3RPTA

Crystal structure of the anti-hiv b12 scaffold protein
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
276
structure length
253
Chain Sequence
DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWHNQHQITGQVDALMSAAQAAGKIPILVVNPFEEGKQWIDEFAAGLKNRPAYIIVDPGAWRFAAYAGKALKAGSSQARIYFDAGHSAWHSPAQMAAALQRADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNESCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase E-2
publication title Computation-guided backbone grafting of a discontinuous motif onto a protein scaffold.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Hydrolase
total genus 94
structure length 253
sequence length 276
chains with identical sequence X
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3rptA00
3VOGA 1HGYA 3RPTA 3A64A 1CB2A 1OC6A 4B4FA 1TMLA 1HGWA 4AX7A 1UP2A 1QJWA 1OCNA 3VOFA 1QK2A 1GZ1A 2BVWA 2BOGX 4I5UA 2BODX 4I5RA 3ABXA 1UP0A 4B4HA 2BOEX 1OC7A 1OCBA 4AX6A 1DYSA 2BOFX 4AU0A 4AVNA 1OC5A 3RU8X 4A05A 1UP3A 3A9BA 3VOHA 3VOJA 1UOZA 3VOIA 1OCJA 4AVOA 1BVWA 1QK0A
chains in the Genus database with same CATH superfamily
3EXSA 4QCEA 4HN8A 2LLEA 2PP0A 3W22A 3BO9A 1K4GA 3WH6A 1V51A 4IP4A 2PRMA 2WCSA 4B3KA 3BPWA 4OU1A 1EGVA 2EXOA 1K02A 1LL4A 1NJJA 4UBPC 4HGXA 3VNZA 3I3EA 4US6A 1VB9A 3CT2A 1D7KA 4KEVA 4AEOA 3DGBA 4XZNX 2E25A 3KLLA 1EQPA 3PWGA 2FTPA 3NOYA 4HA3A 3H2AA 1EYWA 1T96A 1FHLA 1D8WA 3E2RA 2VDHA 3LNPA 3Q37A 3F5KA 4JTTA 2E7FA 4F0RA 5AC7A 1UD8A 4C6QA 2Z27A 2XH7A 2A3HA 1VCFA 4ACZA 4XKYA 2VEFA 2NW0A 4GYFA 1HP5A 2BS9A 5CG0A 1PHQA 3B9AA 4C6FA 5KZMA 4F2BA 7XIMA 1F3WA 1R87A 1OHLA 5IFPA 1D2KA 3OIXA 3L7RA 4GACA 4BQ4A 5I00A 2PDBA 1MW0A 2XDFA 3VK5A 5HNNA 1A5MC 1XGEA 3VD7A 3GU9A 1YYAA 1GJWA 2CZDA 4CU7A 4ZL1A 3GG1A 2VC5A 6CGTA 3T8LA 1GZGA 5D32A 4DO5A 1W1A1 3P61A 5RUBA 4XIAA 3WBWA 4LBRA 2HDJA 4XWUA 4JDYA 2J4GA 1Q7QA 2QR6A 3KRBA 2IQ0A 4HNNA 4N4PA 3TQ0A 3NYZA 2WM0A 3BG5A 3SR7A 1JAEA 4DUVA 1NARA 3RYSA 4HQVA 1F2JA 5D9OA 2ACSA 4NZCA 3LI1A 3SO7A 4XQ6A 2C0AA 5BWAA 2FZNA 2PE4A 4O16A 2VEPA 1XIGA 4L9YA 2A3EA 1JUKA 3WYZA 3NEHA 1TZZA 4J3TA 3B0UX 1XQKA 1V7YA 4NL1A 1XIJA 3BGGA 2VC7A 3CQHA 2Z00A 3BG3A 1WNOA 5A2AA 1JUBA 3PZUA 2GFTA 1UZHA 2EPOA 3BAKA 4D6HA 1XG3A 1Y8BA 3N3MA 4GVFA 3NDOA 2HE8A 3S47A 1XI3A 1DPMA 5A8NA 3IPWA 1HF6A 3DEQA 5E1QA 3EOOA 5FD0A 1MUCA 4GH1A 1QHPA 1Y5VA 1FQ0A 2JIEA 4HSHA 4KWUA 3UR7A 2XH2A 4FX8A 1VFSA 3NPUA 5BCAA 3W2MA 3VM5A 1FOBA 2QUMA 2WNQA 2VRJA 3NTYA 3PK7A 4JTUA 1BYAA 1WUFA 1PCKA 4IJCA 1JCYA 1QPNA 4Z17A 2VOTA 4PMVA 1OABA 3DU0A 2FDMA 3A22A 2OJPA 3LN3A 3OYXA 1JZ8A 3AAMA 3MWCA 4XTDA 5M1TA 3FS2A 1F05A 3ORWA 2Y4SA 1E0TA 3CM4A 3STGA 4XSMA 4EAYA 1LP6A 3DESA 3G1HA 1KKRA 3BLLA 4M6PA 1TCMA 3OW1A 4XG1A 1RH9A 3ARSA 2IXUA 3BAXA 3NDYA 4FA3A 2ZX8A 4XD6A 3VKCA 1UP0A 4YJ5A 4QGCA 4LUSA 4JTSA 4E38A 3A9BA 3F03K 2ABBA 1EP3A 5CPTA 2BBFA 4PFHA 5A94A 3F7JA 4XZLX 1MQRA 3TN5A 5A69A 3EPMA 2V3GA 3A24A 4C91A 3EDKA 5I77A 2QPSA 3K1GA 1VKFA 3VZYA 5D03A 4EAMA 1R7AA 3WJYA 1BXBA 2ZADA 4B3ZA 5F2LA 2OEMA 3OGVA 3FOKA 3W76A 1SFJA 2QKFA 4M1RA 4PC8A 2CWNA 8TIMA 3E2QA 3RCMA 4DYKA 1OF8A 3UG8A 3YPIA 2ZE0A 2PCQA 4IQLA 1CXHA 2DZSA 1YX1A 1C8QA 1JL8A 3ANUA 2NLYA 4KCVA 3PZQA 1SJBA 3RRXA 1TRDA 3B8VA 3SCRA 4PTDA 1ZFJA 5IHSA 1JZ7A 1W1TA 4NU7A 2PA6A 2J6XA 3F2CA 4LALA 2O9RA 4WD0A 1JCJA 3TP4A 3SQSA 1XYCA 2WC7A 3P0XA 5C5YA 1IXQA 1G4SA 2FMOA 4CNSA 1B31A 4PL2A 4J3UA 1E43A 3GR8A 1XYAA 3SCVA 3TFCA 1DXEA 1FKXA 1FH8A 1ZJAA 3GKAA 1IIHA 4MOZA 1U22A 3T6CA 3PM6A 3ATYA 1R9XA 3CGTA 3A3WA 3GIQA 3CHEA 2OLSA 2DH3A 4NHVA 1N8WA 4C6MA 4C7GA 4KPLA 5KSWA 2XWEA 3R7MA 3QOKA 3TJIA 3GH7A 4BWLA 4C1KA 4LY4A 4E8DA 3T4CA 2WYSA 3UGRA 5ABFA 3GDTA 2BVYA 3NM3A 2ZRXA 1FWEC 1QVBA 2VGGA 3RM4A 3S9IA 2NXIA 3UYIA 2D73A 4MMWA 1U5JA 1TREA 3M0LA 3CS2A 3NWRA 3ZVHA 3E3HA 1ODZA 1L6YA 1JI2A 4EPDC 3CXOA 2DIKA 5HWJA 2CERA 4JN6A 1R2RA 4M1BA 1A3XA 4WXZA 2V8ZA 2UY5A 3EDEA 3IAQA 3KS5A 3WL0A 5FJUA 3QFEA 1VD6A 4DZHA 4RR4A 4E4FA 2CLOA 4UFHA 1KCXA 2J8FA 4Y96A 5DRIA 4KKXA 1U2YA 4AZGA 2CETA 4PMJA 3URBA 1SM9A 1GKQA 1EUNA 3BW3A 1VFTA 2A7PA 1ZS2A 5ABTA 1SMDA 4ZOBA 3QQWA 2CHRA 2R24A 1XG4A 1QWKA 3HPFA 4EF9A 4RNIA 4A21A 4PUEA 4C1LA 4BR1A 1LT8A 5BU9A 4KCTA 1BGAA 4ECLA 1AQ0A 4YCPA 3U5UA 3VIOA 1A3WA 5B80A 2QGHA 1GVQA 3NGJA 1W3KA 3C0JA 4O19A 3RITA 2AAMA 1KA9F 1GVFA 4N02A 1ONEA 3TW6A 4E2DA 2PU0A 5DELA 2VM8A 3MDUA 1E71M 4RUBA 2G96A 1G4TA 1S2WA 3W72A 1A5AA 4PUDA 3IJ8A 3N15A 4PYSA 4GD0A 4QDWA 1UUOA 1W3IA 4J3WA 2WKJA 3KTSA 3S1UA 3G0XA 1XQLA 2REQA 3DFHA 2OLHA 2OCZA 2Q8ZA 3EXTA 3CIVA 3E5BA 3G1XA 4CGTA 3SB0A 3MKCA 3WD1A 2A0NA 4KFPA 4BEQA 4PTMA 1W3TA 4AVNA 4CUCA 4X9SA 4MLRA 4YVPA 3N1AA 1M65A 2GJXB 1WZAA 4XBSA 3TXZA 3W28A 3OLGA 2FGZA 2OFJA 1J10A 4B91A 3RLGA 2J7CA 5XINA 4H41A 1N7KA 4QP0A 3PHAA 2WHKA 2QT3A 4JTQA 3RX2A 1BSLA 1EZ2A 2W61A 2Q6ZA 5KITA 3RO6A 1EPVA 1C9DA 3IRSA 3L5LA 3HV8A 3P0WA 4I8YA 3T44A 3ABRA 5C9WA 5FSDC 1AL7A 3OODA 2W4XA 2AMGA 1CLKA 3M0XA 5AB3A 1R0MA 4WDWA 3A47A 3NDZA 4NKCA 2WMFA 1KTNA 1JFHA 2NXHA 3W2JA 4PA8A 5BOOA 1FHDA 1ADSA 2YW4A 1CWYA 1E0VA 2PD5A 3BGAA 2CITA 4R85A 3UXAA 1CGUA 2E40A 1QW9A 1TTQA 4GKLA 2OT0A 1RALA 3OLEA 2DJLA 1BHGA 1OGBA 3SUVA 3ZQ9A 4GINA 4C1NA 2F84A 1R3TA 1L6WA 2QCFA 1T8XA 3CQ0A 3NL5A 4GX9A 2VELA 1S2TA 4QX4A 1KTBA 3A6OA 3K8LA 4IPIA 1H62A 1GOOA 3S46A 1BEUA 3CHVA 4F8XA 3ABOA 1I0DA 3E0IA 3PTDA 3AFBA 1UPMB 2OWWA 2JGYA 4I3GA 2YDQA 2C1HA 3G1YA 2YL5A 3PWIA 3UPMA 2FJKA 1VF8A 2WKLA 4QQ3A 4HYVA 4GI8A 5EPDA 5XIAA 2QULA 3WDHA 2YW3A 1TR9A 1UHVA 4HVXA 3OO2A 2PC4A 3CT7A 4HSNA 3WLPA 3CZGA 1JF6A 1JQVA 2MUCA 2PTYA 3UG4A 3PZIA 5L6UA 3VKBA 1XS2A 2W0UA 2PZNA 4PL1A 2QJGA 4I9AA 4LAZA 1ZAHA 2Z7KA 2C7FA 3NQMA 3E5PA 1XXXA 1BGGA 1MFVA 4BY3A 2R1PA 2YYTA 4EXQA 5FACA 3KZSA 4UFIA 2WANA 3SGUA 3AHTA 3REQB 1XLLA 1Q66A 1FXPA 1TMLA 2PDNA 4J1OA 1Z6KA 2EG8A 3EMCA 1RQBA 1W1VA 4Z2GA 2QDHA 3WK0A 3LSBA 2FHBA 4JEJA 3B8SA 1FP8A 3RMJA 1UD2A 3OP2A 2ZDRA 4URIA 5EY5A 3GHTA 3QTGA 3V36A 1C93A 4ZE4A 1JUEA 4B3LA 2EPMX 1Q6CA 1OY0A 2VR5A 3L4YA 3TMQA 4AIEA 1ZB5A 1H7RA 1OC7A 2Y88A 3M7WA 2CESA 4GXMA 2OSWA 2XGBA 3RAOA 4CU6A 1AH3A 4X0VA 2WHMA 2ZZ2A 4FR1A 2X40A 3O6AA 3PZOA 3ZVIA 5M5DA 2UY4A 3G1FA 2CZ5A 4QG6A 5EU9A 4IFRA 3EB2A 1XV8A 2VFEA 3U5YA 1BG4A 3UZJA 1NFPA 2FFCA 1P7TA 3GB6A 4BI6A 1MRAA 1VLIA 3TR9A 5EKYA 1MXDA 3LCHA 3KCLA 4R53A 3WQCA 3AMCA 1BVWA 4Q4QA 3P80A 3SY1A 1VJIA 8CGTA 2Y61A 3GNPA 3MYOA 4B90A 3FN9A 3R89A 4RCXA 5CKSA 3R4IA 4M19A 1H7XA 4NNCA 1SFTA 4PUUA 1V4YA 1DJHA 5CSRA 3CWOX 3OVGA 5ENLA 3WEZA 1BVZA 3AXXA 4B5TA 3Q45A 4E8GA 4MJ4A 1VIWA 4ZOCA 1N8FA 1GWJA 4FOJA 1B5TA 5LXXA 3MVIA 4WUIA 2QAFA 2WJEA 1WA3A 1S5TA 2F6UA 3DFPA 1HUVA 2IS7A 3R8RA 1X6UA 4OKDA 4UMCA 4GFIA 1GG1A 5FJRA 4UFJA 4H6EA 1A80A 3U2OA 1FCVA 2NX1A 3FJ6A 1WZMA 4Z42C 2ABAA 4QS6A 1E4IA 2C91A 3BV7A 4BK9A 1GUVA 3VIKA 2OU4A 1NFBA 1ONRA 4PMYA 4K6AA 2GWGA 4YMZA 3QGAC 4MNMA 4QJ4B 2A6NA 3L0NA 4KMQA 1YNQA 4HJFA 4AX7A 3DGRA 1J79A 4WRHA 1A47A 1Y5XA 3O8AA 3LLFA 3GBDA 3W7DA 2E9BA 2PF8A 5AECA 3WD3A 3HTWA 2G3IA 3UP8A 3OZYA 2J9YA 2GJPA 1PYFA 4M8UA 4ERAA 2HXUA 5DCEA 1VFOA 5FIPA 5HA7A 2VT0A 2FH6A 3IIXA 1XBXA 1SJAA 1WDPA 1M5WA 5A6BA 3T4WA 2ZIDA 3K46A 1REQB 2YSWA 4AVFA 3IRDA 3IJ9A 5HBFA 1Q5MA 1A50A 3L5MA 2NVDA 3I68A 3A4AA 3UPWA 4DBEA 1JXJA 1UW9A 1PEZA 3WD4A 2OEKA 5CPMA 4AMCA 3AJXA 1HL2A 1CGVA 4OT7A 1SFLA 4IIGA 4DNMA 3FK4A 3G1RA 1EJTC 4L4PA 1TV3A 4R3UA 3DBNA 2VEKA 4O50A 1V0NA 4W7UA 1VHNA 4MZ1A 1IXOA 5DCDA 3VOIA 1BWKA 1WYIA 3C5QA 1LBMA 2GQ8A 5KEZA 2J27A 3B0XA 1EWDA 2VCBA 4DI9A 3BJFA 2AL2A 3QYQA 3ZR4A 5FOOA 3T78A 5HJYA 3ITXA 4PB5A 4OGZA 2PDLA 1TZ7A 5I03A 5AYZA 5A8GA 5MHBA 3QY8A 1T6MA 5AVNA 3N6JA 3VOCA 2QDGA 1G94A 3FAWA 4WDXA 1QDSA 4GUHA 2GGJA 2BMBA 2FGBA 3SCNA 5D8ZA 3K4DA 3LXBA 4ZBCA 3AU6A 1S1RA 4WHBA 3SEPA 2ZICA 4QG9A 1XIBA 3SURA 3ZR6A 5JH2A 4ZFCA 4IL0A 1L6GA 2DSVA 3PTKA 2XN2A 3BWWA 1OD0A 3H24A 5EL1A 2WHJA 1I60A 4I9TA 3VDHA 1VCGA 5A2CA 3ARQA 3G1SA 1FKWA 1FHUA 1TMQA 2QVNA 3BSGA 3B8IA 3WF2A 1TPB1 1IXNA 4KEZA 9XIAA 4MM1A 1KM2A 2VOMA 4KW2A 5GNXA 2F2HA 3OYZA 4EPEC 4R9OA 2W66A 1RV8A 3H53A 1DTUA 2YKKA 4OIFA 5EFDA 2DUXA 3P2VA 1IZKA 1EGMA 2BY0A 2CW6A 3VD9A 4PULA 3VOJA 4CCEA 3ERPA 3C86A 1EFZA 2VL4A 3GQYA 4JFSA 4N9BA 2PDYA 5HR6A 4PUKA 5CLWA 1KQZA 4DZAA 3VCRA 4MB1A 4PFMA 2DZXA 3PUDA 1ZJIA 2F6XA 1TX2A 4HK7A 4RX0A 1OWQA 5CC5A 1R30A 1RUSA 3GDMA 4Q8TA 2PTZA 3M0VA 1LRNA 2JF6A 3AWNA 3Q94A 2ZXAA 3KL5A 3AYVA 1W5MA 2A3LA 4HIBA 4F0KA 3WFAA 1L2UA 3WNNA 3PZNA 1UQYA 2BOGX 1W8GA 1XGZA 4PMDA 1KV8A 4IL2A 3RCNA 2ZWYA 4GUJA 2VX7A 3MUCA 1SSDA 4G7FA 1DJXA 1HTIA 1Z3NA 3VPLA 3IJ7A 2G3NA 1E9YB 5LIKX 3PBVA 3R0UA 2JKAA 3FLUA 3LBCA 2PDJA 5BYWA 4W93A 1XIHA 3G1AA 2OWXA 3C8NA 3L21A 1KLZA 2AQWA 1FWSA 4A8LA 3W81A 3L4WA 2GQ3A 1LG1A 4W5ZA 2R14A 3HJZA 3V1PA 3VDBA 1H7NA 3DDMA 4JPGA 1QNOA 5AHNA 3JUGA 3W7IA 4PMXA 2Y1HA 4B4HA 5F4WA 3PP7A 1MXSA 1BRLA 3FVMA 1S2UA 5EMJA 4N7QA 4U5KA 1UZ4A 4G56A 2GGIA 4GUGA 3NGFA 4C7FA 2BGQA 3NO1A 1S5WA 1PZ2A 3RJYA 2VC9A 3WLRA 3RO8A 3CV1A 3S5SA 5CH9A 1UMLA 1OB0A 1ZLPA 3PWAA 3Q4DA 1F74A 5DY2A 4K1WA 5JMUA 4S2CA 2VKZG 4NAFB 4D9PA 4D8LA 1K4HA 2YR1A 5AOUA 4RPQA 1C7SA 2Z29A 1JZ2A 4HD5A 5EMKA 2XM2A 1XD0A 1EX5A 3IVUA 1R38A 2VFGA 1XLEA 4JQ3A 1M6JA 3TLQA 4UTUA 3QZ6A 1DQXA 1DORA 3I6TA 4O13A 2QHAA 1KXQA 3NIYA 3A23A 5D9PA 5XIMA 2OT1A 5EMLA 3DKJA 1BWLA 3TZFA 4N4QA 3QC3A 4PB3A 2X1IA 1JZ4A 1CNVA 1EP2A 3MI3A 3PC0A 5DBUA 2EGZA 3L4VA 3CV7A 1Q6LA 3D47A 2HWGA 2VX6A 1MWOA 4HOXA 1OFBA 1PPIA 3D3FA 2CLHA 4B5WA 3CTTA 3F4NA 1VJZA 1YPFA 1VGAA 3H21A 1X6LA 3WJXA 5DQPA 4NUWA 3N34A 3S5ZA 1VPXA 4ES4A 3L66A 3W85A 3BMVA 4CNOA 2C0HA 2QJHA 2J75A 3W7KA 3MMUA 4ASTA 3HMJG 4BI7A 4EPKA 4H8UA 1WKDA 1TV5A 2FYMA 4QRNA 1F3EA 2H9AA 1Q45A 2E4TA 3S5NA 2KZHA 2J47A 4PR4A 1ZUAX 3L0KA 4GQRA 2R1KA 3QW4B 1W32A 3MP5A 4L6HA 1TPC1 2HNEA 3NQ6A 5AHIA 3ZS4A 2ZYFA 2J9ZA 2FLIA 2QAPA 3BLDA 3W75A 5A6BD 1IT7A 4MY9A 1UP2A 5TBOA 3WLSA 3L2LA 1XLGA 1PVNA 3EKGA 4XO7A 2GQAA 3VNMA 1POJA 1A0EA 4F2UA 2F6KA 3LHVA 3HN3A 1ZL1A 4QSHA 3UCDA 3KFTA 2VZOA 3OB8A 2Q3OA 2XH0A 3LGDA 2PD9A 3ABQA 4FNQA 1IEXA 2V2CA 5HWMA 1UBPC 4MKSA 4U3CA 1VFMA 1Z48A 1F07A 3SCOA 3W82A 1E0WA 5JH1A 3ZT6A 4CD8A 2XGIA 4S3BA 4F2TA 1XLKA 3N25A 1UR3M 3QHMA 3UESA 1UR2A 2BX7A 4ZXOA 2DH2A 1W9UA 4RK8A 3TYEA 4ICMA 2C79A 1OVDA 3LTYA 1SW3A 1VIZA 4NASA 4BQ5A 2FZBA 4NQ1A 1GW9A 2GGHA 4XISA 1UB3A 5M2FX 3WLMA 2BWGA 2JGQA 4F66A 3BLKA 1IV8A 1JAKA 1G7VA 3F4DA 2CHOA 2D0GA 2VR2A 2VEIA 3I3DA 3P5ZA 4CVUA 2Q8XA 4UCGA 4MY1A 5HWNA 3NQDA 3VI2A 3MDWA 2BG5A 4H1ZA 3V0TA 2WVSA 4CD7A 1R9YA 3ONBA 4BEUA 4DJEC 1PJ9A 4DEFA 3BCDA 7PTDA 2ZDSA 4KRUA 3M7SA 3E2SA 3B9OA 1OCQA 1J12A 1PTDA 3IK4A 3KVLA 4S23A 1H4PA 1F76A 1E6QM 4A6GA 2HTMA 3I4EA 1TWDA 2A2IA 2D22A 1YXDA 1XUUA 2HVOA 3LD5A 4P2VA 4GXPA 1C3FA 3MUZ1 3K4AA 4OVXA 4FXRA 2V81A 5JU6A 1XHGA 5M03A 2IW0A 2CPUA 3H2MA 3PZGA 2PDKA 1UR1A 2VQTA 3ARTA 3AS3A 2WMJA 3N04A 3MYPA 3OVRA 4F79A 2C14A 3N3TA 3BANA 2FFIA 4AHQA 2EJAA 3W27A 2XYLA 4AX6A 3PUGA 3LX9A 4MUPA 3WY1A 1NEYA 4LS2A 4K8GA 3O6DA 4ZODA 1J5TA 2OZ0A 4LAMA 2EPHA 2QIWA 2P10A 4TUFA 1RR2A 4KT2A 4LAKA 1XF0A 4BFAA 2FQIA 3I4KA 4Q33A 3RFAA 3S1XA 2YBVA 3BMXA 1W3LA 4LB4A 2GK1B 3UR8A 5BRBA 4MDPA 1NAL1 4EXBA 4AG0A 5CAKA 3DFOA 3PJXA 3W83A 3GTHA 3VUPA 3GDLA 3CBWA 1TO3A 4IPNB 2B0MA 1EXPA 2XSAA 2VFHA 4GYKA 4Q7IA 2BB0A 4AD3A 3WF4A 3F2BA 2Y70A 1OG6A 3OBAA 3NVTA 3F1QA 4IF2A 4EWND 4Q8UA 1BYDA 3WK2A 2VEMA 3DUGA 1YBQB 3RM8A 3DCPA 3FA4A 3E38A 4EACA 3TAOA 1S2AA 1BLIA 3MSYA 1TQJA 4JNZA 1KR1A 1M53A 3AIVA 1LLOA 2WXDM 4FLQA 1IF2A 1MO0A 2YCIX 3E02A 3PY2A 5FESA 3EWBX 4CLMA 2AKZA 2PWEA 1YW1A 1OT2A 2Y5SA 2BVWA 3ITLA 5DEZA 5E6ZA 3QC0A 4AB4A 4L1WA 3V18A 2HQAA 3NQVA 2E5DA 3W3OA 1NDWA 1OZQA 4DM1A 4B2DA 2PDQA 1EDTA 3NURA 3IV3A 1H61A 4L6OA 4AZCA 3LCXA 4J3XA 5AYBA 1E9IA 1MW1A 3GH5A 4WOZA 2CLKA 3NPVA 3UBPC 4QITA 1GTHA 4GHRA 1PUDA 1J0KA 2HS6A 3BC9A 5K4ZA 4JQAA 1UWSA 4YNGA 3SW6A 5A6JA 4ACZB 3BAIA 1F8IA 4ADSA 2PLJA 2ZA1A 1R3QA 3C2YA 4LTSA 3A4XA 4ZB0A 5CPLA 3RCYA 3MY9A 4MAZA 2I5GA 3WLIA 3PG8A 1WOBA 3IVSA 3QSTA 2C18A 4BA0A 3LV6A 3XISA 4GOAA 1E55A 3WUBA 4PRWA 5IOBA 5C9RA 3B05A 3CK5A 3VNIA 4JTKA 3W07A 2IMRA 1KXVA 2KX9A 3RJXA 3C2VA 3AIQA 5H8MA 4MPKA 3SCSA 3PB2A 1ELSA 3TYZA 1W9DM 3LEPA 3WENA 4A3YA 4Z1AA 2WMGA 1WXZA 3NSXA 2PLKA 3ISIX 4XAZA 4UQBA 1ZHAA 2GOKA 1I4NA 2Z1KA 3M1ZA 2E8YA 3FVDA 1JF5A 3GFZA 3NQBA 2FKPA 2D1ZA 2I7GA 1UR0A 3G6MA 1T0OA 2PCEA 1NELA 3PANA 1RA0A 3OOQA 1B3OA 4DUXA 3UEQA 3NNTA 3WLQA 1WKEA 5D09A 2VUNA 2Y8KA 3EWCA 4D72A 1EEPA 3QY6A 1XW8A 3AC0A 5ECUA 5D2TA 1MQQA 4AZIA 2WOQA 3P5YA 3LS9A 5HNTA 2G3MA 1WXJA 1O6IA 2YFOA 1TPWA 3PPGA 1SJCA 3LY0A 4RZBA 2DZWA 3UT0A 5A3HA 1PTGA 4ZCWA 4BJHA 1UOZA 4AEFA 3BJTA 3U8GA 4MNLA 2PDHA 1GOQA 2X1UA 4NNAA 3C8FA 3VC5A 3W1NA 2O4MA 5BXRA 5D05A 2C3ZA 1AZ1A 5C6MA 4UFMA 3UW6A 2WBGA 3EPNA 4QJ3B 3AMLA 1FCBA 2GPTA 4ZO7A 1XIIA 2VGFA 1I2PA 1LZOA 1FWNA 3S5OA 1L2QA 1FH9A 1GK8A 2QJJA 2E0PA 1FWHC 2XN0A 4MG4A 2QUVA 4E6MA 1TYGA 4LUSB 2I17A 2E5BA 2YLLA 4JD4A 1P0NA 3CMGA 4W8LA 1PWLA 4LRSA 2W63A 1M7XA 3FDKA 4LV4A 3AIEA 3LENA 3GTNA 1S46A 1KR0A 1W5QA 5LIYX 1OGGA 3PPHA 3RUBL 3MWAA 4JGDA 3IGXA 2XZ7A 3W4RA 2YXGA 3LM3A 3A4JA 5CPNA 3WQVA 4B9YA 4DZIA 4QXIA 1QNRA 1V0KA 1K7XA 4FPSA 4L5ZA 1GJUA 3GNDA 3CAWA 4L56A 4QR6A 2YOCA 2WPBA 1CEOA 3MPGA 2J88A 2VD8A 4I90A 2ZX9A 3VIMA 1QBAA 4NYUA 1XLJA 3W2NA 2W5FA 3QMSA 2G97A 2VO5A 1XLAA 3LYEA 1G6CA 4Z1DA 1UWAA 2PI6A 2GJXA 2E68A 1BF6A 3VD5A 2VZTA 4H9UA 3HM7A 4JTEA 4GJ1A 2ZZ7A 1EDGA 1HJVA 2O7QA 4K8EA 1ZY9A 3QR0A 3LA4A 2BOEX 2Z0IA 1VQTA 4HA4A 4G7EB 2PDUA 2Y24A 3H23A 4YL2A 2YGYA 1KRCC 3W38A 4PTVA 1TPEA 2OKTA 2CLEA 4AZ6A 2GSEA 1W91A 4M6QA 1H09A 3GG0A 1VBJA 2WC3A 3MVTA 4IT1A 2DSWA 3WMLA 5DLCA 2XN1A 1N82A 2R1LA 1YADA 1ISYA 2JE8A 3GFYA 3DFQA 2VX4A 1B9BA 4PB4A 3AIBA 4JFUA 4GI6A 2H90A 4M29A 5GPRA 4ZOAA 3T7VA 1PIGA 3LTPA 1HNYA 1GVYA 2EBNA 2Q01A 4GXWA 3W1RA 1KBKA 5HUOA 3NUKA 4JEQA 4XUYA 2G3FA 1B3ZA 1E6XM 3CH9A 1HO1A 4S2BA 3SIZA 2PDCA 2QV4A 1PXGA 5ABFB 4Z1BA 1SZNA 1M7JA 3VDCA 1OX6A 2ZUSA 1XICA 3WN6A 3UNDA 2ZZ1A 4V27A 3ZVHB 3UXDA 4YPJA 1XRSA 3M6DA 3WLTA 1BTMA 4HPGA 2B31A 3QM3A 4NAEB 1WZKA 3IJ6A 2WJZA 4B2DD 3I3BA 3SGGA 4P7LA 1LDCA 4JDBA 4RV8A 3CZLA 1QI2A 3WJWA 2I56A 3KP1A 5AYXA 2C6QA 5E70A 2JK2A 5E09A 4JS3A 1GYNA 2FVLA 5I09A 2DQWA 3TCSA 1FWDC 4NZ3A 1EX1A 3KBJA 2YCJA 1NH6A 5A6SA 3C0LA 3U2CA 4B5SA 3UVIA 4ZQRA 3OIHA 3EPOA 3WUEA 3REQA 3ARPA 4CCDA 2H3BA 1LLZA 2EG6A 3AHVA 4KF1A 5KZEA 3NZGA 3ES7A 1QOXA 4QCFA 1M04A 2WWDA 2ZC8A 5LNUA 3C3NA 3SECA 5AY7A 3CQKA 3WQ8A 1UA3A 4DJEA 3SZ8A 1YDYA 2WMHA 3P60A 2VRQA 4PCSA 3GNXA 4E0CA 4NRRA 1GPFA 3NXFA 3VDGA 3VDAA 1XBZA 2XVPA 1R9ZA 3TN4A 4AEEA 3TSMA 3QGVA 5CXPA 1XYMA 1OFQA 3MSDA 3QR1A 3VM7A 4O4VA 5CPSA 1XLMA 3VOFA 2E8ZA 1XH2A 3WBAA 3HGOA 1NWUA 1KGXA 5E5CA 3CAQA 1OYCA 3R13A 1HJSA 2CLMA 3CHFA 1QO2A 4O8AA 6XIAA 3WMCA 5TQLA 4W85A 5JIWA 3OGRA 4Q7BA 3URQA 2OX4A 2CC0A 4KGLA 2OB3A 1E4MM 4Y7EA 3EOLA 2Z7GA 1XM3A 4I8DA 1CXKA 2CZVA 4PUMA 2PGWA 1LBFA 4HU8A 3SDOA 2BXVA 4C5ZA 2ZXDA 4KGJA 5CQ1A 3NZQA 5HQEA 4NG3A 5CGTA 1XRFA 3QBUA 2ZRUA 1GQIA 3IIPA 1HQTA 4UOJA 3K4WA 1XIDA 1H5VA 4UQDA 1DYSA 1P4CA 3RILA 2X41A 3LCFA 3MV01 4GVHA 4LVBA 4QDPA 5CSYA 3TTEA 1DJYA 4JL1A 2UBPC 2X0HA 4JNMA 1DHPA 4LVGA 4D8ZA 4Z2KA 3B03A 3A64A 3P74A 2Y89A 1QXLA 4B92A 1US3A 3EB4A 4PSRA 4AWTA 3QPZA 3FXGA 1L6SA 4IIHA 4AW7A 2Y7EA 4TV6A 3PTQA 5LNWA 3WH7A 4C1NB 3VKJA 3UZ5A 4GBUA 3VNDA 1V3KA 3CAKA 1UIPA 3WIJA 1OQFA 4LCQA 4ZTYA 4DRSA 3IUDA 4L1GA 3SRFA 2E3ZA 4Q4SA 3EWDA 4F0MA 1YDOA 3AXHA 1ITQA 3SAZA 2NQ9A 2VFFA 1TKKA 4K2SA 5LNVA 1D9EA 1R3RA 3CUIA 1VYSX 4WLCA 5LNSA 4UNKA 4JQ4A 3D0CA 4LX4A 4AZHA 3DHUA 3LB0A 5G2HA 1PL9A 1EJ7L 1RBLA 2QEZA 2POZA 3EX4A 1G5AA 1OX4A 3N9RA 2O55A 3DYOA 4GY0A 1ZTVA 2NSXA 1BQGA 3AYSA 1TPVA 2JEQA 1SR9A 2J7GA 5DT5A 5DO8A 1KFWA 1E1EA 2WVTA 3TN6A 4WK9A 1KNWA 3L4UA 2OOGA 5U4NA 1Z44A 3L5AA 1CX9A 3A5FA 5LIWX 4CNTA 3XINA 2XSBA 3L68A 1MEWA 4GUFA 4POCA 1GKPA 4YTSA 3ALGA 1EJVC 2NUYA 4S3EA 4HK6A 4ILSA 4GG9A 4MWAE 2GJNA 5I7GA 1UR8A 2BXZA 3LPOA 3WDQA 3GIYA 3N9SA 4Q8NA 5HK4A 3CHCA 3UZYA 4B15A 2RJGA 5HXMA 2CHNA 4M24A 4H04A 3STPA 1GVRA 1SW0A 1X38A 3FHAA 3PPCA 1MYRA 3W02A 3IWPA 2WMIA 3VAVA 4XB3A 3PFMA 1JPIA 3UJ2A 2FVKA 3IS4A 2HV5A 2CXEA 1LCOA 1HJWA 3L9CA 1M7PA 3WQFA 2FGLA 1VJSA 2MANA 3A13A 5IDIA 5H6HA 4CQCA 4IICA 3C0SA 1E0UA 3B0YA 1P7TB 2QMJA 3SJNA 1TIMA 4TTGA 3NQ8A 3AROA 1JVNA 3SY8A 3M0MA 5LGXA 1H0IA 5EMMA 2XM1A 4ZXLA 5G4HC 3T2PA 1K7FA 3USBA 5CEWA 5ECVA 1CLVA 1I45A 3GFXA 2J74A 3EWUA 3FJLA 1MVYA 4LT9A 3BH4A 4CCCA 4IMDA 4FHAA 3W7PA 1B3VA 2VENA 4Q8PA 3R11A 1TJ1A 2NXGA 3R0DA 1IYXA 4NSBA 1QI4A 3VIJA 4AWUA 4I5UA 4IIEA 4XZ9A 1UH4A 3NL3A 1HKWA 3PBYA 3URAA 3R10A 5CC7A 2PTDA 3O07A 5I3FA 5T9CE 3V0UA 2P50A 4MLJA 1WZLA 1YE4A 4DF0A 1K6WA 1YTKA 3ZLHA 1Z32X 4ORMA 4GQ0A 2A3CA 2F38A 3AMGA 1A0CA 2XVLA 4YHGA 3GXFA 3TEVA 5DMYA 4UTIA 3BICA 4HOWA 1G01A 4HSOA 3H2CA 2ZA2A 3NJ3A 2RDUA 4EE9A 2GVEA 2OMAA 3GDKA 4O1DA 3TTYA 1DIDA 1GOKA 1GZ1A 4WY0F 3W1AA 4TMBA 2YXXA 4MB4A 1EIBA 3UU0A 3RGTA 5BXPA 4DJED 1TJ2A 4Z2JA 4GGBA 5I07A 1JZ5A 4ADUA 2XSXA 1QI0A 1KM0A 4GA8A 3URNA 3CQJA 3WD2A 4S3GA 3NQ2A 3TJLA 1KWKA 1I2QA 4K68A 3MV11 3ZOAA 4C6LA 3H4XA 4LF2A 4NZ5A 4CNUA 5FEZA 2TPSA 3W26A 3I7RA 1DEDA 3AIWA 4V1YA 1HFBA 2WLZA 3QFWA 2HSAA 3WFLA 3S6TA 3HV9A 3AALA 1YXCA 4ZENA 3OVQA 1FTXA 3KP0A 1XSIA 3PAOA 3L67A 1HO4A 2ISVA 4YVXA 3R43A 5A8OA 2OSYA 2PRHA 2C1IA 1QPOA 4RNHA 2AL2B 1EB3A 4WJ8A 2E09A 3G0UA 4O0KA 1M9HA 1R8LA 3U6WA 3W7JA 4B5NA 1E9ZB 3SRDA 1GVEA 3CUZA 3EX3A 3GU1A 2ZUNA 3H6OA 4H9YA 4QE1A 2QV5A 1PX8A 1GORA 4HHLA 1OGSA 5DMMA 1LQ2A 1QK2A 4X61A 3WEMA 3G1DA 4LVFA 4NJGA 4WKFA 1Q6GA 4KEUA 1DXIA 1KM3A 4UR9A 1PO9A 4FIQA 4G8TA 3W7RA 2A7RA 2BY2A 5F1VA 3EB3A 3QV7A 1ZALA 1LF1A 2HRWA 4WSHA 2WZMA 4ZA0A 3UWYA 4C90A 1KRBC 2ZX5A 4WR3A 3DYPA 3CIWA 1RD6A 1V77A 3LI0A 5H8UA 4AUBA 2ZTJA 1YEYA 2ALDA 1E56A 2YA1A 1N2VA 3W29A 5CZ0A 1ADDA 1GQKA 1R47A 2ZUMA 4LVAA 1PZ0A 2DUZA 4HU4A 1TV8A 4DYEA 4O12A 3AHXA 3W1UA 2RHGA 4FEZA 1OM0A 4OV4A 2GSHA 1DWHM 1L8NA 3B97A 4CN1A 3PPFA 1BXCA 4H01A 4DJFC 4HU0A 4KH2A 2VURA 1EC8A 1S2VA 2Z2UA 3UJRA 3XIMA 5I3JA 3N14A 2ISSA 2AAAA 4X2RA 3GSMA 4GQBA 3VD3A 4G9PA 4YWSA 1L6FA 2QXWA 2DQXA 3R8GA 4UQCA 2GVLA 1IHIA 4CQAA 5C54A 1QTWA 3HG2A 3UCQA 1WDDA 2F9RA 3GXNA 3A5VA 4GGHA 3OLIA 3FA5A 4BI5A 4ALDA 3E0WA 2YL9A 4AZ5A 1PE1A 3BLEA 4JTLA 1K3UA 2KAUC 2PDMA 1F4AA 5I2UA 2CIPA 1V6TA 3V75A 3WQ5A 1W3HA 2VVNA 3U2ZA 1ZRQA 3TTQA 5K9CA 2A3AA 3OLDA 3W6MA 4YCOA 5L9FA 1OT1A 1DHKA 2HEJA 2DW6A 3O1NA 3B9DA 5D30A 5FF7A 1YRRA 2ASHA 3BDKA 2ZRWA 3VNYA 1LROA 2QJNA 1P0DA 2G37A 4GNVA 4NX0A 3PBWA 2VCAA 2CZFA 4ZVJA 2E77A 2J8GA 3OTRA 3TC3A 4KQNA 1EF2A 5D37A 4PRRA 5LNRA 3KCJA 3IVTA 3GRIA 3M5XA 4JHOA 2BTMA 3S42A 4XD3A 1TE6A 2YXOA 5E6YA 1ZBKA 3RIKA 5G4EA 3KRSA 4Q8WA 3GHRA 1X8FA 3P62A 3GYCA 4YVVA 3ABSA 3CEUA 4Y90A 3QV9A 4IMCA 3O06A 1ITUA 2BXYA 1C8XA 4N42A 3CNYA 1TV4A 4ML9A 2UWFA 4UNIA 4LU0A 1SYTA 3ZLGA 3HOJA 1F61A 3R6IA 4UOZA 3L2IA 5A6KA 4IFKA 4R34A 4EKJA 1TR1A 4BQ3A 1AQMA 3UY8A 1ONWA 3KOWA 4FXSA 6PTDA 1HW6A 2Z1XA 3CZ8A 3CUGA 4J3VA 5CBJA 3NXLA 8A3HA 4MZ8A 3P8IA 3DH7A 1J18A 2CFFA 1H50A 1G9HA 1RCXB 1RY0A 2ZUTA 5C55A 3SQLA 3QPEA 4A8IA 5LA1A 2GDUA 1WKFA 3CL8A 4DUWA 3WCZA 2QYGA 4DBDA 2J8TA 1QNPA 4JIQA 1CENA 1JYVA 3RX4A 1H7PA 5B7ZA 3GK0A 1W31A 2OYKA 4PBFA 4YYCA 2DV0A 1KW1A 4QFUA 2XH4A 5G4WA 4YTUA 2D3LA 5I5RA 5TF0A 4DO7A 5BROA 4FI4A 1H5YA 5K9XA 4H2CA 3ABZA 4PSPA 2J7BA 2QVHA 1OADA 3C56A 3DHPA 5BRQA 5D38A 4YTRA 4PEEA 4CNNA 1R5YA 4LPCA 3NO5A 3I7SA 4AY8A 4KWSA 1GKRA 1GTEA 2X7VA 5CGMA 1EO5A 3IACA 3STFA 3R5EA 3P14A 1XIEA 3W1XA 3O0FA 4NI3A 1QCWA 4GKTA 3MA8A 1EHAA 3VIGA 3MO7A 4TOQA 3UG3A 1NOUA 2A85A 5FI8A 4YHEA 3S6OA 3V35A 1MUWA 1F6YA 5E0FA 1H7OA 1PKMA 2FPTA 1YIXA 2P76A 1Q6OA 2YLAA 1RAKA 1DWFM 3U57A 4C7DA 4WOQA 4DO4A 2W6RA 1MW3A 2Y62A 2RUSA 3DXIA 4CD6A 4ZEPA 3GYEA 1A5BA 2HVMA 3LLDA 4OE7A 3N9KA 1TPDA 4GVGA 3LXCA 1TUFA 4D6IA 2HPMA 3T40A 3WLNA 3QVQA 3SUSA 4Q4MA 5BU6A 1UD3A 2ZZ5A 1JCNA 1ZP4A 2WKGA 5IBXC 1EO7A 5SWUA 4A8RA 3I6RA 1FWGC 5FF0A 4D71A 1U1HA 5D04C 1LRTA 3FKRA 5AC5A 1KXHA 4GCAA 4PE8A 1NWSA 1AJ0A 4OBSA 4ZMGA 3N4EA 3S4TA 1CDGA 3APYA 4PBGA 3WBEA 3PZTA 1VFLA 4H6KA 1SR0A 1XGDA 2ZA3A 1YTEA 3VILA 3K1DA 2GVYA 1ZPTA 1UMYA 3P7YA 3VX0A 1XLBA 4JTIA 3W0KA 3W25A 4R27A 3M07A 2XISA 4FLSA 3MKVA 4JYEA 3VGEA 5LA0A 4AIBA 1V3LA 1OFPA 1TSIA 1DOSA 1RPXA 1C91A 1QOPA 3H22A 4HMCA 1XSKA 3IJDA 5JBFA 3CL6A 4JQ2A 2WSKA 1UD4A 2NVCA 1XLDA 1CGYA 4Q4PA 4L7ZA 1GVSA 3NZ1A 1RVKA 3OGSA 3EXRA 1BD0A 3CL7A 3MHUA 4AISA 3WQGA 4ZTXA 4FOKA 5C8BB 1ONXA 1BSIA 3HFTA 1J96A 1BAGA 4X63A 1SO3A 3K5XA 2CCRA 4FZIA 4EVZA 2ZUVA 3A12A 4XUGA 5C2XA 3GBEA 1D7FA 1TUXA 3M4HA 3TJ4A 3IIVA 3A9IA 4RE0A 4X9YA 3T0TA 5K2ZA 3W37A 4B4FA 1P6WA 1MMFA 5I23A 2DUAA 4RXFA 3TNBA 3EAUA 3GNNA 2I9UA 4LNYA 4UCFA 2P8BA 2WNWA 2PLCA 1NIUA 1N55A 5D9MA 1K9FA 1UWUA 1EOKA 1ZQ5A 2F2KA 3KDNA 3FIGA 4XTIA 4H8HA 3QTPA 2FMNA 4KRTA 4AD1A 1EIXA 1AD1A 2PDIA 3ITYA 4LUTA 1H1YA 4MNJA 3WG6A 3KHJA 5FKYA 2XVGA 2PODA 1CPUA 4S3FA 4LFYA 4PGLA 1V3IA 4PMRA 4YS1A 2DZVA 4AZCB 3MTWA 4E2VA 4ZQOA 2QCNA 1C8VA 3E6EA 2WK2A 1W2PA 3ONCA 2J78A 3DYMA 2IPFA 1XCWA 5TD4A 3PF3A 5JIPA 3O7UA 4NZFA 5FF4A 3S83A 4H00A 2C8NA 2CYGA 4S38A 3AXKA 3THDA 3H7VA 4ENLA 9XIMA 3LRLA 2CLIA 3ZWTA 3CJPA 1R3WA 1VPQA 1DQWA 4DWSC 1YNPA 2Z2BA 3AI0A 4IP5A 5CJNA 3AHZA 1AD4A 3INPA 3U4FA 4ROPA 4X22A 2W9MA 2OZ3A 4HYWA 4JIRA 4ZE5A 4ZSUA 3OU8A 3OA3A 3G3DA 3LHZA 4R7WA 1KXTA 2FZDA 2QMKA 4QEHA 2G50A 4EXAA 4HK5A 3M0IA 5LHEA 1AQHA 4G7EA 3FSTA 2VI0A 1CTNA 1SW7A 2HBVA 5I24A 4MYAA 3WL1A 1JCLA 3EX1A 1RJRA 1R2SA 3FJNA 2Z1WA 3RLVA 5DF0A 3CU2A 4DYJA 3AXMA 3C4UA 3VC6A 3MMWA 3KS6A 4L9ZA 3S3GA 2EPNA 3SUTA 3UWEA 5EBUA 2R1NA 1CZ1A 2CNCA 3MUXA 3LZ5A 2WM1A 4Q32A 4QNWA 1Z7AA 1A5LC 3N4AA 1TA3A 5FAGA 3WKZA 3EX6A 3N2TA 1KM1A 3U3HA 4WQ6A 3G22A 1IGWA 2Y6ZA 2I57A 2QCCA 4U2ZA 1Q6EA 5JXQA 1UZ1A 3GZ3A 4JIPA 3MUIA 4DJFA 2NVAA 2DT2A 1X1NA 3NZPA 1SUXA 4KWVA 4EIVA 2PLMA 2RDWA 4QAWA 2Y0FA 3SRHA 4GCXA 4UR8A 3UGVA 1ECEA 3TQKA 2OPJA 4CQ9A 4IG2A 2BV9A 2A79A 3H7UA 3TYCA 4ZQCA 3N17A 4B5UA 4I6VA 4J2MA 4AC1X 2OVLA 3BG9A 4PCNA 2E6AA 4U4MA 1KBJA 3UZXA 1WKYA 1T99A 1B4EA 3WO8A 5KETA 3UR5A 3QZEA 2YA2A 2PB1A 1FBAA 1JYXA 1GQJA 1W5OA 1B9ZA 4FB7A 1ISZA 4NAEA 3WLJA 1NDVA 3IK2A 2VXNA 4H6QA 2HISA 2PWFA 4M6UA 3NSMA 2QIIA 2O7SA 1EEXA 4NF7A 3LRMA 3O9NA 4OQVA 3LCLA 4IIDA 1QATA 2WW5A 1LJYA 3R0KA 3GLCA 2EKCA 3SSZA 4KEMA 4XBJA 1MDLA 1H0GA 4UB9A 3MB9A 2ZX6A 5M3WA 5REQA 3VFCA 1A5UA 1TJPA 1KKOA 2BASA 3SY5A 5FAJA 3FEMA 4HHMA 1IZCA 4DXXA 1LT7A 7REQB 1UKOA 5E9XA 2R8WA 1GYMA 5AC8A 1MW2A 3MQTA 4LEQA 1Q7ZA 1NQKA 1I2RA 4X3ZA 4H7VA 1NFGA 1RY8A 1AODA 2PAJA 3RU8X 3BOFA 5A6MA 4REQA 4DIAA 5AC6A 3VTRA 1VAHA 2A1YA 4MKNA 4JN8A 1TZ9A 1WB0A 2Y7GA 5DX7A 3WQ6A 3NSNA 3BOLA 1GEQA 3BLOA 3OZOA 2TAAA 4F0LA 4F4RA 1S3HA 5BOFA 4UQ9A 1L0PA 1NWTA 3BURA 4I5RA 4LW7A 1K8CA 3QN3A 1BF2A 2IKGA 3QW3A 4MJZA 1XPGA 4H9VA 1PWMA 1NP2A 2J13A 1V6XA 4RZ4A 4TXEA 5FEPA 1LG2A 2PPGA 2X0YA 3GVQA 4Q4OA 3VZXA 4A4AA 1FWBC 4QLLA 1W0MA 5CZTA 3GNOA 2NT1A 3JR2A 3M41A 3LG3A 2ZZ3A 1POKA 1E70M 3DECA 3KVKA 4NY2A 1UD6A 1VEMA 3HPSA 6ENLA 3AO0A 4L65A 4QISA 3GW3A 1EJXC 5DMLA 4PBEA 1XDLA 2VCCA 4HU3A 3PJTA 1EQCA 1AMYA 1AQFA 4MFEA 4BQ2A 4KIRA 4E3TA 1XIFA 3JZUA 1XBYA 5CLTA 2W67A 4JIIX 4YIWA 1JFXA 3WDRA 2J7EA 3TA6A 1Q7MA 4S3KA 5ABHA 1LL7A 2HS8A 1PX3A 1D8CA 4KWOA 1XPYA 3Q58A 5CSSA 4BF7A 2WQPA 3U9IA 4O11A 1M1BA 5G2IA 1NDYA 3T55A 4XZIA 3E9AA 5HR7A 2I14A 4JQ1A 1L8PA 1LQ0A 3W2UA 3W2KA 3PULA 1BVNP 5CSUA 1UOKA 2BFGA 3AYTA 4GE8A 3UJSA 4OJYA 1RA5A 3SI9A 7ODCA 3UWUA 3HPZA 2XINA 4DO6A 2PMQA 1GVIA 3GR7A 4MSSA 1GHSA 1YHTA 3KXQA 2P1FA 3KOYA 4GPNA 4XVEA 4E4PA 3W00A 1RSCA 3LERA 3WLLA 2YBUA 2BHUA 1S5VA 3IIZA 5H1WA 1CI1A 1UR4A 2ICSA 3VNKA 1WAUA 1P0EA 2VDGA 1ENUA 3VXGA 2J24A 2C1GA 3GS6A 4FALA 2PRLA 4JCLA 1OD8A 1K7EA 4J3ZA 1EP1A 5FJTA 4MIMA 2CKSA 4A2SA 5KMYA 4GRSA 2YB4A 4ZO6A 3GO2A 1JZ3A 4O10A 3O16A 2ATSA 3RLHA 3CV2A 1R2TA 1VEOA 1EF3A 3GHSA 1W1ZA 1ZBWA 4JICA 5LHFA 3MCMA 4UWMA 1V6YA 3OHMB 4QTGA 1TELA 3K30A 3LSCA 2ACUA 3QYSA 2VYOA 5ABGA 3TC7A 4MYXA 2DORA 1KV5A 1UH3A 2XG9A 4WSJA 2QJMA 1DQUA 4R88A 4D6JA 2JFEX 1W1IE 1JDDA 2V67A 1A5KC 1E51A 3LZ3A 1BYBA 1ZJBA 5HUPA 5IBXA 2NQLA 4ZSTA 4LUJA 2PURA 1RBOB 2E6YA 1AUSL 4WKHA 3E0LA 3ELFA 2WNZA 3QSRA 4ICNA 4O8RA 3IUIA 4CVWA 4J9JA 7TAAA 1TJRA 2YJQA 1R3YA 3PBUA 4ZFMA 3TQPA 1Q6FA 3S1VA 4NP7A 2EPLX 4BS0A 1O5KA 2QDEA 3GUWA 1MI3A 1KRAC 3W70A 4LANA 4DF1A 1UA7A 3DZ1A 4DJFD 4OUEA 4A8NA 4MKVA 1ME9A 4FP1A 3TU9A 4RXGA 4J28A 4GO9A 4F40A 4EX4A 3EX2A 4PCPA 1LUCB 4WIWA 4G1NA 4H7CA 1EKOA 1ISXA 2PBGA 3CQIA 4IX2A 4PEKA 4IOTA 1OZMA 3TYDA 1IWPA 3NEVA 3UJEA 3TN3A 2J6VA 4H3DA 1FDZA 2ZX7A 1IWAA 2WO5A 3B06A 1JEZA 1XKJA 2O0TA 3KRUA 2FJUB 4XO6A 1ZBVA 4YLWA 4DX3A 3HA1A 5D9NA 4UTFA 1XLHA 3COTA 1S3TC 3UETA 5I02A 1SZFA 4CU8A 1EH9A 3O0KA 4H9ZA 4J5NA 3KWXA 1PKYA 2OQHA 4JZ5A 3P3BA 3GTXA 3QKZA 1P1XA 4CQ8A 2DW7A 3WDIA 3STEA 4M80A 4BWLC 1OK6A 1JCXA 1NF7A 1UBSA 1UUQA 5C2GA 3NG3A 3BSMA 2VNCA 2PU1A 3WUFA 4FNRA 1OC5A 5C2CA 4V28A 4B16A 1HZYA 4HN4A 3CWHA 2Z24A 5AHLA 4MAVA 2QCDA 4LH8A 1HJQA 3GKFA 3FYYA 3DERA 4LS1A 2XTKA 1XJBA 3FCPA 2WCAA 2WLYA 3GH4A 1G67A 3H2FA 4K7VA 4ROQA 1VPYA 4F48A 1OX4B 3W7HA 4XBKA 4CNPA 3W7MA 1V3JA 4I5XA 3B9EA 3F2DA 3KCOA 4JKMA 5HMDA 4OBTA 1SO5A 1SPQA 1V3HA 4EP8C 7TIMA 2V3DA 5EMYA 4DWSA 4IMFA 4QAIA 1FRBA 2DIJA 1MUMA 1QASA 4C6OA 2Z1BA 1JPDX 1H2JA 1WX0A 1Z42A 1B3YA 1B2YA 3R2GA 4EANA 4DLMA 2XZ9A 4DXVA 5C9XA 1V5XA 3UQNA 1PAMA 4NVTA 1Q65A 3NPWA 1ZSXA 2PGRA 4O18A 5F4SA 4DM2A 4HCHA 2Y5JA 1OFEA 2OZ8A 2XGZA 2V6AA 3TDFA 2TRSA 1TIWA 1ZGDA 3ENLA 4F9JA 2WMIB 2YCEA 1DJZA 4D8AA 1X1OA 3W7GA 2R91A 1YPIA 4LAOA 2V9DA 2C15A 3QMRA 1ME7A 2QCEA 3MCOA 3II1A 3FJ4A 4QLKA 5KZDA 3CB8A 2TMDA 4IZGA 1BFNA 2XHYA 3D3AA 1UKQA 1JNEA 1KFJA 2XVKA 2YL6A 4LVDA 2DVUA 1F7BA 4A3QA 3HIJA 5D2YA 1EC9A 1E1CA 1T41A 3TOYA 1XH0A 2DSKA 3LPPA 4DNHA 3IGUA 3SBFA 1IR2A 2ZBTA 4JKKA 1US2A 1F73A 4UTJA 4B9ZA 3BL3A 3TX9A 5I3DA 4HT3A 1GONA 4RW5A 1TV7A 3WJSA 4IPLA 1GOIA 1V6WA 4H83A 3LTSA 4L80A 4DN1A 4KCUA 4WDUA 2WV8A 4DJDD 4PCTA 3B04A 3RPTA 5BNKA 1YLVA 3EKZA 2E5CA 2CBJA 3F5LA 5G1YA 3UY7A 1JIBA 1IEIA 1V7AA 5HNRA 3G3MA 2VX5A 3BW4A 4GC4A 3CZEA 5LZLA 4NXSA 1V0LA 3V5OA 1BTCA 4C6DA 3Q67A 4HNVA 4PH6A 2OQLA 3FAXA 4GIRA 3QQ0A 3OQEA 4IISA 1EJWC 3M0KA 4Y8FA 1J0ZA 3LHUA 3ZT5A 5GQBA 5CG7A 1EBGA 2Z26A 5EGRA 3TTOA 3LRKA 2H3DA 4YXGA 2QZRA 4IM4A 2VVSA 3OEXA 1VS1A 4W7WA 3VOHA 3K8MA 1LTDA 4L4MA 5DXYA 3M0JA 3SCWA 4GIYA 2VP8A 1XKYA 1MEHA 3APGA 3MUAA 1C8YA 3GXDA 3QLDA 3UWVA 1T8QA 1Q6QA 1MQPA 5LIUX 1ME8A 3PSWA 3KLKA 2OOFA 4D1JA 4DZ5A 2DPEA 5K9DA 1KFLA 1XL9A 1ZU8A 3H2NA 2W3ZA 3MHFA 4HZ6A 5EB8A 3WMSA 3KM8A 1XP3A 2VZVA 5A6AA 3RMEA 1JDAA 2Z2AA 3GC4A 2R82A 3VX1A 3CYVA 4IJBA 1E15A 4CQDA 1NDZA 8XIMA 2QF7A 3N2MA 3SADA 2CLLA 3O05A 3CZKA 2EPKX 3WQWA 3NQAA 6XIMA 2J77A 4D2JA 3KOZA 2WMKA 2WHLA 4GWEA 1O94A 4FX6M 4HJWA 1JGIA 3G77A 5DT7A 3E2VA 1UWQA 4FIRA 1DJNA 1EL3A 1YTDA 5DANA 4BKNA 5BMXA 3FYOA 4JKLA 2QUUA 3Q2DA 3APTA 3SN0A 1RLDA 1UASA 4MNKA 5A95A 1FXQA 1DTNA 1ZAIA 6REQA 4GY1A 2NQZA 4GVIA 2UV8G 4MADA 3NL2A 4CN6A 4R5EA 3MBFA 5F2GA 5CZSA 3HG4A 1HKKA 2PS2A 1GHRA 1E6PA 2CZEA 2X0SA 5T26A 5AYIA 2V68A 3U7VA 3NQ7A 1VBUA 2V82A 2VD9A 3GVVA 3H2EA 4ZQPA 2ON3A 2ZRVA 1KGUA 4L61A 1UYQA 1Q3NA 4TMCA 3WLHA 3MU7A 1PB0A 3TWAA 4U31A 1W6TA 2DT1A 1XLCA 2XWDA 4MWAC 1XLIA 4IFOA 2WC4A 4HZ7A 4YYFA 1QT1A 2J25A 3TFXA 5A5WA 2POTA 3TLLA 1OFOA 4Y9OA 1SZEA 2I5QA 4RLIA 4LB3A 2IQTA 3N6HA 4AWSA 1CXIA 1WUEA 1VBHA 2PUZA 3IV8A 3ZFHA 3L4XA 2XPKA 3BAJA 4G5DA 2ZVIA 4QNEA 4KBXA 4H9TA 7CGTA 2GUYA 5A6LA 1HT6A 2G41A 1J2WA 4DQWA 1E5JA 3WNOA 1UZDA 1MZHA 4K37A 4RE2A 4PMZA 2QJIA 4M7TA 3NFUA 3KVJA 3ZSTA 2PDFA 1Q85A 2ZKMX 2V5KA 3C3UA 4IHCA 2V30A 4HNOA 3FXYA 3KEHA 5JBDA 4GX8A 3TR2A 3KBSA 4QROA 5AKQA 1S39A 1OFAA 4DWSD 1OBAA 2XVNA 3BCJA 1US0A 3CO4A 4KFNA 3RXZA 1E3ZA 1SMAA 1HGYA 3W01A 1QAPA 3ZWSA 2NLIA 2JALA 3UXLA 3NO3A 2CWXA 4MGGA 2HK0A 2XIQA 3UXKA 2PF0A 1IGSA 4JTDA 1EA0A 4U2YA 3TROA 3RPMA 5I79A 3E74A 4NZ4A 3SFKA 2ZFAA 3SUUA 1OF6A 3GW0A 3AIUA 2BSLA 4WZHA 1QW7A 2PDXA 1Y7VA 2OGJA 3EWWA 1AJZA 2NQHA 4Q4RA 1X98A 2OYLA 1WDSA 4LQ1A 2ANUA 3ECQA 1FWAC 1P6BA 1IEWA 1XYBA 3B8DA 3LBOA 2V5LA 5JBEA 3KOXA 3B3DA 2Q71A 1JD7A 2PWUA 3H4WA 3V3WA 3NM1A 5E9AA 3QY7A 3FGCA 4MVAA 3WNPA 1FFRA 1D3CA 1JZ6A 4LXFA 1I2OA 4QQUA 1I2NA 3AUOA 1XCFA 2E6FA 2NQJA 3DG7A 1VBRA 1KFEA 2J62A 3EDJA 3UJFA 1EBHA 1B57A 1CT5A 3JS3A 1T7LA 1V02E 3ARUA 3LMYA 3HU7A 1NWRA 3BCFA 1FFQA 1RJPA 1RQHA 1TV2A 5JQ9A 2GL5A 2RFGA 3B40A 4IFKB 4IGMA 5I3KA 2A21A 2NWSA 4NJKA 1EJRC 3K2GA 3ZMRA 4W9TA 4JL2A 3U48A 1K9DA 4XKMA 4QHRA 1JDEA 4JY8A 3VOGA 1G1YA 1E5NA 4ORIA 3T2OA 4ZO9A 1EDQA 4M0XA 5HMFA 3GE7A 5C71A 3GHUA 1A5CA 4ZR8A 2CU0A 3K8KA 3T0CA 3HZ3A 4C60A 1FP9A 3NAVA 3BZGA 1AH0A 3IJQA 1AMKA 3BJSA 3HPAA 1K8YA 1X1ZA 1U33A 2INFA 1V03A 3WQPA 4UFLA 2IQDA 4C65A 1LRQA 1V79A 3S1GA 4ZQNA 3PVFA 3EDDA 2VFIA 2GQ9A 3GC5A 4HKPA 3VUSA 1PBGA 1JNDA 2CEQA 2TODA 2ACRA 4LOCA 2VQUA 4P7RA 5IXEA 1F6KA 3VO0A 4DB7A 4LEFA 3W23A 1Q63A 4BCEA 3DG3A 3NPXA 1V93A 4NJIA 3MI6A 1OCJA 4S3JA 3WH5A 3TAKA 1A5NC 2TYSA 4L9XA 4M56A 2I16A 1HGWA 4GJJA 2VDIA 2X30A 3M16A 1KBBA 1QU4A 3DBPA 1PCWA 1AL8A 1GT8A 3FKKA 3TCEA 1WAWA 2XFYA 1VC4A 2Q8LA 5K7JA 3S2NA 1VLWA 1V08A 4I9JA 1GJPA 3M0YA 3JZEA 1IWBA 2CBUA 1XFBA 3T1GA 3A21A 2UZ9A 3CLMA 4N6FA 3MI2A 2J7DA 1J01A 4XZHA 3STCA 3T8QA 4AY1A 5CCZA 1O7AA 3VGGA 2PBOA 1IIGA 1XCXA 2OSXA 1W3JA 1QJWA 1RJQA 3GXMA 4JBRA 3THUA 4YTTA 3LV5A 3HO8A 3T0DA 2YL8A 4JY9A 1VFHA 2PWVA 1TWWA 3G1VA 2HJPA 4PZVA 1FUYA 2GJRA 4WGHA 4TVCA 5C9ZA 1S5NA 4Y2WA 1CLXA 2AL1A 1IT0A 3RR1A 4OOZA 1IEQA 1K77A 3S8HA 3WZ0E 3V5FA 2YIHA 1VBGA 1E6NA 1BWVA 4E5TA 1MNSA 4GY7A 3WLOA 4HNCA 3H7RA 3W7CA 2YCKX 4GLEA 1H49A 2UY3A 2QPUA 3BUVA 2GZXA 6ALDA 5BXSA 2AQOA 4FOUA 2HBXA 1YQ2A 3KVMA 4GQQA 1WV2A 4IQDA 2ISDA 5DMNA 4E2BA 1FDYA 3DI0A 4S39A 1Z8AA 2F8QA 4O53A 1O5RA 1J11A 3FY1A 3NYDA 4QE5A 2CXGA 4JX5A 6TAAA 1KQYA 1E6RA 2PDPA 2FZ9A 1CECA 3R25A 1QWGA 1Z9AA 1U1UA 1JGMA 3WD0A 3HBLA 1I6NA 1B30A 3WF3A 3VNLA 2Y8UA 3PJWA 1DJWA 1NQ6A 2XU2A 3EEGA 4UUIA 4WY0A 2AGKA 4GMEA 2VZSA 3H70A 1PKLA 3WQ4A 2QDDA 3ES8A 3TQVA 1EC7A 1EPXA 4ATLA 2RGMA 4Q6XA 2F61A 2NV9A 2WBKA 1XX1A 1KC7A 2WZEA 2G4JA 4YTQA 3KL0A 4LGXA 2WSRA 5PTDA 3ALFA 1ZAJA 1G69A 2PP1A 2MNRA 4TU1A 4JCMA 4RL3A 2D0FA 3MKKA 4A35A 3CPRA 1OYAA 1B90A 4KIEA 4O1AA 3H4GA 5IDZA 3ZO9A 1VFUA 1WBJA 2OKOA 3TXVA 1KTCA 4LYKA 3ARRA 4IUOA 3QZAA 3W1TA 4I9MA 3AU2A 4WVXA 1YMYA 5LGZA 3M6YA 4TTUA 4PMQA 1X96A 1GOXA 3CMFA 1EOMA 3W2LA 3T05A 4IWWA 3CEPA 3NCOA 3ABXA 3ARWA 4RDYA 2XIBA 3M5VA 4UMBA 4BF9A 1TE1A 1TMHA 3BSHA 3GZAA 4O15A 1ECQA 7REQA 3AS0A 3W87A 1TPH1 3DOPA 4TIMA 4AHOA 4HPHA 3FSUA 3ARVA 1WOAA 4EK7A 4LUTB 2Z6IA 1J6PA 1TFVA 5BOEA 4JX4A 5C9UA 1NOFA 3T0BA 4N9DA 4KCWA 3VGFA 2W92A 4BHYA 2FZMA 2NX9A 3R1ZA 5AZ1A 1DP0A 3HF3A 4XAYA 2PFHA 4JIHA 3LGEA 2RH9A 1IT8A 1A49A 3RG6A 3AISA 1T5AA 1K8ZA 3W88A 2G3JA 1RHCA 4GJIA 2NX3A 2X1RA 3UR2A 3BLIA 1TX0A 1B4KA 3KWSA 1I8JA 1Q6DA 3WBXA 4GK8A 1QPRA 1LQAA 1K1DA 2ZTKA 1EGZA 2EAWA 4GNJA 4IUGA 3AS1A 3POHA 3TJXA 3OG2A 1H63A 2V5DA 3DC8A 1VRXA 3BARA 3DENA 2DT3A 1FWFC 3SSJA 5F7UA 3LU2A 2GLKA 1CGTA 3CUFA 3GX9A 3IARA 2FH8A 3BZJA 1HX0A 3UNTA 3N12A 5CZJA 4AH7A 1QO5A 1XC6A 3CH0A 1LORA 3S2CA 1DIOA 1WDRA 2XFWA 3N2BA 4I7VA 3H8AA 4E4UA 4UQEA 1RCOB 4MWAA 3UFYA 3NQEA 5BWFA 1ALDA 1QPQA 3RU6A 4QLJA 2C16A 1XYLA 5BXTA 1TA3B 4UTMA 1T40A 3J7HA 3GR4A 3CASA 5D8WA 5AVHA 3DI1A 5GJMA 2XIIA 5CZKA 5AN7A 3ZJ8A 2Q02A 3ITGA 1KFCA 4PODA 2P0OA 1WBHA 2W62A 3KOFA 2IPGA 4MTVA 3V0SA 4J4KA 3ME3A 3QRHA 5G1MA 1KBIA 4IG2B 4IXHA 1J8VA 1GZJA 1MSSA 1KM5A 1HL9A 3BLFA 2YB1A 9RUBA 4ATDA 1QK0A 4GFSA 4DVOA 3C0QA 2DSZA 3EKLA 5A6TC 2G95A 3BAYA 2DDXA 5G1TA 4CCZA 2JKEA 2ZC1A 1MFUA 2WCGA 2YZ5A 3WNKA 3W6YA 2GSJA 4MFDA 5GNYA 3AXIA 3PG9A 5J04A 4ZO8A 3ANYA 4ML4A 4JX6A 4MF4A 5GNZA 3PUOA 1QNSA 3AJ7A 4WXYA 9CGTA 3PSVA 2ZRZA 5J5RA 3EOSA 5CAHA 1QUMA 5LSMA 3QF0A 3QHOA 5REQB 5A8QA 2FZ8A 4A3RA 1CW2A 3SN1A 2BGSA 3FV9A 1OK4A 5LIXX 3ANVA 4HMNA 1W5PA 4J2PA 5DRCA 1F9CA 1PHWA 1HKMA 4H19A 4FLRA 4DUOA 1D3GA 3PZ9A 1C90A 1UKTA 4REQB 4Y8EA 3MP3A 4IJRA 4RE4A 1YE6A 3TKFA 1X97A 2NQ5A 3K13A 5HNUA 1NU5A 4XAFA 2GOUA 3W7LA 1R85A 1U5VA 4P7OA 3IIOA 2INZA 1QHOA 3QPYA 3GUGA 1Q8AA 3RF9A 2R6OA 5T91A 3PBMA 1W1PA 2QCHA 3CO8A 1QBBA 4GH3A 2D23A 5HINA 2OYMA 1LWIA 2H8ZA 1DJQA 1FCUA 3EA1A 2Y5EA 1XFCA 3W1MA 2YYUA 1ZP3A 4LBUA 4JFWA 1LBLA 3KL3A 3M44A 1UCWA 3NQCA 1R3VA 3U4AA 1LUCA 4Z2HA 1SO4A 2P5NA 4V15A 1WPCA 3TNOA 2QW5A 4WJEA 3AQUA 3ATZA 3S6DA 1EHNA 4ERGA 3NQFA 4MZYA 1WXYA 2W27A 4CQBA 2G8ZA 2D2OA 3TE9A 3ZM8A 2BY3A 3ZJKA 3KAOA 1AW1A 4DELA 1LL6A 1DWIM 2QF8A 4JHZA 4HNLA 3EBVA 4GNKB 4O0QA 2PWDA 1W1B1 3DIPA 1JYWA 1JULA 1Q4NX 4UZSA 5BMWA 3H26A 2RDXA 3UD6A 1E4LA 4RDWA 1Q2RA 1Y5WA 1TWSA 4Q7NA 1K9TA 4FK9A 3WBYA 1GNXA 2VWSA 2O9TA 4W88A 4A3HA 3W73A 3GXTA 2ZUUA 4GQGA 4GYPC 3OBKA 3MUY1 1TWIA 1E6SM 1VR6A 1QRQA 1BXNA 1ZCCA 3V5CA 4L1XA 5C70A 2GDQA 1JRBA 2O9OA 4O17A 3WF0A 1V3MA 2DVTA 1M3UA 4MUZA 3CWNA 1SU5A 2QQ6A 1V8EA 3M43A 4RV3A 1DXFA 1DBTA 2J79A 3C2FA 4CN4A 1W2VA 4NT0A 1DE6A 3LCGA 4FS9A 1TTJA 3TONA 2QCGA 3O6CA 5F4XA 3MSGA 3SCPA 4ZQMA 4OTKA 1E0XA 4KS0A 4C6EA 2OELA 1THFD 2GVGA 3HURA 2OX1A 2V5JA 2YBTA 2GVJA 2VUYA 3ZJ7A 3OG3A 3VD4A 4HHPA 3IUHA 1W9BM 3EEZA 4UIOA 1VRDA 4JTGA 1Q2SA 4LYQA 2WB5A 3KBWA 3P93A 4HHHA 3BAWA 1OFRA 2Z25A 4BF5A 3CPGA 3SM0A 3TIMA 4RZ5A 1P5BA 4U28A 3KBMA 4ERIA 2HMCA 3BMWA 4RZ6A 2R9RA 1UC4A 5J5DA 3BLPX 5D2WA 4GO8A 3TC6A 3EZ4A 2X42A 1S2CA 2C13A 5LKYA 4C6BA 4D6CA 1VYRA 2WVVA 1SO6A 1BPLB 4LF1A 4ZOEA 2B7NA 4RW3A 2INEA 2X8RA 4TVDA 3TH6A 5A1AA 1FCQA 1P0BA 1NVMA 2ZZ4A 1GQNA 3DX5A 3T09A 1E1FA 1XINA 3C2EA 2OQYA 4MWAD 1MXGA 2QCMA 4GZIA 4K39A 4XIMA 4FF5A 4LYPA 4KETA 5C7VA 3OVPA 3G0SA 1XYZA 2YZRA 4O57A 1EZWA 1JG9A 5EFFA 3CYJA 3CIXA 4D1IA 4OOUA 1UJPA 3FFSA 1P43A 4J3SA 4UFKA 4WGXA 1PDZA 3VMNA 5HATA 3LBMA 4HB7A 5MF5A 5MKGA 3F4CA 1X6NA 4Y9MA 1X8CA 5E0CA 3FDGA 3I7QA 4P5UA 1HL8A 5FJPA 2AOSA 1ZJHA 2BLEA 1ZNNA 3GG8A 5CC3A 4O4WA 1P48A 3JVAA 4OV9A 2CBIA 1XC4A 1XH1A 3GAYA 2PSNA 4J35A 1ICPA 4M51A 2V5BA 2HPIA 1IZJA 5AC4A 4JIEA 3JW7A 4AF0A 1SVDA 3DFTA 2BHZA 5FEXA 3WH8A 3F5JA 4P8VA 1CBGA 3U2EA 1O5XA 4IPJA 2PDGA 2ESCA 2XUCA 3VGDA 2PEVA 3TYAA 2WZIA 4A05A 5DBTA 5CBBA 4IGNA 5AZ0A 6TIMA 2QUTA 4CD4A 3ZT7A 2FVMA 3PZMA 3BOXA 2V38A 5HANA 4MB3A 1VYPX 4IMAA 4S3AA 2XFFA 2BVDA 4N9EA 2X2YA 3QV8A 5CJMA 5EBAA 4AC7C 4FF7A 2YCLA 1QNQA 3WK3A 3LQGA 4PCFA 4PMOA 3MS8A 5A8PA 4US5A 2TSYA 1H1NA 1J4EA 1JCMP 5A8MA 4M3PA 3WEOA 4UR7A 1FY6A 4CEXC 3HG3A 1GGOA 3W7NA 1NOWA 4A22A 5FL0A 4DF2A 4FNSA 2QCDB 3ITTA 2OXNA 5F1UA 2IPWA 3V16A 4WF7A 2Y8VA 1DL3A 3MO4A 1O68A 3ZIZA 3U7BA 4O1CA 1RK5A 3R12A 1ZZMA 4XD4A 2VFDA 2WAGA 1HKIA 3LDVA 3GAKA 3OHIA 1KB3A 3G8RA 1NSJA 1HJUA 3UWWA 4J27A 4XZWA 1LYXA 1QMLA 1VH7A 3HGJA 1F3XA 1FWTA 3NA8A 4DWSB 3TSDA 5IHRA 1M01A 2X16A 1UUMA 1VP5A 4QEEA 3RN6A 5GVJA 2VTFA 3EDFA 3NL6A 2XIOA 3GD6A 2OGYA 1AH4A 4PRTA 3B0VC 4HPJA 4W86A 3C6CA 2FB2A 1YPXA 3FNDA 1EA9C 3O15A 3R8HA 3OJGA 1GG0A 5DN1A 1UJQA 4FO4A 1LOSA 3ZSSA 1AFSA 4Q6JA 2Q09A 4NJJA 1I9CB 4UNLA 1KLYA 2V5CA 5D33A 1ODUA 1QOQA 4KESA 1K6AA 2WJDA 3FEQA 2WWCA 1J2BA 1UC5A 3BGJA 4UTTC 4XAGA 2IKHA 3P67A 2Y7FA 3QLLA 5AYYA 3UPBA 2EF9A 2Y7DA 1O1HA 2A6LA 3W86A 2WSPA 4IQEA 4C6KA 1FWIC 2WZTA 4RKAA 5FA5A 2OR2A 3A3HA 3QJAA 1CXLA 2DEPA 2BHYA 3W53A 1M41A 3RNDA 1E1CB 4U5IA 1J9YA 1GOWA 4HP5A 4PUWA 4NJHA 4S3DA 1XDMA 4NX5A 3T81A 1OSEA 1DKWA 4AVOA 3GXIA 3UA3A 4YWIA 4MY8A 3HQPA 1FWCC 4HZ8A 4M5PA 2NUXA 1P0KA 1XR2A 3SRKA 4PTNA 1JDFA 5KZ6A 5HMSA 3N18A 1A5SA 2P88A 4P8XA 3PTMA 3AYRA 4AU0A 4QBXA 3TSBA 3H2OA 2Q3RA 3S9ZA 3GVWA 1CGXA 5AFDA 2D2JA 3WUGA 4Q8OA 5G2WA 3S2MA 3UYCA 2V2DA 4K36A 2DZUA 3MW7A 2NSOA 3MSRA 3GIPA 1UWRA 4RNFA 3VYLA 4D6EA 1H51A 4NZJA 3LCIA 2XIMA 3PBGA 5HPOA 3LK6A 2B7OA 1E40A 2O4QA 2V3FA 4W5UA 1LLWA 4CD5A 1GW1A 3IANA 2OODA 1EJUC 3WLKX 2ZRYA 3TYUA 5ABEA 2X09A 3EA2A 3OBEA 4QJ1A 2IXVA 2ATMA 5EA9A 1L9WA 4N9CA 5TIMA 4DAFA 3B8TA 3FYPA 2E9MA 5DY3A 1Z69A 4JTJA 2OO0A 3S2LA 4AD4A 2JIWA 2NT0A 3ARXA 3L4ZA 4QSFA 1PKNA 5LYRA 4RNJA 5J8LA 5M17A 3EA3A 2D24A 3TK7A 4AIOA 1W9VA 1CXFA 3HJEA 4AZ7A 5HMEA 2PTXA 4O1BA 3Q65A 1JPKA 4CKQA 2RKXA 1B1YA 4DBWA 3TW9A 1UD5A 5EYWA 4R33A 3KHDA 3AZTA 3WH9A 1J93A 5T8GA 1ZCOA 3VVGA 5I6SA 3UCCA 4JFVA 5B7YA 5CGQA 5CPQA 4JTAA 2JQXA 1RVGA 4GISA 3LMZA 3IJIA 2PDWA 2CBVA 2DZPA 1LWJA 3AICA 4U33A 4Z0SA 1UWTA 3HQOA 4JTHA 2DY3A 4XKYB 5AHFA 4A3UA 2WPGA 1JPHA 3ITOA 4G6CA 1GOMA 1BKSA 6REQB 4D6DA 2YFNA 4N6EA 1TWZA 5IFTA 4R7JA 2PGFA 3WNLA 4LWWA 1JR1A 1JDCA 1CB2A 3M46A 4EOUA 5C7HA 3WDJA 2L5HA 3T07A 3V1HA 1JD9A 1OCNA 3O63A 5BW6A 2HNHA 3N13A 4M81A 1BQCA 4PTXA 4H7ZA 1DIKA 1NM9A 3JU2A 4K7YA 1H41A 3M0HA 4YN5A 2C71A 3VIFA 5FCZA 1UKPA 2VGBA 2WZHA 4QDMA 2V69A 4Q4KA 3POCA 4RE3A 2I1OA 1UIOA 4MJMA 1O60A 3DFSA 4WX2A 1K9EA 3N11A 3PB0A 1KCKA 1SJDA 4GYPA 2H8XA 2PTWA 2FTWA 4E8CA 2DP3A 3GNRA 4Q3MA 4XSLA 4LSBA 2NWRA 3C61A 1R6WA 2Y2WA 1BG9A 4US5D 1S38A 5D2XA 4H8NA 2DZTA 4F0HA 3EMQA 3CLWA 2I5IA 3UVAA 2DSUA 1O5QA 2DFAA 1M68A 4F9DA 5CBIA 2RJHA 2QUNA 1WDWA 2XIJA 1VEPA 4AD5A 3G8EA 4ATWA 3CC1A 4JNYA 1ITCA 1K03A 5I0DA 4J40A 1FA2A 3LUTA 4IP7A 1OIMA 4NI8A 5CPOA 3GVRA 1K8XA 2DT0A 3GC2A 4IH3A 1Z41A 2E1WA 3UWQA 3SGZA 2OG9A 3OQ8A 4H4IA 2HCVA 2J7FA 3H55A 3MANA 1DWGM 5HQMA 4DJDC 1F6PA 4AY7A 1AZ2A 4JYFA 1JJKA 1R7OA 3ZZ1A 4IX0A 4O14A 1VENA 4GI4A 5I06A 3CUXA 3PS7A 1YDNA 1S1PA 3VKAA 8XIAA 2VMFA 2X1TA 3T9PA 4JXCA 4DXKA 3SQMA 1GCYA 1SSGA 4W87A 2GGGA 3NQGA 3W1QA 1TPFA 3ICJA 1YDVA 1RPKA 3MP4A 4OUIA 1P6CA 3N2CA 4HMDA 4JR5A 3CAVA 4FXJA 1H7WA 3GTFA 4AIUA 5F2IA 3C2RA 2ODOA 4TO8A 1FWRA 3N73A 2XFRA 8RUCA 1PIFA 3M47A 1EWEA 1DJIA 4S3CA 1XSJA 3FW6A 4V2XA 2UY2A 3W74A 4NRSA 4A2RA 5HOSA 1FX6A 1JI1A 2A7NA 3FGCB 3F4WA 4XZMX 5HULA 4UXDA 4D6GA 2F7FA 4U3AA 1W8SA 1MZRA 4TR9A 3L0GA 4PMNA 4W7VA 2P0IA 5AHMA 5JVLA 3PR2A 5H2ZA 4NZ1A 3EWYA 3OA5A 4TQTA 1O95A 1F3TA 4B5XA 3P82A 4MJ2A 3HQ1A 5GJPA 4AWEA 2GDVA 4JTFA 3WELA 3SFWA 4UTWC 3AZRA 4HOZA 3NVDA 4LRTA 3T2QA 3E0FA 1IR1A 4X2PA 1TRIA 2G0WA 2Z1VA 2I9EA 3M5YA 2EHHA 1D3HA 5K4XA 4HPNA 4RDVA 3D46A 3HQNA 1HVQA 1J6OA 1GPWA 1WQ5A 1B54A 1ISVA 2ISFA 3C52A 3ITCA 4JFTA 2AMXA 3QKEA 1E73M 2V2HA 2JF7A 4TX8A 2EKGA 1C7TA 4IMEA 1MRQA 4UQAA 3E12A 1H60A 2E6DA 2AKMA 4QG8A 4FX7A 4IPPA 4UTKA 4W89A 3G5EA 5FSEC 3N29A 3SCQA 4O0ZA 3RR4A 4L4OA 1W1YA 3E96A 4L64A 4HZMA 2FB3A 5I3GA 3VABA 4P7QA 3ARZA 4HTYA 4LNCA 4UC5A 1RP9A 3A3XA 2YDAA 4P8UA 2CLPA 3N2XA 1W9XA 4Y9AA 3BV4A 4D6FA 4PN2A 1B0IA 2WNNA 4RJEA 3NR0A 4IQJA 3FX4A 4DPQA 1R3SA 1TVPA 3BXWA 1EXBA 4MB5A 4C6IA 1PDYA 3IJLA 1PZ3A 4B5VA 4HYRA 3LOTA 5EMUA 1SQ7A 5H8PA 2B4GA 3T0AA 3RLUA 1KM4A 4LY8A 4K3ZA 3MZ2A 3VMPA 1LOLA 4K8HA 5DFAA 1VFFA 5GJNA 1TPUA 1FWWA 2ZXQA 1I1WA 3SCTA 1JCTA 3IAPA 4M6VA 4O1EA 2VC6A 2WQDA 1TJ0A 4PTWA 5FJIA 1TB3A 1PTAA 2DZBA 3O2LA 4FSAA 3W9ZA 2J66A 3CUHA 4W84A 1OG0A 5F2MA 1CIUA 2D20A 3MJMA 2ZUWA 3S5YA 3HGRA 1DE5A 4UMAA 1RK6A 2ALRA 2O56A 3IEBA 5FJOA 1FVPA 4HPXA 1TTPA 2BOFX 1J5SA 2E9LA 4O54A 4XZBA 2GUUA 3PNUA 4HA1A 3LPGA 4EPBC 3FA3A 3T08A 1H3GA 4F0SA 3QH2A 3AHYA 3UF9A 2PC8A 3P81A 4GZJA 1X7IA 2O9PA 3GWQA 1TTIA 1M7OA 1VHCA 1FH7A 1CGWA 3P6LA 3WF1A 3KE0A 4LJ3A 2ADAA 3V7PA 1YNYA 3BVJA 4ADTA 4UTTA 3EYPA 3AMKA 3RX3A 4HNUA 1Q6RA 4Q8QA 3AZSA 4MDOA 4TV5A 3O6YX 5HJXA 3RPDA 3UA4A 1ITXA 1DIEA 1AJ2A 3VGBA 3QXBA 2REQB 1JQXA 3S2JA 3L12A 1QR7A 2VZUA 5DXXA 4RPPA 4WDTA 3LHYA 2G5WA 3L23A 2ZCGA 4FLOA 4JOMA 3EMZA 2D69A 3BK0A 1XYFA 1UR9A 4JHMA 1N8IA 2DIEA 2EQDA 3IGSA 2A5HA 4QIUA 1U1JA 4WJXA 1ISWA 3WK1A 3WQDA 1E6ZA 3BQ6A 3QGKC 1ICQA 4WY0B 3BW2A 3V4BA 2DU2A 1GQLA 3PZVA 2VGIA 2WSQA 3IGHX 4J7RA 1FWJC 3KUMA 3MJYA 3B9NA 3KTXA 4AYGA 4IGHA 3N4FA 3UZWA 1QFEA 2ONEA 3KX6A 3LGGA 4F3HA 5KINA 1X7FA 1R86A 3KBVA 2EO7A 1DV7A 2R1MA 3WNMA 4FNUA 1A5OC 1RQEA 1HN1A 3PAJA 4OHQA 4V1XA 3THQA 3LCWA 3MMTA 1UH2A 3JRKA 4H9XA 1KCZA 3VGHA 4X0NA 4DAIA 1LM1A 1RLCL 1XLFA 1I0BA 3GM8A 4OWGA 1K70A 4W4QA 2DVXA 3WFZA 3PN8A 3W84A 5KTLA 3GTIA 4OFCA 4H6RA 4UTLA 4AQLA 1EUAA 4JTRA 2QLYA 4KRZA 3LLXA 4DLFA 5BZAA 1BKHA 3R58A 3LHWA 3UZZA 2X2GA 2NUWA 3HFYA 4K38A 4QE4A 1Y0EA 3B4YA 1ML1A 2AGTA 1LOQA 1G4EA 1XWYA 2GGEA 5HJLA 4AXKA 1CXEA 1A0DA 4NILA 4R9XA 3L2MA 5H91A 3D6NA 3VMOA 2HROA 2SFPA 2X05A 1GYLA 5TNVA 4GIEA 4EF8A 1F4HA 4QS5A 1F8MA 1U5HA 4L6DA 3EOEA 3TWBA 1O12A 4LUYA 4ACYA 2EEXA 2Z28A 5LA2A 1PYMA 1U30A 5I78A 3SCUA 4HCDA 4TX6A 4LC6A 5E93A 3TVAA 1REQA 3QR3A 4IXXA 4OECA 1AA1B 2D2GA 2YDSA 4PUNA 1HVXA 3TA9A 5IRPA 3QV6A 2BZNA 3PJUA 3N6QA 2E28A 3KZPA 3WMBA 1FDJA 3WQOA 1O1ZA 3QQ1A 1DWJM 2VJXA 4O1FA 1JYNA 1QW8A 3U0HA 1F5ZA 3QOMA 3PUEA 1V6VA 3VCNA 3GY1A 2IPJA 2ZWZA 4LV9A 1IQ8A 3RK8A 1P1MA 4MPQA 2OTDA 3OZPA 2VRKA 3HB9A 1Q13A 3EOUA 3B0PA 3HGSA 4NNBA 1MDRA 1E3XA 7A3HA 3AWOA 3ZLFA 1WO2A 2VEGA 3WX7A 2ZZ6A 3W1LA 2IKIA 5U7SA 6A3HA 2VR4A 4LUIA 4KERA 5D2VA 2JEPA 3CUJA 1NTHA 4A29A 2W79A 1KFBA 4PMUA 1ESWA 1WE5A 3QHNA 3KW3A 1E72M 3MC5A 2DGAA 4OZOA 1KCLA 1Y65A 3VKDA 3GXPA 1OYBA 4Z0JA 4XX6A 2XJ7A 1NP0A 4Y9PA 3WSUA 3EWZA 3THCA 1OINA 1XIMA 4X60A 4MWAB 4AD2A 2BY1A 2Z4GA 3USZA 1RBAA 3A4WA 1J0IA 2W91A 4S1FA 3CPUA 1OJXA 5C0QA 4HNTA 2PZ0A 4E2OA 2VHLA 3DC0A 1CCWB 4XV0A 3VA8A 4NIRA 3I65A 3R94A 4C5YA 1PIIA 4PUJA 4I7UA 4R7OA 3HPXA 4ZB2A 4FNTA 3W71A 3H54A 4Y9NA 4GZ7A 2HE5A 4H8VA 4LBSA 1WDQA 2WJFA 3D5HA 1KFKA 1AW2A 2ZXBA 3EWXA 1TCDA 4QJ5B 2QPXA 3MMDA 3E0VA 3WQEA 1X39A 3M5ZA 3LPFA 1A53A 4RDZA 4DPPA 1O66A 3L4TA 1QNVA