 3Q3GE 3LOUA 4CLDA 5KNCH 3BIWA 2EW8A 4RE6A 1WO8A 1K68A 1JL3A 2Q99A 3D3NA 1T2DA 3QKRB 2G9UA 3I0ZA 4G0ZA 1BD4A 2YC4C 3P9ZA 3JQ8A 2FRDC 4K26A 4RPGA 4ZI5A 1K4MA 2R8EA 2FUEA 3WKDA 2WSSA 3BXEA 3F8TA 3T0GA 3PTAA 1YB4A 2ODAA 1GAQA 3K1YA 4FZJA 3Q8LA 5FNVB 1F06A 1K8XB 3DXXA 3BKWA 3LPCA 4MV4A 1AXEA 5JQGA 1O9GA 1U6KA 2MYNA 4ZHQF 1U1CA 3RK4A 2BZGA 3FN4A 3S2GA 2HC9A 5AM3A 1QQ7A 4V03A 1NFQA 1O2DA 3L7JA 3QVKA 5BQOA 2ZAGA 1PR4A 2GAIA 1B6GA 2EXXA 2X2OA 3O3OB 3ORSA 4FFPA 4XDGA 3E05A 3TD2A 4ZV4A 2HLPA 5TPZD 4HPWA 4XGNA 5DRTA 2XAAA 3HCDA 3LP8A 3PTZA 3TLCA 5DYYA 3UT0A 1D2CA 5DNDA 4KN8A 1ZINA 4S1WA 4RBNA 3C4QA 4EY7A 1QU3A 2IA5A 3I3SR 4LZAA 1V9SA 4YBRA 1VBFA 3W9YA 2I1VB 1G5RA 3E2PA 5AH0A 2DXIA 3RS4A 3E35A 1IDN1 3JQPA 3M4JA 3NTXA 4RF3A 1MHPA 2F3TA 2OORC 1DRWA 2OMKA 4LJRA 3KJXA 3ECSA 3AFOA 2LIVA 1F9EA 1KAMA 3TSAA 1C2YA 3WHPA 4MH0R 3FHLA 3CPSA 6GPBA 5C9ZA 1RKBA 4HZGA 1PJQA 3QIVA 2XHEA 1Q1ZA 2W4IA 5AM4A 2LTAA 2B7LA 3GJSA 1DIAA 1I3NA 2QUHA 4KRXA 3UBMA 4PIVA 1HO3A 4BPBA 1JWBB 1JSXA 3GRKA 2FHPA 2DQKA 3RUIA 3AC0A 5EVCA 4G86A 5IHXA 2PLFA 3SEAA 1ILWA 2Q3CA 4PFKA 1H9BA 4ZICA 5FUQA 5MF6A 4TKLA 2GOYA 2OHXA 1F4VA 3IEXA 2CF6A 1G6OA 1UWVA 1Q0TA 1YHZA 4MS1A 4E30A 3CLUC 4MS3B 5T8KC 2C58A 3MJRA 4MS1B 4KYVA 1SUCA 4MO9A 4P4LA 5BP7A 1E2FA 4MP3A 4R9RA 3PCRB 2A67A 4ZT3A 3ZNQA 2YHAA 4MWBA 3BTVA 3K1JA 4F8EA 4XVUA 2G6BA 5EZYF 3WTBA 4WDQA 1SAYA 2GBIA 1ANKA 1XZHA 2WHYA 3HVKA 2R7NA 4FR0A 3LW8A 2BFBA 1RYYA 3BJEA 3NJ8A 4YJ3B 1P6QA 2FWJA 5AVOA 2DM6A 3R23A 3MSXA 4MR7B 4ZODA 3S81A 1I4OA 1JPNA 2WOJA 2PT5A 3OIUA 1IY1A 4Q12A 1VIMA 1G9TA 4R8RA 1MABA 4K9PA 1USKA 1R6UA 4N1AA 1HQDA 1E3EA 1PO7A 1PZXA 5DI3A 3WL7A 4PVDA 2IXAA 5IZCA 3SNKA 1HNWB 3KX2A 4RPJA 5HFAA 1NJ5A 4BNVA 3GLIE 4DOMA 3PITA 3Q7TA 4PC1A 1CUZA 1CUUA 3HYCA 4P3OA 3OJWA 1AF7A 4O4HA 3GLHE 4CFSA 1WDMA 2GBPA 2O8FA 5EE9A 3LOPA 4WOJA 3AKYA 2B1GA 4HQOA 3WXMA 2BKAA 2WHPA 2J6CA 5B1DA 2XZDA 3PHJA 4EGAA 5FLKA 2QDKA 2AXNA 3MINA 3TZEA 3D0QA 1IM2A 1AGNA 3CJQA 4DXAA 3SKYA 2OV2A 4OD0A 1OZFA 2GXSA 4AJ4A 2XH8A 4A73A 3NR2A 1NVBA 3OMXA 3D6AA 3PDHA 5DCYA 1VBNA 2JARA 3ID6C 2BVNA 4QREA 5ALZA 4IH4A 1AH2A 1H5NA 1EQUA 4TKVA 4BNDB 5BNZA 1LBHA 4BRWA 1KAGA 1U80A 3A4YA 2WFZA 1YKGA 4GC9A 4K6KA 1JV2B 4JCOA 3R7BA 4QU8A 2ZE6A 4JXKA 4WFKA 3A11A 4DLWA 3IP5A 3CWCA 3U56A 4U9HS 4BJ6A 1N78A 2TMYA 3GT0A 3PPXA 3IQZA 2C9CA 2QU7A 3FGPA 3QX8A 3O8LA 4A2WA 1VJRA 3I30X 1UADA 4KUEA 1GL7A 4NNPA 5EPOA 3KJHA 3STVA 5E95A 1OXMA 5GP1A 4JI2B 2YYSA 3F1LA 1BH2A 5K8IA 2CJPA 1QRRA 3HYNA 4DRXB 3RAEC 1SC3A 2RI0A 4UOZA 1IUOA 1SOMA 4MPPA 4D02A 4BKRA 4QAJA 5ADVA 2XTMA 1AKMA 3AR3A 3ZY6A 1A82A 4M22A 1F4PA 3RS0A 1R0YA 3HJHA 3H9EO 2R4UA 1ZPDA 2YTZA 5AOAA 1RXSA 3KQSA 4LNUB 5C8YB 4HGPA 4Z54A 1SVOA 5EFOA 5J2UA 3U4QB 1KOFA 5BPFA 2DERA 2D0PB 4G25A 4M87A 4WKBA 4IP0A 1G20B 1LPNA 1JVBA 4P8RA 2EBHX 4QUAA 2JJMA 2OK8A 4JSRA 4MULA 1CUXA 4G9EA 1HR0B 4PYOA 4V1CA 1Q20A 2R1TA 1GPWB 1WP9A 2D5IA 2RHOA 5L3SB 3HJNA 2UXCB 5ADWA 2R0QC 2OEPA 1UMBA 3WK4A 5CT9A 3O1HB 1NATA 4XPIA 3EH1A 4DIFA 4GD3Q 2B4YA 4K86A 1JB1A 1NJGA 2CDNA 3T3EA 2ZP1A 4RYLA 4IS2A 1YQ9A 1O6BA 1YE5A 2MSCB 3PUKA 2ZUCA 4HQ6A 3TPZA 1QQ6A 4IXDA 5AUPB 1D6NA 2G6TA 4KXWA 3GK3A 3H3JA 3LKBA 3OIGA 4BZQA 1Q1BA 1HURA 4LY0A 3HCWA 4PTYA 4BO3A 4HH4A 4K9KA 4KE6A 5DU2A 5CBPB 3IEIA 3USES 2A8YA 1MD9A 3I28A 3IUJA 4IO1A 1ZUNB 4FJ2A 5CJJA 4DABA 4G8JA 1RPJA 3FJOA 3L1VA 3SAJA 5AO9A 4JI8B 5DX8A 3IAFA 1MDBA 3QWBA 2HHAA 2Q2QA 2IS1A 3Q9LA 2CD9A 1JFRA 1FCJA 3CV3A 4HZIA 4JI1B 2HA3A 3K4HA 5LVAA 3A1CA 5ALSA 3DQQA 4ENSA 1Z15A 4JWKA 5DW0A 2B0JA 3ORHA 4BFYA 3AY7A 2BMAA 1AQJA 1QH8B 1RHKA 2GRUA 2ZYTX 3D59A 4RPLA 4ZREA 3ZGLA 3CKLA 5J43A 2AUMA 4AZ0B 4EF6A 1PL0A 2GCGA 1N9GB 1NNSA 2YY5A 1K6JA 3GNQA 5J2TF 4DADA 1FIUA 1M1YA 2SICE 2OKGA 4D8WA 1Y5IA 3DCYA 1DCFA 3FNEA 1A95A 1X1DA 4H59A 4WOBA 1SU7A 4O5OA 3EVGA 3HJCA 3PIIA 4ECAA 2GBLC 4BV2A 1W2WB 2PUJA 4TXLA 4E5UA 3F5SA 2ZJ0A 3RYFA 2VJOA 4KYTA 3O2QB 3VR4H 2V0NA 2W8ZA 3B7PA 2VATA 4FBLA 4NS1A 3VHRA 4B3FX 1U8XX 3LXRA 5DIFA 3H8VA 2X3YA 3FLMA 1UODA 4LWOA 4MP6A 1Y6GA 3LKVA 2E7ZA 1JG4A 2XQIA 3KB2A 3CF0A 4LN1A 4EJ2A 1VLQA 3L84A 5A3RA 5JH7F 1PUXA 1FL9A 1N6LA 1Y6FA 3B1JA 3RGWS 1GA6A 5ISMA 3EJ6A 3V48A 2BHTA 2ZSIA 3M3HA 4ZU3A 1ZN9A 4L0CA 4O1HA 4ZVSA 4RTNA 2F90A 1MX5A 4YMTA 1ZA1A 1AHIA 1NKSA 3H3XA 4BYMA 2GN0A 3F6SA 5AKGA 4LDNA 3LIPA 4P4GA 3VZRA 2R86A 4MVXA 3WOVA 1JLSA 4EMBA 5ALTA 1QG6A 1XWIA 1RZRA 3UV3A 4V3CA 3U62A 3VYUB 3NP9A 2D2EA 2QYHA 2X9VA 4OG2A 2FE1A 1JA9A 5D87A 3SZUA 3TI7A 3K53A 2ZQYA 5HMMA 3N1UA 5D01A 3RJZA 1BW9A 4V0QA 4ZU1X 3M6FA 3UW3A 2Y05A 1YONA 1W4ZA 3HC7A 2DX7A 3HCPA 2YHIA 3QF4A 5A05A 3ZTYA 1PFQA 4CBVA 3EUEA 2PUEA 1B8PA 3EXFB 5AK4A 4KFCA 2ZWIA 1W2HA 1PNRA 5KQRA 2C00A 3AWDA 2WTNA 2Y0CA 3GHHA 4QGAA 3QEOA 4F2GA 1A5BB 4M1MA 3ZHVA 5TF0A 5J2UF 2XUHA 4NQRA 2FN4A 4KFRA 1N4AA 4XYEA 4WA7A 4PYRA 3L18A 1E3WB 1PIWA 1RPNA 2DP4E 1JXQA 2SCUB 1M34E 2XE6A 5FI0B 3QU7A 1U1EA 1XCPA 3H5OA 3ZG6A 3AZOA 2M6LA 2ZGVA 3UHAA 2B69A 2EBFX 3BMCB 1SUAA 1ZVKA 3FFXA 4DDWA 2QRKA 3OEHD 5AVWA 2ZYIA 2I3ZA 4R0NA 2PKYX 3FRJA 1CJUC 3LUFA 3SF8B 1BX3A 1NW3A 1W87A 2NSDA 3BB3A 3PG5A 4MWDA 4J7XA 3D8UA 4AY6A 1VKOA 4KL8S 4L9SA 2X58A 1D1PA 1M76A 3RFCA 3QFHA 2JAXA 2D0IA 2AC2A 3WGNA 4HFRA 1H2ZA 3RKSA 5M2QA 2II6A 3S2EA 2A3NA 4DIEA 4DT1B 5IMSA 3EWSA 1P4SA 3NI2A 1PQ4A 2XYPA 1V7CA 4EY4A 4HL6A 5K9ZA 1QO0D 4LXHA 2JFBA 1KY5A 1B0AA 1Z08A 2AFIE 2WJIA 4PGHA 4XSVA 1USGA 1E3DA 1U0EA 2HFJA 1ORWA 2B4KA 1NVXQ 1TMOA 1Z0SA 2H9AA 3HCCA 4ZXPA 3AW8A 3F3SA 2O5VA 3TBFA 1CIPA 2BKEA 3ZKAA 1EH5A 2IY7A 2OO5C 4P80A 5DF1A 3MJ4A 4INJA 4AZ0A 3SLRA 4RTJA 1CNEA 2ZITA 3F6BX 3RV3A 2JLYA 3O91A 1UC5B 1ZH2A 2DY1A 5SY9A 5KC9A 5E2AA 1P2SA 4PCAA 2VSYA 4P4NA 1LLFA 3UV6A 1OH5A 1GT6A 2V9PA 2E49A 1G2QA 4QOJA 4X1YA 2O2ZA 1ZH0A 5TQ2B 3WB2A 3ADOA 4QUEA 1MEEA 2AEMA 1DKLA 3PL5A 4GP9A 3MWEA 1C3XA 1G21B 2DFNA 4PGMA 4RY0A 5AIAA 4CCWA 2WYVA 4LZLA 5ADUS 5GGYA 2GESA 5CX1B 1GSOA 4X66B 3KIPA 4G2NA 3GLGA 2CDRA 1KYZA 2W2MA 3PDIB 3R3HA 3T3PB 1H5QA 5H80A 2A3RA 3S8MA 1U5BB 3LRXA 1HV8A 4AVYA 4LE1A 1MQAA 2QE7A 3KPWA 4NCXA 1TVKB 2J0VA 1EG2A 2O19A 1CUHA 5ICMA 3L40A 3ICQB 1VMKA 4ALMA 3J81k 1HORA 3D6VA 3EIWA 1XU9A 3QU9A 5DM60 4C4AA 1L5QA 4Y2TA 5FTJA 4BFVA 2C2HA 1N5JA 2COKA 2PANA 2Y6UA 3BZUA 3LO8A 3FHJA 1ISJA 2QSZA 1KJIA 2IELA 2WV7A 3F46A 1YA8A 5IP5A 5F3WB 4ADSG 5KVCA 1XMPA 3RUAA 2CFIA 3LQKA 4DEYA 4QE3A 3GFPA 4PYKA 3WAKA 4BU0A 1PT6A 3B51X 3FPFA 4X97A 1KRXA 1XLUA 2VT3A 4FMDB 1Z5VA 1QGED 1ZITA 3O0DA 3V3TA 2VUHB 1WR8A 3HY3A 3L4SO 3CW9A 1WQ4A 3A4MA 3DVLA 3FYDA 1HDRA 3T34A 3TWOA 1QH1A 3SZ3A 4BE4A 4FYJA 1IUKA 3IODA 1HRKA 3LT0A 1IJKA 1OYVA 1UDAA 1UPAA 1XD9A 2EKDA 3AKDA 3PLNA 5CCDA 1LJ8A 2DFTA 5FOVA 3HCEA 3GLFE 4A5OA 1IG3A 1QS0A 3VX4A 4J1TC 2QMHA 1RLTA 3B7GA 1ZG3A 4JEMA 1Y8RB 2P9GA 2QW1A 2OM2A 4X94A 1P0MA 2HY7A 4X93A 3C3JA 5DK6A 2W7TA 5EPUA 3U7QA 4D3SA 3OPNA 5TJ9A 3BEDA 5A2QA 2J5QA 2O06A 4D8VA 1YIAA 4FSXA 1HOTA 1OZGA 3LLCA 5JCOC 2VF8A 1QB7A 4M36A 3UJAA 2G82A 1ISSA 3S3TA 4FBGA 1KVUA 1VSBA 2YIJA 1NF9A 4E07A 1RJWA 1RWQA 1Y3IA 1NBOA 4FMCF 1DEXA 1W34A 5CGZA 4DMKA 3CHYA 5H5JA 3LNTA 3M33A 4BLSA 1CR4A 5KQGA 3R7LA 1FJXA 2RHRA 4QDTA 5F5XA 1BOOA 3T15A 2ZTVA 3L1KA 5LQSA 4MPJA 1IEXA 1Y4UA 4DUPA 2IYWA 2YQZA 2PXAA 1ZD5A 4KLRA 4C6TB 1S9DA 4Y6OA 2R6CA 1R9NA 4HRAA 5DXAA 4EQ6A 1IWBB 4A2PA 1ZBQA 2IYRA 2FPIA 2PWBA 4MMXB 4PPQA 4AMZA 2XW6A 3W4KA 3F7TA 1NRXA 2VG8A 1V8FA 5K20A 3F4KA 4JROA 1HTWA 3T5AA 4I4NA 2X8AA 3GXOA 2OC9A 1LTHR 4RV4A 1ZI6A 3FTPA 2AN1A 3LK7A 3LO5A 1IY9A 1EXDA 1ADYA 2NXWA 1II8B 3QBTA 4ZIRB 1E4VA 1Y6RA 1V5WA 1D2EA 4EHBA 4XR9A 2H31A 5CA0A 1GITA 1WY5A 3Q3IA 1KJ8A 5JO9A 4EATA 4I8IA 3K73O 2Z5GA 5I7WA 3BSSA 3H2KA 2QTHA 2R6AA 4LJ6A 4LSZA 2ZJYA 3E9CA 5LMNB 4HQFA 1C30B 5KUTA 4F2DA 2EARA 5E8JA 5F1YA 1NVUQ 2Z98A 2UYQA 2OGWA 3UW1A 1MLDA 4X7BA 2MIIA 3MLBA 2AI2A 2P3OA 1M8JA 2VKQA 4W1SA 2PJDA 4A1FA 4A2CA 3H2IA 5IULC 4LXYA 3I1FA 5TDHA 3ZDQA 3OQ6A 3ZCRA 4NECA 4GPBA 5GJVC 3JWGA 1KY2A 1K92A 1VIYA 3O84A 1RXUA 4RMNA 3WE7A 2BUBA 5SV2A 1T26A 2WSYB 2ZI4A 4MKGA 4MYUA 3JWPA 4GBMA 4CG0A 3SX0A 2CNDA 3ETLA 1DX9A 4HUTA 5D7BA 5KOYA 2YJNA 3VZDA 4EFMA 3O4VA 1FUKA 2FJPA 1M6EX 1UKEA 2WAOA 3RSQA 3W3AD 4EX7A 3HSSA 4MKIA 4E5YA 5J4YA 1OR8A 3LBFA 4NXMB 1MB9A 1I7SB 1Z9BA 4B5LA 1VBMA 1CLEA 3DULA 2FK7A 2AUTA 2JJ8A 5B53A 4JYZA 2AD1A 2R47A 5CA1B 1DAFA 3V7YA 4ZC8A 4QJIA 4EPTA 2BIFA 2NG1A 4LHSA 2LUOA 1P0CA 3A6EA 3JZDA 4BCCA 1E20A 4GS5A 5JQWA 1NUTA 1GGMA 2W9XA 1WBDA 2YZNA 3U60B 2AC4A 4U6SA 4GH5A 3V00A 2QTGA 3X1ZA 4OXXA 1NX6A 3ASUA 2LD4A 4MRPA 2Q7OE 3GLKA 4AYXA 3QU4A 2VO1A 3TVTA 4DILA 5HS6A 3DMRA 2OILA 2EJVA 1WXGA 4JUIA 1GARA 1U0NA 1RQ2A 1XVLA 2H1HA 2Q27A 4XAQA 4ARCA 2PSHA 3WLNA 7REQA 3GLVA 1G8FA 2JRCA 3OTGA 3UVEA 4GP6A 3T1QA 3ZWYA 3VH4A 2FPOA 2P9TA 3SR4A 1CK4A 1P1FA 4Q5IA 5E1DA 3QLEA 3A9VA 3DCIA 2G8NA 4LEIA 3WLQA 3EIFA 1W35A 2DQYA 2IDZA 5CM8B 1OC4A 4F6CA 3BDIA 1TKCA 4HG2A 1O5TA 4KFTA 2ENUA 2YCBA 3A2MA 1HH4A 4L2IA 4O2BB 3UPTA 2VTVA 2ZRQA 3MN1A 4XKJA 2BFAA 3VR6A 5JFTA 4QJ5A 4BKOA 2YWCA 2IUTA 3SE0A 4XQ9A 3BGVA 2R8OA 2XGOA 3HKDA 3GLGE 1YMUA 1QVWA 5E6SA 2PX5A 4G2TA 5LXTB 4UJ3A 3M6AA 1DFHA 2MWMA 5ALKA 3PJRA 4MO2A 1OBFO 4DCJA 1NN1A 2V54A 3VMMA 3PYLA 2OQ2A 3MIIA 2IU4A 4PX2A 3HU5A 5GOZA 1N2SA 3DAOA 3TOXA 1HBJA 4X9XA 1RXVA 3PJEA 3EZ7A 1TIPA 2RGEA 1TT5B 3OEEA 5BR1A 4ME6A 3THRA 5C1OA 2M6KA 1R8YA 1FS6A 1GV1A 3AESB 3W3AA 3T5MA 3L4KA 3I76A 2QT0A 4RIFA 4GQBA 3OKAA 1YO6A 1P39A 4CLOA 4HFMA 4JGIA 1OJ7A 1J90A 2QU8A 4XQ0A 1XIVA 1Z2NX 1KRHA 4LPSA 4FFRA 4FX2A 3NIFB 4NCBA 3KSUA 2X15A 3PFGA 4XGKA 2H1VA 2EG5A 2JFYA 2BW0A 3W2FA 4KQGA 3WG9A 3UWDA 1TTHA 2HNAA 1Z13A 2XXJA 3GQBA 3QXCA 2ACVA 3D4LA 4LY3A 3VPBA 2I7TA 2DHDA 3BHNA 1H1LA 4KQHA 3VTZA 1GEEA 3BD9A 4O0LA 3QM1A 5EYPA 2YS7A 3LL4A 5JAIA 2V96A 3OECA 3QEMB 1YJ8A 3U40A 5BV0A 5JXIA 4D6YA 4ZVPA 4YCJA 5BY2A 1XPUA 1JDSA 3F6EX 1ZFNA 2QTVA 2XRMA 2Y66A 3HWRA 4GQAA 2XI4A 4X20B 1X7XB 3WYEA 4PHGA 3EE6A 5HGXA 4RD6A 4FYYA 1VPTA 4KK3A 2HU5A 4NJEB 2CV1A 3G2OA 1A5ZA 5L6LB 3AP3A 2GI4A 2FJ0A 3NBQA 2ENWA 4AY5A 2Q6KA 1UZLA 2HSZA 4JLSA 3UMBA 3PC8C 2VHJA 4ZGGA 4OQMA 4PAGA 2WE8A 4ZU6X 1GKKA 1YR2A 1Z2PX 2C3OA 5H1YA 4DIKA 1OXUA 5J5AA 1CCWA 3W6ZA 3WLMA 5LYJF 4RKFA 3NG1A 5JOQA 2OXIA 2GJ8A 2WOOA 4TT8A 1AQUA 1C1DA 4ND6A 5GVRA 6PFKA 5I4KA 3V33A 3ET4A 3ROMA 3JQFC 5J4KA 4CM6A 3I8OA 3I37X 4Q0MA 1U7XA 2V4MA 2XTAA 3A8TA 1PCXA 4TTJA 2TS1A 1X9HA 1U7PA 3P5BA 4S0ZA 2IHZA 1RT9A 4OX9Y 4UCQA 3X1KA 5ILOA 1AOXA 4ER5A 3PNLA 2E4ZA 3KU4A 1C80A 1SRRA 4DEXA 4ZQIA 5CXUA 1I0ZA 4LJAA 4IZ6A 3EAGA 3D3WA 3CVYA 2CT8A 2Q4DA 3GD5A 1JDNA 1WDWB 3RC1A 1CQXA 3D6UA 4YV1A 1U81A 1OAAA 2BEVB 4YMUA 3JQGB 4N3GA 1NM5A 1W6RA 2GNOA 5LYJB 1O77A 3LDGA 3GT7A 5ED4A 2HYDA 2X2FA 2NO7A 1QV7A 1YJ5A 1EK2A 2DCUA 3ZHYA 3LUBA 4MKZA 3HSYA 2QE7D 2QGZA 3QVOA 1A9PA 1YZTA 1WVIA 4F5DA 4TWRA 4B73A 1OAOC 4M49A 1XF1A 2DPXA 2YWFA 3L1IA 4OQDA 2CSXA 1WE2A 2FXIA 5KYXA 1Q7TA 2W98A 3GVHA 4QQRA 4IY1A 1KY4A 1IC6A 1PL7A 5C8XA 1KMHB 3CZMA 1KFKB 1U6IA 2D1TA 4HH1A 4YDSA 4GM1A 3CXUA 1UP6A 2EEPA 4KXUA 4PO9A 5KOIA 5T4BA 2I1LA 3VR2D 621PA 1QIGA 2Y4OA 4PLZA 5JPCA 3QUCA 3R0QA 3HCBA 2D62A 4E1VA 4BMZA 2WWYA 2IJGX 4N4AA 2WYWA 2OXFA 4K81B 1AKRA 4IV8A 2DR0A 2QRJA 2KLBA 4MLPA 2PSJA 1E7SA 4FXPA 4UUBA 1R16A 2ZIFA 3KPVA 5AHWA 4KH1A 3W8RA 5ARBA 3AR6A 5HRUA 3AF6A 1VPLA 1G16A 2VPXA 3I42A 2GCOB 1FXSA 1W5AA 2RSLA 1RD4A 1P80A 2UUCB 3ZE0B 4TQAA 4QWWA 3GFRA 1F6WA 2XGGA 5EJ5A 4EYGA 2FV8A 3U39A 3GV0A 4NESA 4FHCA 5LKRA 4OHZA 1YB7A 4O4LF 3C3MA 3KCQA 4C5AA 4WBNB 1LDYA 2Q5LA 2AI1A 3OQPA 1AZSC 3IJRA 1E66A 3U9TA 1CJVC 1VCHA 3UQYS 1Z39A 4ZCMA 1ORVA 2I91A 1CZKA 1Z7GA 2I33A 1UAAA 5TPWB 1HQCA 4OQFA 3GJ8A 3WX0A 3F90A 5FYDA 2PPVA 3DFZA 4LTNA 5BN3A 2JASA 3WRVA 3EVZA 4OHUA 5K09A 1FMCA 4ZMRA 2MT9A 5JD6A 3RTAA 4OCZA 1C5KA 2FW9A 2QG6A 4OYRA 3TIGA 2ID9A 2NO1A 3KKZA 4LRXA 5G1NA 3RARA 3ETNA 3KBOA 2RHWA 4P4SB 3N2LA 5JJLA 3UXMA 2P77A 2WU0A 1F2UB 5DTEA 4MW9A 4AKHA 4GZLA 2RHMA 1NC1A 4JVMA 4TYNA 5H8WA 3I1JA 2XT0A 2RKBA 5T3YA 1CQPA 2WJJA 3GC6A 3T4PA 4F38A 5JWHA 1GADO 1S2IA 1W581 3EZ2A 3IELA 1ORIA 3L43A 1R8QA 4Y2UA 4PYNA 1C8LA 2HJ9A 4JAVC 3LQFA 1M83A 3BSYA 5K6AC 1CIVA 1U0HC 1Y1KE 1DC6A 2RHGB 3Q7PA 4CJXA 2RHCA 3S2YA 3R8FA 2VLIA 1Y82A 3ZD9A 2RHLA 2CNOA 2M2IA 3TOZA 2I2FA 3NXKA 4R41A 1LJLA 3PRYA 2GZ1A 2ZB2A 2D0OB 3FR7A 1L7QA 3DV0B 4ZRDA 3VTAA 4TUYB 3DV2A 3A4IA 4WXMA 2DLCX 4K6OA 3SICE 1TQ4A 4MV5A 1MVOA 3N0RA 1CJBA 3E4CA 4G3XA 4X6LA 4FSDA 1S01A 1TZ2A 3DDUA 1YZGA 3NYWA 5KKAA 3VH2A 5KEIA 4IINA 3NNSA 3JYPA 1RQXA 5JTTA 3FR8A 1PJRA 1WF3A 3WKEA 3SXUA 4EITA 4L4ZA 3HABA 1Z06A 2O2DA 2X5OA 3OIWA 3F6PA 3ICWA 2MOKA 1ONOA 4KQJA 2AXQA 3IQGX 3M34A 1M1XB 4G4GA 5KREA 1BS2A 2JGDA 3NFYA 2HCRA 2XWSA 4W8HA 3EIUA 4XX1A 3ED5A 5GGXA 1BVRA 1AGYA 2Z30A 1CUSA 4MVJP 4YCAA 3TW0A 5L3VA 4Q3OA 3ZJ5A 4CV3A 3ABRB 3T1TA 3KQNA 3K70B 2ZSDA 4JT8A 5JAUA 4UHJA 1B0UA 5JQGB 2VZLA 4WZAB 5AR1A 3HDYA 3FPBA 3MJHA 3HB4X 1Z7WA 2PGJA 2XYQA 2FSFA 2ZAOA 1GNVA 3WBJA 3HKEA 4XZ3A 3Q3VA 2QF7A 4L0MA 4N3NA 4MINA 1EDZA 1U3UA 3OBIA 1TT7A 4UFNA 1LSSA 4UARA 2ZJAA 2C82A 1U3CA 3JQ8B 3RRNA 1WCXA 2QW8A 3LF1A 3UO8B 4A1OA 5JMWA 5KKNB 4NI5A 1C1XB 3BA6A 1WZ2A 4AZWA 4ID3A 3JQAD 5D3KA 2C2WA 3K8QA 4PIPA 2CZCA 4HNUA 4AF6A 5A0VA 2CBZA 2HMUA 2XUDA 5MGNA 4BNJA 4JYMA 3WYNA 2YVKA 3LYHA 1LRKA 2AHRA 1CRLA 1ESEA 5LPNA 3KQKA 1QGDA 4DY4A 1JIJA 1RAHA 2DMRA 2IXBA 1XUOA 2REQB 3E3LA 4YBZA 4NDZA 5FTWA 2VYQA 3E22A 3ZUPA 4BWFB 3E9RA 4YCCA 4LF9B 1ECPA 3CKMA 2JIZD 3D6MA 4FDMA 4MSUA 4WLNA 3U9LA 3LWNA 1VHLA 2BFBB 2RFLA 4J6EA 4XASA 4EDHA 1CZHA 1EFDN 1ICIA 5EJ4A 4OOFA 1UPBA 4QTTB 3CFYA 4YJFA 3U37A 1USIA 4IDBA 4ASUD 2JKVA 2VPPA 4K8RB 3LS2A 5JZBA 4WW0A 3IOYA 3E58A 3UB4A 2GPWA 3UCEA 5FBVB 5FA6A 2YWGA 1RYBA 3P9IA 3PU6A 4DN6A 3TZLA 2HA2A 4LQDA 4RZQA 1I1QB 4UNNA 3MQFA 3ZXUB 2NU9A 4XLZA 1NX9A 2GZMA 2HJVA 4G07A 3OAAA 4GG1A 2Q1TA 4B8YA 2JGMA 1VHDA 2WYOA 1NBMD 5DWVA 2E87A 3HGTA 1KYVA 4Z7QB 4DNFA 2Z4TA 4G09A 4EUFA 4RHFA 1EDDA 1OSNA 3AI7A 1PGQA 3ENZA 3WOHA 1EJBA 3N3BC 3KKEA 2H7CA 2NU6A 1AKEA 1XDWA 5CIQA 4O2AB 1W4AA 2FR1A 2H00A 3HUDA 3H17A 1SCIA 1UK7A 3NFRA 3TW4A 1DWOA 2QNRA 4AS2A 4BIMA 3MQ2A 2YNMC 1YGYA 4QYSA 4C89A 4GXQA 3TRKA 4QVIA 1RQLA 4MUNA 1X92A 4Y30A 1GA1A 1LTQA 5EWLB 3ZE6A 3T5TA 4EUKA 1RLJA 1ENZA 1C9JA 1PLJA 1Q15A 4JMPA 4NS4A 1L8LA 4WCVA 1KL7A 1L5LA 1CVLA 1SXJA 1Q7EA 3HUEA 5EL0A 4F7WA 3DZCA 3K5HA 1H6CA 4I6GA 5K5EA 3IQFA 3DUFB 3C1OA 5KTRA 1U2DA 2DFVA 2AOTB 5T6BA 5A62A 4MQ4A 3H84A 2ANBA 3LQ2A 1BWRA 1NYLA 1W73A 4YJHB 2W6QA 5SYNA 1EFPA 2PAFA 4JI6B 4BVGA 2Z95A 4CKEA 4DLAA 4Q48A 3FUVA 3ZI7A 3AILA 2JFWA 3UFXB 4G0WA 1A9OA 1GRRA 3WFZA 5I3CA 3QYAA 1H85A 1XLTA 4FFOA 4PQRA 3MTQA 3KPYA 3FOAA 3SSMA 3URKA 1TEXA 3PI6A 3WLHA 2YW9A 4AIIA 1UXKA 4DS3A 4RVOA 2OO7A 1G6HA 1XA4A 4PO3X 4E6PA 1EB9A 1RPAA 5LKAA 4YI3A 2AR0A 1RHQA 2ODQA 2HZ7A 1KI6A 4QNRA 5DLDA 5EIBD 3EX7C 4LYGA 4R1OA 3JD1A 3DMFA 1E3IA 1ESZA 3IERA 4J1NA 1U94A 2C83A 5E7QA 5AVQA 1PHRA 1E2UA 2HLHA 3AR7A 3K0CA 2AFHE 4UC0A 4ZAWA 5GVSA 2FDCA 1I3LA 4B3TB 3BL5A 2EHJA 3MA0A 2VEOA 4C0AC 9LDBA 4MCHA 4EHLA 4RO0A 4GR4A 1Q0PA 4ESEA 1FQWA 5CEEA 4QPCA 3OJLA 4R1LA 2VWQA 3SM9A 2VTKA 3PKIA 3DF7A 2RI1A 3OPQA 4Y6SA 1Q1AA 1NI4A 2R44A 3D4IA 4B8WA 4ZYWA 3TYXA 3KVNA 4DA9A 3FOCA 4V1CI 2AG1A 2RJNA 1DSSG 5K6AA 3REGA 2Q7DA 1ECBA 1ZJJA 2PUTA 2C9MA 3QUQA 1OYYA 5TE9A 1S2NA 1SUEA 2A4KA 1B4DA 1US8A 1MG5A 5E9QA 4TYQA 5HXAA 4LDJA 1Z74A 2AA3A 2HU7A 2ZI3A 4RK6A 5CAEB 4MHTA 1EEXB 2D2FA 4HDQB 1EP1B 1SUIA 2I7VA 1P1JA 3A32A 3C6KA 3W2TA 3A3YA 3G2QA 3SQMA 1R12A 3ZNNA 3ORQA 3G8AA 5KCZA 2O05A 3MPOA 1X1RA 4GXNA 1DTWB 1P2BA 3K94A 1UXOA 1B8OA 3DBHA 3HB9A 1PNVA 2OYSA 3AQ4A 3K92A 2X6QA 4JUDX 3TPCA 3DF9A 3T94A 3TZBA 3KJQA 2QJRA 4M1QA 1JEOA 2WZCA 3LYAA 1ODSA 1PBNA 4NJEA 1M3SA 5JYCA 3IT2A 1RJDA 1Z6XA 3ZLTA 1JEQB 4HLNA 4HXGA 3R5FA 2XQKA 5HYVA 2EIXA 1I4DD 3GUZA 1S2DA 1RWNA 4L07A 2V7WA 2HIGA 1G2IA 4KMOA 3RKUA 2XITA 4EB6B 2AYXA 2CSUA 2E21A 1QGUB 1HL7A 2RH5A 1P2TA 5FAXA 1OGJA 3PQEA 4HWRA 1ZK2A 2R6DA 2WU4A 2HH9A 2RI6A 3DKPA 3G2HA 1JHVA 3RS8A 5KX5B 3GCWA 3ER6A 3LPMA 1UJ2A 4GI3A 1LPPA 3SE7A 2O4CA 4EYSA 2NQ8A 2HDNB 4XRGA 3OU6A 3ROZA 1E2QA 3HFGA 3HFSA 1Y37A 3E15A 1Z0JA 1QE3A 2HHJA 4QFDA 3T3OA 2QSYA 1QH8A 1CRWG 1XHLA 2OWEA 3LD9A 5HIJA 3RWOA 3OTIA 5LD2C 2G08A 3AJDA 4IPTA 2IU0A 1U0GA 5AK3A 4EGQA 2Q3MA 3BDAA 4UHHA 1GNRA 4AUKA 5JO0A 1TAQA 5ENDA 5FBZA 4EG8A 4WEQA 3HMKA 3L2OB 2PMKA 3ZIAD 5AW6A 4BP8A 2JAPA 3UAOA 4NPCA 3LBHA 3L6DA 1J39A 2VP2A 2ZPUA 3I0MA 1GPUA 3DVQX 3JZAA 1QNLA 3OJ0A 4NJOA 5C5IA 5JU6A 3TLGA 4JI4B 4MWEA 3ZE9A 1VPWA 1JJIA 1XEFA 4M9XA 1QG2A 4CLRB 2WHXA 1I4TD 3HLTA 4L1KA 3VH1A 4NBLA 1JR3A 3H5LA 1QHHB 4BO9A 4YMIA 2HA4A 1T9DA 3HCAA 4I8XA 4LOIA 4FCCA 2VH5R 2C1EA 4Q1CA 1JFSA 2XCTB 1XKQA 2XGMA 2XLCA 4JBNA 2O5CA 4OYLA 4LZPA 1E9CA 3N2GB 4FEAA 4J90A 4LJSA 2CKDA 3I45A 3OPYI 1EGQA 3MG9A 3VZQA 3ZKWA 1RQRA 2FGJA 1FSZA 4KW7A 1J56A 4Z7NB 5TIIA 3AUKA 5LYYA 4BXOB 3DHVA 5EVJA 3N76A 2V98A 1U0RA 1HSZA 4J49A 4CV0A 1PFUA 3VR4A 5AKEA 2GHRA 2Y1DA 4C4TA 4IVPA 1YKFA 8LDHA 4QFCA 4B79A 5JEEA 4BYGA 5LA6A 1T36A 3JZMA 4J0DA 4WSOA 1GXSB 4C0QC 3DGEC 2X2PA 3WGMA 1SVWA 1NASA 4AJJA 2GM5A 2W37A 3QVUA 4HEQA 2GUGA 3FPKA 4MUEA 1E58A 3ZWWA 2WYUA 3K5WA 4XLLA 3OFKA 1V7QA 2GN6A 2GF0A 1IQUA 3DZJA 3N39C 5C8DA 2PJRA 1UPUA 2VTEA 4UAUA 1Q6ZA 2X4LA 3PRKE 1DJNA 1Z7BA 3RAJA 1OLSA 1AA6A 1LC3A 2DH5A 2FZGA 2ZIXB 3FYSA 4QUJA 3PXGA 1FX0A 3R75A 2IGTA 4HADA 1RNLA 1RLIA 1T8UA 1E0DA 1ONBA 1A9XA 1MRZA 1NA5A 3PA8A 2E85A 2PS0A 1A2OA 2PWYA 4TWZA 1T9AA 1M0EA 3DUFA 4Q3CA 5F1PA 5AUOB 1COWD 3SLKA 4FI3F 5LQKA 3ENKA 3F97A 2OD2A 4FFBB 3ITDA 3T3GA 1PQWA 3LP6A 5H70A 5EJ2A 3SHVA 1F1JA 4DKXA 1CP2A 3S1AB 1Z88A 4B6EA 5ALXA 1NG9A 2JIZA 4RZSA 3I5AA 2EGHA 4RSMA 1V8BA 4DVGA 1T4MA 1UWLA 3ZNPA 2EERA 4V0OA 1FQKA 5AVUA 1YASA 4KJZA 4C4SA 2W22A 2ZUBA 2IYQA 3D5QA 3VKFA 4C4PA 4LCEA 2RGUA 3FBGA 2J9XB 3MJFA 5E4FA 3A1SA 3VU0A 1BDHA 1EE9A 1FPQA 2JEYA 1TCUA 2NV6A 4WD3A 2VNAA 1ZR2A 1UFOA 1R10A 4OSOA 4BNGA 5B58C 4HVTA 1ZI9A 3UN1A 3VGJA 1H4SA 4XDZA 1N6NA 2C5SA 2H1IA 2FKAA 3IOMA 2XRZA 1N2JA 3NH6A 1B73A 3CKYA 3PWKA 3PX2A 5CJ2A 1LVHA 3BIOA 4HI0E 4KKXB 3RSFA 3RYCB 1O0CA 3GGPA 1DXHA 4LS3A 3LDFA 2HKIA 1YOVA 2Z6UA 3K72B 3GA7A 4IDPA 3VR4D 3KBBA 1VL2A 3FE2A 4V0MA 3WNQA 2OR3A 5CB4B 3VPCA 3FOZA 1NVVR 3RIYA 3SYRA 3L82B 4DV3B 3KOXA 1GUZA 4MTLA 2APJA 2H48A 5K03A 1HRDA 3QPDA 2QV7A 1RHMA 4Y2GA 1R4MB 5HVNA 2QP3A 3NBMA 3H86A 4FK8A 4MGYR 2PX8A 3IBTA 2Y0EA 2H3HA 1JJBA 1WKVA 1ZNYA 1G3QA 1QOZA 2QJFA 5CYOA 4K6HA 3UH0A 3AR2A 3U80A 4NAUA 4BB9A 1T5LA 1BTOA 1WBBA 5I01A 4D3ZA 1P3DA 1QMPA 3GY0A 4AX8A 1I51A 1QHHA 2J0SA 1G1AA 2NP7A 3FJYA 1DADA 2IV3A 2PX3A 1WSDA 4FSHA 2WZBA 1SCNE 1TQ6A 1WUIS 3KUUA 4KXLA 5FH9A 5GIPE 4G56A 3IPLA 1Z8HA 2EFCB 4WBXC 2BELA 4UU7A 4DV7B 4HD8A 3LXXA 1YR6A 2P6UA 4HEJA 2VF2A 5JYEA 3K5PA 4JU8A 1HEUA 3ANSA 5KYYB 3GP3A 5HFNA 3F3KA 4KR0A 5MN6A 1KMIY 3F7NA 1E1LA 1X7GA 1GCOA 3E1SA 5IPFA 3D8SA 1DIOB 4CUKA 5DTRA 3ZW7A 2DBZA 2YXLA 1RIFA 3A36A 3B5JA 3QG1A 2NZXA 1GXSA 4HJXA 4MW6A 4PNPA 5DYGA 1JHUA 1VZ3A 2ZAIA 1HUQA 2FUKA 1KI4A 2CLOB 2GBLA 4UW9A 3OJOA 1BCRA 4RLSA 3PWSA 3U13A 4YV7A 2FQQA 2OBBA 3HRIA 1TJYA 4RH0A 1DG3A 3AR9A 2Q45A 5DGCA 1DAOA 1TK2A 4B43A 2FMXA 1WHTB 1NYRA 4MR7A 2PKQO 4BTEA 2NPIA 5ARCA 3GRZA 4B4OA 4LK3A 2UZIR 1TPYA 4QGSA 3IDQA 3V1UA 1KF0A 1UC9A 5A06A 5B4TA 1P44A 2B2NA 2IYTA 5DV9A 2I3DA 2ZRMA 2PUBA 2OPBA 3GLSA 4UAJA 1K98A 1R37A 1U90A 3HRHA 3A4TA 4F8JA 1ODCA 1XCJA 3G2MA 1XZGA 4GM4A 4IEIA 4BOYA 3AVVA 4JHXA 4DEVA 5C2JB 2PSSA 4XJSA 3H2SA 1BN6A 1KDPA 5EZ5A 4R6XA 3TUZC 2VWHA 1AY0A 2JGAA 2IZ5A 1GQRA 2WWTA 2D6FA 1VOTA 2VSXA 4JMLA 4UTZA 2FEWB 5EZSA 3WISA 2W6JA 5M04A 1UBFA 1N7HA 2R7KA 1S4MA 2TMKA 3KFVA 4V0LA 3O6VA 3O8OA 3SZRA 2H2WA 4EI2A 1TZKA 3BIJA 1JT9A 1NJ8A 4C29A 2HBRA 4CNBA 1KC3A 2I9PA 3G02A 4YUAA 2YJ6A 1IN4A 2ZATA 3AEZA 3RREA 5HR5A 1WXHA 4ZKDA 2Q3EA 1CQZA 1JMVA 1SHTX 2A88A 1P9RA 3A6JA 3Q8WA 1KQ3A 4EW3A 1PZMA 1XJCA 2ZJ8A 5AHOA 4EQ6B 3H0KA 3FOWA 1G8MA 3VDRA 3ZX4A 5BW8A 2CXHA 5HIIA 4TVKA 4M1SA 3VR5A 4US2R 4FDUA 1P8JA 4ZYUA 5HQ3B 2XBUA 2ZRIA 3MS7A 1H8HA 2GJAA 4UXHA 1RPZA 3MHTA 1KZ4A 4WECA 5EI5A 1H2FA 2CLEB 3VTFA 1P9WA 4HNTA 2YNMD 1H22A 3FUUA 3H8JA 1HQYE 2R68A 2DOKA 4ALIA 3RB8A 1TDJA 4D9BA 3BFXA 1L6RA 4FWBA 3MWDA 5LA6B 2XCSB 3C1TA 3UMYA 2PUCA 2Q9UA 3LWBA 2ZCUA 2Q0XA 4IIEA 2WF5A 1QV9A 1HEYA 1E7RA 1ZM9A 2GD0A 3KYBA 4EO4A 4YEDA 4DQ0A 3PHCA 1LFAA 3FCCA 4DR4B 3BBLA 3IT0A 1G4AE 1JXMA 3K0BA 4FU0A 3GCDA 4I55F 2D7DA 3G3EA 3HXLA 3VYRB 2AKYA 4C03A 4JKOA 3CLKA 1OFHA 3NC1C 4ENQA 2V4ZA 3L93A 2QR3A 5H68A 2AG8A 4MB6A 2BYTA 3Q2OA 4HNSA 2W2LA 4XWKA 3RVRA 1DTWA 2ANCA 5A5VA 2QM7A 1O54A 2Z1NA 3J7TA 4YCBA 1G1MA 2ZXFA 2D2XA 4ARIA 4RZIA 1OLUB 1PJ4A 4LOJA 3PFCA 2PIDA 4N7JA 3WQQA 2P5YA 4CLRA 1MJ5A 2WWGA 1W30A 4PSDA 1N7GA 4NMXB 1ZVQA 2IYLD 4G5GA 1T0IA 4MP8A 4OBEA 4EK9A 3ITKA 1POWA 2Q8PA 1WUHS 1QB8A 1FP2A 1X7DA 4N54A 5DBIA 1XAIA 3NALA 2YN2A 4G5HA 4H17A 1XJ5A 4IYJA 5B3AA 1RMQA 2Q5FA 3IHTA 4PR0A 4Z4CA 3I12A 1QP8A 2HHHB 1QC5B 4HSGA 4IAOA 2AKAB 4R2KA 1ZKDA 4X85A 1N6HA 1I36A 4TZ6A 3VVMA 2AFVA 1TMKA 2Y0BA 3DDOA 2UZ1A 5EKDA 1L8QA 2NSJA 3PIDA 4XX0B 4XB1A 1P73A 5D3MB 3KAPA 5IW8A 2XT9A 1O5OA 4QXPA 5KVQA 5SYMA 4GDFA 3S68A 1NQAO 4G4SO 4XCXA 3T61A 3UOGA 3AJAA 1E5VA 3CNNA 1H94A 3F8WA 4BGDA 3TJMA 3WSTA 3ZWDA 2QPOA 4Q4LA 4Q03A 3S2FA 1GDHA 1Q95A 2GT1A 1SPBS 3DBRA 1W0JA 4Q00A 5BN5A 3M70A 1BCSB 2NPOA 2GAAA 2AF3C 5LUBA 1QRTA 4QPZA 3AG6A 3ETJA 1LH0A 3DBLA 5EWMB 1UBGA 4UBKA 9LDTA 5LQUA 5J5CA 4F56A 5FLEX 1U2ZA 3SQNA 4G0PA 1ZL0A 2GPNA 7YASA 4LBYA 2C54A 1X7WA 2X0JA 3AF5A 4QAQA 3I4FA 1KE1A 1SIOA 3DZ8A 2YUTA 4K40A 3GROA 4RZUA 3WNCA 3P0JA 3AJ9A 4B2IA 2Z1MA 3RG2A 5JY1A 4D43A 2FF7A 3ZV6A 1C7EA 3IYLW 1XEWY 5BSHA 1MF7A 4Y0AA 2B0CA 3DHEA 5HZGA 3TLAA 3O7WA 3BA1A 4AZSA 3EQ6A 3NATA 5JNVA 1QQAA 4I50B 2UUBB 2F1RA 4YT5A 2EJCA 1WW3A 1AG9A 4U7DA 4OREX 1J8QA 1TAGA 1KDZA 1BJRE 5L4LA 5LFAA 4O4IA 4NAHA 4TMVA 3C3KA 3KJZA 1IQRA 2C2OA 1X0VA 3EGDA 3H1FA 4YP6A 4R8VA 3W5UA 3U7FB 4MQEB 4Q1FA 5KAMA 3ABSB 3OTWA 4FZ3A 3SR3A 5K4GA 2ZB3A 1X13A 3RSOA 2JFZA 3GRUA 3QRWA 5HF9A 1E9BA 1BNCA 2V7GA 3Q5EA 4NBSA 4BLQA 3C6MA 1L8OA 3UKJA 2O6HA 2QV0A 1R5BA 4QARA 1MIOB 4B4VA 1D2GA 1X3LA 3HS3A 3W9SA 5L3ZA 4H7PA 3TUJC 3JASA 1CY8A 5LXTF 4BY9E 1OIXA 1YBFA 3EFEA 3KJIA 4LV8B 3OTOB 3BJZA 1HDEA 4TLAA 3OICA 2ONCA 2BHNA 3ZDAA 1G6Q1 2AOVA 2FCRA 4OEHA 2BD0A 2HJGA 5KSZA 3RS7A 4KPGA 1RM3A 2QIOA 4LJ4A 2F1HA 2GHIA 2QIPA 2NX2A 2PM8A 1JWLA 4Q1VA 1EGHA 1OMOA 2GEUA 3DLPX 3GELA 2VP3A 1ECCA 3HA3A 3LY5A 4WLFA 2AE1A 5ALLA 3RWBA 4E1BA 5DK4A 4CWAA 4D41A 5EY5B 4LJKA 3HP1A 1FDOA 2Y1XA 3ONNA 3N87A 1H1LB 4MHOA 1N3LA 4YRRA 5F5NA 3ZEAA 5I48A 5AKXA 4WTOA 5JCPA 4W5RA 4ZTZB 3I5MA 4XIGS 1RP1A 1MH9A 3C14C 1I10A 3PNVA 2IEDA 1NV9A 5FOQA 2FWBA 2O50A 1OHHD 4NBUA 2HBQA 3LCCA 3AHIA 2OZPA 2X7XA 2Q5IA 4JLJA 4OKNA 1XD8A 2I4NA 1XA3A 3OPMA 4LW8A 4QHYA 1UM8A 3SZLA 5JJ5A 3NU1A 4KBGA 5ECDA 4BXOA 3K31A 1TEZA 4DLTA 2FG5A 5JADA 2VDNB 4FGLA 2BFPA 3M1YA 1UIRA 3WIEA 1IBMB 1KYWA 1REQB 1CP3A 2OLKA 1P1BA 3U26A 2AGVA 1OILA 3QLUC 3W3ZB 1CDZA 1M8PA 3PC4A 5GAJA 1JLRA 2Z2JA 5IAKA 5KVSA 3LJKA 4ZV9A 1A4RA 1J0EA 2WF7A 3GOHA 3R24A 4UPVA 3N28A 1N25A 4IV5A 4QYWA 4UHFA 1Q7CA 1UPXA 5JNUA 5CLQA 3GEPA 5HKOA 1AF4A 4A8PA 1JIUA 4BKUA 2GLXA 1V3VA 1N0UA 3SHFA 1FEZA 2EHDA 4GC5A 3QTLA 2D5LA 3BMCA 5JH7A 1IHDA 5MGBA 1BGXT 2LGJA 4KTTE 2P7HA 1H4VB 4DCPA 4RJKA 2DH6A 4V39A 3A6PC 4ND4A 4PW0A 6AT1A 1EGMB 3ES9A 4KO3S 1ML3A 1NN5A 2FZWA 4G01B 4J4BA 2HJHA 1D1SA 4EG0A 4ETMA 4Q4CA 5JZ9A 2C5BA 2OCIA 3NZEA 4ZYXA 4ZEMA 5CCEA 5A4KA 2R2GA 2C7BA 5IVPA 1CJCA 1YE8A 2RGNA 3MCZA 4DLYA 4B6SA 3ZGYA 3A6KA 2FX2A 1HWYA 3HNOA 3CSUA 3ZCXA 5I5EA 1ZK0A 4BMSA 1U8CB 2H2AA 3G6KA 5CK4A 2I22A 2VR1A 2WIDA 4UPEA 1E1DA 5CG2A 3LAWA 4X71A 5BMVB 3BXZA 2ZQZA 3PWTA 1DAHA 1F4LA 1FP4A 4MX8A 1FTSA 2B7BA 3IAS6 4D4LA 2BONA 3OEED 5C5EA 2POCA 5CGQB 1K7YA 2YYAA 2OAQ1 1BXRA 2RHTA 4BLUA 5K0SA 3R7DA 1J8FA 1DXOA 3IESA 4M0PA 3OOJA 4W7HA 4BLTA 1C3JA 1SA0B 2PZJA 2EF1A 2GLTA 2H29A 1YRLA 2RGGA 2VP6A 1Q44A 3AY3A 4MUAA 4PVCA 3RHSA 5KTNA 4CHTA 4WX2B 1E4EA 2EZ9A 2O8BB 3JRXA 4M86A 2XUQA 1BMQA 3ZV3A 4CIDA 2AD5A 2ET6A 1XMXA 5AJXA 1WLSA 3G9XA 4LF6B 1OJLA 1YR3A 1OQAA 2PCJA 4PFQA 3CUUA 1Y48E 3JTMA 3P2JA 2ZT8A 2QW0X 1CR6A 2ZBGA 4BO0A 1SUFA 1MJNA 5ALMA 4MWCA 4YGYA 4C1BA 3EMKA 1MHTA 4KO8A 3TTWA 4E88A 1VQ1A 1W0JD 2OE2A 2Q62A 4KCGA 4TXHA 1KY3A 3OU2A 4NU5A 1J0BA 2ZULA 3AR8A 3EF0A 3EGCA 1FJ2A 1PJ2A 1RVDA 3BK7A 4MVJF 4I99A 4WNCA 2C31A 2OHJA 4AJKA 2I6SA 1CD5A 4NEQA 4B3CA 1QHFA 4K0KB 1FUUA 1Z22A 1SUWA 1DQYA 3IOCA 3D1JA 1H1DA 2NUPB 2XOKA 4DIUA 4NFYA 2WTUA 3O8DA 5JDCC 2F3RA 3QE0A 1SVLA 3D0RA 5EUBA 1ZMTA 3U6KA 2KX7A 4RDXA 1M34A 1PSDA 4EY6A 4P3PA 1PVVA 4C4ZA 5FWXB 1JLHA 2FRXA 4H08A 4MQ6A 4UAGA 4O59O 4CN8A 1BAPA 3WL4A 4IUDS 2OCBA 1JN0A 1LSJA 3DO6A 1CTQA 4ZZ2A 3UKDA 3RFVA 1IZ9A 4FN5A 2JGIA 3G2LA 5K3EA 1DDIA 1Q92A 4HEHA 2A4MA 4J1TA 2GA9A 4TM7A 1GKIA 2Q1WA 4WKCA