3RQGA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 76
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqgA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqgA02
3B71A 4XEFA 1OW8A 2L6GA 3GM1A 1KNYA 3O10A 2JPUA 1OW7A 1OW6A 1WOLA 2L6HA 4R32A 2L6FA 1UFBA 3C18A 2PBEA 4NQFA 1V4AA 3W8HB 2JX0A 3JYYA 3GM3A 3S9OA 3U3FA 3W8IB 4GEHB 1QVXA 3RQEA 1PV3A 3C8GA 3L8JA 4EBJA 3GM2A 1K04A 2LK4A 4EBKA 1K40A 3C8GB 4XEKA 3BRJA 3L8IA 1JOGA 4XEVA 5F28E 3C8GD 1KTMA 2Q00A 3JZ0A 3K7DA 1K05A 1ZZPA 3TULA 2HSBA 3RQFA 1O3UA 2KK1A 1WTYA 3RQGA 1WWPA 3AJMA 3MFNA 3U0CA 2YWAA
chains in the Genus database with same CATH superfamily
2AU5A 4BJ6C 3PCVA 1EY3A 4FESA 2Z15A 3R7CA 1AUEA 3IQCA 3EH2A 5KJPA 4E0HA 1Z23A 4JYLA 3PDMP 4H4KC 3NMIA 5JP7A 2HSQA 4KI2A 1FMVA 3S28A 3ASNC 3X1OA 3AGUA 4MVOA 5E33A 2WZFA 4MVSA 3QMKA 3NG1A 4K3WA 3BRJA 3GODA 4PJLA 3UMHA 1DCIA 1H6GA 2KK1A 1XZQA 4O6MA 5CI8A 5COMA 1ZYRF 3HLZA 4DRJB 3FVYA 5JVEA 1MNDA 3A4NA 4U5BE 1D1AA 1VLSA 1UG7A 3ITFA 3ABMC 1OKKD 3NRHA 3Q6NA 2W4BA 5IY5C 5L0CA 3WHNA 3LEVA 4BJ5C 2EPOA 2YLDA 3Q7LA 2Y69C 3POVA 3JT1A 3OA1A 1YYJA 3G50A 5D92A 1Q0MA 4PJJA 1ZW3A 3K1HA 3T88A 2VCAA 3R0OA 3I4UA 1GS9A 4JJFA 1NU9C 2YKZA 3QW1A 2L6GA 5L3QA 3S9OA 2XLOA 5DLJA 3LJBA 3A4MA 2X51A 1HW1A 1YZAA 4HEAJ 2YL3A 1SR2A 2OJED 2WVOA 4IRUA 1SYQA 3LLKA 4I52A 3RF3A 2L81A 5JSLA 1R5ID 4AE4B 4YJWA 3S29A 2ZXRA 2VCCA 2M4EA 2AVKA 2EINC 4DVYP 3S0XA 1M57C 2R05A 1ORSC 1R4TA 4PFPA 2J7PD 4N6HA 2HFIA 5T3TA 1VYIA 2XL8A 3LNRA 2L7AA 3OEOA 2F6QA 1VK5A 2EPKX 1TKNA 2WVNA 4NY3A 3FDUA 2P7VA 4GYTA 3C63A 2NG1A 3AG1C 3GWLA 4XEFA 5E3CA 1T6UA 1OR2A 4HE8D 1EKYA 1EA8A 2R7VA 3T6GB 3SXYA 1CPQA 1U0BB 2D4UA 1MMAA 1TFOB 1TWGA 1CGNA 3G4XA 4C3DA 3DXJF 2EJ5A 4O79A 2PBEA 2QQ3A 4OIRF 2NPUA 1K40A 3DWWA 3L8IA 3T4RA 2LCHA 3GORA 2QLAA 4OINF 2C03A 1NFOA 1HW2A 1LM3B 4CS8C 3SXKA 1Y6DA 3NDBB 3VRCA 4U5FE 3US6A 4K2NA 2WL8A 4C7OA 4U19A 1ORJA 2EIMC 3U9MA 4G78A 4CS8A 4E7ZA 4JTAB 4O6YA 5A6KA 3KYIA 1RKEA 2VX2A 1Q52A 4FJWD 4FWVA 2W45A 1HMOA 3SXZA 3M1CB 3CQZA 2PX0A 4DRIB 3PHF2 3EQLF 3DJUB 1OXKA 1LE4A 2G3VA 2J0WA 3HNJA 4D4XA 4OIPF 3H65A 3EFOB 1UX4A 4L6RA 2BL2A 2YQYA 3B0PA 1GQAA 4WGZA 3EGDB 2HSBA 2LD6A 4MVZA 4DJ9A 3DM5A 4K0DA 1OW7A 2DGJA 3TK0A 4JZAA 1H9GA 2EPLX 1DUBA 2C04A 2OCCC 3MLGA 1RMVA 4YT5A 5BUOA 2G3KA 4EKWA 3AG3C 4JOTA 3H02A 2HW5A 3B71A 2OQMA 3AM1A 1VYKA 4LLEA 1WZ8A 3EJNA 1S05A 2KC3A 2GDCA 5DS4A 2GA0A 1TWCA 2P63A 4WABA 3DD7A 4JFCA 3PZKA 3Q1TA 4YN0B 2GWWA 4RDAA 4KNWA 2LK4A 4YK5A 3W4YA 3QTHA 1YLMA 5K0IA 2IXOA 4Q4ZF 2A0BA 4CX9A 2ZXPA 1NU7D 2HMQA 3NKEA 4JC7A 3HRXA 4YL1A 2RSEB 3L1MA 3RIPA 4JCSA 2KJGA 5A69A 4EBKA 2LQGA 1Q0KA 5HV9A 1F1MA 1K05A 1XWJA 1YAUO 2HJMA 4OIQF 2DB4A 2NSFA 1G8XA 3WAQA 2HZ8A 3HKKA 3M4CA 4NTFA 3T9OA 2PNOA 4JE9A 2P6VA 2PBPA 3M15A 3IQ5A 3T6BA 2NUPB 4NC3A 2E87A 1D1BA 3U2LA 3MBGA 2IXPA 4CDAA 1UFBA 5A6JA 5BQGA 1O87A 2RD9A 5A6BA 5AC4A 3B9QA 1FTSA 3SLLA 4LACB 3O55A 2Q3TA 2XXAA 3H2VA 1RCPA 2FFHA 3AJMA 2CW0F 1J8MF 2YL1A 3JRTA 3X2QC 1HMDA 4D4NA 3GM3A 2Q9BA 2QNLA 3ZWIA 4BG0A 3MYBA 3VM6A 1TFKB 4EWCA 1EQ1A 3H2UA 3LS0A 2EILC 2I8BA 3R9SA 5DS6A 4U9DA 4NTBA 3ZTZA 1NBBA 1Q0FA 4U5CE 3S90A 1UIYA 3FOOA 2LP4A 1OXBA 5KYUA 3J06A 4U5GA 2VB6A 2MYSA 2CGEA 2UZFA 1JR8A 4F4BA 4K7BA 1WN0A 4MVQA 1Z7Qc 1YDIA 1V55C 1I5NA 3GEHA 2VREA 2L6FA 2J9WA 1M56C 3JYYA 2CNWA 3TD7A 1PV3A 2IBFA 2XSEA 1NSGB 4OLQA 5CI9A 1QLEC 2R02A 5DQZA 3EG9A 5B3SC 3TJ5A 3QXIA 1QKRA 2ZPAA 4BJ6A 2KSFA 3IQ6A 2B0JA 3JRMO 3SWXA 1FAPB 3T6JA 5C9GA 5L0IA 3SEOA 4NQFA 2R03A 2P61A 3ZQYA 5BQIA 1H7IA 2Y3DA 1JOGA 2H7VC 3JZ0A 3MOYA 4AK9A 3DE9A 2YVKA 2OJQA 2Y3HA 3C18A 4IZBA 1WGWA 3K1IC 4DXWA 1E84A 2OU6A 1MMNA 4IGGA 4CSAC 3TLFA 3GM1A 1M2VA 2A0UA 3HNLA 1L3PA 3K1IA 5E3AA 4CBEA 4Z9JA 1PD0A 1EF9A 3RSIA 1LI7A 4BJ5A 1JMWA 2ICWG 3C8GD 4IARA 1BR4A 2DYSC 4P9TA 2YLIA 3R2PA 4XQ1A 4DRHB 5KYNA 3QXZA 1E83A 1JAFA 2G62A 3FAJA 3NMKA 3PMRA 3JTLO 1QPUA 4MVMA 4AX2A 4MI2A 3V7OA 1NZYA 2CYDA 5AC5A 1U6HA 1CGOA 3I5QA 2L9JA 4JEAA 2B0HA 1OQCA 5GPGB 4U18A 3K66A 5AGFA 4OG1A 2NSGA 2WZGA 4E7SA 3ADCA 1I4YA 2WVQA 3V5XA 3ZC4A 4C3BA 5JT4A 3FMSA 3I47A 3G4ZA 3DAGA 1NFNA 5DS5A 5B1BC 5A6AA 4BJTA 1Y4CA 3QK8A 2GTRA 3V5YA 2DUBA 2QTVA 2PX3A 3ZDLA 5DVWA 5L0DA 3U2MA 5JUAA 1ST6A 2FW2A 3EGXA 5EHHA 2I15A 2FAPB 4BEJA 4CDVA 1G5ZA 4YT8A 3SP1A 3FDQA 3ADDA 2Q9AA 4E18A 3A11A 3FAPB 4HFFB 5F5FA 1JPJA 3GANA 1T5OA 2YZSA 3C8GB 4I42A 1MNEA 3KYJA 3WG7C 2ZQQA 1ZU4A 3LUTB 1T9KA 1BR2A 1I4ZA 3AOUA 4AL1A 1Z5ZA 3JSZA 4PK4A 4I44A 3K6BA 1YARO 4J30B 1E85A 4PR9A 3F47A 4LDQA 3QW0A 4C7OB 1NLXA 2ASRA 3DMDA 3RYLA 2BE5F 1LVKA 4XPYA 3RQEA 4ER9A 3RVYA 5L0HA 2BC5A 3SXMA 4MOUA 1BZ4A 3ZTMA 2H8AA 1UX5A 3FHDA 2MWQA 1FFTC 1DOWA 2PFDA 3E9VA 3MYIA 3NYJA 2R9RB 2J9VA 3RH3A 5EK0A 4JW1A 3DI5A 1N1CA 2CDQA 1CPRA 3EGDA 3CAXA 5A6BD 2R7TA 1SF8A 3VAYA 1XZPA 4NEKA 3DE8A 5DQTA 1A0BA 3Q0GA 3L0IA 3HTKC 1Z3IX 1YA9A 3K33A 4GEHA 3KL4A 1Z63A 1HZDA 2A6HF 2XS8A 2UUIA 1LE2A 5JBXA 3DM9B 4RD9A 3RQFA 4ELWA 4DOZA 4ELSA 3KQFA 1ZHZA 1KNYA 2QUPA 2IEXA 3AQBA 2V3CC 3RKOF 3JCUQ 4U5HA 3C62A 1OR3A 3EH1A 4I4ZA 1KU2A 1M2OA 1IZMA 1RXQA 4QIJA 3EZIA 1WASA 2J9BA 5FCLA 4DBQA 2QE9A 4J7YA 1DOVA 1LI5A 4EMLA 2XM0A 4LDKA 4OIOF 3B0UX 2W4MA 2AP3A 4I1OB 4CDYA 4IWBA 1E86A 3A4LA 4YT4A 4ZLDA 4E0IA 4PJMA 1OCOC 4BJ1A 4DVZA 1HY5A 2CNWD 2EIKC 2XL6A 4QI0A 2V26A 4B6IA 1EF8A 5F5HA 4Z9IA 4W8KA 3SZRA 5JS5A 1Q51A 4G0HA 1NZEA 3HINA 3VYWA 3W8HA 3LAYA 5KYWB 4EBJA 1LS1A 1ZU5A 4BEMJ 5T1DB 2HV6A 3RW0A 2P1AA 1RJ9A 3UR3C 4G7ZF 1PCXA 2HJ3A 2XLMA 2XXAB 3U9JA 4RBNA 5KYYB 2NUTB 2GFHA 4CIPA 3HNKA 2J9UA 2A69F 1ZVZA 4LDRA 2AWYA 1V4AA 4YWQA 5KYXA 4P9FA 1TR2A 4MVUA 3I5PA 2IXMA 2DI3A 3SYNA 1W2WA 3JYHA 1RJMA 4G7HF 3AG2C 1A7DA 2WZLA 4ZU2A 3C7JA 4YL0A 1MMGA 3BEHA 4JEBA 3W8IA 4GQHA 1QVXA 1K04A 1AEPA 1VB5A 1ZHTA 4FZWC 3AG4C 3RVZA 2FBMA 5KYUB 5CIVA 3UMIA 2OEVA 3O39A 1L7CA 1U89A 3N24A 3GEEA 3NYLA 1H9TA 3EHNA 1V54C 2QY9A 4FZWA 4XWJA 5TJ5E 5F28E 3S27A 4MVRA 1VTMP 1YVIA 2MHRA 2UUHA 3HJCA 4EBBA 2ETSA 1LS4A 2LFFA 1T6QA 1D0XA 2VASA 1D0YA 1EI7A 3T89A 3ADBA 1JRAA 3EG9B 2EPMX 3RQGA 2TMVP 4WCZA 3IQTA 5L0GA 4U1AA 1ZHXA 3MYFA 1OW6A 5B1AC 2KQ9A 4WGYA 3A9CA 4N4WA 1QSPA 3LEOA 2KGOA 2A68F 3VF0A 4YL3A 4I1MA 3B0VC 1V74B 3OWTA 4JJGA 3W2WA 2VH3A 4JRZA 3AGTA 1TQGA 3TOLA 4X0RA 2XRHA 1NG1A 3LNMB 3O10A 2JPUA 3LLIA 4JIOA 1LIHA 5L0JA 3WODF 3H81A 3ZQVA 256BA 1T6IA 2YL0A 3K7DA 3UGOA 4ONSA 1M6TA 3MFNA 2Y39A 3CZ6A 1D0ZA 4A2NB 5L0FA 4JKVA 1M2VB 1PD1A 2R7UA 1JXZA 3UNGC 2M64A 2HV7A 5D91A 1J8YF 1KTMA 2XS1A 4U9EA 4CSAA 4CJOA 2XLEA 2YHSA 2Y3GA 3ATPA 3S84A 4R32A 4A4AA 1Q0GA 4CS7A 1CGME 3UGPA 4CIHA 2OEXA 1RJNA 3O4XE 2J8WA 1GGQA 3IHUA 1ZHWA 2R7QA 1WATA 3R9TA 3DKAA 4MQ9F 4ZLCA 4O7GA 5T3WA 3TRRA 2O9XA 1C02A 1NZYB 4JTCB 1Z6AA 4NCQA 4NNQA 1SMYF 4OD4A 1OCCC 4YT2A 4KBLA 4DBRA 3N2ZB 1O5HA 3TOMA 4AE4A 4M63A 2L6HA 2R7SA 4ULWA 2LIGA 2LSEA 4KC9A 3E70C 4ULVA 3ABLC 3KPHA 2YLGA 4XEKA 4EIYA 3TJ6A 4NTAA 3JSEO 4HFKB 1Q0DA 3NYMA 1YZCA 4IZDA 4XPWA 3AQCA 1HE1A 4QDLA 3EGXB 3UMKA 2EPNA 4MNDA 4MTOA 1MJ3A 2Q00A 4JURI 3V5ZA 4U5DE 2IOQA 5E2QA 1ORYA 3Q7GA 3B29A 1VMAA 1YJGA 2ZXWC 1OKKA 2Q4FA 2VCBA 3GWNA 4JCZA 5JBWA 3LESA 3CSKA 4IAQA 5JLIA 1TWAA 3CEXA 2J0XA 2XL4A 4JTDB 2YEVA 1SZIA 3IEEA 5BQHA 1AVOB 3FXHA 3C8GA 3ZSUA 2J46A 1OCRC 2XLHA 4PFOA 4MW8A 3TULA 3Q6MA 2Y3BA 4I3MA 3T8AA 2J45A 1ZW2A 1JPNA 2XM4A 1WOLA 2R7XA 3U3FA 5HSWA 4JCHA 4U5EE 1RKEB 2R25A 2F22A 4MTFA 2YRFA 1FFHA 1C17M 2LFDA 3KKBA 1WWPA 1BBHA 3NKDA 1OW8A 2XLWA 5COGA 2CCYA 3EZHA 2IYLD 2KYHA 1GM5A 2HS5A 2H7OA 3L8JA 1S7ZA 1B68A 1ZHYA 1YA7O 1MMDA 1VLTA 2IM8A 2J7PA 3FOPA 2OG2A 4BPMA 3KMIA 4ANJA 3HNIA 1G4US 4XLNF 2JD3A 4MTGA 3QZCA 2PPYA 3M4BA 3EFOA 3ECSA 2YL7A 5FZTA 1TWHA 2PF4E 4AL0A 3ABKC 3GEIA 1BDJB 4XEVA 1LKXA 2EIJC 3M79A 4CJGA 1RKCA 4W8PA 4C3EA 4GEHB 1T01A 4K1OA 2VC9A 4PJNA 2D5RB 3P5MA 3EPVA 5COFA 1OCZC 1VOMA 2XLVA 4LLCA 4Z9HA 4J32B 1Y64B 3Q0JA 4OD5A 4Q7CA 4LERA 3RFYA 4IZCA 3IRBA 3NMJA 2AWCA 2DYRC 3ZIBA 4N06A 4G7OF 4QIIA 1FMWA 2Q7RA 1APCA 4N6CA 3DJNB 3U8VA 2OOCA 4EUKB 4O6NA 4KNVA 1A7EA 2YWAA 2R7RA 2IXNA 2Q9CA 1A7VA 3DAFA 3MX3A 3F46A 2A6EF 3KH2A 2FGYA 4IJJA 3ASOC 1E2XA 2XLDA 3N0TA 2KNHA 2KW3C 1ZZPA 2W9YA 2WB7A 4JVSA 4FX5A 4JWVA 2R7OA 3W8HB 1BR1A 2JX0A 4XTKA 2ZD9A 2GAQA 3GM2A 1G4WR 4IB4A 1FNTc 2ZQRA 1RJ9B 1WTYA 3QVZA 3U0CA 2NUPA 4CS9C 1HE9A 4MS2A 3ZVRA 2H7BA 1IW7F 4E17A 5KYWA 5KYXB 5B3IA 1LPEA 1MQVA 4WJ0A 4QI2A 2HKVA 3U8PA 4CS9A 3U3BA 3L34A 5KYYA 2NUTA 3TQOA 5JRAA 2A1DD 4ELXA 4XLPF 2HUJA 4Q5SF 3DZAA 2HMZA 2PP4A 3EHMA 4FAPB 3W8IB 4MW3A 2P0NA 1QZXA 3C8ZA 1D1CA 4IAOA 4KNPA 1FR0A 3QVYA 3SNHA 5L3VA 1C03A 1QQ3A 2R7WA 3W2VA 2X0CA 4F47A 2OKUA 4H54A 4PACA 4UDVA 1YYXA 4EHPA 4XPXA 3LS1A 4J7TA 3U5SA 1A41A 5EGYA 3ZG1A 3IPMO 3OC7A 4P6IC 2ZXOA 1O3UA 3O6XA 3G64A
chains in the Genus database with same CATH topology
2L6GA 3GM1A 3O10A 1UX5A 2JPUA 1OW7A 1WOLA 2L6HA 1Y64B 2PBEA 3S9OA 3U3FA 1QVXA 3A4MA 1K04A 1K40A 4XEKA 3L8IA 3C8GD 3IRBA 3K7DA 1WWPA 3MFNA 3ADDA 3B71A 1OW8A 3AM1A 3A4LA 2L6FA 1UFBA 3JYYA 3W8IB 1PV3A 3L8JA 3C8GB 3BRJA 1KTMA 5F28E 2Q00A 2P63A 2KK1A 3AJMA 2YWAA 3A4NA 4R32A 4NQFA 3GM3A 4EBJA 3O4XE 2LK4A 4XEVA 1JOGA 3ADBA 3JZ0A 1ZZPA 3RQFA 3RQGA 3ADCA 4XEFA 1KNYA 1OW6A 3C18A 1V4AA 3W8HB 2JX0A 4GEHB 3RQEA 3C8GA 4NNQA 3GM2A 1UX4A 4EBKA 1K05A 1RJMA 3TULA 2HSBA 1O3UA 1WTYA 3U0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  4XEF A;  1OW8 A;  2L6G A;  3GM1 A;  1KNY A;  3O10 A;  2JPU A;  1OW7 A;  1OW6 A;  1WOL A;  2L6H A;  4R32 A;  2L6F A;  1UFB A;  3C18 A;  2PBE A;  4NQF A;  1V4A A;  3W8H B;  2JX0 A;  3JYY A;  3GM3 A;  3S9O A;  3U3F A;  3W8I B;  4GEH B;  1QVX A;  3RQE A;  1PV3 A;  3C8G A;  3L8J A;  4EBJ A;  3GM2 A;  1K04 A;  2LK4 A;  4EBK A;  1K40 A;  3C8G B;  4XEK A;  3BRJ A;  3L8I A;  1JOG A;  4XEV A;  5F28 E;  3C8G D;  1KTM A;  2Q00 A;  3JZ0 A;  3K7D A;  1K05 A;  1ZZP A;  3TUL A;  2HSB A;  3RQF A;  1O3U A;  2KK1 A;  1WTY A;  3RQG A;  1WWP A;  3AJM A;  3MFN A;  3U0C A;  2YWA A; 
#chains in the Genus database with same CATH topology
 2AU5 A;  4BJ6 C;  3PCV A;  1EY3 A;  4FES A;  2Z15 A;  3R7C A;  1AUE A;  3IQC A;  3EH2 A;  5KJP A;  4E0H A;  1Z23 A;  4JYL A;  3PDM P;  4H4K C;  3NMI A;  5JP7 A;  2HSQ A;  4KI2 A;  1FMV A;  3S28 A;  3ASN C;  3X1O A;  3AGU A;  4MVO A;  5E33 A;  2WZF A;  4MVS A;  3QMK A;  3NG1 A;  4K3W A;  3BRJ A;  3GOD A;  4PJL A;  3UMH A;  1DCI A;  1H6G A;  2KK1 A;  1XZQ A;  4O6M A;  5CI8 A;  5COM A;  1ZYR F;  3HLZ A;  4DRJ B;  3FVY A;  5JVE A;  1MND A;  3A4N A;  4U5B E;  1D1A A;  1VLS A;  1UG7 A;  3ITF A;  3ABM C;  1OKK D;  3NRH A;  3Q6N A;  2W4B A;  5IY5 C;  5L0C A;  3WHN A;  3LEV A;  4BJ5 C;  2EPO A;  2YLD A;  3Q7L A;  2Y69 C;  3POV A;  3JT1 A;  3OA1 A;  1YYJ A;  3G50 A;  5D92 A;  1Q0M A;  4PJJ A;  1ZW3 A;  3K1H A;  3T88 A;  2VCA A;  3R0O A;  3I4U A;  1GS9 A;  4JJF A;  1NU9 C;  2YKZ A;  3QW1 A;  2L6G A;  5L3Q A;  3S9O A;  2XLO A;  5DLJ A;  3LJB A;  3A4M A;  2X51 A;  1HW1 A;  1YZA A;  4HEA J;  2YL3 A;  1SR2 A;  2OJE D;  2WVO A;  4IRU A;  1SYQ A;  3LLK A;  4I52 A;  3RF3 A;  2L81 A;  5JSL A;  1R5I D;  4AE4 B;  4YJW A;  3S29 A;  2ZXR A;  2VCC A;  2M4E A;  2AVK A;  2EIN C;  4DVY P;  3S0X A;  1M57 C;  2R05 A;  1ORS C;  1R4T A;  4PFP A;  2J7P D;  4N6H A;  2HFI A;  5T3T A;  1VYI A;  2XL8 A;  3LNR A;  2L7A A;  3OEO A;  2F6Q A;  1VK5 A;  2EPK X;  1TKN A;  2WVN A;  4NY3 A;  3FDU A;  2P7V A;  4GYT A;  3C63 A;  2NG1 A;  3AG1 C;  3GWL A;  4XEF A;  5E3C A;  1T6U A;  1OR2 A;  4HE8 D;  1EKY A;  1EA8 A;  2R7V A;  3T6G B;  3SXY A;  1CPQ A;  1U0B B;  2D4U A;  1MMA A;  1TFO B;  1TWG A;  1CGN A;  3G4X A;  4C3D A;  3DXJ F;  2EJ5 A;  4O79 A;  2PBE A;  2QQ3 A;  4OIR F;  2NPU A;  1K40 A;  3DWW A;  3L8I A;  3T4R A;  2LCH A;  3GOR A;  2QLA A;  4OIN F;  2C03 A;  1NFO A;  1HW2 A;  1LM3 B;  4CS8 C;  3SXK A;  1Y6D A;  3NDB B;  3VRC A;  4U5F E;  3US6 A;  4K2N A;  2WL8 A;  4C7O A;  4U19 A;  1ORJ A;  2EIM C;  3U9M A;  4G78 A;  4CS8 A;  4E7Z A;  4JTA B;  4O6Y A;  5A6K A;  3KYI A;  1RKE A;  2VX2 A;  1Q52 A;  4FJW D;  4FWV A;  2W45 A;  1HMO A;  3SXZ A;  3M1C B;  3CQZ A;  2PX0 A;  4DRI B;  3PHF 2;  3EQL F;  3DJU B;  1OXK A;  1LE4 A;  2G3V A;  2J0W A;  3HNJ A;  4D4X A;  4OIP F;  3H65 A;  3EFO B;  1UX4 A;  4L6R A;  2BL2 A;  2YQY A;  3B0P A;  1GQA A;  4WGZ A;  3EGD B;  2HSB A;  2LD6 A;  4MVZ A;  4DJ9 A;  3DM5 A;  4K0D A;  1OW7 A;  2DGJ A;  3TK0 A;  4JZA A;  1H9G A;  2EPL X;  1DUB A;  2C04 A;  2OCC C;  3MLG A;  1RMV A;  4YT5 A;  5BUO A;  2G3K A;  4EKW A;  3AG3 C;  4JOT A;  3H02 A;  2HW5 A;  3B71 A;  2OQM A;  3AM1 A;  1VYK A;  4LLE A;  1WZ8 A;  3EJN A;  1S05 A;  2KC3 A;  2GDC A;  5DS4 A;  2GA0 A;  1TWC A;  2P63 A;  4WAB A;  3DD7 A;  4JFC A;  3PZK A;  3Q1T A;  4YN0 B;  2GWW A;  4RDA A;  4KNW A;  2LK4 A;  4YK5 A;  3W4Y A;  3QTH A;  1YLM A;  5K0I A;  2IXO A;  4Q4Z F;  2A0B A;  4CX9 A;  2ZXP A;  1NU7 D;  2HMQ A;  3NKE A;  4JC7 A;  3HRX A;  4YL1 A;  2RSE B;  3L1M A;  3RIP A;  4JCS A;  2KJG A;  5A69 A;  4EBK A;  2LQG A;  1Q0K A;  5HV9 A;  1F1M A;  1K05 A;  1XWJ A;  1YAU O;  2HJM A;  4OIQ F;  2DB4 A;  2NSF A;  1G8X A;  3WAQ A;  2HZ8 A;  3HKK A;  3M4C A;  4NTF A;  3T9O A;  2PNO A;  4JE9 A;  2P6V A;  2PBP A;  3M15 A;  3IQ5 A;  3T6B A;  2NUP B;  4NC3 A;  2E87 A;  1D1B A;  3U2L A;  3MBG A;  2IXP A;  4CDA A;  1UFB A;  5A6J A;  5BQG A;  1O87 A;  2RD9 A;  5A6B A;  5AC4 A;  3B9Q A;  1FTS A;  3SLL A;  4LAC B;  3O55 A;  2Q3T A;  2XXA A;  3H2V A;  1RCP A;  2FFH A;  3AJM A;  2CW0 F;  1J8M F;  2YL1 A;  3JRT A;  3X2Q C;  1HMD A;  4D4N A;  3GM3 A;  2Q9B A;  2QNL A;  3ZWI A;  4BG0 A;  3MYB A;  3VM6 A;  1TFK B;  4EWC A;  1EQ1 A;  3H2U A;  3LS0 A;  2EIL C;  2I8B A;  3R9S A;  5DS6 A;  4U9D A;  4NTB A;  3ZTZ A;  1NBB A;  1Q0F A;  4U5C E;  3S90 A;  1UIY A;  3FOO A;  2LP4 A;  1OXB A;  5KYU A;  3J06 A;  4U5G A;  2VB6 A;  2MYS A;  2CGE A;  2UZF A;  1JR8 A;  4F4B A;  4K7B A;  1WN0 A;  4MVQ A;  1Z7Q c;  1YDI A;  1V55 C;  1I5N A;  3GEH A;  2VRE A;  2L6F A;  2J9W A;  1M56 C;  3JYY A;  2CNW A;  3TD7 A;  1PV3 A;  2IBF A;  2XSE A;  1NSG B;  4OLQ A;  5CI9 A;  1QLE C;  2R02 A;  5DQZ A;  3EG9 A;  5B3S C;  3TJ5 A;  3QXI A;  1QKR A;  2ZPA A;  4BJ6 A;  2KSF A;  3IQ6 A;  2B0J A;  3JRM O;  3SWX A;  1FAP B;  3T6J A;  5C9G A;  5L0I A;  3SEO A;  4NQF A;  2R03 A;  2P61 A;  3ZQY A;  5BQI A;  1H7I A;  2Y3D A;  1JOG A;  2H7V C;  3JZ0 A;  3MOY A;  4AK9 A;  3DE9 A;  2YVK A;  2OJQ A;  2Y3H A;  3C18 A;  4IZB A;  1WGW A;  3K1I C;  4DXW A;  1E84 A;  2OU6 A;  1MMN A;  4IGG A;  4CSA C;  3TLF A;  3GM1 A;  1M2V A;  2A0U A;  3HNL A;  1L3P A;  3K1I A;  5E3A A;  4CBE A;  4Z9J A;  1PD0 A;  1EF9 A;  3RSI A;  1LI7 A;  4BJ5 A;  1JMW A;  2ICW G;  3C8G D;  4IAR A;  1BR4 A;  2DYS C;  4P9T A;  2YLI A;  3R2P A;  4XQ1 A;  4DRH B;  5KYN A;  3QXZ A;  1E83 A;  1JAF A;  2G62 A;  3FAJ A;  3NMK A;  3PMR A;  3JTL O;  1QPU A;  4MVM A;  4AX2 A;  4MI2 A;  3V7O A;  1NZY A;  2CYD A;  5AC5 A;  1U6H A;  1CGO A;  3I5Q A;  2L9J A;  4JEA A;  2B0H A;  1OQC A;  5GPG B;  4U18 A;  3K66 A;  5AGF A;  4OG1 A;  2NSG A;  2WZG A;  4E7S A;  3ADC A;  1I4Y A;  2WVQ A;  3V5X A;  3ZC4 A;  4C3B A;  5JT4 A;  3FMS A;  3I47 A;  3G4Z A;  3DAG A;  1NFN A;  5DS5 A;  5B1B C;  5A6A A;  4BJT A;  1Y4C A;  3QK8 A;  2GTR A;  3V5Y A;  2DUB A;  2QTV A;  2PX3 A;  3ZDL A;  5DVW A;  5L0D A;  3U2M A;  5JUA A;  1ST6 A;  2FW2 A;  3EGX A;  5EHH A;  2I15 A;  2FAP B;  4BEJ A;  4CDV A;  1G5Z A;  4YT8 A;  3SP1 A;  3FDQ A;  3ADD A;  2Q9A A;  4E18 A;  3A11 A;  3FAP B;  4HFF B;  5F5F A;  1JPJ A;  3GAN A;  1T5O A;  2YZS A;  3C8G B;  4I42 A;  1MNE A;  3KYJ A;  3WG7 C;  2ZQQ A;  1ZU4 A;  3LUT B;  1T9K A;  1BR2 A;  1I4Z A;  3AOU A;  4AL1 A;  1Z5Z A;  3JSZ A;  4PK4 A;  4I44 A;  3K6B A;  1YAR O;  4J30 B;  1E85 A;  4PR9 A;  3F47 A;  4LDQ A;  3QW0 A;  4C7O B;  1NLX A;  2ASR A;  3DMD A;  3RYL A;  2BE5 F;  1LVK A;  4XPY A;  3RQE A;  4ER9 A;  3RVY A;  5L0H A;  2BC5 A;  3SXM A;  4MOU A;  1BZ4 A;  3ZTM A;  2H8A A;  1UX5 A;  3FHD A;  2MWQ A;  1FFT C;  1DOW A;  2PFD A;  3E9V A;  3MYI A;  3NYJ A;  2R9R B;  2J9V A;  3RH3 A;  5EK0 A;  4JW1 A;  3DI5 A;  1N1C A;  2CDQ A;  1CPR A;  3EGD A;  3CAX A;  5A6B D;  2R7T A;  1SF8 A;  3VAY A;  1XZP A;  4NEK A;  3DE8 A;  5DQT A;  1A0B A;  3Q0G A;  3L0I A;  3HTK C;  1Z3I X;  1YA9 A;  3K33 A;  4GEH A;  3KL4 A;  1Z63 A;  1HZD A;  2A6H F;  2XS8 A;  2UUI A;  1LE2 A;  5JBX A;  3DM9 B;  4RD9 A;  3RQF A;  4ELW A;  4DOZ A;  4ELS A;  3KQF A;  1ZHZ A;  1KNY A;  2QUP A;  2IEX A;  3AQB A;  2V3C C;  3RKO F;  3JCU Q;  4U5H A;  3C62 A;  1OR3 A;  3EH1 A;  4I4Z A;  1KU2 A;  1M2O A;  1IZM A;  1RXQ A;  4QIJ A;  3EZI A;  1WAS A;  2J9B A;  5FCL A;  4DBQ A;  2QE9 A;  4J7Y A;  1DOV A;  1LI5 A;  4EML A;  2XM0 A;  4LDK A;  4OIO F;  3B0U X;  2W4M A;  2AP3 A;  4I1O B;  4CDY A;  4IWB A;  1E86 A;  3A4L A;  4YT4 A;  4ZLD A;  4E0I A;  4PJM A;  1OCO C;  4BJ1 A;  4DVZ A;  1HY5 A;  2CNW D;  2EIK C;  2XL6 A;  4QI0 A;  2V26 A;  4B6I A;  1EF8 A;  5F5H A;  4Z9I A;  4W8K A;  3SZR A;  5JS5 A;  1Q51 A;  4G0H A;  1NZE A;  3HIN A;  3VYW A;  3W8H A;  3LAY A;  5KYW B;  4EBJ A;  1LS1 A;  1ZU5 A;  4BEM J;  5T1D B;  2HV6 A;  3RW0 A;  2P1A A;  1RJ9 A;  3UR3 C;  4G7Z F;  1PCX A;  2HJ3 A;  2XLM A;  2XXA B;  3U9J A;  4RBN A;  5KYY B;  2NUT B;  2GFH A;  4CIP A;  3HNK A;  2J9U A;  2A69 F;  1ZVZ A;  4LDR A;  2AWY A;  1V4A A;  4YWQ A;  5KYX A;  4P9F A;  1TR2 A;  4MVU A;  3I5P A;  2IXM A;  2DI3 A;  3SYN A;  1W2W A;  3JYH A;  1RJM A;  4G7H F;  3AG2 C;  1A7D A;  2WZL A;  4ZU2 A;  3C7J A;  4YL0 A;  1MMG A;  3BEH A;  4JEB A;  3W8I A;  4GQH A;  1QVX A;  1K04 A;  1AEP A;  1VB5 A;  1ZHT A;  4FZW C;  3AG4 C;  3RVZ A;  2FBM A;  5KYU B;  5CIV A;  3UMI A;  2OEV A;  3O39 A;  1L7C A;  1U89 A;  3N24 A;  3GEE A;  3NYL A;  1H9T A;  3EHN A;  1V54 C;  2QY9 A;  4FZW A;  4XWJ A;  5TJ5 E;  5F28 E;  3S27 A;  4MVR A;  1VTM P;  1YVI A;  2MHR A;  2UUH A;  3HJC A;  4EBB A;  2ETS A;  1LS4 A;  2LFF A;  1T6Q A;  1D0X A;  2VAS A;  1D0Y A;  1EI7 A;  3T89 A;  3ADB A;  1JRA A;  3EG9 B;  2EPM X;  3RQG A;  2TMV P;  4WCZ A;  3IQT A;  5L0G A;  4U1A A;  1ZHX A;  3MYF A;  1OW6 A;  5B1A C;  2KQ9 A;  4WGY A;  3A9C A;  4N4W A;  1QSP A;  3LEO A;  2KGO A;  2A68 F;  3VF0 A;  4YL3 A;  4I1M A;  3B0V C;  1V74 B;  3OWT A;  4JJG A;  3W2W A;  2VH3 A;  4JRZ A;  3AGT A;  1TQG A;  3TOL A;  4X0R A;  2XRH A;  1NG1 A;  3LNM B;  3O10 A;  2JPU A;  3LLI A;  4JIO A;  1LIH A;  5L0J A;  3WOD F;  3H81 A;  3ZQV A;  256B A;  1T6I A;  2YL0 A;  3K7D A;  3UGO A;  4ONS A;  1M6T A;  3MFN A;  2Y39 A;  3CZ6 A;  1D0Z A;  4A2N B;  5L0F A;  4JKV A;  1M2V B;  1PD1 A;  2R7U A;  1JXZ A;  3UNG C;  2M64 A;  2HV7 A;  5D91 A;  1J8Y F;  1KTM A;  2XS1 A;  4U9E A;  4CSA A;  4CJO A;  2XLE A;  2YHS A;  2Y3G A;  3ATP A;  3S84 A;  4R32 A;  4A4A A;  1Q0G A;  4CS7 A;  1CGM E;  3UGP A;  4CIH A;  2OEX A;  1RJN A;  3O4X E;  2J8W A;  1GGQ A;  3IHU A;  1ZHW A;  2R7Q A;  1WAT A;  3R9T A;  3DKA A;  4MQ9 F;  4ZLC A;  4O7G A;  5T3W A;  3TRR A;  2O9X A;  1C02 A;  1NZY B;  4JTC B;  1Z6A A;  4NCQ A;  4NNQ A;  1SMY F;  4OD4 A;  1OCC C;  4YT2 A;  4KBL A;  4DBR A;  3N2Z B;  1O5H A;  3TOM A;  4AE4 A;  4M63 A;  2L6H A;  2R7S A;  4ULW A;  2LIG A;  2LSE A;  4KC9 A;  3E70 C;  4ULV A;  3ABL C;  3KPH A;  2YLG A;  4XEK A;  4EIY A;  3TJ6 A;  4NTA A;  3JSE O;  4HFK B;  1Q0D A;  3NYM A;  1YZC A;  4IZD A;  4XPW A;  3AQC A;  1HE1 A;  4QDL A;  3EGX B;  3UMK A;  2EPN A;  4MND A;  4MTO A;  1MJ3 A;  2Q00 A;  4JUR I;  3V5Z A;  4U5D E;  2IOQ A;  5E2Q A;  1ORY A;  3Q7G A;  3B29 A;  1VMA A;  1YJG A;  2ZXW C;  1OKK A;  2Q4F A;  2VCB A;  3GWN A;  4JCZ A;  5JBW A;  3LES A;  3CSK A;  4IAQ A;  5JLI A;  1TWA A;  3CEX A;  2J0X A;  2XL4 A;  4JTD B;  2YEV A;  1SZI A;  3IEE A;  5BQH A;  1AVO B;  3FXH A;  3C8G A;  3ZSU A;  2J46 A;  1OCR C;  2XLH A;  4PFO A;  4MW8 A;  3TUL A;  3Q6M A;  2Y3B A;  4I3M A;  3T8A A;  2J45 A;  1ZW2 A;  1JPN A;  2XM4 A;  1WOL A;  2R7X A;  3U3F A;  5HSW A;  4JCH A;  4U5E E;  1RKE B;  2R25 A;  2F22 A;  4MTF A;  2YRF A;  1FFH A;  1C17 M;  2LFD A;  3KKB A;  1WWP A;  1BBH A;  3NKD A;  1OW8 A;  2XLW A;  5COG A;  2CCY A;  3EZH A;  2IYL D;  2KYH A;  1GM5 A;  2HS5 A;  2H7O A;  3L8J A;  1S7Z A;  1B68 A;  1ZHY A;  1YA7 O;  1MMD A;  1VLT A;  2IM8 A;  2J7P A;  3FOP A;  2OG2 A;  4BPM A;  3KMI A;  4ANJ A;  3HNI A;  1G4U S;  4XLN F;  2JD3 A;  4MTG A;  3QZC A;  2PPY A;  3M4B A;  3EFO A;  3ECS A;  2YL7 A;  5FZT A;  1TWH A;  2PF4 E;  4AL0 A;  3ABK C;  3GEI A;  1BDJ B;  4XEV A;  1LKX A;  2EIJ C;  3M79 A;  4CJG A;  1RKC A;  4W8P A;  4C3E A;  4GEH B;  1T01 A;  4K1O A;  2VC9 A;  4PJN A;  2D5R B;  3P5M A;  3EPV A;  5COF A;  1OCZ C;  1VOM A;  2XLV A;  4LLC A;  4Z9H A;  4J32 B;  1Y64 B;  3Q0J A;  4OD5 A;  4Q7C A;  4LER A;  3RFY A;  4IZC A;  3IRB A;  3NMJ A;  2AWC A;  2DYR C;  3ZIB A;  4N06 A;  4G7O F;  4QII A;  1FMW A;  2Q7R A;  1APC A;  4N6C A;  3DJN B;  3U8V A;  2OOC A;  4EUK B;  4O6N A;  4KNV A;  1A7E A;  2YWA A;  2R7R A;  2IXN A;  2Q9C A;  1A7V A;  3DAF A;  3MX3 A;  3F46 A;  2A6E F;  3KH2 A;  2FGY A;  4IJJ A;  3ASO C;  1E2X A;  2XLD A;  3N0T A;  2KNH A;  2KW3 C;  1ZZP A;  2W9Y A;  2WB7 A;  4JVS A;  4FX5 A;  4JWV A;  2R7O A;  3W8H B;  1BR1 A;  2JX0 A;  4XTK A;  2ZD9 A;  2GAQ A;  3GM2 A;  1G4W R;  4IB4 A;  1FNT c;  2ZQR A;  1RJ9 B;  1WTY A;  3QVZ A;  3U0C A;  2NUP A;  4CS9 C;  1HE9 A;  4MS2 A;  3ZVR A;  2H7B A;  1IW7 F;  4E17 A;  5KYW A;  5KYX B;  5B3I A;  1LPE A;  1MQV A;  4WJ0 A;  4QI2 A;  2HKV A;  3U8P A;  4CS9 A;  3U3B A;  3L34 A;  5KYY A;  2NUT A;  3TQO A;  5JRA A;  2A1D D;  4ELX A;  4XLP F;  2HUJ A;  4Q5S F;  3DZA A;  2HMZ A;  2PP4 A;  3EHM A;  4FAP B;  3W8I B;  4MW3 A;  2P0N A;  1QZX A;  3C8Z A;  1D1C A;  4IAO A;  4KNP A;  1FR0 A;  3QVY A;  3SNH A;  5L3V A;  1C03 A;  1QQ3 A;  2R7W A;  3W2V A;  2X0C A;  4F47 A;  2OKU A;  4H54 A;  4PAC A;  4UDV A;  1YYX A;  4EHP A;  4XPX A;  3LS1 A;  4J7T A;  3U5S A;  1A41 A;  5EGY A;  3ZG1 A;  3IPM O;  3OC7 A;  4P6I C;  2ZXO A;  1O3U A;  3O6X A;  3G64 A; 
#chains in the Genus database with same CATH homology
 2L6G A;  3GM1 A;  3O10 A;  1UX5 A;  2JPU A;  1OW7 A;  1WOL A;  2L6H A;  1Y64 B;  2PBE A;  3S9O A;  3U3F A;  1QVX A;  3A4M A;  1K04 A;  1K40 A;  4XEK A;  3L8I A;  3C8G D;  3IRB A;  3K7D A;  1WWP A;  3MFN A;  3ADD A;  3B71 A;  1OW8 A;  3AM1 A;  3A4L A;  2L6F A;  1UFB A;  3JYY A;  3W8I B;  1PV3 A;  3L8J A;  3C8G B;  3BRJ A;  1KTM A;  5F28 E;  2Q00 A;  2P63 A;  2KK1 A;  3AJM A;  2YWA A;  3A4N A;  4R32 A;  4NQF A;  3GM3 A;  4EBJ A;  3O4X E;  2LK4 A;  4XEV A;  1JOG A;  3ADB A;  3JZ0 A;  1ZZP A;  3RQF A;  3RQG A;  3ADC A;  4XEF A;  1KNY A;  1OW6 A;  3C18 A;  1V4A A;  3W8H B;  2JX0 A;  4GEH B;  3RQE A;  3C8G A;  4NNQ A;  3GM2 A;  1UX4 A;  4EBK A;  1K05 A;  1RJM A;  3TUL A;  2HSB A;  1O3U A;  1WTY A;  3U0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...