3RPTA

Crystal structure of the anti-hiv b12 scaffold protein
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
276
structure length
253
Chain Sequence
DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWHNQHQITGQVDALMSAAQAAGKIPILVVNPFEEGKQWIDEFAAGLKNRPAYIIVDPGAWRFAAYAGKALKAGSSQARIYFDAGHSAWHSPAQMAAALQRADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNESCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase E-2
publication title Computation-guided backbone grafting of a discontinuous motif onto a protein scaffold.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Hydrolase
total genus 94
structure length 253
sequence length 276
chains with identical sequence X
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3rptA00
1GZ1A 1OCJA 3VOGA 1OC5A 2BOEX 1OC6A 1UOZA 1DYSA 1OCNA 4A05A 2BODX 1HGWA 3RPTA 1OC7A 3VOIA 3RU8X 4B4FA 1TMLA 4B4HA 1BVWA 2BVWA 3VOHA 4AX6A 1UP3A 2BOGX 3VOFA 3VOJA 4I5UA 1QK2A 1OCBA 4AVOA 4I5RA 1HGYA 4AX7A 3ABXA 1QK0A 3A9BA 4AVNA 1UP0A 1CB2A 2BOFX 3A64A 1UP2A 1QJWA 4AU0A
chains in the Genus database with same CATH superfamily
5CH9A 3BQ6A 2GSEA 2CXEA 1H7RA 1NOFA 4C5ZA 3GTFA 1RCQA 3H53A 1ZENA 4JAWA 4OIFA 1A50A 2WO5A 1W6TA 5I3KA 3N2XA 3W85A 1J0YA 2VZSA 3OLIA 3EX4A 4MTVA 4GQRA 3K8LA 5IM51 1JCYA 2QULA 3MTWA 1MEIA 1JCTA 1FP8A 4ZOBA 1XSKA 3HZ3A 1KGWA 2EXOA 2Q02A 4IP4A 3WDHA 4PBEA 4GGHA 4J40A 3PK7A 3FFSA 2GUUA 4N9BA 4ZTXA 1W17A 2BWGA 3W2MA 2YCIX 1QI0A 1D8WA 2GQ8A 4HGXA 1NQ6A 4JTCA 2WMFA 3KBJA 4K3ZA 3QLLA 5A2BA 1JF6A 3WJZA 4V27A 2HBVA 3GNPA 3K4DA 2OSWA 3W73A 1T8QA 4I5RA 4JIRA 1TB3A 1V08A 3A5FA 2C0AA 2D73A 3TJ4A 4X9SA 3CU2A 1HJXA 1OM0A 3MA8A 3NFUA 2VD9A 3RPTA 3PAOA 2Z1SA 1S5VA 2YA1A 1Q85A 3LMYA 4B3LA 1R47A 3R11A 1KNWA 3KZPA 2X40A 1TR9A 3QHOA 4Q3MA 2OQLA 3B0VC 4YHEA 5TBOA 1TRIA 4G7FA 2E9LA 1I2RA 2OXNA 1UUQA 3BLLA 2ACSA 5GQBA 5CLWA 2NXHA 2R14A 3KTSA 3BVJA 1X6UA 1WZLA 2BG5A 4ZOEA 2Y89A 4DM1A 1SJDA 1YNQA 4LB4A 3W1NA 3PPFA 3N6JA 2ZUMA 4O52A 4U3AA 3F1QA 4ZVJA 3KL3A 3LQGA 2X0YA 3CH0A 1IEIA 2BASA 2DZWA 4LRSA 1LLWA 1C93A 4LEQA 5GNYA 3BSHA 3VOFA 4LVAA 2XU2A 2GWGA 3AIUA 4UB9A 5I5RA 1E1EA 1XR2A 4HTYA 3M0HA 5D9PA 4WDXA 3TJLA 3I4KA 1UJPA 1E4MM 2AGKA 4JN7A 1GNXA 1YADA 2H3DA 3I7QA 1K8CA 3I10A 1DE5A 2W61A 4WQ6A 2WHKA 3SFKA 3B0PA 3NZQA 3UXAA 3LOTA 4TTUA 4FXRA 1TR1A 3MKKA 3BOLA 2DUZA 5CQ1A 3RJYA 2DUAA 2A5HA 5HUOA 3L2LA 4RXFA 2ZYFA 3GW3A 2Q8XA 3EWUA 2WVSA 4O11A 3S5NA 4LX4A 3WBWA 1W91A 4H01A 1Z3NA 4UOJA 4AY7A 1AW2A 1WUEA 4UQCA 5M03A 3W7OA 1TJ2A 3CZ8A 3LBMA 3CUZA 1RPXA 2HVNA 3AWNA 2YCKX 1JL8A 3OBEA 3W2UA 1VCFA 1ONEA 3H7VA 4BS0A 3HG3A 4JFVA 3EWDA 3TN6A 4PUWA 3C2OA 4O1FA 5CBIA 4AU0A 5KITA 4M19A 4PBGA 1KM3A 1MSSA 4EACA 2ZXDA 1WZAA 3OP2A 4MG4A 1QPRA 2C14A 3MDWA 1YXDA 3SW6A 2DZPA 1V7YA 2BHUA 4GKLA 4Z2GA 1ZBVA 1MW2A 1RALA 2W67A 1VEMA 4AEFA 4M7TA 4S3BA 3LSBA 4Z0JA 2PDMA 5FF4A 2WC7A 2WBKA 1DQXA 2PDPA 4R7WA 3R8GA 2B7QA 4D6CA 1FBAA 4AIBA 3EEGA 2G8ZA 2QF7A 2OEKA 3NZPA 3U4AA 3AIVA 4JTGA 3TZNA 4PMXA 3BAIA 3BPWA 4KW2A 5LA2A 1T99A 3TW6A 3M43A 2A6NA 2X2YA 3MUZ1 4TTGA 4PMDA 1KA9F 1LUCA 4GO8A 1GG0A 2HTMA 2PP0A 3MSRA 4O19A 3W0KA 1NEYA 1U33A 1TUXA 4J2PA 4I6KA 3LM7A 3SDOA 3PY2A 3AMKA 3SCRA 5C9RA 3RDKA 1X8CA 4IXHA 3TKFA 1XX1A 3HGSA 5F2IA 4JZ5A 3QSRA 4NF7A 2NWSA 2QV4A 1AQMA 1K3UA 4FR6A 4S3JA 1VCVA 3B0UX 4DWSD 3G1VA 4RV8A 4AWEA 3THDA 4HNTA 1JDEA 2HK0A 5A2AA 3CB8A 3LCWA 4E8DA 2YR1A 2D0FA 3VAVA 3VZZA 2J62A 3LGGA 1X1OA 3EWYA 1DWJM 5G4HC 4A8IA 3EDEA 3OU8A 2DT3A 1Q63A 3STCA 7PTDA 2ZXQA 4XAFA 3F4VA 1YTKA 4S3GA 2A3EA 4QDWA 3BAWA 1V02E 3G8RA 1KV8A 1TJ1A 3GTNA 4YLWA 1SFLA 3T40A 3PZ9A 3W88A 4WGHA 1UA3A 4FXSA 3O15A 4R7OA 3I3DA 4DZIA 1YRRA 1R7AA 1OSEA 2QJNA 4HU8A 1REQA 1GKRA 4I9AA 1TPFA 1KRBC 4WJXA 4Q8OA 1LQ2A 5LIYX 1OX6A 2XH0A 3ZLHA 1UZDA 5BXPA 3OGRA 3T44A 1MDRA 5DF0A 3AROA 2DT0A 3CJPA 1C90A 5HJLA 4XD4A 2HPMA 3LZ3A 2BOFX 1B9BA 5CSYA 1HG3A 1R3WA 3NYDA 1TZ7A 2OELA 3PF3A 4E3TA 2AQOA 4ZFMA 1L6GA 4IQJA 1PHWA 4NNBA 3NQCA 3ARPA 2FDSA 4FB7A 1B54A 1FWWA 1XUUA 3N18A 3UJSA 1OT1A 4GVHA 1M1BA 4S3CA 1UBPC 1BKSA 3ECQA 4Y6GA 4P7RA 5DRCA 2PMQA 2D0HA 8TIMA 3PTQA 1K1DA 1EIBA 2OZ3A 4BQ3A 4L1GA 4H2HA 3NQAA 3LLFA 4Y8FA 2BOGX 4MF4A 4OHQA 4RE2A 3E0WA 1V8EA 1AFSA 4B2DA 1IEVA 3B0XA 3I6TA 1G01A 3LG3A 4WGXA 4J3SA 3T0DA 3MI6A 3NQVA 3BW2A 4GH1A 4DO4A 2E5DA 3M5XA 4IH3A 4M1BA 4HNCA 2R1LA 4JTDA 4C6BA 2ZZ3A 1DHKA 4RDWA 1QRQA 4Z1AA 1BTCA 1QNPA 1K8XA 7CGTA 1DJYA 1FWBC 1NTHA 1QOXA 1OK4A 4B5TA 3H2AA 3RX2A 2NLIA 3CYJA 2HK1A 2PBOA 4UTIA 2ZC1A 3PNUA 1FFRA 3LRMA 3N12A 1L2UA 1P0NA 3DX5A 4HOXA 2I14A 1DBTA 1WDRA 3W27A 5HQMA 3AJ7A 1BYDA 1XM3A 4F2TA 4MKNA 1EP1A 5JH1A 4NZ4A 3UPBA 5ABGA 4HNLA 5C9UA 2PUZA 4W84A 4V33A 2R8WA 4J9JA 5CPLA 3O06A 3BV4A 1XYCA 4XUGA 4N9EA 1YBQA 4C6LA 3VKCA 3TR2A 4UTFA 1W1YA 1N55A 4HSNA 5D2WA 1K9DA 1N2VA 1F4AA 3BLOA 1ONRA 1Q6LA 4O28A 1MEWA 1P6BA 3DC8A 4GX9A 3BOFA 3NPUA 1Z8AA 3A21A 4M51A 4QJ4B 4M56A 3NDZA 1LTDA 4U5KA 3K1GA 1H4PA 3II1A 3ZJ7A 2CWNA 4XVEA 5BWAA 4JX6A 3S0CA 3FYPA 2PURA 1TO3A 4IQLA 3GWQA 5HWJA 4WRHA 4BJHA 3W86A 4LW7A 4LXFA 3VGEA 3MUY1 4IQDA 1ZBKA 4PUDA 4LVDA 3HN3A 5HMSA 5LGZA 4LBSA 2F6XA 4AMAA 1QNOA 5FEZA 3MSYA 1V03A 4H6KA 1Q6RA 4H00A 3TNBA 3BJTA 3MSGA 4DJFD 1KBLA 4LTSA 2NZLA 1R3VA 1F3TA 2XISA 4PZVA 1E6NA 3H26A 1M7XA 1TPH1 3W83A 3WJYA 3WYZA 1WYIA 1L9WA 4LUYA 3A4WA 2WSYA 2ZICA 3MV11 1KR0A 4EIVA 4L61A 1VR6A 3ORWA 3V36A 2F7FA 2VWSA 1EZWA 8XIAA 3GIQA 1F76A 3TSMA 1I1XA 4G6CA 4HMNA 4UTTA 4Q4RA 4F9DA 1Q6OA 1UH2A 2PFHA 4O0KA 2BGNE 2ISWA 1J93A 5BZAA 2VKZG 2H8XA 2E9BA 3W82A 4I9MA 1Z69A 4Q4SA 3TQ0A 1GT8A 4S3EA 1UWAA 2ABBA 1UCWA 1TV2A 3M47A 1HL2A 4QG6A 4GQBA 4H9YA 1KCXA 1YW1A 2QAPA 2H8ZA 5HJYA 1M53A 4QR6A 2FMNA 5G2HA 1OFPA 4UMBA 4ADSA 3LTYA 1I0BA 2ZWZA 5DY3A 3UA4A 4J1OA 4L6OA 3S2CA 4H8NA 4MAVA 3VABA 4A8RA 1KQYA 4JIIX 4UZSA 3MUXA 2BV9A 4Y8EA 4PFMA 1DE6A 4O14A 3M0KA 1FWAC 3BQ5A 3BCJA 2GDVA 4DBSA 1G7UA 5CJNA 5EU9A 1PPIA 2FTYA 3DECA 4L6DA 3WK3A 1M5WA 4PR4A 3VDBA 1UMYA 1VGAA 5FJTA 1TE6A 4NKCA 1E51A 2ZZ1A 4LJ3A 3W3OA 1KGXA 1L6SA 4MKVA 1PWMA 2E8ZA 1JFXA 3KCJA 4ZB2A 4JX4A 4XO7A 2GVYA 2ZX5A 5ABTA 3UJFA 1BG9A 5A95A 4JTSA 1YXYA 5C54A 1BEUA 3TOYA 3AAMA 4JQ4A 1XWYA 2DORA 3WH6A 3TX9A 2DSUA 4Q8WA 4QHRA 2QHAA 1YYAA 3PJWA 4C6IA 4G1NA 4C6MA 4XD6A 4OQVA 3GC2A 4H6EA 5IFPA 1QK0A 3UPMA 1EP2A 3K2GA 3A64A 3H4XA 2Z27A 1CNVA 3MU7A 3W07A 4EKJA 1TREA 3G1AA 1B0IA 2GGJA 4FA3A 4R27A 2GVLA 1RJRA 4PCSA 3CHFA 3HQOA 2HZGA 2FGLA 5A69A 1MNSA 3OG3A 3UYCA 3RLHA 3RJXA 1XLIA 1E0XA 4Y7EA 2X30A 1H7NA 1RAKA 2CZFA 1NSJA 3F03K 1E6SM 1ISWA 2HVOA 4WOZA 4LUTB 3TU9A 3HOJA 3SRKA 1O6IA 2G97A 5HPCA 1CEOA 4OBRA 1W1A1 2VEPA 4HOWA 3O05A 3IV8A 4ERGA 1GWJA 3BMVA 4ALDA 1KFBA 3I68A 2PDKA 1UKSA 4Q7NA 1OC5A 3STGA 2WCGA 1OCNA 3SJNA 4RZ5A 3UXIA 5AYIA 2V8ZA 3VUSA 1JQXA 3T2PA 3GG7A 1MUCA 5K9XA 5AB3A 3PFMA 3CBWA 3RFAA 2VNCA 2Y8KA 5K9CA 4Q33A 1GZJA 5M1TA 2DV0A 1RH9A 3KM8A 1IR1A 3E2QA 1UH3A 2A85A 4H7VA 3PBYA 3GH5A 5CZKA 1LP6A 1X98A 2E6YA 4GG9A 1A5NC 2A7PA 1IE7C 1JUBA 4L80A 1VEPA 4TVDA 3UA3A 2J9XA 2PGEA 4XBSA 1Z89A 3PJUA 4OECA 1Q6FA 1SR9A 1OBAA 2P0OA 1EJ7L 3OZMA 4NT0A 4W7VA 3S46A 6TAAA 2D20A 4IMEA 3C2FA 3AXHA 1PIFA 1TQXA 1FH7A 4GUIA 3RG6A 3P82A 4R3UA 2UY2A 1RP8A 3RLGA 3WMSA 3WNNA 1CGTA 3KDNA 4H9UA 4LS2A 2VX5A 4H9ZA 1VKFA 1H11A 3YPIA 4LCRA 1IGSA 3SQMA 3VNLA 3VD5A 4J3XA 4XB3A 2DP3A 3NCOA 4UOQA 1VFTA 1QPKA 2CBVA 4N6FA 3M6YA 2OJPA 2XWEA 1OYCA 4DBEA 5BOEA 1BFNA 3RNDA 2OO0A 1OGBA 3D47A 1J4EA 4A2RA 3TJXA 3WD1A 2Y7DA 1RA5A 4K6AA 2ATMA 4A22A 3NPVA 2FJUB 4F2UA 5C7HA 2ZZ7A 3R12A 4CCZA 1CXKA 5I24A 2YL6A 2W6RA 3BLEA 3FV9A 3IJLA 5E0KA 2WKJA 2D69A 3WNMA 1N82A 1GYNA 3IJ9A 5E09A 3V1PA 3OOQA 4LBRA 4W8LA 1QNVA 5HBFA 2PWFA 1EOMA 3NA8A 4H9MA 3NDYA 1QHOA 2PDUA 1JPMA 1IXQA 3PZVA 3SM0A 4TMBA 2VXNA 4QP0A 4O1AA 2XH7A 4RPQA 3GD6A 5LXXA 3H7UA 1W3KA 3S83A 3Q67A 4DLMA 3CZGA 3EOSA 2J8GA 2OQHA 3HTWA 3BXWA 4BQ4A 2BY2A 3HF3A 2KAUC 4D6GA 3HMJG 4XAGA 3GHRA 2ZDSA 1ZTVA 4EWND 2VELA 1B3WA 2XVKA 4GBUA 2QR6A 3M4HA 4GK8A 2EG7A 3QHNA 2I17A 2QCFA 3GR4A 5JIWA 4XG1A 3UZXA 3RITA 4F3HA 4PH6A 1EO7A 3AHZA 2YIHA 3PZMA 4DQWA 2C79A 1KXVA 4O4WA 2PU1A 1K77A 3G18A 4LS1A 1C92A 3QMRA 3TE9A 2V2DA 3DYOA 4CEXC 3CUJA 3CWOX 3QQ1A 1W3NA 3WQVA 4KEZA 4US5A 1U5HA 2HSAA 3NZ1A 4HA3A 3KUMA 4GC3A 1QR7A 2XG9A 4J3WA 3EYPA 1FWSA 3NXLA 3IJQA 4JTQA 1EGVA 3W1UA 1Y8BA 3BO9A 4D8AA 1PX3A 5AZ1A 3V18A 1J0KA 3EGJA 4ZQCA 2PWDA 2BVYA 2VP8A 1GW1A 3FYOA 1XIBA 4C7DA 4S2CA 4Z17A 5CG7A 3IK2A 3M9YA 3N2CA 7ODCA 2EKGA 3ITXA 1XGEA 4IGMA 4YTUA 1UG6A 5BMWA 4GYJA 1Z44A 3PWAA 1FY6A 3USZA 3BJSA 3CGTA 1PB0A 3FY1A 5HA7A 3WZ0E 5FI8A 1P0KA 1Q3NA 5CC5A 3OZYA 4PB5A 3RM8A 2VFEA 3BMWA 3K4WA 3RUBL 1B3ZA 4JL2A 4L1XA 4GVIA 8RUCA 3FVDA 4I90A 3UJ2A 4LEFA 3UP8A 3TK7A 3EB4A 4AZ6A 2QCMA 2P76A 1W37A 4MWAD 1TWSA 1XG4A 3AALA 2WC3A 3UGRA 1CGWA 1S38A 3AXKA 3F4NA 4MMWA 1EZ2A 3VNJA 4F40A 1LROA 3WBYA 1UC4A 4XZHA 3AYRA 2GVJA 2GQ9A 2WPGA 3LS9A 2PCQA 3SY5A 3COTA 2CEQA 4L4MA 3S5SA 3W74A 3TEVA 3AMDA 2QDGA 3KXQA 4AD0A 1PBGA 4HSOA 1UQYA 4M29A 4N42A 4U4MA 4CNOA 1WOBA 4DZHA 4AWSA 3G0UA 1FVPA 2JKAA 4GC4A 4XISA 1MI3A 2J47A 1Z9AA 5GJPA 2P3ZA 2GJXB 4IP5A 1GTEA 4MWAE 3N2OA 1YQ2A 2PDNA 2PGWA 2Y4SA 3R10A 3VNYA 1XYMA 5U4NA 1X96A 1XC6A 2O4QA 2BXVA 1J2BA 3W6LA 3ZXWA 3NJ3A 1A4MA 3N3MA 4V15A 2V5JA 4MUPA 4O57A 1AA1B 3FSUA 2FZMA 4LC6A 1CECA 1BVNP 3SSZA 2QIIA 3VOCA 4Q6JA 4BY3A 2XWDA 5E93A 1Q6EA 3WQGA 1UPPA 3W38A 1W3TA 2Q3RA 1XKJA 4H83A 1RQEA 3VIIA 2ZUNA 4UR9A 3GAKA 1LBLA 3SUSA 1P4CA 4RE0A 4AIEA 2VFHA 3QEZA 3SCQA 3W7KA 4BI6A 2PPGA 3B0YA 3MANA 4NXSA 2ZIDA 4HZMA 3WLKX 4X9YA 4DJEA 3WELA 1XIJA 3CH9A 3DIPA 1OD8A 4EPDC 2FHFA 3FEMA 3L4VA 2FVKA 3AS3A 5C9XA 3W7DA 2ADAA 2HROA 3NIYA 2ZADA 3KP1A 1B3XA 3GDLA 3L12A 4JTTA 3L0KA 2OCZA 3SIMA 3B4YA 1GPFA 2PRHA 4CLMA 3TFXA 4JPGA 2W66A 1EOKA 3LCXA 4R88A 2VGBA 4K37A 1IIHA 4UC5A 1VS1A 1OT2A 1WP6A 2WLZA 2RDTA 1NM9A 4GJJA 3GW0A 2IXUA 3FNDA 4JCMA 1VFSA 1XF0A 2VQTA 3QZAA 4GZJA 3HURA 2WJZA 2QUNA 3IV3A 2A3AA 4PMRA 4HZ6A 5REQB 1LT8A 4IL2A 3W1AA 3JZEA 4OWGA 1JNDA 1DEDA 2E3ZA 3QMTA 5G4EA 3WLSA 4EXBA 3EWCA 2PEVA 3HQNA 1GONA 1GHSA 5CBBA 1X1ZA 2V5CA 3ABQA 4GVGA 1E43A 2PTXA 1EGMA 2ZWYA 1OFQA 2FZNA 3W6MA 5HWMA 2GJRA 3UR8A 2XHYA 2EG6A 4NI3A 3LRLA 3K1DA 2CNCA 3KRSA 7A3HA 4TMCA 3BL3A 4WLCA 4M6VA 3NQFA 5DXYA 2HEJA 3OVQA 2E1WA 4IIGA 1ADOA 3PJXA 3RU8X 1TVLA 1A5AA 4GH3A 4CVUA 4C60A 1ADDA 3SUTA 1D7FA 1L8PA 3VZYA 3C3UA 3CPGA 1EB3A 4PEKA 1TELA 4LUTA 1W3LA 4GQGA 4UTKA 2VEMA 1XJBA 1E0UA 4IMCA 4GE8A 2YB4A 1V0MA 4X61A 4IF2A 4MJMA 1QPQA 5EGRA 3B8TA 3KZSA 5EYWA 4HYWA 1O5RA 2WNNA 1H7WA 2W63A 4BI5A 1H50A 2QYGA 2QVHA 3UZZA 4DI8A 2D2JA 4MPKA 1E9LA 1W9BM 1W9DM 1WX0A 2EAWA 3AYTA 3IIVA 2TODA 1TZZA 4LOCA 3RCYA 4BWLA 2Y5JA 3EWBX 1ZSXA 2J6VA 2XDFA 3T0CA 2BVDA 4IFKB 3K8KA 1B5TA 3TFCA 1XYBA 1I1WA 4FOJA 4NJIA 1G4EA 1S2VA 1ZCCA 3NM1A 3HV9A 1JPHA 3TCSA 1TV3A 3M0LA 1GJPA 5E5CA 3OO2A 5BROA 1JD7A 4UTWC 2YLAA 3TC6A 4YTRA 4PGLA 1R86A 2GWNA 1XRFA 5G5IA 4UNKA 1C8XA 4ORIA 3NOYA 2VOTA 4RZBA 1MXGA 5EB8A 3TYBA 3MP5A 5LXEA 3LEPA 2Z1KA 3L67A 3V3WA 4O8RA 3FA3A 1WBJA 3ITVA 3MUCA 1UUMA 2NV9A 5H8UA 1H1NA 3CWNA 3NZRA 3FCPA 2VFGA 5HMDA 2JF7A 3HM7A 2XIBA 2CFFA 2VYOA 5CPNA 4AC1X 1F2JA 2X8RA 1GQJA 1OCQA 2J7BA 1TJRA 4ZA0A 3NO5A 4OTKA 1I75A 3KW3A 5AYBA 3HGOA 5JBEA 1B3YA 3ITGA 4OUEA 4XKYA 1F6PA 1CI1A 1CGYA 3OYZA 4MY1A 2NXIA 3KBMA 4B9YA 1XP3A 5FD0A 2VD8A 1PKYA 1TMHA 1HKIA 2X0HA 2E5BA 3PUOA 3BLIA 4QITA 4ZGYA 4FXJA 1VHNA 4LAOA 1JZ6A 2NSOA 1KW1A 1OWQA 3TR9A 3WQ8A 3TXVA 3W7IA 2PC8A 3N25A 1POKA 3H2CA 5DCEA 3UCCA 1I2PA 4PSRA 4WXYA 1WV2A 2RJHA 3BLKA 2F38A 5FJPA 4H9VA 1CB2A 4ILSA 1VFOA 2PDXA 3HB9A 4FP1A 2X7WA 2ZZ4A 4PCPA 3C61A 3THAA 4OZOA 1OFAA 3ZWTA 4Q8UA 3AC0A 4FX6M 4AZIA 4ATWA 1Y5WA 3WJWA 3IAQA 4I6VA 1CIUA 2XVPA 4B5SA 3I3BA 2V6AA 2FVMA 3GG8A 4GIEA 3W7RA 1CPUA 1IQ8A 1ZBCA 1D3CA 3CUGA 4BCEA 2XVGA 4GI6A 3WN6A 1HKVA 1UR3M 1E0VA 2ZZ6A 1VPXA 3PANA 2C16A 3CZJA 2DW6A 3F5KA 3GUGA 5C5YA 1XSIA 4BF9A 3S9IA 5GNXA 5BMXA 1V6WA 4D6DA 3T8QA 3KBVA 4TR9A 4Q7IA 2VM8A 4EX4A 5KZMA 4CQ8A 2Z7KA 5HK4A 4PCNA 3FDKA 3M5VA 1TX0A 1U1JA 4YJ5A 4QISA 3GZ3A 3IARA 1KFLA 4OOZA 3ZS4A 2F6UA 4AHPA 4Q4OA 1KBIA 1V79A 3P5ZA 3CPRA 3G1XA 3QKZA 1NFGA 3BANA 1VIWA 4GBDA 1EO5A 1UWUA 3O63A 1ISZA 4DB7A 5B7YA 3ALGA 1TV8A 1OADA 1Z48A 4F0KA 5GNZA 1AZ2A 2ZUVA 2IQTA 4ZTYA 5DMMA 1NVMA 2D23A 4RNJA 3N4AA 5ENLA 4LSBA 1PDZA 4EAYA 3UT0A 2Z1WA 3CAQA 2R1NA 4BEUA 1KR1A 3TWBA 2CHNA 1V02A 3PSVA 5HQLA 2IQDA 4H6RA 2QGYA 2W62A 3WQ6A 3HIJA 3CZLA 3A4AA 3QZ6A 1W32A 3L5AA 2JQXA 4PFHA 3VCCA 3T4WA 3T0BA 5DCDA 4O12A 2FH6A 3C0LA 4I7VA 3QTPA 1LWHA 2JKPA 2XFRA 4L7ZA 3HG2A 4JL1A 2CLKA 5DMNA 4FMVA 3L68A 5KTLA 1EXBA 4DWSA 5FJIA 3MMDA 3QC3A 1JCXA 2QJMA 4L1WA 3BTNA 2IKHA 4M1RA 4NRSA 4LRTA 5M5DA 3CT7A 2ZE3A 1A5OC 2YX0A 1HZYA 3EPNA 4CD7A 1W8SA 4Y90A 4FNUA 4Q4QA 3V35A 1RQBA 2FB3A 2QJHA 1AW5A 4GFIA 2G3MA 4L4LA 3TSDA 3EXSA 1JZ4A 3WD4A 4CQ9A 5JXQA 1V3HA 3F7JA 1DOSA 4GO9A 3S5ZA 4KEVA 5LA1A 2XN1A 2ZRZA 1RJQA 1TIMA 2DPEA 2J77A 4CN6A 1LDCA 1FFQA 4GY1A 1KM0A 5FCZA 4HPHA 4XBKA 3QQWA 1BWLA 3CXOA 3GVVA 1W5MA 2D22A 4M5PA 3EB2A 4ZODA 4XD5A 1G4PA 3UR5A 3V7PA 2ZXBA 4HNOA 3EAUA 4QJ3B 3URBA 4C6OA 1C3FA 3GE7A 3TIMA 4FLQA 2G4JA 4JX5A 2QPXA 4YCPA 2WWDA 3D3FA 1XYAA 4JTJA 4XO6A 4NAEB 1E6ZA 1DPMA 4O17A 2F9RA 2PSNA 1HQTA 2ISVA 3SURA 3U57A 3W75A 4NNCA 4JR5A 1TPWA 1T0OA 2CZVA 1SO6A 3A3XA 3MYOA 2Z24A 3ZVHB 4A3RA 1WNOA 3W7PA 3Q58A 1PZ3A 2WHJA 1I2NA 2FMOA 4V2XA 4QROA 1E5JA 3SUWA 2YOCA 3GNXA 3VOGA 3EKGA 5FJRA 5DQPA 1VBRA 1ZJHA 4UFLA 1MZHA 5LKYA 4Z1BA 2YW4A 3QYSA 1F3EA 2C3ZA 3LPFA 3M7SA 4XSMA 1BXNA 3VKAA 2XINA 5BXSA 3BGJA 2J7GA 3GNOA 3K30A 1B9ZA 3LA4A 5LIUX 1F61A 4KWSA 5KMYA 2ANUA 1BVZA 1GVOA 3PN8A 1FWNA 4GIAA 5ABEA 1Z41A 1E5NA 5AZ0A 1XYFA 1VRDA 1JZ5A 3KOYA 2NUYA 3KLLA 3U2OA 2JGYA 2OZ8A 3T42A 4NXKA 4NX5A 2FFIA 5LA0A 3QR1A 1SSDA 2AQWA 1BXCA 3Q65A 3WLOA 3G1RA 3LDVA 3GLCA 1KLZA 3T6CA 2YL9A 3B4UA 1W54A 2OODA 5D33A 3F5JA 4U3CA 3LCFA 3EDFA 4HMCA 4CGTA 4LT9A 3V16A 3R43A 3WEZA 4HN4A 5A8PA 1HP4A 2RGMA 3EX3A 2VEIA 1X38A 1XS2A 4CNPA 1PS9A 3WLIA 3THQA 2VC7A 1UKPA 1W9UA 3CHEA 2TYSA 1W1IE 1E40A 4BZYA 1TFVA 1R9XA 3W26A 3S4TA 4UMAA 4ECLA 3I7SA 3UZJA 4C6NA 1ZP3A 4QE4A 4FNQA 3W81A 2FIQA 3E5BA 1VBUA 4FS9A 5D9NA 4ZQMA 2OOGA 1XYZA 2IKIA 4UFHA 5DEZA 3WBXA 4B92A 5CAHA 1SJBA 2FYMA 4Q8QA 1O1ZA 3KVJA 2WZIA 4PBFA 4E4FA 4IMDA 4YVPA 3CO8A 2ISDA 4IZGA 3EPMA 2RJGA 3VNDA 3THCA 3H70A 3CPUA 5AVHA 1HF6A 1G4SA 4IIBA 1N8WA 1YEYA 1P0DA 4HBKA 3G8EA 4W88A 2OZ0A 4PRWA 1J9YA 4DJFA 2ESCA 2BSLA 1ZAIA 2DZSA 1KFKA 1LRQA 1WBHA 3T2OA 3FXGA 3NGJA 2E7FA 3OPSA 3RXZA 5CPMA 5LIXX 3BLDA 1GVSA 1D8CA 5G1YA 1G4TA 3W7GA 1YMYA 4I9TA 3KP0A 3LHUA 1Q7QA 3N6QA 2QJJA 1DJWA 1R30A 3STPA 4AYGA 4M80A 4NJHA 1UD3A 4EXAA 3ARRA 2F84A 3M0ZA 1IYXA 3ENLA 2VEKA 2VEGA 3U2CA 3U9IA 1JGIA 4RV3A 2X0SA 1AH4A 1TPVA 2GQ3A 2OZTA 3WQCA 3CL8A 4HHPA 1VJIA 3TTYA 2UY3A 3ABRA 3O9NA 3KBNA 4FIQA 3KHJA 1CT5A 1U5JA 1EFZA 2BZNA 2XN0A 2FKPA 1XIHA 2XGZA 1F8IA 3SZ8A 1XIGA 1KXHA 3STEA 5CG0A 3P62A 1VF8A 3DAQA 1NDWA 4DWDA 1C91A 2A3CA 1O4UA 4PUMA 2QUMA 5D2VA 1GUVA 2CHRA 3A4JA 2OFJA 2OGJA 1WUFA 2FJKA 2A79A 1L6FA 3RO6A 1W56A 4IIDA 2IMRA 4ZMGA 1LG2A 4B5UA 3ATYA 3CT2A 1TG7A 1W2VA 3VX0A 4PULA 2D2OA 4JTEA 3NL6A 3CASA 4HCHA 2EJ1A 3B3DA 5ECUA 1ML1A 4H9TA 4L5ZA 3AI0A 5D05A 4I8DA 1EKOA 1PSCA 2V69A 2ZUSA 2R91A 2Q71A 1JI1A 3QR3A 4J35A 4MNJA 2FB2A 3TAOA 3GKAA 3NURA 4DYJA 2REQB 5AKQA 4XZIA 4PUEA 5DRIA 3RAOA 3IVUA 5I3IA 3QPZA 2YDAA 1JAKA 3UG3A 5HDRA 2PDLA 1CXLA 3V75A 4ZCWA 1LT7A 5F7UA 3OW1A 5CLTA 1C9WA 3HJZA 2PTYA 4GMEA 3R2GA 4U10A 1F5ZA 1QO2A 3L2IA 2GOKA 4XTDA 5BXTA 4PB3A 1IZCA 1O5QA 3CO4A 2UV8G 2FGBA 2HMCA 5D02A 1S3TC 4NJJA 3V1HA 3TP4A 3MV01 1A5LC 1YTDA 9CGTA 4PMJA 1W3HA 1FDJA 4LB3A 2CW6A 3WY1A 4AH7A 4QDMA 4YTTA 3OIHA 3BLFA 3UJRA 2OX4A 5CPOA 3S2MA 3FGCB 1FCUA 4XIAA 3B8UA 4KWOA 1JYNA 1U22A 3GDRA 2VUNA 3MO7A 1ISXA 3XISA 5FAJA 2WVUA 1YDOA 1JYXA 1PJ9A 3E96A 4O0QA 1MFUA 3SCUA 3SCNA 4AB4A 4HVXA 3NSMA 4M8UA 5HNUA 3OQ8A 4GI9A 5M3WA 1EC9A 1VEOA 3MBDA 4A2SA 4DI9A 4REQB 1UHVA 2F2HA 1H09A 4WF7A 4IFOA 3W70A 1GW9A 1HN1A 3CUIA 5FKYA 2BVWA 5HR7A 2P0IA 2ICSA 3SGUA 2YBTA 1S5NA 3ARSA 1QO5A 1ICQA 1KXQA 3N4FA 1O5KA 1ZJIA 2XM1A 3NQ8A 1MQRA 4H04A 3FK4A 3MHGA 3KOWA 4NJKA 3HMCA 4C7FA 1VB9A 1LRTA 3PG9A 2YFOA 1J0HA 3CLMA 4NG3A 4Z2LA 5CEWA 1RBOB 2A3BA 2VJXA 3IIOA 3R6IA 1Q8AA 2NSXA 4A8LA 2F6KA 2PDHA 2PP3A 2VDGA 2BX7A 3IGSA 4D2JA 6CGTA 3QFEA 1XLAA 3A5VA 1SM9A 4AYSA 1VBJA 2FVLA 5ABFB 1DKWA 3ZSSA 3P81A 3CIXA 3M64A 3BDKA 3RU6A 3RF9A 1BQGA 3V5CA 3EDJA 1XV8A 1W1B1 2ALDA 1MXDA 1WXZA 1V6VA 3FAXA 4DWSC 4K1GA 1TPB1 5CZTA 4JEQA 3ANUA 2VL4A 3E0LA 1LWJA 1QHZA 5JVLA 4FAMA 1CLKA 4FX8A 1Q7ZA 1DJXA 4UQ9A 2WMJA 4UQEA 1SSGA 3VDAA 1EHNA 1EQCA 4BA0A 2EGZA 3ONCA 4GNKB 1H0IA 3CIWA 4QSHA 3GDBA 4UFIA 3ZT5A 3A9BA 3QGVA 1VBGA 4AVNA 4RCXA 4IPPA 4JTUA 3N2TA 4ZO9A 2GSJA 3F4CA 2CCRA 3PHAA 3MO4A 3G1SA 1NFBA 3KL0A 4LV9A 4KEUA 2ZE0A 3GVQA 1TKKA 3ZT7A 3IWPA 1FRBA 4U33A 3EXTA 1PDYA 2AQVA 2P10A 3CB3A 2AAAA 4EK7A 3N15A 1QASA 3QFWA 4CU6A 2I9EA 3LV6A 3PJTA 3UPWA 1PIIA 4K8HA 4P8VA 3W7JA 3WQOA 5KEZA 1X7IA 2V2CA 3DFQA 3TLQA 1NU5A 5AYYA 4NAEA 5MKGB 4JKKA 1J6OA 5CSUA 3TW7A 1G67A 1H60A 4GPNA 4NYUA 1H49A 1AMKA 1R7OA 1P1XA 4AVOA 3HBLA 1YDVA 2Z2BA 1A49A 4K7VA 4URIA 3GR8A 5TIMA 3UWUA 1AMYA 4D6EA 1OY0A 5HATA 3W22A 2DW7A 3WH5A 1FX6A 1JZ8A 3HPFA 1IWPA 3TYCA 3PBVA 1UD8A 4QS6A 3BC9A 2A7RA 4NYYA 5E6ZA 2ISFA 1AODA 3FOKA 2ASHA 3DKJA 4NJGA 3H2OA 3AU2A 3MKVA 4PTMA 3UG8A 4GZIA 5AOUA 2WYSA 2X42A 5FL0A 2J66A 1FWGC 4KKXA 3MQTA 4POCA 1M7JA 2BB0A 1NDYA 3KVLA 3EDKA 4D6IA 3LU2A 1GJUA 3K5XA 2PTWA 5FSEC 3MCMA 1OFDA 4OOUA 3LD5A 2W5FA 3EX6A 3R1ZA 3FVMA 3JW7A 4MFEA 4EANA 1AJZA 3Q45A 4WHBA 1XINA 1BYCA 3LI0A 1QNRA 4WUIA 1GOIA 4HMEA 2PGFA 3WNPA 3QXBA 1F4HA 3A3HA 4FSAA 5JH2A 5J5DA 4MB3A 1NFPA 4FLSA 4B5VA 4C6DA 2DVUA 3NZGA 5MHBA 4F8XA 3DHDA 1AUSL 3UVIA 2UZ9A 4CNSA 4ONVA 3PB0A 2QCDB 3GVGA 3WQ4A 3IPWA 1JCJA 1UR8A 2QW5A 3VYLA 1BYBA 4LFYA 2ZVIA 3AISA 4GVFA 3UESA 2Y5EA 2PLKA 3DFPA 3OVPA 3M0MA 4IFRA 3GU2A 1B30A 3NDOA 1AH3A 1R85A 3KS6A 4AZBA 2WM0A 4H9XA 7ENLA 4NILA 4PMYA 3BAJA 3PUEA 2DSKA 3KDOA 4YTQA 5CZ0A 3FSTA 3NUKA 2YA2A 3NTYA 3W28A 3SGGA 3BW4A 4MWAA 4DJDC 1SFTA 3MZNA 1QPOA 2C15A 2NX1A 1KFCA 3FKRA 3R13A 1JULA 1OVDA 4AC7C 2ZTJA 2OT1A 3BGGA 3TN3A 4Q8VA 2RFGA 4TU1A 1FXQA 3C8FA 5E9XA 4O1CA 4HD5A 1UP0A 1GHRA 3MHUA 1P6CA 5KZEA 3KRBA 4GISA 1OIMA 2WSPA 3PUGA 2AL2B 2QCNA 2AAMA 3UNTA 3ALFA 3DBNA 1ZPTA 4MNKA 2GOUA 4PL1A 2YPIA 3NOEA 3MC5A 4K8GA 3IUIA 3RX3A 1XW8A 3TMQA 4LC8A 4LYRA 2C1HA 1ZZMA 5LSMA 3GO2A 2PP1A 3VGFA 3GC4A 3EA2A 1GQNA 3WCZA 3C52A 3AYVA 4O18A 3W84A 4HCLA 1FUYA 3CHVA 1YNYA 4F0MA 3WKZA 5BWFA 4LUIA 3AHYA 2WJFA 4JYFA 4O15A 1KM4A 3URAA 1DXFA 4E2VA 2HISA 3DC0A 4QBXA 2VCAA 1A0EA 3W01A 2O9RA 4DUOA 2J75A 1S2UA 2FHCA 1OINA 5DO8A 2Z2UA 1Q8JA 2V0TA 3JU2A 3V0TA 3HPAA 4L9ZA 1BAGA 3VE9A 4A35A 4DAIA 4PL2A 4MGGA 4W9TA 3TA6A 4A8NA 1K6AA 4P7LA 2VO5A 2DQXA 3QV8A 1RBLA 1YNPA 3MW7A 3WD2A 3O0FA 1UIPA 1ZRQA 2NV1A 4G8TA 2XN2A 3NGFA 3PFRA 2Z6IA 4ZB0A 4Y96A 4C7GA 1JEZA 3IS4A 2PWHA 3VUPA 3AO0A 2EO7A 3BZGA 4GQQA 3ARYA 1P0EA 1UZ4A 3VIHA 5AC6A 1AQHA 2AKZA 1I2OA 4KWVA 3WFZA 2J9YA 2J4GA 2BXZA 4A6GA 7REQA 3KWXA 4FO4A 3SCTA 3MUIA 1KXTA 2VDIA 3FYYA 2WQPA 2I5GA 4FX7A 2QGHA 4LNYA 8XIMA 4BK9A 4JFSA 4DBDA 4J3UA 4PN2A 2GPTA 3BK0A 4Z2JA 2V3GA 2WXDM 3CEUA 2REQA 3TYUA 3O07A 7XIMA 3FIGA 2ON3A 2DT2A 2HCVA 4FLOA 3U2EA 5LNSA 4ICCX 4YVXA 2OWCA 1TPUA 4DZ5A 4QCEA 2PDCA 4AX7A 4NP7A 3WF3A 5FEWA 5LGXA 2XGBA 2V2HA 1ME9A 1X1NA 1XD0A 4F0HA 4NL1A 1E0TA 3E12A 3Q4DA 3ABSA 2WCSA 4AY1A 4CQAA 4E2BA 5KZ6A 1JJKA 2QXWA 3M5ZA 3H8AA 1GG1A 1XGZA 1OK6A 1LBMA 3UWWA 2VCBA 1FKWA 2IPWA 1ADSA 2E67A 5H8MA 3LERA 1VYSX 2EPHA 4CNTA 1JCMP 3FGCA 3DG7A 1B31A 1ZAJA 4U2YA 1WB0A 2E77A 4R5EA 2RH9A 4W87A 3GTXA 1THFD 3DUGA 3A4XA 1J0ZA 1UPMB 4O8AA 5CAKA 4TOQA 3UJEA 1CDGA 1SW3A 1O12A 2Z1XA 3W1LA 1JZ2A 5E9AA 3GR7A 4WDUA 2DH3A 3TLLA 3BARA 4AIUA 4LUJA 1XLKA 1O94A 4QLKA 4QS5A 5L6UA 4D8LA 4E3VA 4JTAA 1V93A 3W7LA 4REQA 5EMMA 4HCDA 4MLJA 4FLRA 5IBXA 4Z2IA 5HMFA 5DX7A 2GJPA 3GYEA 3C6CA 1G0CA 1JXKA 4S23A 2C91A 4AW7A 5A6JA 2J8TA 3IUDA 2BBFA 4O54A 1G69A 4AEOA 1UH4A 2OQYA 5E0CA 5LZLA 2AOSA 1GKPA 2FPYA 4PCFA 1KWKA 3VIKA 4DIAA 3BG3A 4US6A 3U5UA 4PRTA 2ZA3A 3W1QA 4DELA 2R1PA 2ZX6A 1J8VA 1GOOA 1UB3A 4PMQA 1GOWA 4DHGA 4OT7A 4BKNA 5BU9A 1GEHA 3MVTA 4JICA 3W4RA 6ENLA 2OLSA 3CQKA 3L21A 3RGTA 3AU6A 2V5DA 4QJ1A 3E6EA 5G4WA 1UROA 3S1GA 3TTOA 4KCWA 1O60A 5TNVA 1MRAA 2XH4A 3L5MA 1EEXA 4GY7A 1J01A 1K4HA 3APGA 2ZQ0A 2WJEA 1A5CA 4WY0F 4C1NB 3L4YA 2XSBA 3GH7A 3QY6A 5CZSA 2GVGA 3TNOA 2FGZA 3H22A 2CBUA 1W5QA 4TX8A 1UZ1A 1SW0A 1RK6A 1G94A 4AHQA 5AHFA 3CZEA 5A3HA 4JY9A 4UUIA 1X8FA 5FF0A 4GWEA 4AXNA 1DIDA 3HPZA 2I57A 3KCOA 3S9ZA 3C2RA 3MDUA 5K4XA 5IFTA 3FXYA 2INFA 3DENA 4YWSA 3ID7A 3PZOA 3V0SA 3O6AA 2D3NA 3UWQA 1IXOA 3WH9A 4PUUA 2WNZA 2YXGA 3AZSA 5BRPA 3CAWA 2PA6A 4MB5A 4U2ZA 1TPEA 3NVDA 3TXZA 4NUWA 2B81A 3C0SA 4HA1A 5BNKA 3RCMA 1B3VA 1PKNA 2C8NA 1QNSA 2AL1A 3PPGA 2VMFA 3FHAA 3PS7A 3ZFHA 3MT1A 1GCYA 1G7VA 2E6AA 3A12A 1S1RA 1PX4A 5F4WA 2VGIA 1XGDA 4V1XA 3SY8A 4MADA 3L66A 1C8YA 1ME8A 2MNRA 3H2NA 4E2OA 1K7EA 4RW3A 4K39A 3HJEA 1AJ2A 3MJMA 2ZZ5A 4OKDA 3O3RA 3TQPA 2PDQA 5CJMA 4YWIA 4L64A 4HNVA 4AEEA 4FNPA 4TX9A 3WH7A 2QQ6A 1JIBA 2NT1A 2X1RA 4E5TA 4S38A 3AHXA 3E02A 1JUEA 3EDDA 1Q6DA 3WMCA 1D9EA 4GRSA 4N9CA 4E4UA 1XICA 1ZY9A 1P5BA 3GTIA 3VGHA 3VIGA 2NQZA 4Q8TA 3QTGA 3DH7A 2OLHA 4GX8A 1F9CA 3TH6A 1KM1A 2B7NA 1N7KA 3CMGA 1EEPA 3DFSA 3WO8A 1PKMA 2FTWA 1XLCA 5DBUA 2V3EA 4RL3A 3HQ1A 1Z7AA 3R79A 3E2RA 5F1VA 1GEQA 2CETA 4FI4A 4L4OA 3S42A 3LTSA 4XZMX 4QEHA 3W24A 2Y61A 4GHRA 4HP5A 4TV6A 4DUWA 1R6WA 2BFGA 1V77A 1OC7A 2QCDA 3EWZA 3GDMA 3A22A 4DXXA 3FJNA 3PSWA 2HNHA 5B80A 5T91A 2VFDA 2V68A 2QS8A 4ZO7A 1J5SA 5XIMA 4BF7A 4KESA 5I3DA 1Q4NX 1BWVA 3LLDA 3UFYA 4NAFB 1FWRA 1RK5A 1GVRA 4ZB5A 2PDBA 4DXVA 4UIOA 1OFOA 3VOJA 3UCDA 2QEZA 3TYAA 4GKTA 3T9PA 1J2WA 3LI1A 4LUSB 3N73A 3ZR6A 2J79A 1M6JA 5XINA 3TW9A 4J27A 1EHAA 1VFLA 4F0LA 1O66A 1H7XA 3AS1A 4Z2KA 4UFJA 3QH2A 3SRDA 1R46A 1XLJA 3M0IA 3QPYA 1FDZA 4E8GA 3PUDA 1DIOA 3GUWA 1FHLA 2J8FA 4GYPA 4AISA 5DELA 2OTDA 2VRQA 6A3HA 4QG9A 5HNTA 4NSBA 1HKWA 4W7WA 4UTHA 1W9PA 4CD6A 1MEHA 4LAMA 4JIHA 1EJUC 4LH8A 3TA9A 5HMEA 1W3JA 2V82A 4IXXA 1R3TA 5TAOA 3QRHA 3M46A 3H24A 4AFYA 2QUVA 1NWTA 3UU0A 5HNNA 1EPVA 4A3YA 1GQLA 4QNEA 1B90A 1CCWB 5D8WA 3WFLA 2VI0A 4DUXA 1DJZA 1KM6A 1NAL1 4GA8A 1M65A 1PVNA 4CNNA 4RJEA 2VHLA 3FJLA 1HVXA 5PTDA 1JPKA 2HXUA 3OLGA 1VH7A 1F73A 1YKWA 3L4ZA 1OYBA 3P67A 4JDYA 4V28A 5H2ZA 3FW6A 2NQLA 2LLEA 1RVKA 5K3VA 1TV7A 4GCAA 2CC0A 4GNJA 4A3UA 1EX1A 1V6YA 3B04A 4MDPA 2VRJA 3ISIX 3GVWA 4FEZA 4K7YA 2WSQA 2G37A 3LRKA 1E0WA 1FCQA 5IHRA 1WPCA 1VRXA 4KWUA 4QQ3A 5FAGA 4F4RA 2J7EA 2D0GA 4TQTA 1T96A 3RN6A 3LHZA 4E38A 5JBDA 1XCXA 1G9HA 3R7MA 3I6EA 4MUZA 3HPSA 4O4VA 3GXTA 1JDAA 2NVDA 1BF2A 4C6QA 2G3IA 5AC5A 1W0MA 4UFMA 1JCNA 3DKLA 1ITXA 1D7KA 4YVVA 4B5XA 4XVDA 4DX3A 3P60A 2YFNA 2G96A 2Y8VA 3N3TA 3APTA 5D2XA 3FX4A 4M0XA 1VBHA 2VGGA 3FEQA 4KS0A 5F4XA 3VKJA 5EKYA 5A94A 3F2DA 1XFCA 1XQKA 4X60A 5RUBA 1WDWA 4TIMA 2R24A 2DEPA 3LCHA 2GFTA 1BYAA 1E4IA 2E28A 2INZA 3QZEA 4OUIA 3D5HA 1GOXA 1X39A 3NQ6A 3WQDA 1DL3A 5AYXA 3VGGA 1VLIA 3TONA 3PR2A 1LOQA 3VI2A 3S1WA 3VIMA 1TCDA 1H61A 2WMIB 2JK2A 1A80A 4FZIA 5EMJA 3GU9A 1TV5A 3CV6A 1Q4WA 3TDFA 2WB5A 5K9DA 3VM5A 4IIEA 1EDTA 1X6LA 3SY1A 4KFNA 1UKTA 3L65A 4N4QA 2NWRA 1W8GA 2FFCA 2PAJA 2DJLA 3VD3A 1HL8A 2X2GA 3GYCA 1L8NA 4W7UA 1VJZA 4U31A 5LYRA 3ARXA 3RILA 1E56A 5AYZA 1B57A 1ZL1A 4HQVA 5CGMA 3QF0A 1SO5A 3DYPA 2DVXA 2VZTA 1DWHM 2YW3A 1A0DA 3IGUA 2OB3A 3LNMA 3QKEA 3T7VA 1GOMA 3IGXA 1W9VA 3HGJA 3CZKA 1E9YB 1MFVA 4TXEA 3N14A 4IPNB 3ES7A 1VAHA 1XRVA 3PZTA 1WXJA 2EKCA 3E9AA 3W7MA 1XIMA 1JR1A 3BGAA 1A5MC 4X2PA 1F74A 1Q2RA 1K7FA 1K9EA 1HNYA 3BE7A 1IXPA 1Z6KA 2GL5A 3WJXA 1XHGA 4AZ5A 4CEUC 1E4LA 4BEQA 1AL8A 1FP9A 5I07A 2VCCA 1F6KA 4HJWA 1S2CA 3ZVIA 4PTWA 2GJNA 3PWIA 2QCCA 3RR4A 1DQWA 3RLVA 3C3NA 1OFEA 3LV5A 4J7RA 1F3XA 1A3XA 1ZUAX 2XH2A 2X09A 1J6PA 4JQ2A 3IGHX 1OX4B 4M82A 1V3LA 3W6YA 1M7OA 1E15A 2OYLA 5CJ5A 3REQB 1KTBA 2YB1A 1IEXA 1F6YA 5EMKA 4GXWA 1KWGA 5I23A 3UD6A 3FDGA 2EPLX 4PMZA 1E1CB 1GVYA 2CWXA 4N2YA 1FWEC 2DT1A 1S1PA 3MWAA 4GINA 1QBBA 4DO6A 4DNHA 1FDYA 4P8WA 4C1NA 3NR0A 3OTRA 3AIQA 3AHVA 4JQ1A 1RZMA 4FPSA 4FF5A 3MWCA 3MMWA 5DY2A 1F05A 1TZ9A 1LLOA 4AF0B 4JKMA 4I5UA 5J04A 4AD2A 3TC7A 3NO1A 3KS5A 1I2QA 3PM6A 2E4TA 1VD6A 3O8AA 4W93A 3LNPA 4EF9A 4CUCA 4JIEA 4I5XA 2PDJA 1IWBA 4DBUA 3L0GA 3PULA 4MAZA 2ZRUA 3W1XA 5IHSA 1MW3A 1SUXA 4WSKA 3LMZA 2ZA2A 1QW9A 1W1TA 2PWVA 4QCFA 4MJ2A 2VOMA 4CN1A 4WKAA 1W5PA 1UD6A 2ZA1A 3EKZA 5FF2A 4S3FA 5I3JA 3SSJA 1YE4A 1BRLB 3EKLA 4PB4A 1KCLA 2RKXA 2BY1A 1ZAHA 1QFEA 3WLJA 2J9ZA 3ZOAA 1UP2A 1R9ZA 2CZEA 1RY8A 5AHEA 2XZ9A 3OG2A 3H6OA 1SU5A 4OV4A 4GUJA 4X3ZA 3WH8A 3ANVA 4DBWA 3QLDA 2FZ8A 3APYA 3RRXA 3M41A 1MDLA 4K38A 3L0NA 3GNDA 4KFOA 3VOHA 1BG4A 1QT1A 2R1MA 3NEHA 1PKLA 3IJIA 4M6UA 4OJYA 4C65A 1QMLA 1QU4A 4LS0A 1V0LA 3CL7A 2Y2WA 4NVTA 3FHQA 4UNLA 4J3TA 4YIWA 2H9AB 5FACA 2QF8A 3PBUA 4MB4A 1TWDA 2OKOA 4I9JA 2QCHA 2OG9A 1KBJA 1FH9A 1NF0A 3LENA 3GG1A 1TJPA 4ZFCA 2UY5A 3UWYA 4HJFA 1K6WA 1MVYA 3CMFA 3MS8A 1GVFA 5A6MA 4TUFA 3SGZA 2YLLA 3GNNA 3TYDA 1MQPA 3EBVA 4RE3A 4DPPA 2VENA 4ICNA 2NW0A 1HVQA 2ACQA 2OPJA 5I03A 4I3GA 2PGRA 4FR1A 3DU0A 2OGYA 3FN9A 4RDZA 4N02A 5F2GA 2G50A 1IT8A 4DF2A 4L56A 4LAUA 4H8HA 3O2LA 2FH8A 2FQIA 3T81A 2NT0A 4QGCA 1QI3A 3IUHA 2YXOA 1AH0A 3NYZA 2D2GA 5F1UA 3R0UA 4NY2A 1HJVA 1BPLB 1XD1A 4RPPA 2DJXA 3TWAA 4XZWA 3NQBA 2NX9A 4IMAA 2PLMA 4KIRA 4RK8A 4HT3A 4IUOA 3W76A 3NO3A 4IP7A 3AICA 2VX4A 5H6HA 1XH1A 1P1MA 3KOXA 3DG6A 2CLLA 3K13A 3W02A 4NAFA 1DJHA 1LQAA 3AXXA 5A6BD 1OHLA 3O7UA 1EJRC 2A2IA 2WKLA 4RUBA 1ELSA 1EA9C 2L5HA 4PC8A 3CC1A 3SN0A 1YE6A 3F4DA 1TCMA 2RAGA 4LUSA 1YLVA 2Y88A 4DNMA 3QW3A 1OD0A 1LL4A 4WCJA 3H54A 1LZOA 1M3UA 4EPBC 5BCAA 5DMYA 3S5OA 5HJXA 1U1HA 1V7AA 1LL6A 2DQWA 2PF8A 1GVEA 3WDJA 4K2SA 1XI3A 2ZRYA 3ZYZA 4LCSA 3VNIA 1IGWA 4ZO8A 3W2KA 3S6OA 3KTCA 1S5MA 4IOTA 3BW3A 2XFWA 1TJ0A 3QV7A 3BSMA 1KLYA 2QCEA 5K7JA 2O7QA 3H2MA 1ZU8A 1PWLA 1FWIC 5SWUA 5D4YA 1MUWA 5H8PA 4GCXA 1T6MA 3B8DA 2ZRVA 1I45A 4NHVA 4JTKA 1F8MA 3HGRA 3TVAA 1NQKA 1EDQA 1J79A 1WE5A 1LL7A 3W25A 4K1WA 2I5QA 4O16A 4P2VA 3QY7A 3U5YA 1BTMA 3OQEA 4MZ8A 3M07A 5JQ9A 1G6CA 1CB7B 1UKQA 3NAVA 2VR5A 2B31A 2V5LA 2DSZA 1Q6QA 2GLKA 3M7WA 3DFNA 1HGWA 5D30A 1M7PA 4DO7A 3OODA 1Y5XA 2FTPA 3CM4A 3QR0A 3OJGA 1BQCA 4XX6A 1ALDA 7TIMA 1W3IA 4DVOA 3I3EA 3KEHA 2IS7A 2VFFA 1KKOA 4MJZA 5J5RA 4JFUA 5LIKX 4KCVA 4RLIA 2Y62A 3N4EA 1TMLA 3AS2A 4EP8C 1V51A 3ME3A 4PTDA 1E4NA 2F8QA 1QI2A 3CUXA 1Q6GA 1O7AA 3GX9A 5I3HA 3OGSA 3M0YA 1E3ZA 2YZRA 1ICPA 1PUDA 4BFAA 3PTMA 2YCEA 4RDYA 3WF4A 3DI0A 3EX1A 4H3DA 3IJ6A 1UMLA 4IHCA 2V3FA 4B9ZA 2Y7FA 2DZUA 1LOLA 2BTMA 3CYVA 3ZMRA 2BGQA 1ECEA 3H4GA 2ZX9A 3O6YX 4OV9A 2HJPA 1CX9A 1NWSA 4YNGA 2OYKA 4Q4PA 1E9IA 3EEZA 4DM2A 3WG6A 1C7TA 3GSMA 2J78A 1L6WA 4BHYA 2NQ9A 1GK8A 1XPGA 2X05A 3USBA 1V4YA 2WWCA 1QUMA 3DG3A 1PX8A 1VCGA 4OE7A 3IIXA 3RCNA 5CPQA 1P43A 1LRNA 4W5UA 4PMOA 2JF6A 2DY3A 2WVVB 1U5VA 2E09A 4R9OA 3S9YA 5DBTA 1DORA 1OGSA 1Q7MA 3BURA 4UWMA 1QW7A 1PTDA 4S3DA 1S46A 4GYKA 4S39A 3PB2A 4ZE5A 3B97A 4KETA 3W1TA 1W1ZA 3E0IA 4HN8A 1LBFA 1V0NA 5G1MA 3GXMA 3DESA 2WMIA 3RPDA 3SI9A 2P3EA 3W7HA 4NI8A 2A6LA 1JRCA 4NZCA 2B4GA 1PIGA 4W8BA 4AZCB 3QYQA 1IIGA 4E4PA 4O1DA 1H63A 1YIXA 1JF5A 1XLGA 3WQEA 1RV8A 1RSCA 3MCNA 3EX2A 1UP3A 3SIZA 3EPOA 3ITCA 1DJQA 1R3QA 4IT1A 4JFWA 2BS9A 3W37A 1E6PA 3DZ1A 3TZFA 4L4PA 4DRSA 2VX7A 4AVFA 4UFKA 9XIAA 1ODUA 2BLEA 1XG3A 4C6CA 3P6LA 5KZDA 4GIYA 4Y9MA 3Q94A 1J0IA 3DFHA 1Y0EA 4MM1A 3THUA 2DIJA 1V3MA 4KWWA 1FHVA 4QXIA 5M2FX 1NOWA 2E1DA 3FS2A 1HKKA 4JIPA 1E6XM 2WMKA 4RZ4A 1EP3A 3LHVA 4N9DA 1J12A 3ZJ6A 3BLPX 4ZENA 3CUFA 5HR6A 2OEMA 1XIEA 4MOZA 2YYUA 3GU1A 4WD0A 4FNTA 3GXFA 4XWUA 3LGDA 4JIQA 2P88A 3O16A 1R3RA 4YN5A 1Q65A 3WEMA 4D8ZA 4XZNX 2Z29A 3CQJA 4W89A 2WVTA 4UTTC 5CSRA 5F2MA 4MYXA 3ARQA 5MF5A 3GHUA 1Q45A 1FHUA 1OX4A 4QTGA 3TN4A 4YPJA 3BMXA 4ROPA 2ALRA 3IVSA 3BUVA 5I78A 3REQA 3AZTA 1G5AA 1VFFA 3UF9A 3KVMA 4B4HA 1LCOA 1I0DA 2GQAA 5C8BB 1E1CA 3EOOA 3W1MA 4B5WA 4P8XA 2E25A 2PU0A 5I02A 1XFBA 4GUFA 4B3KA 2GGGA 1AK5A 2XTKA 5T9BG 1LYXA 1UZHA 3G3MA 3VKDA 4GUGA 1RVGA 4WSJA 2Y1HA 5G2WA 4GGBA 4L9XA 4ZQRA 2FDMA 4DYEA 4XAZA 4AF0A 1Z42A 8CGTA 2FPVA 2CLHA 3S1UA 1VP5A 4LU0A 1SZNA 4GIRA 4J3ZA 1MYRA 1M9HA 2RDWA 5GJMA 3FLUA 1GORA 3ARUA 1J96A 2W27A 1XQLA 1FQ0A 4A05A 4O10A 1JPDX 1O95A 3QW4B 3SECA 1XUZA 1KCKA 3BICA 1Q5MA 1DJGA 2W9MA 1IR2A 4H8UA 3VNKA 4ACZB 2X1SA 2XGIA 5CPTA 2DDXA 3CQHA 2ZZ2A 5AC8A 4IIFA 3PZQA 1EC7A 3R8HA 1BRLA 1EGZA 2XM2A 1B2YA 3WQWA 1UUOA 4W8AA 1AG1O 1UASA 2EBNA 2J24A 3WNOA 4Z1CA 2NQ5A 1C7SA 5DFAA 3NQGA 4KBXA 1VFHA 1SJCA 5EMUA 1K7XA 5IDZA 5CZJA 1B4KA 2C13A 4PA8A 1IEWA 3U6WA 3B8VA 3EWXA 1FWCC 3QY8A 5I0DA 4GOAA 3LBCA 2PS2A 4HHMA 3N29A 3TQVA 4INFA 2FPTA 3VC6A 1QHPA 2H9AA 1P0BA 1JGMA 4P61A 4Z1YA 1OGGA 1VJSA 4OFCA 3T2QA 3NQ7A 4Q32A 1T40A 1JI2A 3G22A 3F4WA 1UBSA 3N34A 3UXDA 4MPQA 4HKPA 5I00A 2VDHA 3BSGA 4PMUA 1UWIA 3G24A 1W9XA 2GZXA 2GGHA 4JDBA 3QGKC 4UTLA 2XUCA 1OYAA 2RDUA 3WLPA 2BNJA 2CHOA 3CNYA 1RJPA 3SQSA 3PVFA 3LBOA 2NVAA 3ZT6A 3GQYA 1JFHA 2NLYA 2W79A 3GFYA 2GGEA 3WNLA 5EA9A 1WKYA 5E0FA 2WW5A 1EWEA 2W3ZA 2X1UA 4CN4A 2BXYA 4JTFA 3GXPA 1WZKA 2PLJA 3BWWA 3KAOA 5I3GA 4YCOA 3V0UA 3PTKA 2ZC8A 1JDDA 3SCWA 2OVLA 3R94A 4IJBA 1QPNA 3TSBA 1I4NA 3WEOA 4AZGA 3GDTA 3B8SA 1KO0A 3AHTA 1R2RA 3WK2A 2WSRA 2C19A 3VDHA 4Q6XA 1XL9A 1WCGA 4JHMA 3UXLA 1WKDA 4L9YA 2R82A 2DVTA 3KE0A 2QZRA 5HINA 2XSXA 1CGXA 1RA0A 1YX1A 3I7RA 3BCFA 3LSCA 3UWVA 4RNFA 4J4KA 5CGTA 3FJ4A 2ACRA 5B7ZA 5FL1A 4AD4A 1XLBA 1SO4A 1H7OA 4W86A 1FWDC 2FHBA 3P8JA 2GGIA 5EMYA 1ZNNA 3TYEA 4AD5A 3M0VA 4CQCA 1YDNA 2A21A 3VM7A 4KT2A 4OBSA 3TYZA 4JTLA 3CTTA 4TX6A 4D1IA 4YU1A 4UCFA 3EMCA 4X22A 5EMLA 1GGOA 2BOEX 1HFBA 3VFCA 4LNCA 4C6JA 1Y65A 2Y85A 2YKKA 1PCKA 4GD0A 4PODA 4HPGA 1SZRA 4KERA 3UXKA 1XSJA 3EOUA 4EE9A 4QQUA 3LXAA 4IJRA 4RW5A 3ZZ1A 2QVNA 2PRMA 3H7RA 1K9FA 3GHSA 2G3FA 2OT0A 4BQ2A 2A3LA 1DIKA 1V6XA 5FEXA 2TRSA 1NIUA 3UWZA 3DN5A 4GY0A 2JALA 1HKJA 4MVAA 7TAAA 3WQ5A 2XYLA 3GM8A 3QHMA 1S3HA 3EMQA 2D2HA 1TWZA 3KLKA 2HPIA 2WLYA 2PRLA 1CLVA 3LK6A 4D6JA 1VQTA 1H0GA 1JG9A 3VFLA 2WZEA 2Q09A 1M68A 2W0UA 3KRUA 3WBEA 3GHTA 2WAGA 2VWTA 3BAYA 2E8YA 5HQEA 1LM1A 3T1GA 3WQPA 2J7FA 4Q7BA 2JKEA 4QAWA 4AWUA 5J8LA 3NXFA 3OBKA 4XK2A 2ABAA 2Z6JA 4FF7A 2CLMA 4DJDD 1RLCL 3QGAC 3A47A 3MHFA 1H5YA 4LV4A 3ITLA 2E40A 2CLEA 2P8CA 2NVCA 4IG2B 3IIZA 5BXRA 4LAKA 4GNVA 4Y9PA 3N19B 3LX9A 1XBYA 4QAIA 1KM5A 4U28A 3J7HA 1DVJA 3S2NA 3MY9A 3LM3A 5HOSA 4WJEA 4NZJA 2WVVA 1KB3A 1H41A 3UR7A 1QWGA 4IX0A 1XBVA 4UOZA 3MBFA 1SR0A 2HE8A 4LCQA 4RR4A 4MYAA 2YCJA 2NQJA 4HOZA 5C2CA 2DZTA 5TF0A 3CLWA 3T78A 3T07A 4O13A 1EA0A 3G6MA 4ZL1A 4YYFA 4O1EA 3QBUA 2QDEA 2UY4A 1SZEA 4DN1A 3OZPA 1TIWA 1KRAC 4AZCA 4UQAA 2CPUA 1H51A 2A1YA 2YJQA 4Y9NA 2EPNA 5I7GA 3ARZA 2QUUA 1IT7A 4FOKA 2PI6A 2O7SA 3G77A 4XIMA 4KQNA 1UQZA 3VNMA 3LHTA 2Q8LA 2GUBA 1VFUA 5G2IA 4GQ0A 2YXXA 2Z1BA 2PLCA 2OKTA 3CMJA 1E71M 3T08A 4XSLA 4MSSA 3W7EA 1RUSA 1TPDA 1ZJAA 2CKSA 2YCLB 5C7VA 5AY7A 2J27A 3ABZA 1W1VA 1FHDA 6ALDA 4I7UA 3S2JA 3PG8A 3NSNA 1JZ3A 2HWGA 3BZJA 2HRWA 2VC9A 1QNQA 5C55A 4DY1A 3GIPA 2P50A 2YBVA 4LY4A 3W7QA 1RD5A 4CKQA 3ABXA 2GJXA 3LCIA 5H1WA 5AFDA 1MMFA 2C1IA 2B7PA 2VT0A 3UZYA 5I06A 4GJIA 3VNZA 1PZ1A 3T0TA 4X0NA 1GPWA 1K8ZA 1HXJA 5LNWA 4IMFA 3GFXA 5A2CA 2GUYA 3LXCA 4MNLA 2ZCGA 1KM2A 3GBEA 3OB8A 4CU7A 5EFFA 4A3QA 3RIKA 1C9DA 3VK5A 4FNSA 3ABOA 1JPIA 3ZQ9A 3HO8A 3TMLA 3WSUA 1XBXA 4QE5A 1FWTA 1E9ZB 1SQ7A 5FJUA 2ZUWA 4ZOAA 3GBDA 1XDMA 4AMCA 3ARWA 1Z32X 2O9TA 4YMZA 1LF1A 4F2BA 4PYSA 2OWWA 3DEQA 1FKXA 1UR1A 2XIIA 4AXKA 2YA0A 4AAJA 1NARA 3LY0A 1EUAA 2ZKMX 1DXIA 5GVJA 1JYVA 1UYQA 3B9EA 1FA2A 1E55A 3BAXA 4HIBA 3GAYA 3N2MA 2XPKA 1PTGA 3U48A 4AZ7A 3BCDA 1HT6A 3B9NA 4HA4A 1NH6A 2WANA 3CV2A 4DJEC 4YL2A 5A6TC 1UJQA 3WBAA 3IRSA 4IWWA 2PC4A 4ACYA 2J6XA 6TIMA 3N9KA 3E1F1 1EBGA 5A6SA 4JXCA 4OBTA 1FWJC 5CCZA 2QMJA 3HU7A 4QNWA 3ZJKA 4X0VA 2EPMX 4ZOCA 4ACZA 1HL9A 1MW0A 3T8LA 2CYGA 2ATSA 3R0KA 1DHPA 3RM4A 4AIOA 5REQA 4M24A 3QOMA 1XLEA 3W23A 3TTEA 5AHLA 1PO9A 1PYMA 3W7CA 2O55A 4F48A 2YBUA 3NPXA 2VURA 5D03A 1Y5VA 2IW0A 2YDRA 3M16A 2V63A 2DIKA 2Z0IA 4EAMA 2SFPA 4KF1A 1MXSA 4LGXA 3CV7A 2ZBTA 3E5PA 1OX5A 3IAPA 4G56A 3DGBA 4TVCA 3KTXA 4UTWA 4WDTA 5A1AA 5DT5A 5LIWX 3PZUA 1EL3A 5A8GA 1NY1A 3E74A 1YHTA 1EJSC 4JTIA 1YDYA 2VC6A 3CK5A 1CGVA 4U5IA 5I09A 2DH2A 3MI2A 3FJ6A 1DIEA 3AIWA 4D6FA 3CUHA 3VD7A 1UW9A 3G1FA 4JHOA 2I5IA 5D2TA 3Q2DA 3C4UA 5CC3A 4KCUA 4C6FA 1KFEA 3OZOA 2G4FA 2QCGA 4W5ZA 2UBPC 4WIWA 3UCQA 4HNUA 3UERA 4A4AA 1EH9A 4AD3A 3FA5A 3RLUA 3TC3A 1S5WA 4HPNA 1AL7A 2NV2A 1Q6CA 1FXPA 1EJTC 1R87A 4IFKA 5HAOA 1EXPA 4UMCA 4ROQA 3NQ2A 2JEPA 4XKYB 2I7GA 4CU8A 1OF8A 2CKRA 4BWLC 2VC5A 3GC5A 3OYXA 3IANA 1DQUA 3L7RA 4UQBA 4KCTA 3LCLA 3LUTA 1QK2A 1B4EA 1KRCC 5D09A 3WLNA 4MZ1A 3ITTA 4Y9AA 3GXIA 3G0SA 5BW6A 4F66A 3UETA 2G3JA 4F0RA 2PCEA 5AECA 2R6OA 3VA8A 3QSTA 4JYDA 1BXBA 2HQAA 2OU4A 3DHUA 4NRRA 4M81A 4NX0A 3OHMB 2YDSA 4P5UA 4C90A 2W91A 1GQKA 1VZWA 3WUFA 3QC0A 2QLYA 1JDFA 3A9IA 1OIFA 4HK5A 4H8VA 1RCOB 3TQKA 1HJUA 1PCWA 1QATA 3VX1A 4B90A 4LPCA 3IJ7A 3VCNA 4R34A 1IEQA 3VIPA 1HW6A 3E3HA 1D3GA 1LG1A 3P8IA 4EPEC 1T7LA 1LQ0A 3N9RA 3AIRA 1VIZA 1DTNA 2A3HA 2J13A 3I6RA 1VYRA 1OZQA 2BP1A 4WXZA 1H5VA 1WAUA 1MZRA 2WNQA 5A5WA 1TTQA 1AQFA 1WKFA 5C2GA 1KFWA 2WZMA 4OU1A 4S2BA 2Q8ZA 3P0XA 2ONEA 4L65A 3B9DA 1OZMA 1P6WA 1BLIA 5A6LA 2BVTA 1TMQA 2OOFA 4I8YA 3S2LA 3W1PA 1IZKA 4UQDA 3MCOA 2OSXA 1UKOA 1QI4A 2C7FA 5C9WA 2OO6A 3GB6A 5BOFA 2Y7GA 3POHA 4CCCA 3W71A 1QOPA 4ASTA 3W7NA 1GVIA 2TMDA 3CWHA 4JFTA 2QDHA 3C2YA 2OMAA 3UG4A 4ZQOA 2WSKA 4L6HA 3QPEA 2P5NA 1V6UA 2NX3A 4MFDA 3R4IA 4G1KA 3KVKA 4WR3A 1BWKA 3U7BA 2RDXA 5HUPA 4NZ5A 1H2JA 4HB7A 2NXGA 4Z2HA 4QX4A 4QDPA 2DSWA 1S2TA 3DERA 1MRQA 3SQLA 4JKLA 4JD4A 1JYWA 2YGYA 3DCPA 1GJWA 1UWTA 3O6CA 3AXMA 2FLIA 3KL5A 4DWSB 1PV8A 4MY8A 3B9AA 1RBAA 4QRNA 4IG2A 4GLEA 1XLFA 1GYLA 5TD4A 4AQLA 4FHAA 1R5YA 1NWUA 5GJNA 1US3A 4ENLA 4F79A 3NQDA 1EJVC 1UOZA 1OQFA 2O56A 4EVZA 3G2GA 2E5CA 4HTBA 1J0JA 1WDQA 4ML4A 3SCSA 1J18A 2GYIA 4JTHA 4IPJA 1WQ5A 2CERA 3G1DA 4RE4A 2E0PA 4IGNA 4IM4A 3N9SA 1XH0A 3DHFA 3ZWSA 3DFYA 5ECVA 4KEMA 4JQ3A 1QDSA 4X63A 2OLAA 1A53A 1TVPA 5FF3A 1K03A 1ISYA 3AS0A 2ZRXA 4JYEA 2WMGA 4JBRA 4DF0A 1A5BA 5D8ZA 3DFOA 1E6QM 3L4UA 2H3BA 3A13A 4GYFA 4KRTA 3EB3A 4G2DA 2HE5A 1QWKA 3JUGA 3JRKA 5A6BA 2YL5A 4OGZA 4G5DA 4LYPA 2V81A 1IF2A 5LNRA 3VPLA 5JBFA 3TJIA 4PMNA 2BHYA 2PWGA 2WC4A 1NJJA 3VIOA 3AMGA 2FZ9A 3TV8A 4AD1A 4WZHA 3KOFA 3B03A 2WHMA 2BMBA 3BOXA 1H62A 4WDWA 5C71A 4RNHA 4JHZA 4UBPC 1RHCA 1R38A 1P7TB 2INEA 4MZYA 2XIOA 3RO8A 5D9OA 1H3GA 2HBXA 1WO2A 3W2NA 3NG3A 2I1OA 4GJ1A 1TTPA 1TA3B 1AVAA 3VCRA 2YCLA 4PUJA 2Y5SA 3VDGA 4KRUA 1X6NA 4CVWA 4NZ3A 3Q37A 3GZAA 4HU3A 1ZQ5A 2R94A 3E0VA 2AKMA 2G3NA 1A3WA 1ICSA 4IX2A 3WL0A 5DXXA 3I65A 3AQUA 3A23A 3SRHA 1UR0A 2QPSA 3P74A 2CLIA 2FZBA 2VVSA 1K8YA 4B91A 1D3HA 4KFPA 3ZVHA 6XIMA 4JY8A 2CIPA 1XIFA 9RUBA 5FIPA 5HWNA 4EPKA 1S2AA 1WZMA 2GJLA 3P7YA 5CC6A 3O0KA 1QW8A 3URNA 1QI5A 3LXBA 1DP0A 4IGSA 2R9RA 1RLDA 2AGTA 1YXCA 3NM3A 4YTSA 5CBJA 3SO7A 3P84A 2HXTA 2PTZA 3UEQA 4QLLA 2HNEA 4KH2A 3TUUA 3UZ5A 2V5KA 3C0JA 4X2RA 2HS6A 3W1RA 4AY8A 4YXGA 3AXIA 1XRSA 5JMUA 5E1QA 4WJ8A 5AC4A 3WDQA 3AMLA 1HJSA 1R3YA 1KTCA 1SZFA 5L9FA 5G1TA 5LNVA 3V4BA 1TQJA 2XVNA 2O0TA 1NDZA 1YPXA 4D72A 3P93A 3JR2A 3VOIA 4LYQA 4XTIA 3WF1A 3W00A 1MO0A 2DZXA 1GQIA 3EWWA 4XKMA 1QJWA 2Z1VA 2X1TA 4G9PA 2WK2A 4N6EA 5CPSA 2IUZA 3OA3A 3L2MA 4C1LA 1N8IA 4Q8NA 5C6MA 3GXNA 1SFSA 3AWOA 4FOUA 4JQAA 1N8FA 4BR1A 2J7HA 4AX6A 5LNUA 2Y8UA 1XKYA 3L4WA 3P0WA 2TAAA 2QV5A 4KPLA 8A3HA 3N6HA 4IISA 5H91A 1IXNA 1HTIA 1GVQA 1UWSA 3P2VA 1HP5A 1YPIA 3EOEA 3NPWA 3SJ3A 4QSFA 1E6RA 3VXGA 1L2QA 4AWTA 3MSDA 2HV5A 1S39A 3ZIZA 4HMDA 1CYGA 4AHOA 1M04A 4ZXLA 2EPOA 2YZ5A 4G7EB 5CXPA 2WPBA 1U30A 2ACUA 3SCVA 4B15A 4J28A 4NZFA 3RRAA 3WK1A 1I60A 1K70A 3GVRA 2VGFA 5TQLA 1ZALA 3W53A 1XBZA 3ARTA 4UR8A 1LOSA 4CCEA 4FIRA 3E2VA 4XBJA 1R3SA 4R85A 4A29A 3TTQA 1CWYA 5AHMA 3DBPA 3D3AA 2PWUA 4N4PA 2PTDA 1HGYA 1RR2A 2ZTKA 4GXPA 3W9ZA 3SUUA 3MKCA 1MW1A 1PXGA 3C2EA 2JBMA 1QXLA 2QNEA 2WKGA 5DT7A 3VD9A 3T05A 2Z26A 3EA1A 1HIZA 2UWFA 1OCBA 3T0AA 4IIHA 1ZGDA 3KHDA 3QMSA 2X7VA 2QPUA 1SMAA 3NEVA 2CBIA 1Q66A 5HPOA 4DJFC 2Y0FA 1I8JA 2RGLA 2WZHA 4FNRA 1AZ1A 2A0NA 2ZFAA 1CBGA 1R9YA 2PWEA 4ZXOA 3QQ0A 1GTHA 2PF0A 3OGVA 4GZEA 4K36A 1I9CB 2WCAA 2JGQA 3WX7A 4BI7A 1V3IA 5IRPA 1V3KA 4LVGA 4ZBCA 3QV9A 5M17A 4PTNA 4N7QA 3AJXA 3VZXA 2BODX 4ZQPA 1J10A 4GFSA 4F0SA 1F07A 2V38A 2PZNA 4GUHA 3DHPA 2O92A 5ABHA 3IK4A 4QE1A 3LZ5A 4UTMA 1AD4A 3L5LA 4JNZA 2DIEA 4QEEA 4H19A 1KCZA 4HYVA 2TSYA 2WJDA 1NOUA 1QBAA 5A8MA 1R2TA 3WK0A 5FOOA 1A4LA 4W85A 4Z0SA 1PE1A 3PWGA 2OEJA 5FA5A 2J74A 1AJ0A 3D6NA 3S1XA 4PUNA 5HANA 1ENUA 3B8IA 4HZ8A 4A3HA 1VPQA 3UG5A 4ZSTA 1WAWA 1U1UA 2ODOA 2OYMA 5D04C 2MANA 4YHGA 2WNWA 4D6HA 1HO1A 2QJIA 2XZ7A 1IWAA 4ATLA 2FZDA 1A5SA 2DZBA 2PD5A 1E70M 3MUAA 3NWRA 1GKQA 3HA1A 2VTFA 5DN1A 3A24A 2EF9A 5CC7A 2NUXA 3VMOA 3URQA 2BY0A 1XLDA 3E0FA 3UYIA 5XIAA 4HZ7A 2G41A 5AC7A 4WKFA 3WJSA 4NNAA 3AOFA 2JIWA 3GTHA 3RPMA 3SRFA 1PHQA 2PDIA 2VUYA 1DWFM 5C2XA 2YSWA 4JNYA 1EF2A 5FESA 6XIAA 3B06A 2ZDRA 1SO3A 3KRZA 2DGAA 3H4WA 4UCGA 3TTSA 3CHCA 2TPSA 2Y63A 3DXIA 3ERPA 3M1ZA 3OEXA 4HNNA 4HSHA 3DYMA 1BGGA 3ONBA 4BQ5A 3VDCA 5I3FA 4D9PA 1YPFA 2PDFA 1PL9A 4Z08A 5KSWA 1KGUA 1M01A 1MQQA 4S3AA 1WKEA 4P7OA 1IZJA 1NP0A 4MNMA 1CXEA 1KKRA 2EJAA 3D0CA 3QJAA 5EBAA 3T55A 1CLXA 4MHBA 1LJYA 4LYKA 1LWIA 1W2PA 3HPXA 2QAFA 1RXOB 3WLMA 2XVLA 1ONWA 4ATDA 2GVEA 5A6AA 2V3DA 1GOQA 1W5NA 3U7VA 2HVMA 2QCLA 1IT0A 1O68A 1JAEA 1E1FA 4CQDA 1X7FA 1JD9A 1UA7A 2G5WA 4Q4MA 4Z42C 3CV1A 3LB0A 4AZHA 3UZWA 3BJFA 4LY8A 4IL0A 4TVUA 2RUSA 4PCTA 2H90A 2J25A 3SCPA 4M7SA 3S1VA 1EBHA 4IPIA 3QV6A 1EJWC 3BAKA 2I9UA 3M0XA 1DJIA 2KX9A 3GNRA 4Z1DA 3VIFA 4D1JA 4WEVX 2X1IA 1RQHA 1AW1A 3D46A 3DDMA 3M0JA 4E8CA 4XD3A 5ABFA 5EY5A 4JN8A 2C6QA 4W4QA 1VENA 3TOPA 5JIPA 1O1HA 2YL8A 3EA3A 3C86A 1ITUA 3A6OA 2PD9A 4R53A 4O53A 5T9CE 3VU2A 4DLFA 1MUMA 1NDVA 3B05A 2I16A 2CITA 3P14A 2CLFA 3W2LA 5I79A 4B3ZA 2G95A 1TWWA 3DI1A 1BSLA 2BHZA 2Q01A 3KBSA 5HULA 3H12A 2VZOA 1JZ7A 4KRZA 1P7TA 3KBWA 3HG5A 3RR1A 3F2CA 2J88A 3S8HA 1ONXA 2JFEX 5K4ZA 1JQVA 3CQIA 1A3HA 1MWOA 6REQB 1TA3A 4HK7A 2ZVRA 3WF2A 1W1PA 4H4IA 1F7BA 3G6LA 2QT3A 4LF2A 4B2DD 3OA5A 4IGHA 3VIJA 4AG0A 3WMLA 3O6DA 1BVWA 5D37A 3TN5A 3PBWA 1DXEA 5I77A 4H6QA 4HA0A 1GZ1A 5F4SA 3DOPA 3AFBA 4V1YA 3K4AA 3VILA 1ZCOA 1R8LA 2CESA 1WA3A 5MKGA 4O0ZA 3MVIA 1FCVA 3XINA 4IUGA 1ZB5A 4WY0B 1EC8A 1KBBA 3UW6A 3ZJ8A 3GFZA 1CW2A 3C8NA 2CBJA 4NU7A 1KFJA 2P53A 2VVNA 1C29A 4DF1A 1CZ1A 2HDJA 4QM1A 9XIMA 3PC0A 3I4EA 3U8GA 4RX0A 4QIUA 1M03A 5DMLA 2ZRWA 4B4FA 2R1KA 3F2BA 3HFTA 3GG0A 1FCBA 4J5NA 3G1HA 4C5YA 3BH4A 5JUVA 1V6TA 1S5TA 4H41A 3WD0A 3OLEA 1OABA 4ML9A 1UWRA 3OVGA 3AMCA 1JRBA 4HK6A 4PUKA 3GRIA 4IPLA 1E72M 1IV8A 3U2ZA 4OVXA 3IJDA 3SBFA 4JEJA 5HXMA 3WLHA 4IICA 3GS6A 4PSPA 2W4XA 1H7PA 4WOQA 4ZSUA 4JTRA 4ZO6A 4LBUA 2VZVA 1ZBWA 2C71A 2GDUA 1ISVA 2RHGA 1RCXB 2ZX7A 3VMPA 1XCFA 3VKBA 3ARVA 2CXGA 1WDSA 4H7CA 4C6KA 1CXFA 3AIBA 2B0MA 4RXGA 4DJDA 2CZDA 5A8QA 1RY0A 6PTDA 1E3XA 3RX4A 3LPPA 4HPXA 3IVTA 3VD4A 5E6YA 1CXIA 1TYGA 2C1GA 1FH8A 3U0HA 4ZR8A 5DCBA 1KBKA 5BU6A 3WLQA 2OX1A 4KMQA 4NASA 2OSYA 4FK9A 3E49A 3WQFA 4PTXA 1IHIA 2ZUUA 2IPFA 4MWAB 5C0QA 3IEBA 2DUXA 3S47A 3E2SA 5C9ZA 1T41A 1PAMA 1UWQA 1DYSA 4WKHA 2DFAA 1XDJA 2XIJA 3SEPA 3EXRA 1EYWA 1HJQA 2H6RA 3MP3A 2DU2A 3C2VA 1F3WA 1UOKA 3N04A 3UQNA 1ODZA 4QLJA 1ESWA 2P8BA 1Y7VA 3UY8A 1H1ZA 2E9MA 1Q13A 4G7EA 4J3VA 1XIIA 3QM3A 4ICMA 4WSHA 1BF6A 1ZJBA 2F2KA 5FEPA 1EX5A 1NP2A 3JVAA 5EFDA 2ZUTA 1CENA 3ES8A 3NSXA 5IDIA 5BYWA 3L4TA 1A47A 1UIOA 3G5EA 1UD5A 4WX2A 2W92A 4DAFA 3M44A 4MIMA 3C56A 5DANA 3WUEA 4C1KA 2BDQA 5LHFA 2GK1B 4ZE4A 4ORMA 3T09A 3VO0A 3VMNA 4C6PA 4I7WA 2PBGA 3P5YA 2O9PA 5AHNA 2YDQA 4MWAC 3LN3A 4JNMA 3R58A 5FJOA 1EIXA 1TWIA 1QCWA 4MDOA 3KFTA 3R25A 2AL2A 2Y6ZA 1UD2A 3MMUA 3RYSA 2EEXA 2PDYA 1KV5A 2VZUA 4GACA 3W72A 4CNUA 4DEFA 3V5OA 5EBUA 1DV7A 1PEZA 3GXDA 2Y70A 3R5EA 4C91A 2P1FA 2ZXAA 2PB1A 3EZ4A 5BRBA 1J11A 5F2LA 1GYMA 2O9OA 2PZ0A 3UGVA 1OFBA 3UBPC 1A5UA 3R8RA 3LGEA 1SMDA 5IXEA 4M3PA 1V3JA 1A0CA 4GZ7A 1I6NA 1ZP4A 1PZ0A 1A5KC 1TE1A 4EWJA 3CEPA 5KETA 3OBAA 4A21A 4XAPA 7REQB 1B3OA 3AUJA 4Y9OA 1POJA 4CD4A 5FJJA 1TSIA 2IKJA 1KD0A 2XFFA 2B7OA 1OEPA 4GABA 2YYTA 4H7ZA 3G1YA 5BRQA 3P3BA 3OVRA 1XC4A 2EQDA 1TPC1 3MMTA 3B8WA 3JS3A 1ME7A 1TVNA 3SB0A 1XDLA 4MLRA 3CHDA 4E2DA 4LWWA 3MZ2A 1DWIM 3BG5A 3HG4A 4ZEPA 1T8XA 3H55A 3NL5A 4JS3A 1MNZA 1HX0A 4EF8A 4PMVA 2CLOA 3W87A 4WK9A 1L6YA 4YS1A 3LTPA 1SJAA 1TV4A 3NVTA 4UNIA 1OG6A 2I56A 3P80A 2A4AA 3LQLA 4XZBA 1VHCA 3G0XA 1EPXA 4XUYA 2X41A 4GI8A 4ERAA 2E6DA 3OLDA 2QJGA 3AIEA 3LPOA 1XYLA 2VX6A 2EPKX 3RMEA 3L23A 1WDPA 5D9MA 5AVNA 1R0MA 3MP4A 3PPCA 1XIDA 2PDGA 4CCDA 2DSVA 3ICJA 4ADUA 3UNDA 3S3GA 4Q8PA 3OIXA 3GDKA 1OCJA 3POCA 3QN3A 1UR4A 3PP7A 2Y7EA 1V0KA 3PZNA 1SFJA 3BG9A 3M6DA 2QUTA 1KC7A 1SPQA 5BOOA 3M5YA 1JCLA 5A8NA 1CTNA 4ADTA 2IXVA 4MB1A 3C0QA 1NELA 4DPQA 4Q8MA