3RPBA

The c2b-domain of rabphilin: structural variations in a janus-faced domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
140
structure length
140
Chain Sequence
RGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Janus-faced C2B domain of rabphilin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords RABPHILIN 3-A
total genus 21
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3rpbA00
1BDYA 4G11A 4F91B 3IM1A 2WXGA 3F04A 4FJZA 2YRBA 3CSFA 4LCVA 3DBSA 5G2NA 4XZ4A 4JPSA 5JHBA 3IBEA 4L1LA 4WWOA 1DSYA 2BWQA 4J6IA 4MJJA 4GNKB 4NPJA 4ANXA 1E90A 4BGDA 2FJUB 1HE8A 2ENPA 2WXKA 3QAQA 4FLHA 3PRZA 4OVVA 2WXIA 4WEEA 3RPBA 5EDSA 2YOAA 1K5WA 4FHJA 3L16A 2A4ZA 3ZW3A 2Z0UA 4PS3A 1BYNA 1E8YA 1DJZA 2DMHA 4AOFA 1RH8A 1TJXA 4ANVA 4IQHA 3PYCA 3CSTA 1E8ZA 4ICXA 1RSYA 4Y1SA 1WFJA 3T8MA 5CCJA 1UOWA 2WXQA 3L17A 4FULA 3QK0A 4KZCA 4TUUA 4L2YA 4QJ4B 2NSQA 2CHZA 1WFMA 2Y3AA 3NSJA 1V27A 3QR0A 1DJXA 2WXHA 3ZVVA 1DQVA 3HHMA 2B3RA 5H4YA 5CCHE 4DNLA 2CM6A 2CJTA 3HIZA 3FDWA 3M7FB 2QZQA 2WXJA 1UGKA 3L54A 4WWNA 1CJYA 2Q3XA 3B7YA 2Q0ZX 3N5AA 1W15A 2UZPA 3P2BA 2NCEA 3ZIMA 4FJYA 4TS6A 3KWUA 1BCIA 4PS7A 4V11A 4LT7A 3LJ3A 2WXMA 2DMGA 1DJWA 5G55A 4ANWA 4F93B 2NQ3A 4FHKA 1UOVA 4IHBA 3QR1A 1DJGA 3R7RA 4QJ5B 2K3HA 2FK9A 2RD0A 4EZJA 5T8IA 2CHWA 4QJ3B 3GPEA 5JHAA 1E7VA 3APCA 3F01A 4LDCA 2D8KA 4OVUA 4XX5A 4AJWA 3OAWA 2WXFA 3L08A 3NZUA 4NS0A 4F92B 1TJMA 3APFA 1DJIA 2WXNA 1GMIA 4ICWA 3TL5A 4A55A 3OHMB 4KITB 1W16A 2WXRA 4GB9A 3HN8A 4Y1TA 4WWPA 3W56A 1RLWA 4F1SA 3QARA 3W57A 3MJWA 4NP9A 2ENQA 3F00A 5KJ7E 4EZKA 4HLEA 4QAMB 2ENJA 2CM5A 2V4LA 3KWTA 2K45A 3FBKA 1QASA 2KI6A 2N1TE 3JZYA 4ANUA 2ZKMX 4BFRA 3L4CA 4DK5A 2WXPA 4EZLA 3RDJA 3ML8A 3NZSA 4FA6A 1E8WA 2A5UA 2K4AA 4HVBA 3DPDA 4WAFA 2JQZA 3R7QA 3ENEA 4FADA 1YRKA 2CHXA 4L1BA 2ISDA 1E8XA 3TWYA 2CJSA 3F05A 4TV3A 4XE0A 3TJPA 3PREA 3APDA 3ML9A 2R83A 2WXOA 4NPKA 2EP6A 4PS8A 3L13A 2K8MA 2QZ5A 2X38A 2WXLA 1E7UA 3PS6A 1DJYA 3QJZA 3SD5A 3PFQA 4L23A 3L9BA 4KZ0A 2CHDA 4URKA 1A25A 1DJHA 2LHAA 5H4ZA 1QATA 3S2AA 5CCGE
chains in the Genus database with same CATH superfamily
4BM7A 4IDJL 5KSVA 4J4PD 1TZOA 5I30L 2HKHH 4FFYA 1NL0H 2VC2L 4XCFH 5DMKA 3ARPA 3G6DH 2NZIA 2EZ0D 3GSXA 4LO9A 2VLRA 3ZIYA 3SDXE 1U95A 1AS6A 3QULA 4BSVB 2ATAA 3E1F1 4PD4J 2Z92B 4HEPA 4U2YA 1PZ5B 4TSAH 1EZVX 5GRUH 3TN0D 4FQPA 3FSZA 4OZHA 3I2CL 2COVD 3OAYK 3X13A 2K6YA 1XGQB 2JJUA 3DA0A 5DSCA 3OKLB 3FOMA 4JG0L 4R3SA 3VA6A 4RBPH 2Y0SA 4N28A 2YAPA 4FI8A 1KTLB 5H37G 5F6IC 3I3BA 4JRYD 1MY7A 3HNSH 4YHIB 5ESAA 3HZ3A 3U9PH 4Y4FB 4JKNA 1PZSA 1HKLH 2MKLC 2WXJA 4G6AC 4M5ZL 4BKSC 1RIHL 4IEFB 5A2CA 2R9HD 1PZCA 1BVKB 2CK2A 2EXWD 2CU9A 2FX9L 2F7QA 3CDCA 4P46D 4P2CG 2VUYA 4UT7L 4LXFA 5AYQA 3TT3H 4P23A 1CFNA 3DHPA 1F56A 1J0HA 1Y18B 5F7NC 3Q5TA 1R5VB 4R7LA 3T4YA 1V3JA 3LPWA 2VABB 2KPNA 5FXCH 1P1ZA 2BZCA 3HS9A 4MDIA 1HYSC 3AWFA 3QZOA 3IN0A 3A4EA 4PJEF 5G4MA 5AENA 4NKDB 3BT2L 4Y4HA 2DLTA 4FYRA 3PUUA 1UYWL 3IJ8A 4F92B 1W2KT 5D70H 1KJ2L 1HHJA 3I6KB 5GJTL 2ITFA 3KGRA 4UM8B 3US1A 4YMPA 2HKAA 2PYFA 1EAQA 1SBBA 3KH3A 4RMUA 1XAUA 4PIRF 4N2KA 1I1RA 2GCYA 1BM3L 1OT1A 4FNLH 5DD5H 2EAEA 5E9DE 3WHE1 1CC3A 1PZ3A 1BWWA 3H4FA 1AYRA 2CO2A 5FK9B 3QXWA 5LG6A 5J13B 4G8IA 3DTXB 5IVZA 5F9OH 1JUFA 5C08E 3WS3B 3FUEA 5LG1A 1IQWL 1JNLL 1YMHB 5TQ2H 2VXTL 1KLGA 1JGLL 3BAJA 5IVXA 5KSUB 3OM3B 5F96L 2Y25A 4KY2A 3N55A 3SDCC 1DN0B 1DJYA 4N2NA 5HYEA 2YEZA 1JZ7A 3RDTB 4MA3B 1N59A 1ZGLM 2BNRB 3A21A 5IFAH 1NCDH 5I17B 3LY6A 2ORBH 4Z6AT 2GTQA 4YHYB 4Z78B 3MV8D 1OF0A 4K7PL 3LD8B 1VRSA 1S3KH 2DDQL 3FCGA 2YFNA 3L5WA 4P07A 4AQZA 4JQVC 1FG2B 1D6VL 2HFFB 2CLZA 2OJEA 2DWEA 3ZKXC 1GTFA 4BK4A 1DE4A 3UBXI 4PRIB 2OI9C 4Y16D 2DMHA 3TS8A 4YDNA 3WHE0 4ZD3H 1YEKL 4KDTC 4YZWA 2R1WA 4LRNL 4G7YL 3TVMB 4LLVA 5J12C 4QOKA 3OLDA 4FC3E 5AOIA 5HD8C 1I9RL 4KHTH 1K3ZA 5D9SB 2IG2H 3KPNA 1TG8A 4XOEA 4Q58C 3T2PA 3Q6FB 5FIEA 3THMH 4AV4A 4NLHA 1MWOA 1DQVA 1VKXA 3MRPA 3AS0A 3RVTC 3GEFA 4GIAA 1IC7H 2JELH 3H3BC 4KKLD 4N6QA 4LVNC 1MFDH 1U4FA 4L8CA 2CBOA 1YEWA 2VJ0A 1TPXC 3PNWB 3VTTA 4DH2A 5CJOH 4KKAC 3EZJB 4PJ9A 2WWOA 2VDML 4NQXB 2WN2A 1I9EA 4ZOEA 2GIYA 2H32A 5AZ2L 2XZQH 2B77A 3ZE0F 2WZPD 5JHDB 4NC1C 3RIAK 4YXLL 1VPOL 3BH8B 1S7SB 2ZX9A 1M7IB 3GM8A 3MREA 3O41B 4HIQA 5BS0B 5BUGA 2ICEA 1RUAH 5I1IH 2G75B 2GTZB 2LE9A 2YKLH 5AOJA 4EDWL 1F4XL 3EHBD 3GO1H 3AG4B 4L4VB 1OE1A 1MPAL 4Q0XL 1QBLH 2OSLA 3ATBA 4MS8D 3PWPB 2GBTA 3ZRCC 4AC2A 5HYSA 2LVCA 5I2IA 3L5XH 3T0VA 2WSKA 2V8LA 5D1XA 5FYKH 4Y19D 2PUQT 2UY6B 3MRFB 5A1AA 5IUCA 5AUMA 1EEQA 3QA3A 3BXNB 1NINA 1OGTA 2G4EA 2TSBA 1SM3H 5JQ6L 2QEJA 5B3NA 2SODB 3LXAA 2L8AA 4XVOA 5L2JB 4AZ8A 3BRGC 1Q8MA 2IV8A 2ZX8A 3ARGC 3MYZA 4LASL 3X3GL 2IAMA 1IGTB 1XGYL 4JPIB 4MMXB 1U3YA 1FHGA 4JM2D 2HVBA 2MCMA 1FVDB 4OLWH 1UHVA 3G6AA 1NLDH 5I8CB 5HDQH 2WAHA 3DX6B 1V3LA 3FONA 3FH7A 3QDHA 4P4KC 5F7BA 4NPKA 4YHLH 1H0DB 3L1OH 4KTEH 3KBHE 4NYLA 3PWPD 4H20L 1HHHB 3PFUA 3EOBA 2ADGA 4XCCH 1DQML 1AZRA 3TNMA 3GK8H 3OKEB 1OP3K 4CMMA 4JAMB 1KB5H 5I0VA 3VXRB 3FQYA 3C6LB 1VESA 1WWBX 1HQ4B 2C26A 1N8ZA 2X44D 4HSAC 3BUIA 4ZW6A 3RWEA 3ZT6A 3N1MC 1CU4H 2PO6C 1REIA 2NY2B 2AEQH 2AXGA 3IMTA 4U49A 4YWGL 2H6PA 4IKNA 3MBWB 3S88H 1SXBA 5K33A 3VD7A 2EIEA 5HI3D 3JWDL 1I8IB 1U91B 4PJIA 4AGLA 3R1GH 5K9KA 3Q2LA 2WD0A 3U6XA 4JFSA 1KJ3H 1XMEB 2X4UB 2AAVA 4ZUWA 3AROA 5GGTH 2AZAA 4UZSA 4K71B 3MYJB 1EGJL 4OIIH 4PRPE 5TFSH 4NOFA 4WRLA 3L81A 2J8UF 1RUQH 5AAPA 3NIGF 3S96B 3D0VB 5I16A 2WQWA 1E43A 2V0AA 2OM5A 5ESQA 5E1GA 4G9DB 4Y19E 4HIJA 5LQBH 1BZQK 3FC8A 4J3BA 1MRCL 2FATH 1OZUA 3B4NA 5KS9E 1UA6H 2Z91B 3GB7A 1KXHA 3QZNA 2OYLA 2HJLB 1JYNA 1M7XA 2MNJB 1BQHG 3OXRB 2FO1A 4BSJA 3LRSA 1YN7A 1TEGA 2VKWA 3MRQA 4QPEA 5FFOA 2BVPA 2E7LA 3DJZA 3WFEH 2P47B 1FN4B 4KH9A 1S9WA 2ICWA 2EE3A 1YG9A 3EUUA 3APCA 2VN6A 1NGWA 4MAUH 4OCWH 3OHXA 4MQSB 3GUFA 4YPGA 3NJFA 3PJSA 4G7RB 1XXFC 1AR1C 1L0PA 5F1SA 4ZOBA 4DAGL 3TBYB 1OB1B 2BOLA 3DO7B 1QA9A 2WYIA 3T8VA 4UMGA 3JTTA 3OKMA 3W2DL 5EO0B 3U9UA 1G7QA 4M62L 4ZPVB 4IDLA 3DV4A 4A2DA 3TBBA 5FDYA 5L4JA 4O2FA 1B0RA 1WFNA 3WE6B 3AXIA 2B7DT 4HWUA 4QAWA 1MI5E 1GCFA 4NNXB 5L4IA 2ESVE 3GJFA 1CYXA 4EI5D 1BFOB 3OKYA 4XRCB 3X1EA 3C5XA 4OUUA 1KPUA 4Z7VF 5GRVK 5BMFL 5MI0C 4UDTB 5EOQL 1I1AD 3FNKA 2DQIH 1Y18A 2YZ8A 3CUPB 1QSFA 2Q7YA 3N91A 3SPGA 2EVGA 4KNQA 3HC3L 2V7NA 1P0SE 5IHBA 2Z8WC 5C0AE 3ZHDA 3GLEA 4M29A 5ICXB 4XZ4A 4YHPA 4BHUI 2JJSC 4MXWH 3BQVA 2XQBH 4Z7IA 2JIXD 2DF3A 4MNQB 1DSFH 2HT2C 3L3KB 1J88A 2VXQH 1TENA 2JKLA 4KGLA 4N0FA 3V10A 2P8LA 4FLRA 4QYAA 5GSRA 5H37H 3G6JF 4LAQL 1OL0A 1F6AB 2ZKHL 4MMZB 4RFOH 2EDQA 5IF0B 3VYNA 4JFZH 4ZNCD 4WF7A 3TEYA 3RDTA 3GI9H 1A1OB 1N59B 3EJZD 1BMZA 2FGWH 3BP7A 3H3PL 4LSQL 4NRXA 3ZW3A 5HHOA 3QQDB 3GSXB 4JFFB 2GG1A 3IE9A 2DQTL 1NA8A 1T03H 3MODL 1EAPB 4NQUA 4NZUH 1RSYA 4WUKL 1DLFH 2K78A 2WO3B 1EHAA 3FU5A 4NZDA 1R5WB 1UJ3B 3V0AC 4LGSB 3L5IA 4JM2B 4DUXA 3QUKA 2MNWA 1CD1A 1XGPA 4QCIB 1QLRB 1IL1A 3ZR5A 2N7AA 5F6HJ 3VGHA 1GAFL 3T2QA 2A6IB 4K3EH 5C0IB 2QZQA 4WJ5B 4NOBA 4WZ9A 3KW7A 1VFBA 5DJCB 2Q86B 3MUGB 5F7EH 3TCXA 5TK4A 2ZYRA 1OPGH 2I9TA 3BKYL 3EH1A 5FUCE 3LJ3A 1YY9C 2M8XA 2BP0B 5DLLA 2WZ0A 4V1DB 1FVCB 2Q10A 2FWLB 4NWUL 4AYSA 1TZGH 3AQYA 3SGJA 2AJYL 5D93B 4BZYA 1L9RA 4CBZA 3P2TA 3FUKA 4FMVA 2W92A 2CBPA 2VABA 2GSIB 3HBPA 3PQYD 1HL5A 1U92A 2ZUQB 2IFFL 4KK8C 1DLHA 5J89A 2BRRH 2BIMA 2KLSA 1LXMA 1FNFA 2O5XL 2BS9A 5D1ZC 1XIWB 2AQQA 5HYJB 4LLVB 5ID1B 4QRSA 3U7AA 3T0AA 3Q5YA 1TU2B 4NQVA 4NZTL 3FSAA 5DK0A 1EUUA 2VR5A 4FYSA 5C07E 2OCJA 1V54B 2DEWX 4IIQB 2GTZA 2ENYA 5E70A 4WO4D 4L4VA 3LEVH 1AGFB 4EE2A 2NX5E 1TZHA 2K4WA 1G1YA 3SDDD 1CG9B 1MVFA 1N0XL 1R4XA 2W59A 3QYCA 2OL3B 4KZDL 3KLSA 4OF6A 4EIGB 1GGIH 4OQTL 1MLBB 4G9FB 5EUOB 5AUMB 2KDYA 3MMEA 1JZGA 3MV11 4QUOA 1CTMA 3TJPA 5I6XC 4XAWH 3QDJD 3L48A 4OBSA 4W9ZA 3WO3B 2AJSL 3D0AA 4Z7VB 4AITA 2VQUA 4FFWC 1I85C 4QY8B 5ENWB 4NC2B 3WJJC 2PYED 1BECA 4LSSL 4L23A 4LQ1A 3RP1A 4K5PA 1D5ZB 3L8QA 3HNVL 4UWQB 3MLVL 1X6NA 4KHXL 4Y5YB 2WUBH 1IGTA 1Q90A 2YEQA 3F04A 4MXQD 4W4OA 4FGMA 4HUWA 4QRBA 1RUMH 5EEVA 4MJHA 2EIMB 1EFQA 1PLGH 5AOKA 4IU3B 4L9LC 1HT6A 1DUYA 4GAGH 4PP2B 3WV0A 5K9QI 1FNLA 5DEJA 1A1MA 4WEBL 3QEGL 2FCBA 1K5WA 3R8BB 4A6YA 3NCJL 2MCG1 4FFWD 2QPSA 4HQQH 3O6LL 2YRLA 4M61A 3RU8H 1AS8A 3O81A 4CMMB 2XWEA 4M8QA 3EOYG 1JPFA 4H8WL 1N67A 4UV4L 3OJDB 3CH1A 4ICXA 5T1KD 3CNKA 2DV6A 1BF8A 4A7QA 3B7SA 2XCMC 3OAYH 4YE0A 1T4WA 2XC8A 4QJ4B 3V8CA 2H9GA 3CH8A 2FR4B 3QR0A 1F41A 1JNHB 1E4XH 2PPFA 3IT8D 2UZXA 3AFLA 3LN4B 1NDGB 4URTB 3UIYA 1X9QA 3IMVA 2ITCB 4CMHB 2VAJA 2Q0ZX 5FCUH 1W6LA 4JFYA 3GRGA 5ESVA 5HPMA 3GJFK 4UYPA 5T1MB 4U4BA 2GIXA 2VXSH 3MRKB 4P57A 2VDLH 5C7XL 4XNMB 4F58L 2NQ3A 3HUJF 4LMQE 4OIFA 1EXUB 1ZLVH 4BZ1A 5H8DA 1TITA 3X14B 4KTDH 5DLML 4D94A 1NIBA 3VFSB 1Y0LA 5D7LE 3HHSB 1MRDH 3QCTL 4U1LA 4HPOH 2G0KA 3CFKA 4N0YL 5DDHA 4HXBL 2Z91A 1HXMB 4HIEB 2BVYA 4RGND 3RAJH 3RUGE 1S7SA 3WJMA 1KCUL 3RLSA 3T6ZA 4TULH 3BEWA 3FPXA 1MIEL 4AK1A 1OB0A 3KVDD 3S34L 4MQXC 4X8JA 4HOMA 1N3NA 4OU3A 5B1JC 4E2OA 5GJSH 2COQA 3NTCL 2BNQA 3PWLB 2B2XL 4R4FH 1JHKL 3TV3H 3ALPA 5J1SC 3NZSA 3O2VL 1VIWA 2FUQA 1A8ZA 2BIIA 2NY7H 2DH2A 1FZOA 2OCCB 4PV1C 4APQA 4WKZB 1IZJA 2CO6B 2I9LB 2YA2A 1IJNA 4CU7A 5DR5L 1O75A 2WJ5A 2I27N 2ISDA 5HDOA 3L9EA 4QLRA 4WFFE 4XTRD 3MUUA 5DHVA 3QYMA 2WXOA 4YXKL 3VFOB 5L7XL 1CLYH 2EKJA 1MCFA 4X8CA 1KIUA 3G6AB 4V1DD 4LLUA 1YAIA 2F7PA 4LDLB 3U1QA 1J5HA 1JS4A 4WGVB 3AUVA 3TBWB 3MACH 3SCMB 2J6WA 2CUAA 5DYFA 2OMWA 1TZIB 2YXMA 3ARBA 3JWNH 3RPIB 3KVPA 4K3DH 2CRYA 5KBNC 1JZFA 1QHOA 5DS1A 2EH8L 5FS5A 4ODXA 3SE4A 1IM3A 4F37K 1XIWD 3BFOA 1P84J 1SDDB 4HKBB 4FQJH 3UACA 5AOLA 4BZ2L 4YHPB 5J0BA 1E67A 3FAXA 1G7QB 2VDKB 3V0DA 5FDWB 3BI9X 5EFIB 3UFIA 2Y1ZA 5IY5B 4J39A 3L4WA 3O3BB 2JLPA 1GHFL 3O8XA 1FUNA 3I6LE 3SZKC 4UT9A 1RK7A 1I7RB 1F11B 3DRQB 5DGQA 4LIQE 1QPKA 3U9PL 3SKNA 2BSEA 1MELA 1R3JB 4U6VH 4XRCA 3T3PB 1RZFL 1H3VA 3VGGA 3DUSA 3MC0A 5DVLA 4HUUA 4IRJB 4K94C 3L5XL 4M7ZC 4U7MA 4RWYL 3FU3A 3VCLB 2EIZB 1F8TL 5C0DB 1EUTA 3M46A 1D5MA 1T2JA 2CSPA 4C83A 1VHPA 4PW3A 3IDYB 2UZPA 2IBZY 4TSBL 2F1AA 3U46A 2XI9A 2NYYC 4NO2B 1IKNA 2GAZB 3F7VA 3JYCA 4UT9H 4LT7A 1DVFB 3FYEB 3H2WA 4LB8A 1I1CA 1FRGL 3GS0A 1XZ0A 4KTGA 1XGYH 4XVJH 5I5JA 3EYQC 5EZIL 3WGUB 2K6ZA 2ZWLT 1ZANL 3QORC 4JG1H 1L6PA 4W4OC 3ZKND 4QO1B 4MX7A 3ZSTA 5T1JA 2YIHA 3DO3A 2V9RA 1QEWB 1J0IA 3ULVF 5MP6H 3F7LA 1EO8H 3QZLA 1YN7B 4R7NB 1LGVA 2BVUA 4AM0A 1VENA 3FFCD 4NQCE 3LZQA 5L9DH 4N1HB 1GC1L 5EO1A 3TO2A 1HHGB 4PAZA 1M6OA 1GZPB 2I85A 5DXWA 2VZ3A 3VU1A 1G9NL 1S7TA 2PCFA 4XPAL 1CFBA 1R5WA 3G7TA 4LPXA 1R3LA 2OR9H 1F1AA 1WA0X 5DEFB 5TE7L 4K3HA 1NGQL 5SV4A 1OGPA 3KCPB 4Y4FD 2GSIA 2GY7B 3K72A 5SWZB 3DMMD 2ZWZA 1XB6A 4JHWL 1CICA 1EDYA 4N0UA 2A6IA 3OKMB 5C0IA 1C5BL 1HXYA 1JPST 5CU9A 5C3IA 2CCWA 5GGQL 1J86A 4UF7C 5B1BB 3FU9A 5T1KA 3NJMA 4U6HA 4UNUA 2UZIL 1LO4H 2Z7ZA 5I8KL 2I9TB 2JTYA 4H40A 2BSDA 1BQHA 4GO8A 1DANU 3UYPA 4RDQG 2ZAGA 3V2AR 1X5XA 1HZKA 3GNMH 1C5DB 5IK3A 3UJTH 5HGDB 1CTNA 3VXSE 4CKQA 4PJEB 1U36A 2OL3A 2QQQA 1UXSA 1RK0A 1NSNH 2QKIA 1JI2A 2V7NB 4X50A 2H3NB 5D1QC 1DDHA 5SWZD 3KPMB 4TUKH 2NY5H 2XUWA 2EABA 4C4BA 3QNZA 3HZVA 2FJHA 2VSKB 3TPUB 3HRZA 5BZDB 3OJ2C 1Y6MR 4AIZB 2A0LD 3ZE1F 4FTVA 5KYUA 5E2UH 3FW6A 1N64H 5CIPH 2DM7A 4FRWA 1GJWA 3ARBD 2BY1A 2JCCB 1OY3B 3T77A 1EPFA 3Q1SH 1BOYA 4H20H 4ZNEA 3S35X 2IG2L 4AENA 3V4VB 3MRJB 1YZZA 2Z1PA 5F7DB 1CG9A 1J7VR 1F18A 1JV2A 3L17A 4I13B 4CN1A 1VGKB 3FB7B 1MZYA 3TO4D 4C8XA 1P6WA 1JZ3A 3OZLA 3LRGA 4PJ7A 3DX8A 4XNUH 5CBAB 5T3XL 1ZTXH 1FH5L 4L1DA 1IEBB 1ZK5A 1W0VA 3FTXA 2OTWA 4UTBA 2CCVA 4H26B 3BCDA 1NBCA 3BH9A 3NGBC 4GINA 5DURD 3RNQA 3NIFB 4M7ZB 4M1DL 3AWEA 4BFJA 4LSTL 3BKMH 4GQZA 5F96H 1FFOA 1TO4A 1G5AA 3WLBB 4HC1A 1JF6A 3BQUD 5I15H 5E6UB 4V11A 1BGXL 3P9LB 2Z31D 5AW3B 1CWVA 4MQ7A 3UYRL 3QPQC 4L9LB 4TUOA 5D1ZA 2V17H 4JZNB 4ZAKA 3OSVA 5AB2A 4QKXB 2E86A 3LN4A 2W9EL 4U1HA 2FWUA 2P5WD 1QUNB 2WGNB 1GPOL 4W93A 3TJEH 3P0YH 4B3VA 4OV5A 2C1PB 3H4HA 1V05A 3SGJC 4FFTA 3QG7H 1FI8C 1IAKB 5IKCB 4QHUA 5I6XB 1RLBA 2MNUA 3FOLA 3FQ4A 3H42L 3IDIA 4A7SA 4BE6A 3LS5H 4UTAH 1QSVA 1DEDA 1OCCB 3LN5B 2VR7A 2X87A 4BWWA 5I0YA 3CTTA 4EEEA 4JEGB 3UIZA 4NQEE 4FA6A 2F54B 5F0MB 5KSVB 2OV0A 1Q9OB 4R96B 5IV2B 5EC2A 4MD4A 5IMLA 3IB4A 3QJHB 5IBUG 3FN3A 1JZ5A 2D3VA 4UILH 4GXFA 5TPWH 5HPMB 3T6XA 2AK1H 1YVLA 3CFTA 2R2HB 4HJJH 4NKIL 3VXQA 5DWUL 2BSCA 5JPNB 1YA5A 3IJYB 4P2YA 3K8LA 2IQ9L 1JGIA 1U8PB 4JFQB 5BS0D 5FHBL 5AG8A 3KM1A 1PY4A 2YJLA 1QATA 3S2AA 3CVBA 1J5DA 1IC4L 3A24A 2PTTA 3Q5OA 3X13B 2D03H 3DBSA 1AI1H 1ZLSL 5DSCB 1DBBH 1N2RA 5GS0H 2DPKA 1P4BH 1G6RB 3DHMA 1JI1A 12E8H 4OTXL 4ETQB 2R15A 4HUVA 3TT1L 3P9MA 4YHZH 5IB1B 4ELDA 3WFHA 3EO0B 3MNWA 4HGWA 2GKIA 4I9XA 3SCMA 5B38B 4JO4L 3WSQL 2C3VB 1JZJA 2IQAB 2HP4A 2XPYA 4M4RB 4N6RA 4OGXH 1BX2A 2N59A 4P2RD 1IILE 1EAOA 4JFPB 3S8FB 4QNPE 2ICCA 2V9UA 2BVTA 5E1IA 2VXVH 5GGRA 4KZEH 3G5ZA 3UEQA 1SY6A 2ED8A 4PHXA 4ZMVA 4KKCC 1KFGA 1NM9A 2EC9U 1YHPA 1YY8B 1S7QB 2BSSB 4NJ9L 1QFOA 3DOSB 1NWPA 1ZOXA 3QGVA 2R8SL 3DDGA 5D4HA 3L1OL 3T0EA 1YMMA 5SWSA 1LEKB 4OGQC 4NZ8A 4Y9BA 4N2AA 5GRVL 3MFFA 1ZVNA 1G7JA 3GSOB 4QXUH 5ICZB 2V33A 1JD9A 1UUNA 2A6DB 4IHBA 1K4DA 4OAWA 2YPLD 3RBSA 4EZJA 5C86A 4GSDL 4U6XA 1GGBL 4P9HC 1XF1A 1F58H 2MHAA 1ACXA 3N85L 2D8KA 5FYKE 3SCMC 4PLJC 2QFPA 4DZ8A 1QSFE 2JKTM 4FABH 5FFGA 3M88A 1BZ9B 1UWEH 4PBXA 4A55A 4KITB 2EXYC 3WXWL 1I4FA 2YGVA 5C9KA 3ETSA 1HHJB 1NIAA 3I6KA 4KVCL 1HOCB 1HXMA 4R97C 4NGHH 2WTRB 2HFGL 2D31B 3SE8H 5DD1L 5ACMA 3NPZB 4HX1B 4OQTA 5BQ7B 4I2XE 2K4AA 3G08A 3VCLA 1TZGL 3R7QA 3U79A 5ECJE 5LNEA 4A39A 3V55A 3EDJA 1S9VA 2GW5A 3WXVH 3W0WE 1OGSA 2WSPA 2Y24A 5D1XD 2R1YA 3NQIA 2BIPA 3K71A 5E8NB 5EB9A 4NDMB 5AVUB 2CLRB 3L9BA 1WT5C 4U1SA 1JK9B 1N7MH 3D5OF 5GS3A 1NTDA 5DUML 3VRLE 4FFZL 3KPRE 4P5TC 1LP9B 1F4WH 2PO6A 4KRPC 4BRJA 2Q3AA 1AGDA 4YFEA 4HFWA 1U93B 4H0LC 3ESMA 3L7EB 4FLHA 4ELME 3MRPB 3MO1B 4IEFA 1GGIL 2LFGA 4FHJA 1T03L 4OCXH 1IQDB 5C0BB 1UWXH 3F8UB 5A2AA 4AVJA 5AD0B 1U3HC 2P80A 3WEXB 4CVXA 4F58H 1DE4B 4J6RL 3GBLA 4PJ8A 1T0PB 1EHNA 5KOVC 2YS4A 2VWEC 4Y2OA 1HZLA 2OTUB 4DOHB 1O5DT 4NQDB 4NWTH 4Z7NB 1BD2A 3O6FB 1ES0A 5I71B 2JF1A 2IGFL 4XI5D 5D9SA 4WI3A 4B53A 1MJ8L 5FYKU 4FG0A 1YPZB 5D71H 4Y2DB 5C7ZA 1YNTB 2H1LM 1E0OB 3DURA 1OPGL 4JPQA 1U41A 3N5AA 1JPGA 3HS0B 4MNQD 2WKOF 2ZOLA 3MQIA 4R0LA 5C0BD 1UH4A 2DZEA 2WNXA 4MASA 3CFBB 1VFOA 3ABZA 5HI4D 5BW7A 1JG9A 4UV4H 3QXDA 1A6VL 4PY8I 1IJ9A 1HHIA 3IK2A 3BLPX 3D18B 3ZDYE 3CVHA 4B9CA 3S6CA 1SUHA 3WS3A 1NOLA 1DVFA 1LP9E 2ICWJ 4JREB 3JV0A 2WHVA 2IH3A 2XTJB 3RQ3A 5LXGH 4C56B 2NPLX 2PW2A 3VXTA 1QRNB 1BWMA 3GI9L 3EDFA 4WV1C 1HIMH 1IGML 1RZKC 3SDCA 1YNLH 4MA3A 4NM4H 4ZAKB 5CD3B 2C4FU 3FFOA 4R4NC 4FNQA 1JV2B 3IRZA 3UDWC 3ILDA 5DJ8B 4MMXC 3MDJA 1IGYA 1IIIA 4ILDA 1KPVB 1CFSA 5D7KE 3HZKB 5IR1B 1JCVA 4PR5B 3VB9A 1RJZB 3P4LA 4ODWB 4DVRL 1LE5B 1L6ZA 2XWJA 3CE1A 2Z4TA 4ZUTB 1KPRB 3BH9B 1S7TB 1A7RL 2MQ3A 1U4EA 3DWTA 3R0NA 1HQ4A 4PTTB 4IK7A 3FOLB 2OJEB 3HS0C 5DVPA 1QABA 4HK3N 4DEWA 1XH2A 4HXBH 1GHFH 1ZKAA 4R5XA 2AK4A 2X41A 1ZS8A 1G7MB 2MCAA 3ARDC 1ECZA 1H6FA 3D87B 4NRYA 1OAYL 5IIEA 1HHHA 4K2UH 4X8GA 4BH7A 1GVIA 1ZLUH 3K0WA 5EZJB 4OFVA 2BY0A 4H8PA 3V4VL 3T0ED 4LVHB 2CO7A 3CDZB 4YVNA 3BJ91 3FU7B 4HQQL 4NKMB 5KSBA 3HG5A 3MRNB 4DEPB 4TNWF 1Q4NX 3FFCA 4WTQA 4WU7B 1NDMB 2PTVA 3E8UL 5ISZA 4LVNB 3IJSB 4LHUD 4KJQC 3SDDB 1SXAA 1WZ1L 2X70B 1INQB 2ZXAA 4G7VH 4PP1D 4GG8B 2J1XA 1OK8A 4X98B 4DUWA 5J6HA 1GOFA 1F5WA 4AVHA 3QJFB 1MJ7L 1UT9A 3U0PA 5AVQB 3RUGF 1NL0L 3QIUA 4XCFL 4G6FB 3JUZA 1H9DA 2X1PA 3ZDXB 2DBJA 2FZ3A 3O2DL 1NGXA 4LKCA 5F1OB 1E2VA 4D8PA 3KXFD 5CGYD 5HPOA 4Q9QH 1QAWA 1BX2B 1RIVH 2NXYC 3QA3B 5CN2A 4P2AA 5FO2A 4NJAL 1P7QD 1DUZA 3P2BA 4N26A 4PJXA 5F3HA 4MB3A 3WDJA 2QKSA 4RIRB 2UWEB 4HS8H 1GY2A 4L4VD 3SBRA 2WC7A 3WLBA 1LO2L 1FL6B 3NJGA 2D7OA 4HGKC 4PY8J 5K59E 3WE6A 5C09D 3MLWH 1RL1A 3L08A 2J8OA 5I9QB 4OIBA 1FWXA 1D3CA 5D1QD 5DZNA 4GKZB 5G5DB 3RVVC 1KBVA 5GRYA 1TQCB 1XR8B 4LSPL 4ZMYA 2ZOKA 5EZOL 5T3ZH 4OAWB 4DP7X 2WUCH 3A5VA 3MXVH 1T0MA 2K45A 5AW1B 2WBKA 3LEYH 8PAZA 2O72A 5HHNB 1AR1D 1EXHA 3N0AA 3P4NA 4G8EA 1OARH 2H41A 5HGHA 1BQSA 1ZSHA 4DP8X 3CSYA 4OLYL 5GHWH 3NZHL 2IWGA 4K73A 3TEXA 4FG6C 4IRSB 4K4KA 4ODTL 3TYGL 1T1XA 2QSTA 1OPOA 5C09B 3W9EA 5M95B 3RX8A 5DJ0A 2J2ZA 1K4CA 3RUGA 3L4XA 3FZUD 4U1JB 5TDOB 3TBVA 3UTTA 1T4KB 3E2HC 3G04A 4ONGL 1YYLH 1RXLA 4GY4A 3AG1B 5JQIB 2WQAA 4GSUA 5B1JA 5EU5B 4PJAF 4AQEA 3AITA 4GW5B 1M2OA 4HCIA 4MAYA 5ABDE 4MJJA 1CXEA 1X5ZA 1DQLH 4S0SD 3QIUC 4JHWH 4MSWA 3AY4A 2BCKB 3QCUH 4MYWB 1QLRA 5EF3A 2V7HA 2P8LB 2VDOH 3QJUB 1PY9A 1DQQA 2DL9A 2ZAHA 3OZ9H 4R83A 4ZMWA 3I02B 3AM8C 3FT0A 4N2LA 1HYSD 1ONQA 2V5YA 2ZWKA 4OD2A 1GXEA 2NZ9D 3MLRH 1DVSA 1Z3RA 3CIQA 4D0BB 2AK4E 5I18H 3IDNB 3C8DA 3ZTEA 4Z5RA 1U93A 1I85A 1PW3A 3N44F 3QISA 1KGXA 3L4TA 2ZX5A 4BFNA 5A2LH 5FO9A 1MH5A 1TPXB 1Z2KA 3D2UD 4DNLA 2O6FA 3S5YA 2MEJB 5AW6B 1GY1A 1M7DA 3L54A 3OPUA 1JXJA 2F2HA 4IKJA 5DQDL 1I8KA 4PJ7F 5GGSY 1AIFB 2Q76A 4TOYL 1DQJA 5EZIH 1OF2B 4ZDHA 2J5WA 4FLOA 3ZKSD 5JHDE 5FHAL 1ES0B 4O2FB 4NKOB 3T0EB 5F9JB 4Y4KB 1OT4A 1YECL 1FVCA 2NQCA 1AGFA 2WN3A 4Z1PA 3ZK0A 3QUZB 4G5AA 2RALA 3NZUA 1GIGL 1Z32X 1CQKA 4WGKA 2SEBA 4UM9D 5J6GA 2YGNA 4LLDA 3VXSB 1G1KA 3KM2A 3QXDB 3S35L 1RP8A 3F5WA 3B9DA 4ENZA 1NGZA 2NZ1A 4Y2OB 4HLEA 1MAKA 4CC4A 2EDXA 1QQDB 1JMZA 4S1QH 3ARTA 1UQSB 1BGXH 3HC2A 2IH3B 1RVFH 1EEYB 1SYSA 3BKCL 1QR1A 1MLCB 1F6AA 4MMZA 4NHUA 5A6MA 3FHAA 1XCQB 3ZE2E 5IM7B 4IU3A 4LNVA 1EZSA 3GYRA 4PP2A 4LCYB 2QGBA 5EOCJ 5C0AD 2JCCE 3TZVD 1ADWA 4U3HA 5DJ8A 1MNUL 4LCCA 4Q97A 4NN6C 5FPIA 2A1WL 2B16A 2IAAC 1T6BX 3QHFL 4ZUUB 4R0LC 2AABL 2GYSA 2XN0A 3WUWG 5LBSL 1MHEB 3BPLC 5I1AB 2IPKB 1DCEA 3KHOA 4Y1AE 5T5NG 3C75A 4F91B 5GGUB 1BLIA 5I5IA 1AVAA 2XIIA 2CK0H 1CLVA 3APNA 3WTTA 4F7TA 5ISZD 1CN4A 1FFNB 3PWNA 4Y9EA 5T5FL 2WBJA 4HSQA 4F1ZA 3HW7A 1VZIA 4NPYB 1L6XA 2HLEB 3MUZ1 4YZFF 2OMVA 4OZGA 1WBXA 4NCDA 2B59A 2X3AA 4ATTA 1NDGA 1AKPA 3QWOB 4NUGL 3FO9A 1I8MB 4AEIH 1K5NA 5HD8D 4LNRB 3V7AE 3T0EE 1A5FL 3GK8L 5JNYB 4UOW1 2ERJB 4FULA 1I3RA 1JZHA 4LLMA 4MS8C 2PTUA 2X2UA 2DM2A 1EXUA 1JGUH 4JJ5B 4QI3A 3ZVVA 1B4TA 5FB8A 4OZIF 1WQVT 1FYTB 3ME0A 1DLHB 3BKML 1AIZA 2YD4A 3K6NA 5ISZB 1I31A 3WTYA 1JTTA 3B6SB 4PG9A 2HUEA 3HMXA 4X7FC 1IM3D 4ZFFA 4M6OL 5B3SB 4UANA 2P52A 4HALA 4F24A 3SDXB 4PSPA 3GDCA 1ZPLA 1MQKH 2BH0A 2HFGH 4FQIL 3CBJB 1AGBB 1WS7A 4Z18A 2AJ3A 3IAPA 4IRZA 1RERA 4OGXL 3IF1A 5TH2A 4GKSB 4D8PB 4H7VA 2CJUH 2G5RA 3U6XS 3UGEA 4LHJB 1AJ7H 4I2XA 4NC0B 4OVUA 4LCUB 3HHSA 1J10A 1QNZL 3D50A 3CCHA 3LS5L 3FOMB 4UNVA 1ZXKA 3HMWH 1JHLL 1KJVB 1M57B 4LVOB 5AWNH 2E0PA 4K8RL 4Y16B 1DFBL 3EOTL 1YJDC 2Y69B 4CBPA 5DQ9A 3RIAF 3U4EB 3KGUA 2J57A 5B3JF 3EW3B 2OR7A 2VE6B 4ADJA 4K8RC 3ASOB 4OY9A 2O6DA 3V6BR 5E2TH 5IB3A 1BD2D 4YSTA 1JPSH 2RCSL 3VFNB 2DBLH 5I5MA 3ESVF 5TPWL 2WZPA 4FZEL 3KD4A 3M1BA 4OFIA 5D7IF 1A1MB 1XR8A 2DQ6A 2GITA 3MR9A 3DLQR 4N3TA 5EORH 3SY0B 2CLVB 4J3OD 1SDDA 4HKBA 4R3SB 3TNNB 4MAYD 4XAKE 3B2UD 1AI1L 1BVNT 4FQLL 4XVUC 4UU9B 2WY3B 2K9UA 2Q7NA 4YX2L 3B56A 3QFJB 3NFPA 3BT0A 5GGVY 4ZNEE 1L4IA 4GW1B 4IBZA 5KWYC 4Y4FA 3SDDC 4GMSH 3QUHA 1FNEB 2FX8H 3P73B 1KULA 1VADA 1ESOA 4XP6L 1KUMA 1DVFD 4O00A 5DD1H 4YC2B 4OCYL 4WEEA 4JNXA 3NJKA 2AI0L 5DUBB 2GJZA 4WQOA 3BIAX 1FGVH 1THAA 5EN2A 1ERNA 4OM1H 4ONFL 1S7WB 2VDPH 2ZXQA 4RESB 2ICES 2ATKB 1R19A 2E7LC 3FQUB 2BVEA 1BFSA 3D9AH 3FRUB 3FFCB 4OLZH 3QIWD 3N40F 1L3NA 1JF1B 4HLZH 2BW5A 2D2CC 4DN3H 1OQOA 3AXHA 1DQQB 3CFKB 3W9EB 4PJIF 2QLYA 3U2SB 3LOWA 1FIGH 2FEDD 2XWTA 2NCMA 4HHAB 1HU8A 2PYFB 4PV8B 5C9JA 2WTOA 4U1GB 4YLBA 3DUSB 4MFHA 3GS7A 5FW8A 2BNUB 1JZ2A 3UTTB 3W0WD 1MUJA 5DFTA 1AZVA 1X9UA 1A9EB 3GZPA 2BNQB 3PWLA 4CSZA 4IRZH 4AYID 1KLFB 3T3MF 5CP7B 1FG2A 5E0QA 1OK0A 1VFAB 2E9JA 3RTQB 1A6WL 3O11B 1MG3C 3QC6X 4IJ3C 1JWUB 2ED7A 4DPAX 1A02N 4ZTEA 1MF2L 2X3BA 1XGQA 3ATEA 5TF0A 1A4JB 5LCVH 1J9SA 4YXHL 3RGBA 3WY2A 1IC5H 3GXTA 1ND0A 4JGMA 2GBUA 2YEVB 4MX7B 4ZK8A 2X7LB 4JREC 4PW4A 1XDTT 4FFYH 4R9HA 1PU0A 4JFDE 1P4LB 3WIFA 2CMRL 5I75C 4A67A 3IJEB 3KNBB 2WCGA 3I84A 5CZXC 1WWWX 5CJ5A 2CKBL 2X42A 1ZTXE 1KBBA 1S7RB 4DKEL 5C0AA 5G5DA 2WOYA 1D5XB 3TC9A 4DP4X 3PP4L 5IFHL 4E0RA 1JDDA 4PD4K 2RFXB 2CH8A 4RAUA 1OAXH 1MJJB 2JH2A 5KYNA 4NAJA 4WWID 1IM3B 3S5ZA 4KUZL 5A2FA 3QFDB 4TV3A 2ARJA 4HFUH 5BO1H 2NSXA 4M00A 4XMPH 3JTSB 4LCWE 5B38G 3BE1L 2R83A 5GISL 1G43A 5FO8B 1CD0A 4D0CB 3TIEB 2FJSA 2QZ5A 4B0MM 3SCMD 3QEHB 3K4AA 4QHNA 2EDNA 2IAMC 1E3XA 4IRSA 2APVA 2N4IA 1WGOA 4H2AA 1KIPA 3FN9A 2WLIB 5TD4A 5BJTA 5IK3B 2JI3A 3V4VA 4HIHB 2AQRA 3ZTCC 2VO5A 3DO4A 3EJUA 4B95C 4M56A 4IM8A 2Z31B 3SO3C 4CVWA 1AXSA 4JQVA 1L5GB 1E90A 5DMJB 4MD0B 2F61A 4N90E 1IC0A 2OYPA 4PWJA 5MHSD 2BXZA 3KPMA 4GP4B 3T1FA 1D9KA 2NXZD 4FXLA 1YQ2A 4YBQD 2O5ZH 1QQDA 2HWZH 1DJZA 1AMYA 1DBKH 3CZFB 4YHOL 3KL0A 2VLRD 4YDLB 3ULUD 3HFMH 1UACL 1IE5A 1MLCA 1RPQA 1WFJA 2IGFH 1H6UA 1LO2H 3HRZC 1B3IA 2YD6A 5FM5M 3QQ4A 2VN4A 1V7ML 3LIZL 2NXYD 3S36X 3JWOC 5D1XB 4S0HA 2DWDA 2XWCA 1C5CH 4JM2F 4WGWB 5F1NA 1CPUA 1CR9L 1HCYA 3BVNA 4FQQB 4U1NA 1OAQL 4E68A 4WEBH 4EI5B 5JO5A 1CFTA 3FULA 4TVPH 1DCLA 2Y6SC 3TWCL 5I1AA 1PLBA 4OT1H 3RNQB 3U4AA 1NBVL 5E0FA 2UXGA 5FYKD 4L4TE 5BV7C 2BINA 1S46A 5DEGB 3KCPA 3EF7A 3RIFF 5F89A 1N9PA 4ZMNA 2R69A 2R4SH 3BAKA 3NSDA 5INDA 5I8CA 3SKOA 1FVEB 3NG5A 4GUPA 2CDFB 2DEXX 1T3FB 4XOAA 3QJQB 1NCBL 5I30H 4FFZH 1HKFA 1MJ7H 4TLUA 4ONHB 1KJ2H 4LCWB 4OZGB 2MTAA 3QCVH 3PGFH 3IXAA 1UM4H 4H0HB 3GHEL 3O2DH 1XCTB 2Y5QA 1R3IL 1WG3A 1C5DA 2ZSWA 5FYJU 5C0NC 4GLRH 4NCC1 3UPCA 2IV9A 5ECGA 2KQNA 4AE0A 1W72B 1ETB1 1GS6X 3BAIA 5H94A 1JAEA 5FR3A 3IBOA 1ZV2A 3SKJL 4DK5A 1A2YB 3IAGC 1T5XB 2AZUA 5CEZH 5JYMA 3MJ8B 4JFEE 5IEHB 5IHZA 3MBWA 2NY2D 4OJCA 3AM8A 3P1VA 3O3UN 4WSKA 3UJJH 1P69B 3TN0A 2M26A 2XZAL 2YMTA 4HZ1A 1IO4C 5DJAA 5FGCE 5DFWH 4EBQH 4DGUA 2DH3A 2FLBT 3GSNL 5C2BH 3QXAA 5E5LA 1NCAL 1QR1B 3TESA 3WKML 3HI6H 1RZKH 3WKPA 2FHCA 3GHBH 1IKFH 1MIEH 3MNMA 3ZZSA 3ABMB 2EUWA 1BVLB 1QKZH 5B38A 4HU8A 2TAAA 2W80C 4L8SB 3RDTD 1MVUB 1WWAX 2QLVB 4JFEA 2JXMB 3OB0K 3OHXB 5FM5O 1TF4A 1ACCA 4DPBX 4XZUB 4JPSA 4G8GB 2BIOA 2QVFB 4QWWC 4GNKB 2PTTB 2OTWB 4JO3H 4GAYA 1FV1A 3QDGE 3WE1A 1NC2D 4XWGH 2W81C 4Z0XA 3JBG7 2VDNH 1Y1UA 1ZK9A 2AEWA 2IAMB 3ISRA 3OXRA 4LRNH 4DN4L 2HX8A 4WW2B 5FF6B 3AS2A 4TLSA 3SYQA 4PV9B 1ET7A 1WH0A 3P73A 2DLGA 1YEDA 3E6HA 5KYWA 1G9EA 2OMVB 4FKEA 4NHCH 5DUPL 4Z7OF 4FA8A 4Q7DA 3U82B 1G4RA 1V27A 4FXKA 2I5YL 1UJ3C 2YUWA 1W72L 2B5IB 2CIIB 3V6OA 5DO8A 1ZV9A 4BFBD 2YPVH 4ORGA 4OZFH 4RDQF 2K70A 2MHAB 5EU6E 3JTTB 3FU6A 4AYFA 3H0TB 3B7YA 1PX3A 3CVHL 4HWNA 3IJHB 2EDRA 1LEGB 3DJTA 2VXUL 2CZNA 3UXFA 5TGBA 3B9KC 3O8XD 4FQHB 4ZO9A 3K8KA 1IZKA 1CFQA 1NCDL 1Q38A 1J1XL 3CK0L 3L3GA 3V52H 4PV8A 5IV2A 1SJMA 4HCGA 3VSVA 1UGNA 4PJCF 5AKTA 1MFUA 2YGQA 5CZVL 4QRRD 1O9WA 4IOSA 1R0AL 1TTCA 2FECL 3KYAA 2F5BH 4H4NA 4JQXC 4WDIA 3MX0A 2GFBB 2E6QA 3KPQB 4JVPA 3UAFA 5E8NA 5A7EA 5GRJH 2ZSVB 2JIXB 2R56H 2AERT 2J4WL 2ZYHA 4N8CL 1FNSH 2XIBA 5A2JH 3QUXD 2GK0B 4XCEB 1LO5B 3JWOL 3HR6A 1HDMB 5HY9B 1D2OA 3AB0C 3S36H 4YHLL 1HHKB 2E5EA 4ZMXA 4A2HA 4CVUA 1MUJB 5K39B 3L1FA 4B3EA 2X5PA 4EIZC 1FE8H 2BP0A 3V0GA 4BGLA 5MP6L 1FG9C 3O6FD 3K6SA 2WZAA 3MV7E 5LBSA 1G7LA 4DCQB 1VJSA 3BP6A 2VDMH 3OXSA 3RGVD 3EH4B 4I3RH 1HCVA 1N6VA 4G8AC 4MLSA 3IM1A 2ZOTA 3FAWA 5JOFB 1QA9B 1WA1X 2TRYA 2ZXCA 3VNZA 3CFIC 4YLQT 3EOAB 4ZUVA 4D0CA 3PHOB 5HGAA 5B3JE 2WINA 3WKQA 3CXHJ 2WXIA 1HSBB 1F4XH 1FNGA 1QG3A 3GI8L 3VGAB 5KVEE 1KMGA 1USZA 4XP9L 4FQCL 4S0TD 2WLIA 3LQMA 5B7FA 3MO1A 4OLXH 1UASA 1LEKA 5LKNA 3MLPA 1MNUH 4HOWA 1B4RA 2YUZA 3CSTA 1KPUB 3EH5B 4H1LH 4XHQA 1LK2A 1YUKB 4KMTL 4ESKA 3GINA 2LR4A 2I26N 2VH5H 4P2RE 1OM9A 1ZV5A 5AALA 4E9QA 2IANA 4PJDB 3TA3C 2OK0H 1IV8A 1U8MA 5GIRA 3VRIA 2HJKB 2ATKA 3ZHFA 4KJYB 2CK0L 3P4MB 3PAYA 1QNZH 4I4WA 4FYQA 5FGRA 1CMOA 2DQCH 2VDKH 2BW4A 1E5ZA 3D48R 4O2CA 2DYSB 2IBBA 3MRMB 4PCKA 2FSEB 3D05A 5HDQL 4JFOA 4MQTB 5AWNL 4JJHA 2R0ZH 2EXWC 4P9MH 2YAHA 1JPEA 2FLMA 5TDPB 3ZIMA 1XR9A 5F0LB 4KPHH 4PRDB 1U6AL 3EH2A 1U2HA 4IOIA 1KGUA 3FB5B 4JANA 4YE4H 1E4WL 2NTSP 3QXUA 1I82A 3RB5A 1X7SA 4MD0A 1JGEB 2FJFB 1KZYA 3DPBB 4LESA 1GZHA 4A7VA 1V5JA 5H2BA 4M48H 4XO9A 2V5SA 3D2TA 4Q6IA 4M02A 4TQEL 5DHYA 2JJWA 4K94H 1P2CB 2QMKA 4KK6C 4N2BA 2WQXA 2ZICA 1MAMH 3BD4A 4XMLH 4XX1E 3IRPX 4GKNB 1PAZA 3BWSA 3K0YA 2X2YA 4GBXB 1E6JL 4Y5YA 1D7BA 5CSBA 1D5IL 4MCMA 3RPKA 1I7ZA 2EIKB 3FQWA 1XWVA 2EE2A 2CDFA 2VLME 2EILB 1ND0B 1M4KA 2E27H 5D7LD 4Z7QB 2UZXB 2B1AL 4HU2A 3F12A 1VFBB 1OWWA 2VL4A 4L1TA 4PJ8C 1WWCA 2W65A 2XV6B 1GOHA 2X4QB 3NDZE 1U3HA 1S3KL 3MJ9L 5IMOB 4JZJB 5KTEL 4JRFA 3BUBA 2Y23A 5ESVB 1EJOH 3MA7A 4HT1L 4HKZB 2R2CA 3POCA 4DESA 1BFVL 3FU7A 3PREA 4NKMA 2PR4H 4IRJD 5ETUB 2KZBA 4KNUA 3MZTA 4Q9CA 2ZOWA 3MBEC 2WXLA 4XPTL 3OWEA 5CP3H 2EVJA 3QJZA 5JXED 2GJ6A 4KO7A 2H9GB 2FR4A 4XO4A 1JGVH 2CHDA 2IFGA 2JNZA 5DMIH 1BDYA 5F44A 3MRLA 1TJHL 1X3DA 4NRYB 5DJAB 3CFJA 5ALBH 4CN4A 3TTYA 4O4YL 4AV5A 3E7JA 4ZMZA 4NUPA 4MA1B 3BSZA 3H3PH 1CDIA 3VA2C 5D5ME 4JFYB 4L3EB 2OMBA 3VWJA 4CNIB 3LNHA 1MWAH 4OCWL 4P5MB 3VFUB 4HJUA 2A4ZA 4MKTA 1BQUA 3FUHA 1TTAA 4PRBA 3WNOA 2X4TA 2JCWA 1V7NL 4KAQL 2G30A 1UB6A 3O45A 3MMEB 4DGIL 1C7TA 4PJEE 1PNCA 4JFFD 5HHMB 4OF5A 3EYVB 5D1QB 3IJSA 5EMYA 5LGKA 1EO7A 4M62H 3OB0H 3U7WL 4PJDE 4XNZC 1Z9MA 3VGDA 3X12B 3UO8B 4JDEB 2DQJL 1NIFA 2FX8L 5CGMA 5KYYA 4GT0A 4QKTA 4YHZL 5H37A 4DW2H 3K46A 2Y3NA 2EDOA 4M1GL 1NMCC 1HI6B 1MWAB 4H8WC 3EAKA 2DQGH 1JWSB 3BN9C 4R5VA 2Q8AL 5K9JH 1MG2C 4PQXA 2E6PA 4QRPA 2QPFA 4HEPG 1BBJB 1AJ7L 2YN3A 4IMLA 1QHPA 5D1ZI 3T0EC 3DBXA 3QDMB 2Y2WA 3K74B 1NCWH 5DEGA 3LV3A 3O3BA 1RZIA 1U8LA 2DQMA 1YSOA 2YK1L 4GI9A 5CS7A 4G83A 5I0XA 1YEDB 3E6HB 4LCWA 2ROYA 4JZOA 3SKNB 5FM8A 4N8UA 1B2WH 1A6ZB 5DS2A 3ZKNC 1P53A 1T1WB 1AHWC 3WIIL 5K69A 3CC5B 3V9CA 2VITB 3E3QC 1ZRUA 2KI6A 2P28B 1ZHLA 5DMGD 3COOA 1DZBA 4RRPG 2C7UA 1CFVH 3IWUA 1VEMA 3O6KH 4C83B 5HYQB 4HBCH 1AQ8A 4XAWL 4AMKL 4NQCD 1ZPUA 3GWJA 4N2MA 5AW7B 1PS3A 3SGDI 1WICA 3IDYC 2DQEH 4R8WL 4JW3A 1IC1A 1BW8A 4G9FD 1LEGA 4JO1L 4GQ9L 2JKNA 2OA9A 3PL6B 4U3XA 2C9AA 4DGVL 1DBMH 1KB3A 1UXLA 1JNNL 3V5KB 3C8HA 4URKA 2YR3A 3BKYH 5HY9A 4GQRA 2GY5A 3QXAB 3PXHA 3N3EA 5EH1A 2CKNA 3OR7A 3IDJA 2WQUA 2AJYH 3NJLA 4L8SC 1NGXB 1FGVL 3PP4H 4NN5C 4PFEA 4ANXA 4MDJA 4CRPA 5I76B 3LKOA 1HH6B 1WO2A 3TZVA 3MJGX 3U2JA 4CMHC 4UM9A 4WKZA 2ATPA 3FKUS 1MRCH 1QBML 1IBGL 1YEJL 5IVXB 5A43C 4F7MA 2AJVH 5EEWA 4FX5A 4FXGC 2UWEA 2XV3A 3EFDL 4ZDHB 4Y89A 2IALA 1ZLVK 1RI8A 2Y2TA 5JW3H 2IADB 3OAZH 4WKXA 2FL5A 3DX9B 3LZFL 1CURA 3WKYA 4ZMOA 3WY3A 1GZPA 4KC3B 2Y7OA 1EEUA 3SGEI 1AOHA 1TCMA 3GSQB 2AFNA 2B3IA 3P3UA 3QFJD 4H8QA 4DAGH 1R5VA 3QWRA 1W0WB 2NW3B 2DLIA 3PQYE 3Q8EA 3LS4H 4A7TA 1U8IB 3HE6A 1HXKA 1JFQL 2AEOA 4ORGB 4UQIM 1A6WH 5B1KA 4BK5C 3F5WB 4XHJC 2J1KA 1NGZB 1B0GB 3UJIL 1MI5D 3DX3A 3KWWB 3QC5X 4AYBA 1MFCH 1ZD6A 3MPCA 3IJHA 4JBSA 2OMTB 3T0DA 4XE5B 1J0JA 1F11A 3DRQA 3BFQG 2DYPA 1KXTB 5C2BL 1TNNA 5IJKA 1K4CB 4G2AA 3DYOA 3ULUE 5FYJE 1O7SA 4FNUA 2F5AL 4TNVK 5A6LA 5B7MA 3VX1A 3QARA 4HWBA 4Z8FL 3A3YB 4GIPD 3ARRA 3E3QE 2FJFA 3DPBA 4G42B 3PPSA 1AZNA 3A0OA 1ZEAH 5C0DA 1KYAA 4Q14A 1J11A 2V4LA 5FK9A 3TF4A 1W0VB 1XGRB 5LBVA 5GIRB 5FGBA 4KJYA 3CN4A 3VFTA 3KR3H 2GAZA 3F7VB 3H3KA 1UENA 3D34A 5FA4A 4IS6B 1T7VA 4ODVH 3JWNC 3RWFB 2FD6H 2DRUA 1M7IA 1SHSA 3MREB 5BS0A 1FLRL 2AANA 4DF9A 2CJSA 3STZB 4DN4H 4LCIH 4G6KL 2W9DH 5I66B 3CFMA 3MKKA 4TUOB 4NBXB 3D12B 4G6JH 4X7CC 1KTKE 4U3SB 4EUPA 1RFDH 3MRGB 4LCYA 3SD5A 3MRFA 2KYIA 4UAOB 2PXYD 1UD5A 2NY1C 3WEAA 2QKIC 3NIGE 1AXTH 2CUHA 3V0FA 4PJBE 3WY4A 2YQGA 3FO0H 4R5TA 2WNKA 3IDMB 5E2WH 5TTRA 5CFAA 1M6OB 2FNWA 4AGQA 3QDMD 3DROA 1HAWA 4MCYA 1C8PA 1SHMA 2J6EL 1I9JL 4BK8A 1RHHB 2WVUA 1LNUA 1OSPH 3BGMA 4BZ2H 1J0ZA 3BVXA 4HHGA 2XFGB 4PUBL 4K8RD 1FFNA 4QRPD 3FQNA 3QRGH 3TLRA 1EH9A 2R1WB 5J1TC 4B6ZA 4X8XA 3PHOA 5HGAB 3AWGA 1H0DA 3F6JA 2WINB 1PZ2A 2CMRH 1TMQA 1FIEA 3HZMA 1SJHA 4PLNC 4OGZA 2VMJA 2DJMA 2G9HB 2ORBL 2EADA 1D5BA 1C5CL 1QRNE 1SXCA 4N2GA 3TNMB 4E9SA 4L3EA 1CXFA 3OKEA 3MOQA 5E4OA 1PLAA 4GRWH 1PJ9A 1DBAL 3AXLB 4YUEH 1WP6A 5I6LA 1CLZH 4N25A 1T80A 4JX0A 3TWCH 4GG6F 1C8QA 1HWHB 4WUUB 3PJNA 2SEBB 1HL4A 2WZ5A 1SJVA 4PBDA 1ASQA 2AC0A 2GJ6B 3IPBA 3VE0B 3GSWB 1U8MB 1CJYA 2IPUK 1I7UA 1PIGA 4XH2A 3BAYA 2FJHB 3RVXC 4OZGE 4YXKH 3W81A 3RZCB 2KH2B 1DEEA 2XFXB 4FJYA 4QWWD 3QORA 1T22B 2EC9T 2HG5A 3CFJB 2DMGA 4KJQD 3ET9F 1QOKA 2ICEB 1JV5A 4BCYA 3HG1B 2CO3A 4U6YA 3QHZH 4XVSH 3IDXL 2AP2A 3LPOA 1I1YA 1N0XH 2RD0A 2VAAB 4ERSH 1OLLA 2R51A 3HHRB 2CKBB 3QDJE 2IO5A 2UY6A 2X10A 1TJMA 3APFA 3B1UA 3O45B 4X9YA 3GBDA 1UXMA 5I24A 3VG9C 4I2XB 3UPRB 3CVCA 2ZUQC 1EJ8A 4YSAA 5AZ2H 2XNAB 3CCHB 4K0OA 4P23D 2WAQA 4X4MA 2K9FB 3D39D 3NABH 4JG0H 4GKNA 1AAJA 4PJHE 3RHWK 1L7TL 1SMDA 4PB0L 2XETA 1U8CB 3FTGA 1PF3A 1QW9A 5GGQH 4ELMB 1WUNT 2ZJSL 1WBYB 4XXWC 1E8WA 4HCRA 4Q4EA 4X7EC 4PWEA 4RMQA 1LWJA 4U6VL 1QLEB 1TO5A 4CGUB 1YMMB 1QWNA 3QPKA 4F7EA 3GO1L 2WLZA 2IQAA 4M5ZH 1QBLL 1SLWA 4YEEA 5CZKA 3M1BB 3N2JA 4I88A 4UT7H 5EIVA 1HTYA 2WBWB 4NUQA 4P23C 2AJXL 4WFGD 1KB5B 3VH8B 1NSNL 4HKZA 1DTUA 3KJ4C 4WI6A 1B90A 2LHAA 2WTPA 1I3RB 2WUCL 1KNOA 3SJVB 4UT9L 4OGAD 4YDMA 1O7DC 1PL3A 1AP2A 5EO0A 5F72S 4HEME 3LVTA 1M3JA 5AVVB 2UXTA 5IOKA 5A7BA 5DEZA 1F6FB 1A1NB 2P7TA 3WJLC 3LN5A 5CSZB 4C57C 4JG9A 2PXYA 5E2UL 4Q4IA 2MH4A 3CHXA 4ODTH 3TYGH 3E6FA 5I75B 5AVXB 4X6DF 4JZOB 2C3WA 3GTVA 1G7JB 2WTRA 1T6WA 5EOTA 5EC2B 1JHTA 3BEVA 1RH8A 4APQC 3D4YA 1A7BA 4ABQA 5BV7H 4N5EC 5EN2B 2JCCF 2OCFD 3LPPA 1ZTXL 1TYJA 4WLCA 4JCLA 1AACA 3FO2B 4JFQA 3FRUA 4QRQB 3P77B 3EYFB 2GEEA 4U05A 2DTSA 3IAQA 4HIJB 4PRHA 1NWOA 4LSTH 1FPTL 1MCJA 2APWA 2JLLA 3JV6A 4NDMA 3RX7A 3SB3A 4C4KT 3SDYH 3UJJL 4U1SB 4MNGA 3HIZA 2GUOA 3GXIA 1N2RB 4GI8A 5CJQH 3SKMA 2C7FA 1XZWA 1CF8L 1SF3A 4YL9A 5DJDA 3MVSA 5EEZA 3OKNA 2UZIH 4R4BB 3V0WL 3WTXA 1MCQA 5IT2L 1Y7VA 2NY2C 2BERA 4N9GA 4XP9H 5DQ9B 3U4EA 2YWYA 3LRSB 1NFIA 3ARFC 1RQ5A 4OLXL 4PS7A 3V52L 5AYTA 1ED3A 1DVTA 5CD5C 2NY0D 2C3VA 1NC2B 1SVBA 7FABL 5C0BA 1UD6A 4YPGB 2VB5A 4MNGE 5F71A 4QRPB 4PBVC 2OMZB 4ZO8A 1D6VH 4RBPK 2ADFL 2H0JA 3V6OC 1G7IB 1Q9WA 3V4PA 5GRJL 1BIIB 2DQCL 3D30A 1YAZA 4Q9RL 4PREB 3ZZLA 3BIBX 3DBXB 3KE0A 1N64L 1KCLA 1Z7JA 4ZPVA 2BSSA 2ZUTA 4CU6A 4K23L 1OP9A 2XVLA 3PDGA 2V3EA 2G0LA 3MACL 3IMSA 2QR0A 3KNBA 4QDGA 4QT5B 2Q5BA 1JVOA 1RD6A 1AC6A 1UD8A 3GJFB 2RAMA 3DURB 1BEYL 3GSOA 4BEIA 2J20A 5CZXD 3IFLL 4NZRH 3HPLB 4N20A 1PG7L 2XKNA 1M9WA 1T0OA 5J8OA 4M5SA 4RSVA 1OGAD 1U8IA 4LEOA 2UY7B 4K94L 4DGIH 3CZJA 4HIIA 4PRPB 4X0KA 3P54A 1NBYA 4N90D 5MHSE 3JTSA 5AZUA 3VFTB 4AY0A 5CCKL 1X6LA 3GMOB 4BWTA 1Q94B 3WD5L 2LAAA 1JF1A 3RWFA 3N04A 2NX5A 1TIUA 3QNYA 4F8LA 12E8L 4C56A 3TVMC 2EE6A 1FC1A 4RQQA 3TT1H 4PJHA 4NI3A 3Q48A 3WJJA 1M05A 2NQDA 5KZCD 4OZ4A 4HIHA 4EUPB 1U8JB 5J3HC 3QORD 3L3HA 2P8PA 4HV8B 3QQDA 5FAAA 3B5TA 3PHQA 4UTBL 3LHAA 2A73B 2R1XA 3TA3D 2VJXA 1F2XK 3H9SA 2Z0UA 3MLTA 4LCWD 1E8YA 4PRIE 4WSGA 3U36B 4GAAA 5EBMB 4GQQA 4HSCX 3ILEA 4PRPD 3MV7A 5J5EA 4F8TA 1HH6A 1HESA 2R56L 4UTAL 3V5HB 3QJOA 2DLFH 1N0LA 2CNYA 3L5JA 3UTPE 4GIOA 2P5PA 3LZLA 1ODUA 4R84A 4X4XB 3VD3A 1BM7A 3LXUX 3EDEA 4B9KC 1ZS8B 2RACA 3MV9A 4HG4K 2FBJH 3UZQB 5KZCB 5E8DL 5FWRA 3D39A 3DYMA 3ARVA 3WIFB 2VZOA 1KN4H 4BINA 1CS6A 1WTLA 2ZG1A 4ACTA 5E2JA 1ETA1 2OSXA 2GTWB 5LDSA 2BP8B 5E9AA 4ZUTA 4GRWB 4NT6B 1BD2E 2OL3H 4X6BA 1F58L 2D7TH 3N85H 4FNTA 4ZFOA 5C1MB 2WQRA 3UABA 1M7UA 1L9QA 3VFWB 2FWOA 3PGDA 3JWNG 5E1AA 5JW4M 1XIWA 2APBA 1DEEB 5D5MB 5GRZA 4ZZFA 5ID1A 1DJIA 3DGDA 3N41B 2X2IA 3O6FA 1O6TA 1WEJH 3JWDH 2EDBA 4O02B 1CGVA 3EJCA 1DR9A 4XT1C 3CDGB 5CWSB 3WFBH 3C08H 3S37X 1YPZA 4XXDB 4D9LH 4WHCA 3FCTB 2Y7LA 4P04A 3MCLL 4YHKL 2WWMC 3K8MA 2X1QA 1AG6A 1EJOL 5HVHB 3S4SG 3CLEH 3U1PA 4FQXD 4KZEL 4TUKL 2BC4A 5EF1A 4YK4C 2H0EA 1DUZB 5F3HB 3T0XA 4BFFA 3IMWA 4M8RA 1UURA 3VE0A 1KTDB 1NUGA 2ADIB 4U1LB 5AG9A 4ZW7A 3LH9A 3U0TB 2EP6A 4GRWE 3CZFA 3RY6C 3QWRD 5KBKA 3KGTA 3ARWA 1AGEA 1A9BA 4IGBD 4L48A 1RJLA 3Q9PA 5CJBA 3EHBB 1TJHH 1FL6A 1LK3H 2WVVB 3WAKA 1QBBA 1U6AH 2F1BA 4G11A 4PGZA 5PAZA 3WIIH 2Y2YA 1HSAA 3CSFA 3W3BA 2AMUA 3NJIA 2XA8H 4XWOC 1G9ML 1FDLH 2ZZUT 4NO0A 4F5CE 4BGDA 3A4FA 1HEZA 3DJ9A 4G8GA 4PCTA 3SEPA 3TBCA 3QUZD 3LIUA 4LMQI 4MRBA 1XEUA 1T0MB 2OSYA 4GQPH 3OJDA 1JFQH 3K6DA 3BSHA 3HB3D 5HHNA 1BMWA 4JN1L 2VR3A 4CILA 2YAQA 2IMNA 2BNRE 2W0PA 1NAML 4JDZB 2C3GA 3GSVB 3PU7A 2LAGB 1MCLA 5HJGA 2J2ZB 4P5TA 4KKAD 4F7EB 2MSPA 2EE0A 4PJFA 2WXHA 2NRDA 5IQ9A 3QWNA 3QPQD 1FFQA 4OZHF 1B88A 2Y9RT 3ZPDA 2EIBA 1LDPL 5EC1A 4XP4H 3F7RA 2CDGB 1CLOH 3D8MA 3FQ2A 3VH8A 3OLIA 3RVVD 3AXLA 4PWFA 2Q3XA 5DD6A 4YSEA 4KI5D 3PAZA 2GFBA 4JY6B 2G5BB 1D2PA 1OOWA 2A74A 2ZX6A 3KWVA 5AAWA 5LQBL 4LBEB 3MV8E 1AG0A 2HRLA 4OCNC 1R46A 3VFSA 4I0KA 1WZMA 4LARL 2ZCKL 5GPRA 1RU9L 4F37F 4LPTA 4TRPL 5DUMH 3RGVB 5D8JL 2Y36H 3SKMB 5I8OH 4KJPD 2HG5B 3KEHA 4Y9GA 15C8L 2DMKA 4KWUA 2WMPA 3U9WA 2V2XA 1B2WL 4FTVD 2RH0A 4YOKA 1S78D 4W70A 5K39A 4QTFA 2WGXA 5DWUH 5ITFA 2XPGA 4APQD 1DHKA 3FO0L 3ECBA 3CSPA 5AAWC 3X3FH 2EEBA 2YFOA 1KCBA 4PJXB 4UQ3A 4BFRA 2XWXA 3KJ4B 3ASNB 3O0RH 3ZE1E 1M7DB 2G60H 1P5VA 1Q9WB 3E2HB 5D7IB 2B9AA 3ZDZF 4MNGB 3ENEA 3VI3F 4P05A 1NCCL 3TIDA 1WS8A 5HYJD 3B7TA 4K3EL 3GMRA 5IFJA 4XE0A 1KJ2A 3L3DA 2UX6A 1XF2B 2MOVA 4YNYA 3HB3C 6PAZA 4PV9A 2ZD0A 4MWFA 1U9KA 1FAKT 4QTIL 5EBLA 3VFRB 1FBIL 3GLZA 4JQIA 3S8WA 4GAJL 3S5LB 3DI2B 1CLZL 5HDBF 3KPSE 3CN3A 2BWQA 1KB5A 3ELQA 5DRZB 3ZBMA 5F3BA 5MERA 4CC1A 3LXCA 1BQLL 4PJDA 1PX4A 1Z0MA 4HIIB 4PRPA 4DK3A 1K8IB 3FYIB 1TQCC 2BRRL 4AYFB 1TNMA 1T21B 1TTUA 3PGCB 4XB3A 3MRMA 4X5QA 2ZKHH 3GMLB 4JRYE 4PWGA 1CXKA 1DVQA 4CSPA 1CLYL 2NT0A 3QUMB 4BA0A 5LN8A 2EEAA 3ARGA 4PJHB 1KEMH 4JPKH 4JQIH 2E6JA 3CHOA 4Y1SA 3RILA 1NDTA 4HPYL 2HRHA 1S5IH 4PRDA 5F3FA 5KUMA 3RUGB 3E80A 3X1GA 2HRPH 4J1UB 1XSOA 4GS7B 4KI5F 1U42A 3CZEA 4HKJA 1CGYA 2H3NA 1D5MB 1A7OL 1I7TB 2BS71 1DYZA 3MLZH 5H4YA 1OO2A 2JB6A 4X0KB 2BOCA 5JW5B 1E9QA 4GEJA 2R59A 3P4MA 4HIXL 3MBXL 4F8OA 1WBZA 3K2UL 4ZFZB 3D07A 2HUHA 2NY4B 2VDOB 2FSEA 2ZSVA 4EPSA 5KVMC 5I6KA 3LHPH 1SYSB 3PWNB 1FJ1B 1LD9B 3AZUA 2G75A 2HVKB 2J21A 2CCLA 5EUKB 5JHLA 3KGSA 3S9DB 2UWEE 4JB9L 4RFEA 3NFSL 4QOKE 4NQQA 4NFCA 3SDCD 5JLZB 3QWOA 1B0WA 3CC1A 4Z0BL 5JIHA 4IHOA 1XIWC 5DRWB 2CHWA 4C55A 5C3TA 5JOPE 4RRPM 3RURA 3K6SB 1IEBA 2LOEA 2AJXH 2XZCL 2PCFB 4CJ1A 3VW3H 5IJBC 4F8NA 2H2PC 3SYOA 3MOBL 2O5XH 1VAHA 3CZGA 3LPGA 5T1DH 5IQ7L 4DFIA 1DJSA 2GHZA 3DIDA 4NZTH 4ZUVB 4KDWA 1BJ8A 1AIFA 2AK4D 3G6DL 4HS6A 4XVSL 1G5GA 3LEVL 1PZBA 3MSPA 1VERA 4LHQB 3RY6A 1FO0H 1IGIH 4WENB 4I0PC 4FERA 5T1LD 1WIUA 1AGBA 1ZY9A 5FUCC 5JW4R 4OGAC 2YA1A 2NNRA 4PJAA 3QI9D 4X80H 4ZQKB 1KCVL 1KSRA 3NCYS 5ETUA 5D1XE 3PNWA 1LK2B 2J8UE 3BO8B 2OR9L 5IMKA 3UZVB 1PEZA 1DDHB 4YFLF 4FJZA 2EO1A 1CFMA 3DUUA 5ABAA 2BNQD 3IPFA 5E6YA 1H8LA 3BAXA 3P69A 4WUUE 2V5MA 1N5AA 1TJGL 4KROD 4AIZA 4ORZC 4P49A 8FABB 3EJYD 1VB9A 1YEFL 2VGLM 3TFKC 2E75C 2XKSA 4FTVB 2NX5B 4M7LL 2YQBA 4AEHL 5CJQL 1ZIAA 3D25A 1EFXD 2AJZA 3ARDB 4MMZC 2UZYB 3NACH 2J25A 3FCTA 3GRWL 1Q72H 2OR8A 2EH7L 1AKJD 4P3WA 3VFNA 5C0RH 2N0KA 2LU7A 1NJ9B 4IJ3B 2VW6A 3R8QA 5LNGA 3T6WA 3RL2B 1ZEAL 2JQMA 4GS7C 5ESQB 4PS4L 4JFFE 1HEZB 2IDUA 5LWYH 3PP3H 1NCGA 5I1KH 2HFEA 3MCG1 4FYTA 4LF3B 4JKPL 1TJIL 2DN7A 1UCTA 4FN0A 1TVHB 1CDGA 1LHZA 5CXPA 2F8IA 3LNEA 3K6IA 2B1HL 2X4SA 3BFWA 4NYLB 3ZGIA 1OOAA 3KDMA 3B2PA 2E9IA 2W65B 2K6WA 3OB8A 4M4RA 4N6RB 4NERA 3LNFA 3GSRB 1T7XA 3LSOA 3PQYB 3CMOH 4HETA 4OLEA 1TVDA 1OWRM 1JN6B 2BVOB 5GQBA 3OL2A 1BBJA 4C59B 2WZ6A 2HSIA 2J6EH 5AQ0A 5FGSA 2MQGA 2NLJB 2OX5A 3NSYA 4AH2B 1FPTH 3ORJA 3MNZB 3FQ1A 5HHVH 1AY1H 1FYTA 3EBGA 4RMBA 4FS0A 1QI5A 3CN0A 4KJPC 3VRLF 4PH8A 4O58L 3GSVA 2Z8VC 4WNQB 2KBGA 3U2SA 2E46A 2QHLA 3NJXA 4D0DB 5IFAL 4PRNA 2R4RL 4AT6B 3PWUA 4GG6B 2PP8A 4OFQA 1AD9B 2VZ1A 2VITA 4EN2A 1KN2H 2W0KA 3CUPA 5EC1B 1XGUA 2APTA 2QFRA 2A77H 4YHMH 2ENSA 2XKUA 4UIMA 3ARGD 3HUJE 3IF1B 3F05A 2PYEB 5TH2B 4BFIA 5DD6B 1MQ8A 1IAIM 2CO4A 4MNQE 1GYAA 4MDJB 4OR1A 2VUOA 1UEMA 4WHYH 3T71A 5I76A 3GXPA 1PCSA 4MNHB 1VFAA 2DYRB 1A3QA 5JIIA 2ED6A 2YARA 3KPRB 4MHHG 4M1CD 3UYOD 5IF0A 5CCGE 1RIUL 3RL1A 4L3ED 1MCKA 1NUDA 5CAYB 1Z9LA 1JYVA 1RJLB 1SDYA 4PPTA 4RZKA 5IB1A 2G3ZA 1L3WA 2WVVA 3P9WB 3MRQB 4YSSA 2IGTA 5ALCL 5EBLB 3IDJB 3O2WL 1Q0XH 3W0WB 1O6SA 3HN5A 4PBWD 2CALA 3GHPA 3O3AB 43C9A 3VXOA 3ISWA 5B4MD 3WUWA 4LSUH 1GC1C 4O5LH 2VMDA 3ES6A 3OPZH 2C3HA 4WNSA 2UV3A 2NUPA 5IVXE 2EEFA 2ATPB 4N87A 2CLRA 4NHCL 4HS8L 3KPRD 3PHSA 4FXKC 5DZVA 3BRFA 3DMMA 2WWNA 2DIAA 3ZKMC 2IADA 1JL8A 2YN5A 2DI9A 3U2IA 2CDEA 1NMBH 1KIPB 3WAJA 1JPTL 4L37B 2H1PH 4Y5VC 5EA0L 3VFRA 3U6RA 3T6QC 4H0IA 1S7RA 5IQOA 5IESL 2AXJA 1T1WA 1NCOA 5DWPA 2F7RA 4H88H 3V7AG 5JQ6H 4ZFOL 4YBQC 1M42A 3E1ZA 1GZQA 4KMTH 5MERB 5F3BB 3OGCA 4X5PA 4JHZA 1AZUA 4CJ0A 1JWMA 1ILUA 1LQSR 3QFDA 3QZWA 3BYYA 1XGRA 4LZKA 2BOCB 5JW5A 1OARL 4NRZB 5I1LA 3KWWA 3ULSA 4ZOCA 4Z77B 4N1CA 3PGCA 2AKRA 4G8GD 4I8DA 4KO5A 1NLDL 5I1CH 1I9IL 1CD9B 5F0JB 2HLAB 4L4JA 4NFBA 3C87A 3LCYA 3VJ6B 1L9SA 2PXYC 3FUMA 4IBUA 1J9RA 2IAMD 3U4KA 1MKFA 2DS4A 3HMXL 4JMNA 5KVDH 1XF3B 1AXSB 2EECA 1A5FH 4PVMA 1FDLL 3AY2A 4H5SA 3BPLB 5JO5B 2YO3A 1BZ7A 4HAGA 4GFXA 3TO4C 2HT2D 4PCSA 4TUJA 4A2EA 4D9QE 5FFLA 3QDME 1Q1PA 2A83A 3BVUA 2CNZA 2WYHA 3QUKB 4UM9B 1F90H 2VDOL 1XGPB 1PD0A 4QCIA 2FEEL 3VXSD 1C5BH 1KENH 4JN1H 5L0QB 4FQLH 3ATDA 4ZTPH 3CBKB 3WD5H 2ADJB 5INDB 1INEH 1PZDA 2GPZA 5TDNB 3VFMB 1OTUD 3SSGA 4WJ5A 3ULVE 2F53B 5A3IC 5ITBH 5JLZA 4XN2A 1WAAF 2B1AH 2PO6B 1EFXA 1ACYL 1AGDB 3UJTL 5DCCA 5SX4H 4EN3D 7FABH 1X5YA 2NNXA 4D2NA 3VMNA 2WKLA 1JPFB 1EVUA 1CK0H 1KPRA 1RMFL 2VMFA 2K8QA 3HG1D 4I48A 4UYQA 2BHFA 2QQNL 2WIMA 2NDGA 1JBJA 4Y88A 4MZRA 4MGXA 5F70A 1BF2A 5MEQA 2KZWA 4L3FA 2CE6A 4JRXA 2I24N 3VQMA 4EQ3A 4Z7QE 2DD8H 4YJZL 5K59F 1U30A 1RZQA 5DMIL 4ONHA 5DUJA 3TN0B 1N7ML 4GH7B 4OF0A 5D2LE 5KBMA 4NC1E 4WIQA 1PLCA 2WLLA 2AJZB 2OP4H 3CZLA 1H19A 3U48A 1MHHA 3PCYA 3BOVA 2DBLL 4IU2B 3SDAC 4Z76A 4HJ0C 4S1SH 2JKXA 2AXWA 2W95A 4MAUL 4KK9D 1OHQA 4WHTA 4X9HA 4BYHA 1G0XA 2VMEA 3SDAD 1MLBA 4G9FA 5EUOA 3VI3B 2P8MA 1WA2X 1EGJA 3E38A 3LPFA 2X4NB 3V0EA 4X4YA 4AMWA 4FI7A 2FYYA 5KAQF 1A65A 4QRRA 2KLRA 4TVUA 4AVIA 5I1JL 5IEHA 1IM9A 3AQDA 1I3GL 2E4FA 5D2LB 1ZLWH 4E36A 3QORB 2HPTA 4BWUA 3EJJX 2OQJA 4MXVF 4N3UA 3KPTA 1NUNB 1FZJB 1NCCH 4Q6KA 4WW2A 5FF6A 3SJVD 1Q0YH 1YEHH 4KFZC 3BEWB 5IJKC 1H5BA 4K3GA 2X0WA 5JDSB 2E9WA 1XCXA 1N3NB 2VAAA 3LQZB 4IKIA 4OFPA 4OJYA 4CGTA 3ZTNL 1GMIA 4QTIH 3P0YL 1SLXA 3AACA 5T3XE 1CIUA 4WFHD 4GRMA 2RQEA 4M7KL 4U1NB 3W57A 4UOW0 3ZXAC 1JN6A 2BVOA 4EI5A 3ZLQC 1OD9A 4M93C 4B50A 1QFWH 3KPPA 3HC0B 4NM8H 4Z0XB 4PJXF 4I0CC 3VDAA 5JA8B 2LU3A 4UQEA 3VQ2C 4MAZA 3D85A 3V0VB 3VD5A 3TBTB 5CU5A 4TRPH 3FQNB 1F4HA 1SN5A 1TVHA 4JFZL 4UDUB 3WU1A 2PXYB 4DUVA 2L0DA 4N0RA 5CF3A 1FGNL 3H9SD 1LK3L 4L3CA 5EO9A 3DGCR 3ULVC 3B9AA 3R19A 4XCYA 3JWDC 4BBWA 4LFHG 5IREA 4BH7B 4XODA 4FXKB 2BX5A 3V5DB 1DANT 3HCVB 1OSZB 4OV6F 3MLXL 3X1FA 3ZTDC 4HZLA 3ARXA 1FORH 1MEXL 4HBCL 2D9CA 4Q56A 3QZMA 1A3RH 3REWA 2ENPA 2AF2A 3D3VD 3FUJA 1ZLSH 4UTAA 4FABL 3QUXC 1KXVA 3EGXA 4WO4C 5F9WB 1NAKH 1G0DA 1I7RA 3L16A 3Q44A 4JHVA 1GYVA 4OTXH 2HZHA 3LHPL 4MBOA 3QS2A 3ULUH 4OD3L 5EEXA 1YEGH 1A6UH 4IRSC 1UM6L 3PYCA 1L9MA 1YJDH 3EO9H 1VACB 4X6CE 1UKQA 1PGRB 1HK6A 2NTFA 4LP4A 3UMTA 4AW4A 2EVIA 3J2PA 1T4KA 4IMKA 2Z35B 3EF4A 4M4PA 3MFGB 2QELA 3RWIB 2PYEA 1S8DB 2A4CA 1BQRA 5J9PA 3HE6C 4ZW8A 4PWKA 4LPWA 2JXMA 2NXYB 4DWHA 2MPAL 5T1LA 2A9NH 5IOPB 3QS3A 5CIPB 5C97A 2WLNA 4OKDA 4ODSL 1F4YL 3F65A 4WWKD 5JOFA 5JZ7D 3E8UH 3DX1A 4PW9A 3V4PB 4BCXA 3KJ6L 1UFUA 1O0VA 3QIWB 1AHWA 1QLEL 1RV6X 2WQ8A 3TH4T 1U8CA 1U21A 3FTGB 4OCMC 1QPPA 1YLBB 2UYLA 1HSBA 3OQRA 3TEUA 1D5RA 3QCVL 2QR0B 3IFNL 1F4WL 1JPSL 4FQXA 1GJIA 3II2A 2ARWA 1L9NA 2PCPB 4P2RB 3G5XB 1WE5A 3TO2B 5KYXB 4M6AA 1E7VA 3EYSH 4P23B 5FUOL 4KK5C 4ZOAA 5E6RB 1G84A 3TZVC 2HKFH 3D4GA 2OMZA 3SOBH 5K9OB 4L3AA 2CIIA 4AIXA 1JZEA 4NJAH 2O5ZL 2N7BA 1BIIA 2QMJA 4WWKB 1XD0A 4IMKC 3OHXC 3P4NB 3L4YA 4F57H 5J7CC 4YAQA 4BA8A 1M71A 3AB0B 4HD5A 4P2QB 4Y0GA 3INOA 4NCC2 2CDEB 2CD0A 3GSNH 1OSEA 3ZSSA 2R69L 1BAWA 3BN3B 1M05B 4RAVA 2O5YL 4TQPA 1HKLL 2X4RA 3GTNA 1U8JA 4WO4A 1PQZA 5FO7A 1JHTB 3DJSA 4NUJA 1FBIH 1UXSB 4G8GE 5EWIH 4ANKA 3QQ9D 4A68A 1MCPL 5T3ZE 4DEPC 3WL9A 2VDPL 3BZFA 3JUYA 4UT6H 2AEPL 3AAZA 3L3IB 3CDFA 1GGCL 5JUEL 4N22A 3NIFF 1OP4A 3VRIB 1NBYB 3TEZA 4PMFA 3IE4A 3FO2A 5L6YH 2YSTA 4LSRL 4YDZA 4JM4L 4OM0H 1S9XA 4Q2ZA 5AB1A 3P40A 1RU9H 4AX3A 1BIHA 1IGJA 4JRXD 4ODVL 2NYYD 3CQQA 4IDJH 3W9DA 3EO1A 5DZPA 2JCCA 3T77B 3KYOB 3C5ZA 1PDKA 4N2OA 3DK2A 2ED9A 5D4IA 2HA1A 5SWQA 5K5YA 5KS9A 4IOIB 3F12B 1T5WA 1ORSB 5I17A 3DECA 5C0GA 1NICA 4QMEA 4DPRA 2K3TA 5EIIA 1NCUA 3DX8B 4XTRC 4ZUUA 4Z7VE 1RUPL 5EO1B 1O6SB 1YMME 1JZDC 3GSUB 3Q3GB 5CMAB 5JIPA 1ZGLP 1J9QA 1UOWA 4RSYA 2PF6A 3FMGH 3DVGB 2YPVL 4N24A 1RY7B 2LLGA 3ALWA 1CICD 1KV7A 4QYOB 4BH8B 3MBXH 2ZOOA 4X4XA 2FEDC 2JJVA 2MIZA 1TXKA 4JRXB 1W0YT 2WBJB 3UG5A 1WTGT 1HAUA 3VFWA 4DP9X 3ZHNA 3MNVA 5BUPA 4JZNA 1BOGB 3GSNB 1KG0A 4HS3B 1OTTD 5I71C 2NY0B 4OB5L 1ZVSA 4OLVL 4Q9BA 4WW2C 3NACL 3FO9B 4JB9H 4I3GA 5CEZE 3CK0H 3MRHB 5A3ID 4GEIA 4XXDA 2VM3A 2XG5B