3ROZA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nicotinamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 68
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rozA00
3RO7A 3RSFA 3RS8A 3RRFA 3RRJA 2DG2A 3RT7A 3RSGA 3D3KA 3RU2A 3RTDA 2AX3A 3RRBA 3RTAA 3RS9A 1JZTA 2O8NA 3ROEA 3ROGA 3ROZA 3RNOA 3RREA 3RSQA 3RT9A 3RTBA 3D3JA 3RU3A 3RTEA 3K5WA 3RTCA 3RSSA 3RTGA 3ROXA
chains in the Genus database with same CATH superfamily
1NRXA 1QHHA 3D6UA 3GELA 1OIVA 4BNMA 3AV3A 3PC8C 3QLTA 3TL6A 1V5FA 4JGIA 1CR1A 4RJTA 3BE5A 3KU4A 3BMOA 5K3AA 1PVOA 2Y9PB 1HOXA 3A7DA 4N0QA 4JT4A 4O8CA 4PIPA 4UCXA 5JNSA 5JFOA 2ZIFA 1DBQA 4RH1A 2NLOA 2YFYA 3VX4A 4ZHQF 1ZCJA 1W4AA 2J9RA 1B6GA 1I10A 4RU1A 3UK6A 2GB4A 2P2ZA 2Q6LA 3IS3A 1SB9A 2IHKA 4GZLA 3FGOA 1T6BY 3A06A 4QKQA 1W1WA 1EK0A 1PDWA 3I04M 4JB0A 1NVGA 1U4NA 4UTVA 3AILA 1MH9A 1A9ZA 2D5AA 3I52A 3OFND 4HQ6A 4HXFB 3V3TA 4K86A 2XBUA 4I4NA 1JSCA 1YHNA 3DZJA 3RK0A 4RVSA 2K6GA 2R4UA 9ABPA 1ZH4A 2Z83A 3CN7A 3K70D 2QRVB 3PFKA 2DULA 3TSOA 2DPMA 4MVJM 2EKBA 3A10A 3MIIA 4FSXA 3TFWA 2XYVA 2DHCA 3ZTTA 1EFPB 1RQRA 3UMJA 1TJ3A 1IMOA 5BWNA 3MW8A 1U6KA 4JODA 1EI9A 1MAUA 1TKBA 1VKOA 1YWGO 2FOIA 3UK2A 1P9LA 2VUSA 1J9ZA 4G0ZA 1SM4A 3C1AA 2OCPA 3RU7A 3UY4A 1GNPA 3O0DA 4C21A 2PKWA 4AS1A 5IHPA 3O74A 2XYQA 4Q4HB 3L6DA 5JQGA 2BF7A 3VNRA 3BCHA 2Q5HA 4EFDA 1G1MA 2PUEA 3SF0A 3OFNA 1CUVA 3SKVA 2QP3A 4R6WA 4TMVA 3V6MA 3VKFA 4B7AA 1CRWG 1QHFA 5B2ZA 1NOIA 2R68A 3ODGA 3TD6A 2R48A 3QXXA 1T3ZA 1LWNA 2JFBA 5BQPA 1H8HD 1DIAA 1WV0A 3N5CA 1TVCA 1Z5WA 4D8YA 1FMJA 5D86A 4N7JA 1FL9A 2HXYA 2I6TA 2VJMB 1LRJA 2YZNA 3P8ZA 1AS2A 4JIGA 3G2OA 4F21A 2B7LA 2AZMA 2RAPA 3M6XA 3MT7A 1EFVA 4AJ2A 3DO6A 4U8HA 2CDRA 1A2KC 3ORYA 1G8YA 2BC9A 2V7UA 1U5AA 1FYVA 3JX9A 3A6KA 4GBGA 1P91A 3E3MA 4Y6GB 3X43A 2QLNA 5L7TA 1MTZA 2ZYGA 4M8KA 2RI0A 1GPWB 1FLAA 2IK8A 2JZCA 4MROA 2HJWA 4N54A 3BSSA 1FA9A 3H1GA 4KXYA 2JLRA 3C3AA 2D13A 1KAHA 2P9ZA 4HTAA 4JLBA 1DUVG 4UHDA 1MOSA 2Q5CA 4HPWA 3TLKA 5CDYA 5KOJA 2O8EA 1KERA 1H8HA 4AKEA 2C3UA 3K8OE 3LHKA 4F5EA 2GEFA 2NUPB 3G8CA 3A32A 4GX1A 3LLCA 4ILKA 2JATA 3GA7A 1PJAA 1QHIA 1XCJA 4FJ1A 1B15A 2VWHA 1ID1A 2X1VA 4IHJA 4KGDA 4KXWA 5TXGA 2I8AA 3C5EA 4PFKA 3TZEA 4UE3S 4PZCA 2QM7A 2H29A 2NZVG 4YJHB 4B8YA 3BMXA 3IUSA 4GGPA 4TMZA 4Q16A 3GQVA 3WBBA 5LYYA 2C20A 2F3QA 2NAPA 3MF4A 3MUEA 2OXRA 1K8QA 3P0HA 2K87A 4KQ1A 1DPFA 4S2UA 3EC2A 3G7SA 3R9KA 4BZQA 4F1WA 4POOA 3SDSA 3JQ8A 1T2EA 3EYWA 2VHXA 3QTBA 1CB0A 3Q3JB 4GUDA 4OIFA 2I33A 2Q7DA 4CE6A 1K7SN 1Z8HA 2FW8A 3B5EA 4YUVA 1YZ3A 1TEHA 2HRDA 2JI8A 2PKCA 3TLJA 3FPLA 5D1NA 1Z2OX 1TOAA 3A0UA 4YJ2F 1AS0A 3DS8A 3RGWS 4EYEA 5JXJA 4JUFA 5EQJB 3RIMA 3WP1B 4GL4A 4U5QA 3SSAA 5JROA 3QEAZ 4HAOA 3MVEA 4IJMA 3U7QB 4C4PA 3QTTA 2FSVC 4ZDJA 2XOEA 4V3BA 1OC2A 3BE6A 2HL6A 3D3WA 4G5OA 2QJFA 4HWRA 1D9XA 1H93A 3C3CA 3HKCB 2JIMA 3ABIA 1LK0A 4NPAA 5AVKA 4KQ6A 4EAAA 3D31A 1TW3A 2BFEB 4D74A 1XZGA 4AUEA 3OCUA 4OB8A 4B74A 4W9NC 1C0LA 5BV1A 2WHYA 4LZLA 5LOVF 2QT9A 5FV7A 5B3LA 5ESRA 5HQ3A 2C9CA 3DC2A 4XYLA 1XJCA 2WUWE 2XMSA 3O03A 1Q95A 4I55B 4MCHA 3ZE0B 4C05A 4OK3A 3AHDA 1ZQ9A 3L04A 1ZNQO 3PZBA 1TTHA 1F20A 2F9LA 2R62A 2QRLA 3U3JA 3HP1A 2W2NA 4OHPA 4MIYA 4NAUA 4IFIA 5LP6C 2BFDB 3DBHB 1SCIA 1W4LA 5IJ9A 1SXIA 2PS0A 2X4DA 3PQ8A 4LBVA 5KDDA 5LLSA 4WQMA 8AT1A 1L3CA 4H3HB 2PVSA 4IIJB 5CFRA 2MT9A 2X8JB 4EG1A 3KEOA 1I0LA 1ULBA 1TO6A 1I3NA 3LVFO 3F5SA 4C0XA 4LHWA 1CNMA 1AMUA 5KVSA 1UJNA 5EMLA 5IM4F 1BMQA 4EUSA 2G7ZA 3INNA 5EMNA 4F3YA 2BHTA 4WY5A 1RWWA 3F0TA 5TRTA 5LKRA 1V9LA 1W25A 4XB6B 5BSRA 3M1YA 1KI6B 3OT1B 4FDAA 3HWX1 4W99A 4YRIA 3T5CA 2JH8A 2BFAA 1JIVA 5HKOA 4NY1A 2QRZA 4WBSA 3DE2X 4X85A 3QA3E 5BQ3A 2WZDA 4G89A 4M1KA 4ZO4A 2Q0SA 3CWZA 1O6ZA 1YJAA 3X1JA 1D1QA 3DBIA 3HVHA 1WHTA 5KAMA 5A4KA 1Q1QA 2O59A 2BM0A 3A25A 4NEGA 2O4UX 3Q3GE 4Y1FA 4CG0A 2F8SA 1N2GA 3LY8A 4R3UC 1F4PA 4KX5A 4X7PA 3FXAA 2YMQA 2NUAA 3UV7A 2BGNA 4PN7A 5C32A 1D7OA 1XZBA 4P32A 3CZ5A 1IY2A 4Q3BA 1WY5A 2VQDA 5KTMA 1RRPA 1CFZA 1ELOA 1XLVA 4EM6A 5M7EA 3L1HA 3A37A 1LSJA 4FCVA 3S1LA 4RYDA 4HB2A 5LIRA 1IJBA 1VRVA 2ACEA 3LHIA 4RIEA 3OOSA 4WNIA 1NY6A 4X3OA 4DRZA 2Q3FA 4PAMA 4CKWB 1JHPA 1XTVA 4P5PA 1AKYA 3G85A 3QJ5A 3SIPA 4YMVA 2Z08A 3GQBB 3QELA 5TQ2A 2F90A 4R1NA 3SZUA 4CTOA 1ZNWA 4KH0A 4PYIA 4PO8A 4DSTA 5I3ZA 3PNLA 1J7JA 2FWRA 3KE8A 3D2BA 1JDVA 4JL5A 1EFUA 4RABA 4BNYA 3T7DA 1R4MA 3LOUA 4JJGA 7MDHA 1DFHA 2P90A 4X6LA 3VPAA 3T6KA 3VU0A 4PRKA 1EVIA 1SXQA 4I5DA 1ZC3A 4DMLA 2WQ6A 2W2KB 1OWOA 3HFGA 3PXDA 4PPQA 3EDOA 4B7ZA 4AT1A 3W2GA 2OQ2A 2QR5A 5D7BA 3CVWA 2Y0CA 3OJOA 3LCUA 4MXDA 4Z2YA 4NJMB 1U8EA 2WKWA 4D4JA 3VX3A 3FSEA 2GEUA 1G1AA 2HDNB 4JUDX 5LA6F 3EPLA 4LHZA 1WU8A 4WNCA 4ZV9A 3FR7A 4HWGA 4ZAXA 2ZVDA 1ZI8A 4BKQA 4DGQA 1DRJA 2DQZA 2YYSA 4CIBA 2RH4A 3QTLA 5DX8A 2IYQA 3UTDA 2XUHA 4OPMA 3ZXUB 1B3RA 3AXSA 3OPYB 3D6MA 4P9NA 2Q4EA 2B30A 1XD2B 3M4JA 4DM4A 5JQWA 2HK6A 4OAQA 1SVOA 3AR6A 2V5UA 4RH0A 1E3QA 2GWHA 4UZEA 4DLXA 1AUPA 1SA0B 2CZGA 4IPTA 1GDHA 4JLPA 4R5HA 5REQB 4F6CA 4JYAB 2BGKA 3RYHB 2YXDA 1B2LA 3IEPA 4PX9A 5KAPA 4BFWA 3KKOA 3PHBE 4TYQA 3PR2B 3MQ4A 1FDOA 4UHBA 3AL0C 1WV1A 1Q20A 2R6AA 1YBFA 3QVSA 1TMGE 5GWXA 4DJTA 3VHLB 3UFXA 3KZXA 3NHUA 4RMHA 2C5AA 1M8KA 2HTFA 5JZSA 4EPTA 4G0WA 3ENZA 1Z82A 1IVYA 1S89A 3NHYA 2COEA 3QFFA 4G0YA 3VXKA 1HNXB 1D2RA 1D2NA 1FDWA 3HKEB 1YR9A 1QHEA 2IHUA 1V5GA 3O1HB 4TT8A 3W0LB 1SFRA 3ZWYA 3W5BA 5K3CA 1KIAA 3IKVA 1P7WA 3QFSA 4XB2A 2HYDA 1I7LA 4MWOA 421PA 4QOEA 5BMVB 3KYCB 3ORHA 4XTCS 1LB1B 1ODKA 3CZ9A 3F9IA 3ZE1B 4Z4GA 2WUFA 1RU3A 4DRXB 4Q3AA 4EJSC 3QZUA 1ZOSA 1JR4A 2LIVA 3QVUA 4CETA 5B5SA 3VGJA 2H65A 2XR1A 4AJIA 3NG1A 3THXB 3SX0A 5GJCA 3IT2A 4B5KA 1RI5A 3CONA 4RADA 1ZD4A 4LOAA 3RQIA 1HQDA 3AKCA 3AESB 4EIWA 2DJIA 2QWXA 1K5GA 3ELUA 1D1PA 2RHDA 4ZDKA 2J3MA 2QTVB 5T4BA 3MRVA 4Q7MB 4TYMA 4HD8A 2Z1DA 2PSDA 2QLMA 4PS0A 2PTGA 1VCNA 1G6Q1 2R1TB 5ENZA 4BV2A 1GT91 2BKLA 1CU1A 1JMYA 1VBMA 2P79A 2XPCA 4J0QA 4ER7A 4Q9IA 3R9XB 3LGSA 1IXYA 5EQTA 3AM5A 3LX5A 4IUDS 2FV8A 3ROQA 1NAHA 2WMYA 4DEYA 5B3KA 2I54A 4ZI7F 4AY6A 1NW4A 4B9AA 3FM9A 4BB6A 4AL4A 1E1QD 1Q14A 4NABA 4A7PA 3CC8A 1D9ZA 1JIQA 2E55A 3U7FB 3M5CA 3V1YA 4QECA 1VECA 3NM4A 3MGAA 4DF3A 3E0QA 2ZRKA 3HADA 2PFKA 4EHHA 3Q6NA 2H7VA 4QBKA 4WZAA 4BO4A 1B26A 1C2YA 3D4PA 2L18A 1NU8A 4KYIB 1TXGA 1CUDA 1MTOA 4HAXA 2CHVA 2CMDA 3ZC3A 3N07A 4P35A 1IJKA 3L0SA 1MDBA 4OL0A 3S7ZA 2HSDA 4Z9YA 3AY0A 3TZ6A 1XMVA 4HWOA 4JP3A 2LXNA 4F8EA 2H2FA 4GNRA 1JHUA 1MORA 4DM3A 4PZPA 3IDFA 4Q9KA 5BQ5A 2A1IA 2IE8A 4IVQA 1ZUNB 1MH1A 4XCQA 3UN1A 3FTQA 4RVHA 4F3NA 4IRXA 4UMEA 1FNBA 1E1QA 3O2JA 4J7UA 2G6TA 3G5AA 2FMFA 5IKOA 3EVZA 2CHQA 5JUWA 3EVBA 2DR3A 2HRZA 4BGVA 4Z0NA 1I3KA 3NHMA 3ZU6A 1OWNA 1ZD8A 5H81A 4CKBB 5KOHB 2QVGA 1SCUA 1EGVB 4CEJA 3L1IA 4O4IA 5DLDA 4YJGB 4C3VA 3FLMA 1G3MA 1R9JA 5AVRA 2A5LA 4EW2A 1NBWB 3I64A 3Q5DA 2WU8A 3CXRA 3M6WA 3IJEB 3R7WB 3IIJA 4MCJA 3NYWA 4WFKA 3HXMA 5KNDH 2Y68A 2WWWA 3L7NA 5BURA 3QVKA 2A5FA 3DHWC 3EZNA 5D3KA 3R7BA 4ZV4A 3BB4A 4UXHA 1HDXA 1H0RA 2LR0A 2ADMA 2V7EA 4HWPA 2AN1A 3N7AA 1XMPA 1U2ZA 3C6MA 1RC8A 2VDWB 4GRAA 1L5HA 1NI3A 5DTMA 3FYTA 1NONA 4COOA 2WSMA 3BDIA 1F9AA 4JMPA 4Q6BA 4EUNA 2UUBB 4D9GA 5CEJA 1AXRA 3OA0A 3B6IA 3EC7A 5IYZF 3CB2A 3K1ZA 3M6UA 1LA2A 1QYXA 3ET4A 2A8YA 2ZYDA 3QFTA 3R3XA 5K0BA 1YS1X 5FP0A 2Q9CA 3A9VA 3ZHBA 5HM8A 3P0RA 3MTQA 3WLKX 2H5LA 2AKAB 1WU7A 4KO8A 4M0CA 4O63O 4XOUA 2XQKA 3WX0A 3SVLA 1L5SA 4ZVVA 3ZWOA 4XH9B 2G83A 3BQ9A 4TV9B 1G9SA 1JT9A 1N6OA 2E1PA 5TPZD 2W83A 3DFZA 3PI7A 4K6GA 5CHEA 4M60A 4A27A 2RD2A 4I9NA 3U4MA 4KAXA 3ZWXA 1XKLA 3R5HA 1UM8A 5F9MA 3V7WA 1NXTA 3FUVA 4KP7A 4BWFB 2E4AA 3VC1A 2AE2A 3VV3A 4BQNA 3GBSA 1Q2UA 1KJ8A 4R1OA 3SNKA 3HPQA 3KM0A 1Y3IA 2IX3A 3C85A 4CZ2A 1KO8A 3P0JA 1IN8A 3TZQA 2XE7A 3RVKA 3BIJA 1QVZA 3OF3A 4Y2GA 2UZ4A 1T5DX 4CWAA 1T10A 5G4KA 2QM0A 1RHMA 4Z49A 2PZGA 1Z18A 3EH1A 3HY6A 1CP3A 1QIGA 1JTFA 3CIOA 1BROA 4LF9B 2W2QA 5JS6A 3GHHA 5LB2A 2YICA 4N41A 3K9CA 4K7JA 4N5LA 5E8RA 5J2UB 4BLPA 4KNYA 2YS7A 1HTBA 1LLDA 4IY1A 4NBSA 1R37A 2RARA 4NEHB 2NPIA 4ROSA 4UC0A 3TR0A 1XV5A 2HBQA 2PRIA 2QVYX 3BM5A 3DH0A 3EGXA 4ND1A 4TV8B 1FVXA 1YH3A 3UK1A 4DGSA 4MKFA 3H75A 2VZEA 1R5BA 1T6YA 2C7OA 5A6VA 1YGYA 1G4UR 1G42A 2Y99A 2IPXA 3LBHA 4JWKA 4DR3B 3ND7A 3EFHA 4R7TA 4I9GA 2WUGA 3EE6A 1QFZA 2X8BA 1C3VA 1Z37A 1SWWA 2Q0HA 4XUGB 3W7BA 4GKBA 3WLPA 1QK3A 1HNZB 2VYVD 4L4XA 5G2OA 3BRQA 1W4RA 4QIHA 2I6GA 3EFOA 4IOJA 4DNXA 1R4AA 5EZ5A 2HIGA 2TMGA 1CUHA 2H8KA 2I1QA 4DM7A 1P4GA 3G82C 3NUGA 3PXBA 3K9NA 3I9V6 3K4HA 1NU6A 4O4HF 3H84A 3NP7A 4XD7D 3RFVA 3IJRA 1Z7BA 3DWIA 4JC8A 4MYTA 3AXTA 3G5UA 4F11A 3UHAA 4MQFB 4KPYA 1Q1AA 1NDHA 1IIRA 4PRZA 5JAQA 4J8PA 1E2NA 1TAGA 4N8DA 1XD8A 1IY1A 2WF6A 1Q7RA 1RRVA 1M6YA 1X1RA 3AG5A 3I76A 4N3BA 3DV2A 1V4VA 4DQLA 4BXOB 2IEBA 3HI4A 3A1VA 1E3LA 1N6KA 1Q0UA 3H1EA 1B0AA 3E9RA 4KDCA 4LMPA 1JI3A 1UZMA 4X45A 4F85A 2VYVA 2FJUA 4Z9FA 1PZNA 3S5JA 1F9EA 3PE3A 2QD2A 4KE7A 4WASA 3V7FA 2X4LA 4X61A 3MGBA 4QUKA 2I2DA 4DIEA 1HPLA 4G0PA 2Z6UA 1GSHA 2BR3A 2BVNA 4PLCA 3D8HA 4RJIA 2AEFA 4L6CA 4E32A 1WABA 4R9NA 1RIIA 2I91A 4XD7A 4MUAA 3RVPA 5KQGA 4YQZA 5JYEA 1LPNA 3FWHA 3MXTA 1E5DA 1P9OA 1UMBA 4L51A 2IWRA 1UK9A 2B8EA 1WZEA 3TLGB 3OZTA 1L5KA 5E6UB 2UUAB 1B8NA 1QZ3A 1M2OB 2XKAA 3C3JA 4PAQA 5DWVA 2PGOA 5CR9A 1DC6A 5AW3A 2F3TA 1RAIA 2GZDA 1BDIA 3WJ7A 2HUNA 1XU7A 1F2TA 2EKPA 4LUCA 4PX3A 1R0BA 4R6XA 3UUEA 3W8NA 2PGLA 2EOAA 3DOHA 1A88A 1THTA 1ZGCA 3NEAA 2UZAA 3OETA 3QXGA 3BL5A 4PINA 4A8HA 4AG6A 4Y0NA 3H2GA 1XCMA 1W9HA 2XOKD 2GXUA 2AXQA 4O2BA 4PCUA 4IJ6A 1S9HA 3BH0A 3WV4A 2I4MA 2P9BA 5T6MA 1ZIDA 4LTMA 1V4NA 1Y48E 4EK9A 1T2NA 1IN6A 1WMSA 1YL5A 2Q3HA 1FX0A 3PNOA 3IP1A 2WTUA 5EFOA 4RH3A 3B5IA 4ALJA 4N5NA 4RTJA 5L4LA 2F1OA 3KSRA 2G77B 4E11A 4LV6A 3CNOA 4B85A 2O2YA 4BQQA 1DVRA 1XQVA 4WXRA 3OQIB 1Q22A 2FN3A 1X80A 2I99A 4P7KA 5D87A 1KXJA 1U04A 5BVHA 3ZJ4A 5E3HA 1J33A 4LRWA 5B37A 5JEEA 1L5VA 2JCYA 3AM4A 4ID9A 3U60B 2HQ1A 5FUVA 3OEED 1WMFA 3GNQA 3H8JA 4R0NA 5BR7A 1DRKA 1IJFA 3KK0A 5G0VA 1NM5C 1T1JA 1GGHA 2XOKA 3EXG2 1ZBDA 3PHGA 4FGSA 3B51X 3DXFA 4RY0A 4TT3D 4B6PA 3FB1A 3IX7A 4GBJA 1FFSA 4KWIA 4WJZA 2NP7A 1T4CB 4X1IB 1U0FA 3LX4A 1U1FA 2IHVA 1S1CA 2DWOA 1ECPA 1W34A 2A1UB 2HB6A 1JI0A 5JD3A 3ZGYA 1WDWB 5B2EA 1ZGAA 1M83A 3F6EX 1QCZA 4LY6A 1ZSYA 3PPIA 4JUBA 3RJ5A 4MKZA 5F3DA 1HY3A 2OORC 5E4FA 4LJRA 3LPNA 2F8LA 4HUTA 4ZC1A 2W42A 3HDJA 1L0BA 1TX4B 1VGRA 2A0UA 1NC1A 2ZW9A 1O89A 3DV9A 4UQOA 3ZV6A 3QV1A 5DCWA 1XDBA 1IM2A 1C50A 1NXOA 3PIIA 1W4ZA 4BWYA 4QYTA 3V8RA 3OEEA 1GCIA 1RYMA 7GPBA 1DAFA 4QWMA 4MKGA 4OD0A 1Y1RA 1SCJA 2W93A 3MUOA 2XUJA 3RIHA 1VXRA 6Q21A 2AJBA 2EEPA 1UJBA 5F2NA 3ZLJA 4NENA 1ZH0A 3HKBB 5DNEA 3AFMA 4TT3A 3ZH2A 4A9AA 4N3GA 1C3EA 1NHGA 1P29A 3BXXA 3O8QA 2F4NA 1BFUA 1OLSB 1YCHA 3HACA 4GVLA 5IKMA 4EO7A 3QEBZ 4CT4B 3GZTB 1N7GA 1VHWA 3JU3A 1S2MA 1ESMA 2B83A 2HV9A 3OOWA 3PUXA 2JAWA 3DLTA 2R1ZA 2FN7A 4FYHA 4RZSA 1KEUA 5FLKA 2XXAA 2VOJA 3AGPA 1J24A 2VYFA 3KOMA 1MNAA 4JV5B 3CRNA 5A2GA 4R8LA 4XSVA 5A05A 4JP2A 4Z0TA 1O8CA 1OI2A 3DCNA 1MA0A 1TKRA 1YDGA 2EZTA 3MPUA 4UFNA 3NC1C 2V1UA 1I0IA 2XBLA 1V48A 2OUKA 2XNKA 3UC9A 1DUIA 2IF2A 1EQ2A 1QLHA 1YTLA 5IJXA 3RUIA 3J80A 1U3TA 2HCBA 1IPEA 3FWZA 3LY7A 3URKA 2YFQA 1WO8A 1NVUQ 4ZYZA 3DUWA 2B3TA 3LKZA 5AVTA 3RVBA 1GFWA 3NM5A 3A9CA 1V25A 3JVIA 4GXQA 5LN1A 3PT5A 4H4EA 3UXEA 2BFBA 4NCXA 2FEMA 2DM6A 4XCVA 2REQA 4H60A 3A14A 4K1LA 2ZZNA 4PFQA 4N8EA 2V7PA 3UT5A 3UBTA 4RHFA 4A8PA 2HMSA 1S02A 4DCVA 1HURA 2EJVA 3JQAB 2BGTA 2ZSHA 2FEAA 5DW0A 3WK5A 1V37A 5LDDC 1SUBA 4LJ8A 3FHJA 3K2EA 3KZMA 5K99A 2V7QD 3O7WA 1H2YA 2J9FB 2H4ZA 1NP6A 5FWAA 4BUCA 4V1CI 1VG8A 3E84A 5IDQA 3VO1A 3ZD7A 1VDZA 4IJWA 1LBHA 3ITNA 4K6MA 4AP9A 2W6JD 1FK8A 4N48A 2ORED 5HE9A 2LNDA 1F6BA 3EN0A 2ERXA 2A1TS 3L46A 2VT7A 3I37X 4UDYX 3T7JA 3ZK7A 1Z36A 4G65A 1JALA 5IF9A 4ABTA 4MV1A 5IXSA 4FHDA 1SVLA 1XQ1A 3MOSA 2J0SA 1CY0A 3DXXA 5KYNA 4HYYA 1TZJA 4PX2A 4D2IA 1KJZA 4JLOA 4U00A 1W36D 4P3XA 4ZCLA 5FLEX 4LYEA 2IS1A 4P7BA 1GFIA 2JGJA 2OAP1 3E1GA 4FYXA 4GLLA 4MQ4A 4X7RA 3TLMA 3ZK9A 4DDVA 1IAVA 1AZWA 1TKAA 2V7QA 4FEGA 5AVVA 1MW8X 1Q19A 1AOXA 2JKYA 5LYJA 4R69A 1PJ8A 4C0KA 4IKEA 2W6JA 4F5WA 2R0QC 1DBVO 4ZKEA 5M04A 2J6BA 1KH3A 2WWIA 3OJ0A 1W87A 4HNHA 5GZ1A 1FFYA 5BYKA 1MVNA 2H08A 1DKLA 4CDMA 3AH8A 4RXTA 4YDRA 5FTKA 3JALA 3QVGA 5A3SA 3VTAA 1T6ZA 2J3DA 2HJHA 4KSCA 2Y1OA 1NJ2A 5HF5A 3EODA 4EMBA 2CHFA 1QCCA 5BO5A 3ZHQA 2PQ2A 3NEYA 4QU9A 3GP8A 3OEYA 4KR7A 3KJNA 3VYWA 1SVSA 5EL0A 5DCUA 3BMQB 3TZBA 1NE2A 4ZO9A 1DEOA 1KYIA 3TSZA 1CE8B 2JH9A 4HNAB 1RJDA 2QJOA 2XWPA 3RHFA 2VF4X 2I8LA 1PWEA 4KJZA 2FUEA 2QZZA 1YHYA 3G2MA 3L84A 5EQFA 3K6SB 4Z3OA 1TQ2A 1PDVA 5IASA 4V24A 3R20A 1DBSA 1JLLA 1Q6ZA 3B12A 3EF3A 1Q7BA 2ZSJA 4AP6A 4B4OA 1JR6A 5BP7A 2WJ6A 3H05A 3EIEA 1RIFA 3PQEA 1BVYF 4K6FA 4KCGA 2GPTA 1Y1KE 3IT3A 3G8DA 2Q3LA 2GYWA 3QWHA 4RFSA 1TU4A 1FJGB 5GONA 1CK4A 1TVKA 4MB6A 4BE7B 1M33A 3FPBA 2OPBA 4YJFB 2FYTA 5LNK1 3LC2O 1TF7A 4LSWA 3TINA 4NJOA 1W59A 2PLAA 1MAHA 1DGQA 3FCCA 4UVIA 5DHUA 1P1FA 5CFNA 2JD2A 1SOUA 3RVQA 5E0KB 2WG2A 4MPDA 2WVHA 1GQRA 2CJXA 4EKEA 3QI7A 2VBGA 2YHAA 1A5TA 2QYSA 1FQWA 4ND4A 2H4FA 3D6FA 2VRCD 3E81A 4KGXA 3Q2OA 4RA6A 3F8SA 2C58A 1BE6A 1M8PA 5C81A 2AKEA 1G2OA 2QUZA 4HK4A 3T3PB 1GRNA 2ZCVA 1DX9A 3OUUA 4PSKA 3TFQA 5HRAA 1ZMRA 2C5SA 2L82A 3C8DA 4LTNA 3RSCA 5LQDA 1I33A 4HX2A 4B3FX 1GTMA 5KX5B 5AOCA 2W43A 2A94A 2X9VA 3GEPA 4K5QA 1CQXA 1JWAB 1XZ8A 3QW4B 1J8DA 3GEIA 1LBEA 4JQCA 1IHYA 4WZAE 1NTOA 3VC3A 2GF0A 3K5IA 1NVAA 1MABB 5E8JA 1MAVA 2NZJA 3X2EA 5K6AA 2PJZA 4EG3A 1DXYA 1N5OX 5ILQA 4N0PA 3OZDA 3I2KA 1MO3A 5KWIA 2GJ9A 2VRCA 1J4AA 2SCUA 4L50A 2X9QA 1ADFA 1EU1A 1ZN9A 2D7DA 5TX7A 5KO2A 1IZ7A 3CSDA 4RJKA 4BFSA 1E64A 1M66A 2FKNA 2GRAA 4WOKA 1OXTA 2ZUTA 1K27A 3ZI4A 1WQ3A 4ZO7A 3WRXC 4EYGA 3B2QA 1QQ6A 1YU9A 5TV2A 5FL7D 1N0VC 1E9SA 2CLLB 3OO0A 3W34A 1WXEA 3H2KA 1FRZA 3GAFA 3V3KA 1X9GA 3E9CA 1ZIXA 1TKCA 4GI2A 4M8LA 1QMPA 5HNKA 5HOEA 2LRHA 4EMSA 4PHHA 5KNBH 3ADDA 7ADHA 3GPBA 2AE1A 2XMBA 1QRRA 4P08A 2Z0MA 3P5BA 2JGRA 4EKIA 3IBSA 2G9NA 4OHKA 1Y3AA 1I1QB 4HDQB 4Q9JA 3ZGNA 2WSSA 2CJWA 2DUJA 1OB2A 3ADCA 1YZFA 1M7HA 5MF6A 2EWVA 2OLEA 1A7UA 1SCQA 5FCDA 4MTCA 1DKNA 5BWBA 1DWPA 5FI1B 4F45A 4CIVA 4B4DA 3EGCA 1GUBA 2CLDX 3AB3A 4CI9A 4E0BA 1M1NA 1ZOLA 1SVMA 2G4CA 5FOVA 4EB0A 5K0ZA 3D4OA 4HB0A 1UXJA 4DCMA 3B6EA 3A2KA 1UF9A 1QZTA 1XN4A 2A7XA 2PT5A 4MV0A 3SEAA 4RHYA 3AEUA 2XCUA 3IA7A 4PRLA 4QE3A 3VU9A 3AEXA 3SE0A 3CF4G 4JNKA 4QULA 1U0JA 1WXGA 4JYMA 1KOFA 1Z5VA 4R68A 2G80A 3CUVA 2YVAA 1QO9A 1WVIA 4IG4A 3CKLA 2JAOA 5AI5A 4BS9A 5COBA 4K2AA 4KXVA 4EJ2A 5FNZA 1K4KA 3P32A 3INGA 3ZHUA 5GADl 3LG2A 4UPDA 3TOZA 3QGMA 4B34A 5A4DA 3FE2A 1M9NA 2PS9A 3J81k 2JJYA 2J67A 3W9YA 2AXEA 3PQ6A 4NK5A 5K09A 5KNCD 4G97A 2YMLA 1XVVA 4MQUA 4OXRA 3PQDA 4YAFA 1S01A 3R3WA 3ZKAA 5EXEA 4YNBA 2BLNA 2QGNA 1USVA 4LMAA 2WKSA 1SHZA 4AG3A 2W2PA 4KLCA 1AZSC 4FBMA 1NI4B 4WOBA 2ZIWB 3H87A 2NTNA 3ESBA 1B2RA 4CT0A 2ATXA 3LYLA 2IFTA 4II3A 4LVNA 1NVWQ 4AZ0A 4MJ3A 3RRMA 4LHYA 3RWBA 2HHJA 3UJNA 1OJ7A 2GDZA 1H9BA 1ITZA 3DDZX 3HEBA 5E3IA 3LRPA 1JR2A 1XEAA 4ZN6A 1GUDA 1HT3A 1H8ED 1II8A 2YWHA 4N8SA 3WDMA 3WV5A 3KZCA 5AW7A 1GZ5A 1Y7IA 2QTNA 3IHTA 1DAPA 5KNCA 4HQOA 5EY5B 5WRFA 1IBSA 2H3EA 2Z5GA 3RBAA 3UOGA 2C2WA 3JQ7B 4ER6A 2GAOA 1MB3A 4JLMA 2VJLA 2ZUWA 3DE0X 4AY5A 3ESQA 1PFGA 1YCDA 1KI3A 3G2PA 4C4TA 3RUFA 2PQ0A 1O94D 2R00C 4HL6A 5IPFA 4CEHA 4MRVA 2BY4A 3LQKA 5EZSA 1BKDR 5KKAA 2FE4A 5AOVA 1HSOA 1N6LA 3N2KB 4R7ZA 2P2YA 4Q3CA 3QSYA 1NXXA 2JHPA 2BGLA 4ITRC 9LDBA 1RYFA 3KKNA 2OHXA 2AT1A 1NHWA 2ISCA 1E7WA 3U13A 1VDMA 1DQNA 3D3EA 5UKDA 1FFEA 3O8RA 3AR9A 2PUDA 2AG5A 3CLSC 1H8EA 4A0RA 1XNJA 2VDNB 4UU1A 3AETA 4Z3KA 2I29A 5FTLA 2CUTA 3PIDA 3ZJVA 4PPNA 3U7IA 3B6JA 5ITZB 2VKQA 2JFUA 2V6JA 3UENA 1Y80A 1JP7A 4QGFA 3CNEA 5JO9A 1LTQA 1XA3A 2FPOA 3V34A 4BN4A 1Y42X 3GGCA 1O94A 1EZZA 5IVIA 2Q6VA 4Q3KA 4CQLA 4YAWA 1GKYA 3CUTA 2PKRA 1ULTA 3PUYA 4CM8B 4ZHQA 5IT5A 1NBMD 1JQ5A 5FLXA 3B70A 4MW7A 4IAOA 5FD8A 5FI0B 2JG3A 1AQNA 4HUQA 1QE3A 1O5OA 3K73O 4DDHA 2WYVA 4L8FA 1KYXA 2EL9A 4QNMA 4RFVA 3JZMA 1ZIYA 3W1VA 4RX1A 2HPVA 2YR0A 3GL9A 4CHGA 5CFMA 3FOCA 1Q2XA 3HU2A 3GGSA 4DSUA 2ZT5A 4D4KA 2D2IA 2VT6A 5FWDA 6ADHA 2GCOA 3H99A 4R1QA 4FW9A 4TVOA 2C0PA 4FFOA 3VOBA 4BGIA 2OZLB 1W52X 4MICA 4IJ5A 1XTIA 1T1RA 3OG9A 1VLQA 4DADA 4NFSA 5K2MA 1GR1A 3EEFA 2IYLD 3M1AA 1GVNB 1IOZA 3DLAA 4RCYA 4DLPA 4X20A 4QBHA 2HQBA 3UHOA 3VO8A 3IAFA 4HEA6 2QRQA 1AV6A 5CA0F 1NBMA 2XDQA 3GRUA 4PIVA 3KQMA 4QG7A 1HK7A 1UP6A 1S2DA 5J2TB 4JH0A 4PYKA 3ZCPA 3DZIA 1QGDA 1NN5A 5AVSA 5JTUA 1ADCA 3IEKA 4FQ7A 1DJNA 2GILA 4PQRA 2AN5A 1U2DA 2EF1A 2VPIA 3I8OA 3TH5A 3QUAA 4IV0A 4L9WA 5DP2A 1I2ZA 3N7UA 3X1WA 3VDMA 4S0XA 1YOVB 3HCNA 3KVOA 3SHOA 3TTVA 1MZPA 2IXEA 3OU7A 4US0R 1W1IA 5B57C 4J6FA 4N7RA 3NJRA 2XWQA 1N0IA 4FD3A 4XZ3A 2YHBA 1DEKA 1ZIPA 2JIPA 1SQFA 3CLHA 2ISQA 3ABZA 3FN4A 4D46A 4FGJA 3AO0B 4RPHA 3K09A 3HB9A 5C1IA 3IR6A 3SLRA 5FR2A 4WW0A 3NO4A 3C24A 4TYPA 1SEPA 2Q50A 4W5QA 1JYEA 3DZBA 5TMPA 4MJ7A 4NYMQ 2HLDD 1F8UA 3DMTC 2V6BA 3P97A 4FZ3A 5TLSA 4DRYA 4R0VA 4EY3A 2WK1A 4IDBA 1KNQA 2YWJA 1H5NA 4BBAA 3GROA 2BMEA 3K0KA 4UUPA 4YJDA 2FFQA 3PHIA 1E4YA 3D8BA 3F7TA 4IEFB 5CXQA 1U1CA 4RESA 1PS9A 4OLAA 2PL1A 4W1RA 3BCRA 2FSFA 5DI3A 3TLAA 2QSUA 1X1QA 5ALPA 3RPEA 3ZJ5A 3ES9A 2M6RA 1O57A 1M0EA 2FG5A 2H63A 4WNAB 4F84A 1IN5A 5EPUA 1DRUA 1BHJA 2HMUA 3D5QA 4I50B 4J9UE 2TSYB 4DQVA 1SU6A 4QRDA 4ZVKA 3BJMA 3I2YX 3IIEA 2A5JA 4IFTA 5DSZA 1ZL0A 3LIPA 1TYAE 3OPYI 4G63A 1I9CA 5B1HA 1AIPA 1ZSVA 2G3YA 2YL2A 1CP2A 1S4MA 1U0NA 2X2EA 4C6TB 2HLDA 4UM9B 3HM2A 1JV2B 1U0TA 5TIIA 2AS0A 1U94A 1KQGA 1KHTA 3NTLA 4HKTA 2QZSA 4QVKA 4RHEA 2Q45A 5B1DA 3IV9A 4LX0A 4NYJR 1G3RA 4AJHA 4B81A 3S3TA 2XEXA 3KVNA 4K0KB 2A92A 3DKPA 1V47A 4L8GA 4KN8A 4V39A 3EOZA 4P2GA 3FTCA 1IG0A 1ZRNA 1T6XA 4D8WA 2WHPB 4YJ2A 2B25A 3AJRA 4Q1AA 3LY9A 3O1JC 1TM4E 1G66A 3TQOA 1KWGA 2MR6A 2H2IA 2A9QA 2F43A 2HF8A 3D5TA 1TQ8A 5B4VA 1OT5A 5CXUA 4ZV7A 1KVSA 1UFRA 4U2DA 4B40A 3VKVA 1DSSG 3DVAA 1N6NA 3VO2A 4KKVA 5M29A 4MJXA 5ALQA 4A6PA 1M0WA 1U31A 3W9BA 4QELA 1PIWA 1DX6A 3RTAA 2VJOA 1SOMA 2YVUA 4ZT5A 3LDUA 1LWOA 3JD3A 1H6AA 2QSYA 4HGOA 4YPFA 2AHOA 3PXAA 1JFFA 2VAPA 2GEDA 5K5EA 5LOVA 1P75A 5DHTA 2UVPB 2B4YA 5B12A 4UAJA 1OXMA 2G72A 2QMQA 3CLKA 2V6IA 3FHLA 3LKDA 1E9DA 4KIFA 3SSMA 4F4CA 4JLNA 4DIOA 2CMFA 1H0SA 2OFPA 2ZI4A 5FR1A 4M6WA 2FQXA 3I8XA 4TRMA 2IDMA 3L6RA 3QV2A 5SY4A 3DPUA 1E3MA 1K98A 3PWTA 4AG5A 1M5TA 3JQ9C 3RFCA 4EMTA 4L4UA 1KBQA 3PX3A 4C22A 4N5HX 2NU6B 4Q3LA 4CRWB 3HSSA 1DRWA 2Y92A 1L4LA 3EZ6A 5EJGA 4LW8A 4XXHA 3ANMA 2D6FA 5DHAA 5AESA 1EP2B 3PUWA 4FXOA 3BZWA 6YASA 4JBIA 4L2IB 5IP5A 4HH1A 4M1WA 4D79A 1R4ZA 4NCJA 4MPRA 5IM4A 2HUPA 1TI7A 1SHKA 4Q24A 5A0VA 3IRVA 2GO1A 1USIA 3M4YA 4M1QA 2Z3WA 2XJ4A 3KEGA 1Z2PX 4BVHA 2REBA 3CEHA 1AT1A 1XVUA 2DFVA 4X1YB 5D3MA 4E03A 5M34A 2PZLA 3QLJA 1YGPA 3CVXA 1SZPA 1JLKA 4RENA 1VP9A 1A97A 4MAMA 1HT0A 4BV9A 3BH7A 3KJQA 4GM4A 5HZMA 2G1JA 2XCLA 3KTAB 5JSUA 2X3YA 2II6A 3B1YA 1ZK4A 4JSTA 5IAAA 4GWGA 1OWMA 3AVYA 2HNKA 4XGQA 5EFZA 5CT9A 2BEWA 4ZTBA 4CKCA 5JH7F 4RS3A 2O8BB 2DHDA 1D0SA 1Z8FA 2PUBA 1ENZA 2Z1MA 2MDTA 3EY4A 5HK9A 1K3TA 1BWQA 4C3OB 2CBGA 1E1NA 3TEFA 1VYTA 5BR8B 1R00A 4JI4B 2RGBA 4NU8X 1HEUA 2P0YA 3AR7A 3QEOA 4TXMA 5D01A 3ZXSA 3IIMA 4B3CA 1DAKA 2GZSA 3H9JA 2JAHA 3OZIA 1MG5A 1T36B 2JAQA 3H97A 1SURA 1UBNA 2EG9A 3QNUA 3CSSA 2VNAA 5AP9A 3L8YA 1KAQA 5FADA 1NNUA 4A5OA 1YRQA 1MGPA 3MUNA 3CO0S 2ANCA 4NC9A 1E9AA 4YJ3B 2O0JA 4DABA 1ATZA 2MSEB 3U4QB 2FLVA 5EPEA 4TSFD 3WK6A 1ML4A 5I4IA 3DGEC 3OEWA 4K9QA 2VAXA 3TVTA 3CB4A 2CSUA 3H5AA 2JGDA 4KQ9A 1J8VA 2YDYA 5ALHA 4QOJA 1MJHA 1IDOA 1AMNA 4NH4A 2XGMA 5E9QA 1UZAA 1H66A 1O3YA 1OJLA 1NT4A 4FZRA 2X8WA 1GARA 1V5EA 4ZJZA 2E6UX 4CR8A 4G07A 4ZXFA 1H2AS 3DLCA 2WAAA 4YK7A 5JI2E 3T0FA 2J9GA 5A1JA 1KF0A 1QHHB 1YBVA 5LA6A 2JI9A 4P5EA 2O7SA 1IWBB 4MDHA 3SM9A 1RNLA 5ER9A 3C4QA 3Q85A 3J7AC 2RHTA 3DNMA 1JQEA 4J1TC 3KOOA 5HILA 4BP1A 3D3KA 4YX9A 4RMJA 3BMOB 4TSFA 3GT3A 1DBPA 2RCYA 3G6WA 3QE0A 4URHA 3A6PC 1P81A 3JQFA 4ZJYA 2GZMA 2C2HA 2VEDA 4NP6A 4BZWA 3RSZA 2AJTA 4ZZ0A 2IXGA 5JJCA 4PLWA 1OXXK 1PJ2A 2IEDA 2FF5A 3THYB 1P7PA 2R1VA 2QIOA 4DVGA 3IP6A 5FFNA 2JD0A 5B6IA 5CFOA 3IVCA 3LVBA 3VPHA 2KBEA 5FFMA 3DDOA 4FSDA 2C1ZA 1TCUA 1EWVA 1W85A 4LF5B 4Y1GA 1N5MA 3HR7A 3DW3X 4O02B 1OTXA 1EIWA 1XCOA 2WJPA 3PHHA 4UUQA 3VPXA 2G9RA 4B3TB 2WZQA 3EAGA 5B1SA 1R9MA 1Y9EA 4I9FA 4L9SA 4LF4B 1OH5A 1KP3A 3P9YA 4EYSA 4JGBA 3FCAA 4B8ZA 4KRGA 4QOIA 1GU7A 1ONNA 1YQUA 3EPKA 4RQTA 5HDBB 2RJ3A 1KFKB 2OZPA 1JTVA 1YZKA 2CZCA 3JQDA 1OAOA 2B61A 2I6SA 4RZ2A 3O73A 1JDSA 4IHKA 5GIPE 3KQHA 4JOBA 1E1LA 4NK4A 2AUTA 4QHYA 2A1TR 3BERA 3DGFC 1C7FA 1T6NA 2QUIA 2W2XA 3BRWD 3N28A 4P3PA 5JQGB 2FPKA 2HGSA 1XMSA 2FCAA 3O90A 3T4EA 1TYEB 3KSMA 4WUTA 4JJKA 1U0LA 4L7VA 4EG6A 2RHWA 3OJEA 3QXSA 3LUDA 3PNVA 3V4PB 3R9IA 1Q21A 2CNBA 1A72A 2PZKA 2ALJA 1WNTA 1QNFA 2E18A 2YHUA 3O2NA 4HAIA 4JZKA 2JHAA 5F78A 4DIDA 1N7HA 3EPRA 4ERNA 2NN3C 5SYMA 4I81A 4KQHA 1QU2A 3BMCA 1EFVB 2YW2A 4UJ3A 5AKEA 4G2TA 4XLZA 1PN3A 2FUG6 2O7QA 2PL5A 3C3MA 4S35A 2X22A 2XRFA 4UNQA 4EG4A 1B8OA 5JCOC 4DBLE 5ARCA 4JLUA 2NO0A 5FORA 2FFBA 3BRWA 1XRNA 4MR9A 3TZLA 1OH6A 1JIUA 1PNVA 1QGOA 4H4DA 4L6IA 4TL6A 4X6XA 2EL7A 5AJTA 5TJHA 4Y1RA 1D6NA 3IJ5A 3GLIE 3DP9A 1TRHA 4EHAA 1L8OA 1W93A 2JCXA 4ZJPA 2O8EB 1LF0A 5KOJB 3AZQA 5FRDA 1ESCA 2CDBA 1ZJ6A 2PGIA 4LAFA 4K3UA 2OP0A 3F67A 3F7NA 5LQRA 1ZAKA 1ZK3A 3V8QA 1PL8A 3DAYA 4IHJB 1ZK2A 1E5QA 3V4VB 1M6EX 5AJHA 3N8IA 3D64A 4BUJA 3ONDA 4PQEA 4TKZA 2IEYA 4J90A 3B20A 4YRAA 1BFDA 2ECQA 3QFCA 1ZXBA 4BGUA 5SICE 5BWOA 5EIBC 2WG1A 5D5HA 3OIUA 3OZGA 3TW6A 2LV8A 3JQ8B 1JA1A 2XXBA 1SAYA 4U6SA 2WHQA 2ZU0C 4NFLA 4J0FA 2YFKA 4MUFA 3CLUD 5JXHA 1XBTA 1E3TA 3C3EA 1G5RA 3BD7A 4ZVTA 3HDGA 4QO8A 1G4AE 2Z2ZA 3BWBA 3TW4A 4JBHA 2O0HA 5AIAA 2ZJ2A 5LD2B 3BT7A 3V1TC 3HCWA 1DELA 2XITA 2HF2A 2R8EA 5IT9A 1NLZA 1MJNA 2CZQA 2Q1YA 2J3QA 2NV6A 4F4IA 2XECA 4XTRA 1DBWA 3FMFA 2WA2A 3PGVA 2CNOA 3ZY5A 5AJUA 2QL7A 1BU5A 1Y8AA 2J41A 2C54A 3D3WB 1ZEMA 1NFFA 2HM7A 1FTSA 3HC7A 3OZEA 5EP4A 4WI1A 4BO3A 4C0HA 2EFCB 4YACA 5JNWA 1RFGE 4RL4A 4A2PA 2X8LA 4HTFA 4PG4A 3HBFA 1N9ZA 4U7GA 3B2EA 1G4HA 4FWBA 4HDMA 2ZR8A 4OOEA 4R40A 1RCFA 2ATVA 4AULA 3ZBUA 4P92A 4ETNA 1E9FA 1CR0A 4IIVA 1I7NA 4MI6A 3NRCA 4FUTA 4OP1A 3I58A 3KRTA 4IIBA 4P7JA 4AZ3A 4BC0A 2ZXFA 3RARA 4XAQA 5ITSA 4GM0A 3QOWA 4H16A 4LIPD 5J3JA 2AR0A 3T15A 5IX8A 1ODIA 4Q7KA 5IYZA 3C0KA 1XUOA 5IJ9B 3FSRA 3IAS6 4YCMA 1O54A 2L17A 3PVSA 4OM7A 4DUZB 3U5ZB 1NQWA 2F9FA 2ZBQA 1T0IA 3E8XA 3FF4A 3FNHA 5ILOA 3INRA 1TAQA 5J58A 3OF2A 4CN8A 1SQGA 3EZFA 3KYDA 3U4DA 4B82A 5B30A 3FNQA 1N3YA 2PWZA 3LFTA 5AK3A 5CDSA 5L3QA 4NG4A 1NXVA 2FR8C 1R6XA 3E53A 2HT1A 2FOLA 2NT4A 4PZAA 3NALA 2IDKA 2GJKA 2QI9C 3GJ4A 3KXIA 2NU7A 5I4CA 1EK2A 4CCSA 1CRLA 1JVNA 2DETA 5GP1A 3Q12A 4A0SA 3KP1A 3R7AA 3N2GA 3LK7A 3PNMA 4D3YA 1G0NA 4I2NA 1HE2A 3QFRA 4I0WB 5DDIP 3EPPA 1E3WB 4FT4A 3O1IC 2GZRA 4YRCA 5AJYA 1MF7A 1C9MA 1SHLA 1XVTA 1QZXA 3NTRA 4YIKA 2ARKA 2ATIA 3MAJA 4JJ7A 4Y9RA 1WHTB 3FIUA 3DPSA 4II7A 3KQNA 3EAFA 4FLEA 4NMLA 1Z0KA 3KJGA 3CEJA 4TKUA 3BWYA 1KJJA 2NUAB 3WKBA 4M7PA 4OA5A 2J7PD 3E15A 2EFHB 3V55A 1T8RA 1TIPA 1AO3A 1LUAA 3CT4A 2WWVD 2YFHA 4GRIA 3TECE 1S6YA 2RB4A 1C2TA 3CRMA 1MRZA 1YNOA 1QS0A 4TWAA 1DDOA 1V1JA 1RXVA 2XDYA 3H13A 1J70A 3LLUA 3NC0C 3NM6B 4C7VA 1TT5B 4XYGA 1GRRA 4HLUC 5L40A 2XB8A 5TQ2B 1LQUA 3UWOA 2FX3A 4YEDA 4CIDA 3PD7A 1YL6A 2DBRA 3JRXA 4K1XA 1UC9A 4OK6A 4BMVA 2XNJA 1TCCA 3RGGA 1K5HA 1NBME 1R4MB 1SQ0A 3KD3A 2DWUA 4FE7A 4N9WA 1BOFA 4WH0A 3ZE2B 1AH2A 3KLPX 1JB1A 2OM6A 5GV7A 2BUAA 1A9OA 1JPNA 1MV5A 3PI6A 2OK8A 4Q3OA 1T8YA 2J7PA 3HXKA 3K6KA 1AUOA 3LUHA 4IHAA 4O4HA 1H5QA 4FMDF 1QC5A 1LDYA 1IQPA 5CVTA 3TUZC 2WBLC 1NUTA 2R8XA 1LSOA 2PH3A 3H1FA 3UM9A 2CE2X 4IX1A 4KLAA 2I6QA 3PHLA 2QEQA 2CL7X 5J47A 3BHJA 1SOVA 3CKMA 4WA7A 1Z5ZA 3SBOA 2H4JA 1QWSA 2AJDA 5LMCA 1O96A 1Z4PX 3WBJA 2CV0A 1PSZA 4OBXA 4FCTA 5DFAA 4YYZA 1EDZA 1Z12A 1N4DA 3R6TA 4LPKA 4MVJI 5FKJA 1JA0A 2VYCA 4L4SA 4URXR 3I01M 1RBQA 1KC3A 4RK7A 4OLHA 3IGFA 4GRDA 5KHOC 2Q29A 4ARCA 1P8JA 5G02A 1IM5A 2CKMA 2YWCA 3C4JA 5CH3A 3CZMA 2UZ1A 1OFIA 1PJCA 1JQ3A 4IXTA 5B2FA 2WTAA 1XGKA 3FAZA 4UZFA 5U4XA 5FUQA 3QYPA 1FFBA 3NONA 5BSUA 1NG1A 3H3JA 5HFAA 1J2RA 1XDGA 3MA0A 1ZZEA 1BDJA 1LDEA 2XB9A 1H4TA 4MRAA 1MC8A 4Y9UA 1UFOA 4DC1A 3IEXA 3FBWA 1PV1A 3HI6A 3DOUA 1U81A 1QCDA 2GMWA 2ZSFA 3UFXB 5C51B 1PR6A 1AMOA 1P2GA 1V5IA 1GPMA 4B3JA 3QH4A 1XQ6A 3C6BA 2DFNA 3GI1A 2I9KA 2JC3A 4OV6B 5SV2A 3RVMA 3QLUA 1UZLA 4IIEA 4OQZA 2D5IA 3TRHA 3QWIA 3PQ4A 4INZA 3UYKA 2BGUA 3LQ4A 4II2A 3MIZA 4LI0A 3HSKA 4IJVA 3SC2A 2I4LA 4S05A 2C8LA 1ACMA 1X9IA 3CKKA 5AD1A 4P3OA 2UYYA 1SRRA 2OQVA 3U4HA 4LQDA 4BMOB 3O47A 1UMCA 2R96A 4IQGA 1JIIA 1LNQA 1LLFA 3GJQA 1DKPA 1EIZA 1SUFA 3ELWA 2PX6A 3ZDAA 1YRAA 2WWGA 3QK7A 3HP7A 4DMUB 2P8SA 3LXUX 1ZR4A 1YRHA 2HI0A 4EUEA 4NL4H 2G70A 4WD3A 2WB2A 1XTJA 3UH1A 4ZOCA 2OZKA 5EVCA 3GXBA 1GZSA 4EO4A 1XMIA 5GM1A 2QMYA 4EI2A 1TF2A 1PJBA 3AUSA 4LNHA 1L5OA 2D1RA 1RRMA 5DGIA 2F8TA 1BSVA 1DTEA 1H2BA 2W6NA 1ORTA 2J6HA 2VI5A 3KKLA 4L73A 3RSGA 5C5IA 4OEHA 3PIRA 1EBUA 1R66A 2QL5A 1VM6A 5AKLA 5DLPA 5TQJA 3T9CA 3KS9A 3URMA 1SOAA 1E69A 3CBQA 3B1XA 3NPAA 3QVWA 1X1SA 1ZW1A 4L22A 3VR5H 2PQ6A 1GQYA 2ANBA 3UMCA 2DY1A 2X41A 2IDJA 3BHIA 3LYHA 1D4ZA 3EZ7A 4EPWA 3B7GA 3S2EA 4BGDA 2XV1A 3M5DA 5HWSA 3IKLA 3T9EA 2PTHA 1Y5MA 4GDMA 4WZAB 2OBMA 3W2EA 4GE0A 3CCCA 5BT9A 4BRUA 1R1DA 3PE6A 4LDPA 1NYLA 1UXGA 3SJAA 5E9AA 3G2HA 3RM3A 1KS9A 1FW8A 3AHIA 4GWKA 3CWCA 5E4TA 1IOVA 4O2AF 4J94A 3WWYA 3Q8KA 2FRDC 3SGLA 3PR3A 3OVMA 4ZYWA 5KYTA 4R05A 4CG1A 2Q6TA 1DTWB 3WQQA 1Z0DA 3PDUA 1GA4A 1TQHA 2BTEA 4YH1A 1VIMA 2XHZA 4P22A 3ISTA 5IEJA 3SFVA 3P9NA 2FDCA 4M22A 4XYMA 4GGOA 1U7OA 4YAGA 3UWPA 4YMWA 4P31A 5BRJA 3AYZB 3WSVA 5EIWA 3EXHC 1XLTA 5IARA 4EKGA 4PPYA 3R3ZA 1LV8A 1SCUB 4NFYA 4CEJB 3I1JA 4O4IB 1H23A 5JD4A 3HDTA 2QXYA 3UICA 2APJA 1J8QA 2XB6A 3L4JA 2CNLA 3SJ7A 5JSQA 1I5RA 3JSXA 3BQNB 4IQFA 4N40A 2AZDA 1WULS 1RAFA 4EPVA 2Q2VA 3S99A 2X15A 3LQYA 3C1UA 2O2SA 4PXSA 3ZLVA 1KAGA 1NBIA 5FBKA 4BRZA 3SIXA 3KL4A 2EJUA 2WHXA 4KBGA 3KVYA 4A1OA 5JJKA 2HFJA 4LZOA 1CUXA 1G8KA 4BLTA 1T0HB 3IH5A 1KEZA 4BNFA 1JBKA 4D44A 1L5HB 2VNJA 4WECA 4Q9DA 3ZK8A 3L05A 3AY3A 2QXUA 3FFXA 4PHGA 3HM9A 4TM7A 5CXSA 1GZ4A 5FJIA 3MPOA 1LI5A 3O31A 3WDSA 3WLIA 4BNWA 5L9AA 2VJPA 4KO2S 4PNHA 4XQ0A 3T7SA 2SECE 3WL5A 1WPRA 3UCXA 1PSWA 4F5ZA 4QXAA 1CY2A 1C1XA 2H92A 5BSKA 2GETA 3JZAA 5ICSA 5I01A 1E7QA 2MMCA 4J4HA 2IEIA 1H9CA 1FMTA 3PQ5A 1E2MA 3RU9A 3SK0A 2ZR9A 4BJ1A 2V7GA 2JAUA 2W6MA 1LXCA 4P3KA 4ZQCB 1FUUA 4BWGA 4XB1A 3ILHA 1P3Y1 4L0CA 3UF0A 3MOGA 5JZVA 4CT5A 2XYRA 4LFAB 2PAAA 1AGYA 1V8FA 1WEHA 2JARA 2XVAA 3JQCA 3OM9A 4X95A 4BL5A 1WEKA 2NQTA 4PAGA 3TTXA 4ENUA 3KQOA 4HN9A 1FDVA 4ND3A 1GUAA 3PEEA 2Z6QA 3DL7A 3O3MB 3D3QA 3KKPA 2BELA 1R5JA 2VDVE 1EUDA 3F4BA 4L3WA 2O3JA 4OYRA 1U0EA 4QGSA 1I6LA 1RC0A 5TNXA 2CNWD 4RYLA 4C4AA 5G4KB 3ESYA 3PXXA 1JFRA 1MQ9A 5LZ2A 2O7RA 2C42A 4L5JA 3VVCA 4KFCA 3ONEA 2DXIA 3SMQA 5IZ4A 4WKCA 4ILEA 4X7MA 4M1TA 2V98A 3MWDA 5AM0A 3KCQA 5L3ZA 4N4AA 2BHNA 4RMIA 3GFVA 3KE9A 3LZ6A 1Z28A 5BWCA 2VDUE 4MW6A 4R8MA 1OZ0A 4OB7A 4QA9A 3AOEA 3EQ8A 3K3PA 3EGXB 3D4NA 4PHFA 3D54D 1F8YA 1BXKA 4ENWA 3ZHXA 3FDXA 1KMQA 2DAPA 2VDLB 3UPUA 3VU3A 2XVYA 3AFHA 4OKSA 3C5CA 2AR9A 3DMGA 5IBPA 1N2IA 3G13A 3QF4A 1D2AA 1UFVA 2PANA 1DXQA 1TM5E 5KMGA 5KTRA 3JR7A 4BFTA 2CNWA 2GZ3A 4QTYA 3CW2A 3EFOB 1OZFA 4DMMA 1QP0A 2CNKA 4IV8A 4KZPA 2UXDB 1I13A 1GSOA 1U1EA 1YB6A 1R12A 2JI6A 2QE6A 3H0EA 1VE6A 4W5WA 4B32A 5EHZA 1Q7CA 1QVAA 1S8OA 4Y98A 2P27A 5BUCA 4K9LA 4I3FA 4MQLA 3DD1A 1U3GA 2VBCA 5F3RA 1JPUA 3RTGA 2FSSA 1DAGA 3MG9A 1V7CA 2FZCA 1BX0A 5K3FA 2EKDA 2OAQ1 5LP6F 2WUVA 1NQXA 4TL8A 4DE5A 1BJTA 4ZOLB 1V9SA 1BCSA 1TJPB 3TN7A 3GN2A 1DQSA 1Y1TA 1ZUWA 2PJDA 4HDAA 4ZVRA 1YIOA 4CMIB 4AIIA 4WCVA 4IXWA 3C1OA 4A8JA 3DZHA 3ZCVA 1N2HA 2PX5A 1JU4A 4PTYA 4ANFA 4L9AA 1JECA 2J59A 3HUFA 2J46A 4YA6A 3BRSA 2ID7A 2NTVA 1GADO 3IE0A 4G01B 3I53A 4QXMA 5CIQA 3RS2A 1OPXA 3I2GA 3ZDXB 5TQ0A 4MB2A 3K09C 1N3LA 3OQJA 3OECA 4RVFA 3SEZA 3AVQA 1T9AA 1UMBB 3COZA 2FZ4A 1FSPA 1KXZA 3OQOA 4IGIA 3LPMA 2V74B 3EIWA 3KPVA 5U1PA 5JV5A 4AWBA 1FE8A 4ZO6A 1AKNA 2XCQA 3E8SA 4KAJA 1NG9A 3T3OA 3ZZTA 2DPYA 4LYYA 4Z9BA 1F2TB 1OVMA 3V2HA 5CVEA 2VDQB 4X41A 2HU8A 5AI9A 1JLRA 4B3MB 1UJ5A 4FFSA 2W4MA 1X2BA 4FZ5A 2WTMA 2W11A 5CU7A 2UZIR 1C3XA 4J7XA 4O2BB 2QTMA 5T67A 1OFUA 5LDHA 1QK4A 1BU8A 1PD0A 1T5TA 1BAPA 1L4NA 2PT9A 3C8MA 4YUXA 2NSHA 4MK4A 1XZHA 4CM6A 1E9BA 1RQ7A 1A2OA 1ZDMA 1QIEA 1R6BX 1WCV1 2O07A 3AJ8A 4TVSA 1T9BA 5AI4A 4C43A 3FBGA 3R5FA 3DT6A 2W6PA 3I30X 1IUPA 4HDKA 2X58A 4L4RA 3RUAA 4TZ6A 3TUJC 3RT7A 1X80B 1AU9A 2IYRA 3TE7A 1AK2A 2RHBA 1P0IA 2HWXA 3OQHA 5BVHB 1UKVY 1TMKA 3U40A 4ZCRA 1HDZA 3ZXYA 3SKYA 1VA5A 3L1KA 3AFNA 2IYUA 3V7UA 2F55A 4IG9A 4RD2A 3T1YB 3PPWA 3LGXA 1DZ3A 2FSHA 2GJ4A 5DIZA 1LC0A 3QBTA 1LDGA 2EXXA 2Z1NA 1JEQA 1Z5OA 1IK6A 3LV8A 3GBVA 4D9BA 4LPSA 4WK0B 1WLSA 4R5MA 1RXIA 3IELA 4HDRA 2X7JA 4QUAA 4RD3A 4ZT3A 1WQ1R 5HE8A 4C0QC 2YWGA 1HSZA 1A5BB 1E6CA 1GGKA 1OZAA 2IIQA 2OFWA 3DSRA 1U4OA 3TGWA 4DJJA 2CEKA 1A5AB 2C5LA 1Z0IA 4ENPA 4ZHSA 3TD9A 4BTVA 4C7JA 3KKKA 4X93A 1XVIA 1T3SA 2MU1A 3WJ1A 2FG7C 4RVCA 3QUTA 2ETVA 4P84A 2DTEA 1XU4A 4EFNA 4NENB 4HZUA 3GBPA 5FPPA 2IXAA 4YONB 1FCJA 1PKXA 3A9UA 3ROKA 3UNXA 2F4VB 5LCXA 5DCYA 3MSXA 4QFBA 1AKTA 1OXSC 1KZ6A 1POXA 3EEBA 3O8QB 1GUZA 3W06A 4ZYTA 1RFLA 1QFSA 2VRNA 1JYFA 4HQKA 4IZ6A 4QSMA 1NL3A 1E79D 1XD9A 2VTKA 3IOMA 3Q87B 4KV9A 4N18A 3DE4X 1R3UA 2QW8A 2XXAB 1NUAA 4PSDA 5AUOB 4P5DA 4YCJA 5IXYA 3B78A 1JBEA 1YZYA 3LBNA 3U7JA 3FCYA 1BXGA 2J1LA 1XNRB 3D5EA 3DYVA 3W6ZA 3NC4A 1N2XA 1M1XB 2CCJA 2YIMA 4ZICA 1C9YA 1GLNA 1SKYE 2CJFA 4LISA 1TFUA 4BKUA 1BS1A 3GXOA 3LC1O 4OGWA 3LUAA 3GC6A 5AICA 3K5WA 3Q5GA 1X1AA 3F5MA 3N70A 2AMJA 3IV7A 4K6CA 1AZTA 4LS3A 1UDWA 3OTWA 3PDIA 5H3LA 3AVXA 1TT7A 5F21A 5LL6P 2WG0A 1HXHA 2PH1A 3LX8A 4Y8VA 2WF5A 2WJGA 5CYGA 3WFZA 3ZCUA 2BFBB 1E79A 2J30A 1D0VA 2Q21A 2Q5LA 1R8JA 3E6AA 2ZRBA 5B3JA 1PHPA 2EYQA 1PCXA 4HG2A 1VJRA 3UT5B 3RBZA 3T4UA 4G4IA 2ZIGA 3RUEA 1XDSA 4J43A 4KQXA 3ZNPA 2MSNA 3DCJA 1F0YA 3NNDA 4L76A 4YMLA 1IXSB 1PT6A 1JL3A 1XK6A 3H8VA 3GMSA 1XZPA 1JDZA 1K6XA 3IPRA 4J0JA 1UBKS 2P2GA 1VL1A 3CX6A 4P38A 3CIFA 4YN3A 521PA 621PA 4FS3A 1AKRA 1LPSA 1XA4A 3H7IA 4UQLA 2V8OA 1SR8A 4XJSA 2R85A 4M46A 5FLYA 2A0WA 2Z5VA 2P75A 4AP5A 3C43A 3T3NA 2VNKA 2WJAA 3H5VA 3HNOA 1KZ9A 2P2DA 3KFVA 1ADGA 1NP3A 3CTPA 3UIEA 3MJCA 3HH8A 1P5ZB 4FNOA 4PYJA 5IVPA 3PPXA 2IUFA 2RK4A 1M2JA 1Q57A 4OJKA 5GJVC 3HCAA 4O4LF 3Q9LA 4C0WA 1ZA1A 5JVDF 1FU4A 1Z26A 2FN4A 4GWLA 5JPDA 4MWGA 1WDMA 1KVRA 1VE9A 2QP9X 2C8JA 3A6JA 2WKRA 1FQOA 4P4NA 2J7KA 5HIMA 4EATA 1BC5A 1QV6A 4WK2B 3N0RA 1ULSA 5LYJB 2X5NA 2BRUC 1N5DA 3GN1A 1Q1EA 4NMXB 4Q66C 3BIXA 3GCZA 4KUHA 4W7HA 3AUFA 3CH7A 3NDBB 4BNHA 1G8HA 2PKQP 3JD0A 4CGYA 1QRSA 1JQLB 2BEJA 3ZDZB 3DEZA 3U0VA 1OQAA 4CF6A 1QKJA 1X7ZA 2EGGA 2WHEA 2HKIA 3BHMA 1NR7A 2VP2A 3KAPA 4ZEXA 3JALB 1Q0SA 3JQFC 4LCBA 3AL3A 4WUVA 3X1DA 4B3SB 2Y1LA 4F1JA 3VPFA 3T4XA 2XYHA 5DHQA 2YC4C 3DV0A 1W36B 3UAGA 4DA0A 4L74A 4ZI7A 1J1IA 2BLLA 1N6IA 1YZQA 1YOBA 1EXWA 1LX7A 5CA0A 3HWSA 4ER5A 1KEVA 2NSJA 3R6GA 2ADOA 5KNDD 3DTNA 2BGMA 3FAKA 2Q4OA 4HDSA 2P4SA 1YR3A 3AI1A 4JUCA 4WGFA 1XMQB 2H1LA 3KSDO 5HMMA 3HVKA 1E0KA 2WMNB 2ZFUA 2FUNB 3HGMA 1PYDA 5MDHA 4D9KA 1Q3TA 2QUKA 2C57A 2H0RA 1JLLB 1N5RA 3LWDA 5D85A 2RHHA 4JBNA 3RDPA 4EEXA 4OHYA 2O5EA 2FCRA 3ABRB 2YYAA 1CPYA 4GH5A 5CFLA 3DE1X 1PNQA 1WB4A 3TI9A 4Q1EA 2R7MA 4DDWA 4LJ4A 1U7WA 1OBFO 3HKDA 3A31A 3G9UA 5FFFA 1AY0A 4X64B 2ZSBA 3GX1A 5GONB 1E2JA 1TVKB 1YRBA 5T4EA 4DIFA 1PQYA 3HNPA 4EAQA 2BMAA 4JI5B 4CKEA 2OFOA 4TTTS 4JOQA 3NQ41 3DWGA 4J91A 5KNDA 3SHWA 4LRXA 1OFGA 3I28A 3ZZMA 5HW0A 1X8JA 2O2ZA 1W5EA 1LVGA 2HIAA 3OFJA 5IC6A 2D5CA 1AHIA 4IV5A 3RAPR 2P9YA 1GQFA 2IT1A 2DE0X 3W1EA 4ZZ3A 5JXGA 1OV6A 4BQOA 3GH1A 4X60A 721PA 4X00A 4EOGA 3KT3A 1UCFA 3T9FA 3W78A 4ZMSA 1QO7A 2AIRA 1EB9A 2OBNA 3OA2A 2FH5B 4EB3A 2ID9A 1HYHA 3M3DA 2HTEA 2BCJQ 2FJ0A 2AQIA 3PKZA 1JJBA 4PLTA 5A71A 5IJZA 3ER8A 4GLJA 5GOZA 3AU9A 3GOQA 2GEVA 4H0FA 4BP3A 2BISA 2CL5A 3DQQA 3N3BC 3BSWA 2DTXA 4BLQA 4BU0A 5D5PA 3VO9A 4NZ9A 3KR0A 2X0DA 2A2ZA 2UUOA 3SR4A 5JLJA 1TCVA 3GEHA 3CLRD 4JBXA 3FVTA 2FQ1A 2MYPA 3RV4A 1OTYA 3D1LA 4MV7A 5DGCA 4YT4A 2IY9A 2ILTA 2D06A 3F98A 4R51A 1KWKA 1DOZA 2SCUB 3LOPA 2C2OA 2RFLA 2GK4A 2H1SA 4GP6A 1IB6A 1I94B 1J90A 3RRNA 1QH1A 3VU8A 4AUMA 7REQA 5J43A 4GKJB 3DE7X 4JX9A 4YECA 1DBRA 1A9QA 3QXJA 1EE1A 5LQUA 2PBZA 2BUCA 2OECA 2VFAA 3SPXA 4KLNA 3NBMA 3LO5A 4K9PA 3O2QB 3BEOA 5DASA 2HADA 3DFMA 2XH8A 2BKVA 4G4SO 5FOXA 4N12A 3K96A 1F3LA 2BTOA 5A03A 1U9IC 2JVJA 5E38A 1XIVA 2A9VA 2CFTA 1RW4A 1XYGA 3DTVA 3OTIA 3LH5A 4OG2A 1P6XA 3CLTD 2CJWB 5JMPA 6GPBA 1NNEA 1XHFA 1M8GA 1S3FA 1JNYA 2JCVA 2DSNA 3GDOA 3HFRA 3BTSA 4S1NA 3ZDQA 4MV5A 1CF2O 1U2EA 2QG6A 4MW5A 5JO0A 5KKCA 2W71A 2VQFB 4HH3C 3EPHA 1DDGA 2FSUA 4Q4DA 2V9ZA 4X8LA 1GR0A 3VR3D 3FVQA 3PWZA 4O08A 4WZZA 5CNJA 4DLUA 1M1NB 4U9IS 4OA8A 4PO1A 3QEKA 2J6CA 3I3SR 3OCVA 4R1LA 4L28A 3RWMB 1MX5A 3H5OA 1J5EB 2IU6A 4Y2TA 5CFZA 1FJ2A 4DMGA 3T3DA 3K5HA 1UPBA 3OCJA 1XB2A 4LRSB 1CUUA 3AEUB 3W4JA 3C7KA 1Z4OA 5EXSA 2QLFA 3VU9B 3I6MA 2ET6A 1FYFA 1Y9DA 3CLUC 4QUIA 4BPRA 4PG8A 4D26A 4IW3B 3MRTA 1K6MA 3MYYA 4C4RA 1KQOA 2ECFA 2X1LA 3ED5A 1WY7A 3OKCA 1E2KA 5ARBA 2CVZA 2GRJA 3VNVA 5DYIA 3PU6A 2IV7A 3VR3A 5JI3E 4DA7A 4EHKA 4LVUA 1BE8A 3IP9A 4D6PA 5T8KC 2I7CA 4NICA 4G6ZA 4P7GA 3RJMA 5B53A 1D2EA 2P9HA 2O52A 3ZDFA 1QTQA 5BV0A 2FMHA 4NBWA 5CB0A 4DIBA 4UUAA 1QYDA 3SDZA 1JIXA 2D8AA 3G2JA 2ZR0A 3KIPA 4YUAA 5JH7A 1N32B 1TZBA 5AVZA 4AZ0B 2OL4A 2YS6A 4DB4A 2C1XA 4FZVA 3I9LA 3TEMA 2OO3A 2H5EA 3UAYA 3GCGA 4DBVO 2PSEA 4XCXA 4YRPA 2GEJA 3Q0EA 1OXKB 1UT5A 1II8B 1WDTA 4DLNA 2BZ1A 5IVHA 2OHFA 3VFDA 2HQSA 3USES 2YQ4A 3O9MA 4WVLA 5K9ZA 1U7ZA 1X86B 2GM9A 3M34A 4TQAA 2FUKA 5LQCA 3LWZA 5FX2A 5AW5A 3ETHA 2G4VA 2ASVA 2RBKA 3WGYA 2ODWA 3ZEIA 2JLXA 2GTHA 4CEHB 3AY7A 2QYHA 1Q0ZA 2JFOA 2P0AA 1QFYA 4MKXA 1YNSA 1UAAA 3B2NA 2DFPA 4BJ6A 3BA1A 4QGAA 1Q0PA 3A3PA 1DC7A 4G24A 1I6MA 2H59A 2Y76A 2XT9A 2F59A 4D98A 1K2VN 1V0JA 4W8HA 5J5CA 2VUUA 4JB3A 5GM2A 1JSZA 3RFTA 1GKKA 3H1PA 1N0WA 1M5UA 1V41E 2CJYA 2DZDA 1YAJA 2X9GA 3NNNA 3R44A 4HQNA 4ZCSA 1YA4A 4EKDA 3PJEA 4I9UA 5G41A 3ZV5A 3AETB 2OD2A 3T9AA 4AZTA 1LNSA 3MHTA 3K20A 1QGUA 3D8SA 2R4TA 3PGXA 1BH6A 5L3VA 4CMEA 2EERA 4U2FA 1PFWA 5A4FS 1Y6FA 2GZAA 4UM7A 1LEHA 1GG9A 1UPAA 3STHA 3HY4A 2P6OA 1AQYA 1O8BA 3A3KA 4FX2A 4JENA 3RC9A 1BJRE 4MV8A 4ZAGA 3L7IA 3ZOZA 5IH7A 3EHDA 2P68A 3X2FA 3GT4A 2PAFA 4NR0A 3MMXA 4S1PA 4ZHQB 2ZSKA 2PYZA 4DLTA 1QDLB 3WIVA 2WSBA 2JCBA 4MGIR 2IOFK 5JRDS 5AVWA 5LQSA 1JG2A 1ODCA 3HB1A 4FYVA 5T6BA 4HUQB 3WL8A 3TLEA 4UUOA 5DK6A 3NHKA 5CD1A 4H7PA 2XZPA 4HEHA 4QFMA 3FI9A 3C15C 1U8TA 1XZQA 9GPBA 1JKIA 1WLYA 4CCYA 3SXUA 4F1KA 3ONNA 5BYBA 2A3RA 2R3SA 2GCOB 1EEHA 5ESWA 4Z1MD 5A3JA 1IU9A 1DAEA 1JKJA 5FHQA 3BWEA 3T8YA 2GBLC 4IM7A 1SCKA 5JWRA 4YFVA 3GO4A 4FFMA 1YULA 3LC0A 3RANA 5JXWA 3EXEA 4G0VA 3FZNA 2KS6A 1YQQA 2UYCA 2O8FA 1XELA 4NARA 3AERA 3F4KA 3WLSA 3DZCA 1B3BA 2XDQB 3P2MA 2PKYX 2WTEA 4M2LA 1SIWA 4ZT4A 1EDOA 2J4FA 1WZNA 1MX3A 2N75A 2QA5A 2VUIB 4FFVA 3GNSA 5DJ5A 3EXIA 1WKBA 2JLAA 4XWOA 2GYYA 5HJ2A 3ZCTA 1MOQA 3EXG1 1IHXA 1EA5A 2N0SA 4RSMA 4WFQA 3E18A 4PSVA 3U1VA 3WY9A 3MLEA 4UKDA 2HZ7A 3Q9SA 2AFVA 4MUBA 4EHJA 4GL2A 4Z1MA 1ZHFA 1RKBA 1J2TA 3RJZA 1C14A 3Q7QA 1CLUA 2B1RA 2IZ5A 1SC1A 1U0SY 1UC5B 2A7QA 3QVTA 1MCZA 4KLRA 4PLHA 3OIDA 3R2JA 3VZQA 4AQ7A 3RC2A 1EDBA 2VF5X 4N0DA 5G4LA 4F86A 1UH5A 4QDXA 3WRVA 1FTQA 2YV2A 4R8KA 3V4FA 1FW6A 3LCVB 2JGIA 2V5VA 1KVUA 4MP8A 4DTIA 3JAMA 4R0MA 4P3YA 3IPYA 4E3ZA 3NHLA 5DGDA 1WB5A 2ZCUA 3JYNA 2D1SA 3KELA 5HRCA 1OFVA 4OK5A 4X54A 2EFGA 1KDOA 1YFKA 4UMDA 3IESA 5AXAA 1KEPA 1XDUA 3VPGA 1MMFB 2AG8A 1Y8QA 4MMZB 1LPPA 2C4NA 2H9YA 4G37A 5DI3B 4MWBA 3V1KA 3W7AA 1U11A 1BZYA 4NCHA 3ROMA 2YXEA 1JDNA 2Q2OA 4EPRA 1EJ6A 1PR4A 1R4NA 4XM1A 1MW9X 4FFBA 4N7BA 3ZS8A 4KBYA 3ZU3A 4HT3B 3RNLA 1Q16A 4YBRA 3RV3A 2XE4A 1U7DA 1XXLA 5CURA 5H3CA 8OHMA 3WFJA 4OQPA 1W5AA 2C99A 2G5GX 3SQWA 1X7WA 1HEIA 4D1YA 3RFUA 5ALFA 4UFPA 3VOSA 4KGZA 3KUXA 3C14C 2FWBA 3H3FA 2J5XA 4QAJA 2PUCA 1OU4A 1NURA 3CINA 3A4MA 4OREX 2E6KA 1GU1A 4WMLA 2BMJA 2QLTA 4MQBA 3G1TA 1A4XA 2VA9A 5I7WA 3K32A 1UJ4A 1Y1LA 3EA4A 5AYVA 3BK2A 4YJ2B 2AI1A 4F2GA 1BX1A 5AHKA 1KQ3A 2C4VA 3FSGD 4PY2A 1BGXT 2FG6C 1L5WA 5EKDA 3V1UA 1G17A 2F43B 3I32A 8ATCA 1EHCA 1KFBB 2NT3A 2RGXA 5AOBA 1MU0A 1WDLA 2F67A 4H9GA 1I3OA 3DVAB 3KKZA 1DI0A 2QL6A 4G0NA 3SLKA 1SXJD 1WVMA 4QQFA 2V96A 1EWQA 3T7AA 5FF9A 3CZCA 3ZDYB 1YRLA 3G17A 1XRSB 4AAYA 4PPGA 4Q5IA 5JTTA 4C7KA 2BSQA 2LCIA 3OE5A 3D0RA 4E5MA 5LOVB 4RGBA 4NSNA 3WLQA 3W7VA 2B8WA 5FOUA 1VL8A 4C2UA 4KO1S 1H4VB 1XA0A 1E60A 1WHSB 2FLKA 2QMEA 3M0EA 3PNPA 4WK6A 3BWDD 4YRJA 4PHCA 2BAGA 3A6DA 3L0PA 1FQJA 4GI1A 5FOWA 5G1OA 1RHJA 3TTWA 2D5LA 5KYGA 1W46A 4M6WB 2E89A 4RDIA 1BMTA 2V0CA 1DU4A 3FSGA 3OJCA 5K8TA 2VOEA 4EQ6A 1RLJA 5C35A 2C5GA 2O3UA 5AI0A 1M2VA 4QXQA 4EA6A 5CCXA 4W6QA 3RG8A 4JLJA 3SNHA 1SXJA 4UREA 2CXQA 3H9BA 4YO7A 5JS2A 4OI0A 1JHXA 1E9RA 1ZJZA 4H7FA 2ORVA 3IVRA 4HYEA 4PU0A 4ZGWA 1GRQA 1IHOA 3DJYA 4CF4A 3OHSX 5MN6A 1W94A 1OREA 1Z6YA 5HTKA 4NCAA 3ZUPA 3BAFA 1I14A 4E5KA 3CUEF 3H5TA 5AW2A 2IF0A 1Z6ZA 2GK7A 1NYTA 1ZFNA 3L7JA 5D3MB 2QV0A 1P0CA 3EUFA 2WYIA 2REOA 3UJ3X 1N3IA 1X7YB 3W5CA 1RI2A 3KBBA 3RS4A 1GPAA 1V7QA 2BCGY 3GYBA 3TOSA 2CY0A 3TUIC 3ZHTA 4B44A 2W4IA 1Z6PA 1JDJA 4UTPA 4UW9A 4F7DA 5D2CA 2PG3A 1JEYA 5C8DA 3CVYA 3HJGA 3NWEA 1RYEA 4UNSA 1WMDA 3A4LA 4MKRA 3ZJUA 3WJAA 2BEWB 3B13B 4RAOA 3I1YA 5CIWA 4CKCB 3E5MA 1R64A 1AGNA 1EWRA 3GA5A 2SNIE 5CH5A 1FZQA 3OWOA 4BNDA 2R7LA 1Z62A 3ZN2A 1CYEA 1LX6A 2PUJA 2FWNA 2C7RA 1IHPA 1GPDG 2JEOA 4LXXA 1NDQA 3F9RA 5C18A 2E3JA 1WXWA 3U39A 1R5OA 5T3UA 5J4VA 3IT1A 4QICA 4XVRA 1PT7A 4HNQA 1FZTA 1CHNA 3QKSA 2J45A 2JLSA 4ARZA 2HA7A 5TGZA 3KLBA 4C08A 3QY0A 1E5TA 3EEIA 2C9MA 4HLNA 4ZIRA 4O4JF 1OTHA 1XJ5A 1NA5A 1H6DA 1II0A 4E15A 1DXOA 3MYRA 4WIAA 4K40A 3BFXA 2OCIA 4V02A 3LY5A 4QM7A 2VKTA 1ZLXA 3QUQA 1L5LA 1LU9A 2H6EA 3RJ9A 3ZW7A 4AMBA 1EWYA 4UJ5A 2CCGA 4MYSA 4MW9A 5CGZA 3WYAA 4PNZA 1XNQB 3DO8A 3EUAA 2ZR7A 1OX6A 1Q77A 3O21A 4EG8A 2PMEA 4LRTB 4DEXA 1X1BA 4DNFA 1USGA 3UUWA 2W8BA 4M9SA 1QIHA 3BGSA 3YASA 3NT5A 3U37A 4C4YA 2B2XA 5HBGA 1K7EB 5LA6B 5DHFA 5JY1A 1G8GA 5L6LB 1IZYA 2J3HA 4UU0A 1M6VA 3FCUB 3IDAA 4HRVA 1CUCA 2C1EA 3F9CA 3NXKA 1JDBB 3BILA 3CUWA 2VF2A 4LBWA 4OUKX 3Q7SA 1U8YA 3OT4A 1NMYA 2NACA 1C9NA 1L7XA 2HFKA 4IWNA 5F7JA 2NXCA 3VC7A 4AO6A 4CQJA 5BV2P 3CURA 2NUTA 3OH8A 1PL7A 1TO1E 2P67A 2VHCA 3LCRA 1IPHA 4GF5A 3FTEA 4E4TA 1L6RA 2JRCA 2V6GA 2VWPA 1W85B 3QQPA 3M6IA 1KZYC 2HU5A 4I3GA 4NESA 5AO9A 2C2ZA 2FW0A 3WNQA 1YB5A 2H57A 3KQLA 2M98A 2WLSA 3E3OA 4MQEA 4PYRA 4MRSA 3S81A 5BXQC 3EZYA 4PBTA 2GLUA 2Z56A 1X70A 4KVFA 1T35A 1E2FA 1IOLA 1ST2A 4TKLA 3W6NA 3AKDA 2JFQA 1GNRA 1O5IA 2PS1A 3BIWA 2R1UA 3MD9A 1BE1A 3E22B 1GAQA 3ONWA 3QBDA 4KK4A 3CF2A 1LF5A 1QTIA 3BPSA 3EDYA 4ZAWA 3SBEA 1QIJA 1DWQA 1RBYA 2WAXA 4GQBA 3H4IA 3QLEA 3WHKA 1UOEA 4BN5A 4B4KA 3OU2A 4IIYA 4OSEA 1GCAA 1LK7A 1P0FA 1YR8A 1Y7HA 3AR3A 1VG9B 3DLHA 3AB7A 1MC1A 2Y0BA 2QUHA 2P2CA 4E46A 5F7OA 1B23P 1U3VA 5ECWA 3HP4A 1YSCA 1ZRSA 1YS2X 2J3KA 3A1WA 1W0CA 1IQUA 1ISGA 1QORA 1YMQA 3E9DA 2DB3A 1TK9A 2JGNA 2ZOSA 2WF7A 5EGNA 3ZXXA 3BORA 4UHKA 2C2KA 5J23A 4BVBA 4LBYA 4ER0A 3R6LA 5SY6A 5LDGA 3F6RA 2W22A 3NYRA 5BN3A 2GPAA 4YDQA 2HCJB 1VP3A 1JZTA 2H0QA 5I7HA 1ZOPA 3U3OA 1KY2A 2JBAA 4ZOAA 3CSUA 4GUAA 1JT2A 4PFJA 1Z0FA 4C87A 4BVEA 3SN6A 1KBOA 3BMCB 1QWOA 1VL5A 4PYQA 4TYWA 2HRQA 2ODTX 3DKKA 3BAZA 4FVTA 4YB8A 5BRNA 1Y1PA 4JC5A 4BNIA 1F12A 4AB1A 1N0HA 3A27A 2QGFA 5L95A 1H6BA 1JRLA 3Q11A 3SIWA 1FEZA 1ODFA 4J49A 1TUBA 5C8YF 3B82A 4AICA 2KLHA 1P3JA 2PO5A 2WTXA 5GGXA 2FSIA 2XA1A 3DQZA 5FEUA 1BGVA 2ZDQA 1JX6A 3ELDA 4MR9B 3PF8A 4Q15A 5BR1A 3PC8A 4ZI7B 2XF2A 3S0JA 1SUAA 3ANYB 4RK5A 4Y1RB 1GGJA 1MZVA 1NJ1A 5B64A 5I7EA 2EYUA 2XA2A 1ZL2A 1WZIA 3L0IB 5LKAA 4EL5A 5K3OA 2QX8A 3BTVA 4I14A 5JHHB 1QPGA 1U1IA 2H1VA 4LQ4A 4LY9A 1NNI1 4NJEA 2H1FA 3KXKA 4KQEA 3ID6C 1PBTA 1UEXC 3IB6A 1NW8A 2YY6A 3HXLA 3IBTA 2WI8A 4FBGA 4L57A 4RZQA 3WGNA 3ZWQA 2ERYA 3S29A 3F8WA 2G88A 2GRUA 1SELA 3WHIA 3I5MA 1R27A 2A5DA 4NYJQ 1TJYA 5DNDA 5KWVA 3A4IA 1M6NA 1TVEA 5JSYA 4D9JA 3KWJA 1IVNA 4N03A 4O2AA 4ENRA 5JCXA 1DL5A 4PCLA 2F1RA 1HFWA 3K2IA 3M1LA 4UBJA 3RVLA 2DUMA 1G3QA 3EIHA 2D59A 4QZVA 2VP3A 1E1CA 2ZJOA 2ETXA 3R7SA 4EG0A 5ALLA 3ISJA 4J29A 2A4MA 5GZ6A 1YS4A 2MYUA 2IHBA 3M6VA 2AFIA 3I05A 1EESA 2RHLA 1TA9A 4QUEA 4QSHA 3LQ1A 5DSXA 1XZCA 5DWDA 1DXHA 1KYZA 3HZOA 2JCSA 3LVQE 1XFDA 2EEZA 3M83A