3RQGA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 76
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqgA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqgA02
3U3FA 2Q00A 1V4AA 1ZZPA 2L6FA 1OW8A 2L6GA 3K7DA 2YWAA 3AJMA 3GM1A 4NQFA 2HSBA 3L8IA 2PBEA 3BRJA 3C8GB 3RQFA 1KNYA 3C18A 4XEKA 4XEFA 4GEHB 3MFNA 3C8GA 1WOLA 3C8GD 4XEVA 3L8JA 3GM3A 2JPUA 3B71A 1KTMA 1WWPA 1K40A 2JX0A 2LK4A 3TULA 1OW7A 1O3UA 1UFBA 5F28E 1WTYA 3S9OA 3GM2A 1K05A 1K04A 3U0CA 4EBJA 3RQEA 1JOGA 2KK1A 3W8IB 1QVXA 3W8HB 1OW6A 1PV3A 2L6HA 3JZ0A 3JYYA 3O10A 3RQGA 4EBKA 4R32A
chains in the Genus database with same CATH superfamily
4CDYA 4O7GA 4ELWA 2LSEA 2ZPAA 4QI0A 3R9TA 3L8JA 1QQ3A 1QSPA 1OKKA 3V5XA 3MLGA 3Q7GA 3M15A 2XL4A 1CGOA 1ZU5A 3O6XA 1ST6A 3NKDA 3U9MA 3M79A 2XS8A 4I52A 2PP4A 4CDAA 1SYQA 3M4BA 4JVSA 1LS4A 1V4AA 2WZFA 2XM4A 5T3WA 2P6VA 3U3BA 4KC9A 3U9JA 4DXWA 3IRBA 1Y64B 1ZW3A 1WATA 2GAQA 3H65A 1JAFA 3K33A 4ZLDA 4L6RA 3SXZA 4IAQA 2R7TA 3LEVA 1QVXA 4RBNA 2FGYA 4JJGA 4NC3A 1J8YF 3SLLA 2OOCA 4JZAA 2FBMA 2OG2A 1T6QA 2EJ5A 2J0XA 5KYYA 2LP4A 4OIPF 3TK0A 1D1BA 2R02A 2JD3A 1TWGA 4PR9A 1JPNA 2R7OA 2KK1A 5L0HA 1XZQA 4W8PA 4Z9HA 5BUOA 4MVZA 4JW1A 4NQFA 2L7AA 1J8MF 2OQMA 4G78A 4J32B 1YYJA 1CPRA 1YVIA 4MW8A 5DQTA 1MQVA 3PMRA 2ETSA 4D4XA 5L3VA 4OD4A 3C7JA 1PD0A 3JCUQ 3C8GA 2H7BA 3DJUB 3ABMC 3B0PA 5E3CA 2XSEA 3RSIA 2LD6A 3EHNA 1SZIA 1Q52A 4WGZA 3L8IA 4EUKB 4FZWA 2VASA 2BL2A 3O39A 1NZYA 2IXNA 4PACA 3FDUA 2OEVA 4YT8A 1V54C 4JFCA 1Z5ZA 1RJ9A 1DOVA 3JZ0A 1QLEC 1VYIA 1OXBA 2X0CA 1FMVA 3K7DA 2XS1A 5L0GA 4QDLA 3ADDA 3KYJA 2P63A 2WZLA 2MYSA 3HNLA 4RD9A 1DOWA 1A7VA 3RW0A 2EPNA 1T5OA 4MVMA 3U0CA 1E85A 4CSAA 2XL6A 3EZHA 5E2QA 1BR2A 3HTKC 3GEIA 3SYNA 3L34A 1YZAA 3DMDA 1OCOC 1OW7A 2KNHA 1ZHZA 2A69F 3VF0A 3SZRA 2XLVA 1B68A 4R32A 1YARO 1G8XA 3IQCA 3IPMO 2WZGA 4E0IA 1U89A 1TQGA 2XLMA 4JURI 3TOLA 2Y39A 3EJNA 4D4NA 3U2MA 2BE5F 2HUJA 5TJ5E 3V7OA 2OU6A 1ZHWA 1VLTA 3FAPB 4XQ1A 1JR8A 4OLQA 3ADCA 1OCRC 4OIRF 2HSQA 2R7XA 2R7QA 4YJWA 4C3DA 3K1HA 1EF9A 2LFFA 1Q51A 3R9SA 4KI2A 5CI8A 3AOUA 2Y3DA 1MNEA 4NTAA 1RJ9B 5A6BD 3IHUA 3IEEA 4WGYA 5JBXA 1OW6A 3V5ZA 4LDRA 3BEHA 1EKYA 1V55C 3FOPA 4PJJA 2CNWD 4CX9A 1FFTC 3MFNA 2R05A 4Q7CA 2YQYA 1YDIA 3PZKA 3UGPA 1WASA 4WCZA 4YT2A 4UDVA 2DGJA 3ZTZA 3W8IA 3DWWA 4DBRA 2OEXA 2EIKC 3CSKA 1JXZA 1JPJA 3C18A 3QK8A 3Q6MA 5COFA 4PFOA 3ITFA 1ZVZA 4FJWD 3LNRA 2C03A 3KMIA 5L0DA 2A6HF 3W2WA 3S27A 2IBFA 1OR2A 4U18A 4N4WA 1JRAA 2XXAB 5E3AA 3SWXA 1Z3IX 5DLJA 3L0IA 4KBLA 2W4MA 2H8AA 1K04A 1IZMA 5L0JA 4U1AA 1M6TA 4ULWA 4JIOA 4DRJB 4XTKA 4ELSA 3AG3C 5KYUA 1G4US 3T4RA 2EPMX 3TOMA 4CS7A 2J46A 4DRIB 4U5DE 4NTBA 2ICWG 3EH1A 1I4ZA 1Z63A 3SEOA 2P61A 1ORJA 4CJOA 3UGOA 1N1CA 3ZTMA 2W4BA 1KU2A 1NU7D 4IZDA 3FVYA 3WAQA 1A7DA 1GGQA 3ASOC 3W2VA 1O5HA 2LCHA 2YL0A 2ASRA 3F47A 1OCCC 4K7BA 4XPWA 3AGTA 4MS2A 3ZC4A 3T6BA 2NG1A 3ZQYA 4CIPA 1PV3A 2B0JA 2YVKA 1RKCA 4HEAJ 2P0NA 4CS8C 4E7SA 2KJGA 2IYLD 3R0OA 4DVZA 3TLFA 3JYYA 1WN0A 1A41A 1FFHA 3WODF 2R7VA 5KYWA 3AG4C 1U6HA 5JS5A 2NUPA 3VRCA 3IQTA 2D5RB 5A6BA 1I4YA 1WTYA 3EG9A 4EWCA 3UMIA 1LE4A 2QNLA 3A4NA 3RQGA 3C8ZA 2RD9A 2Q4FA 4LDKA 2CNWA 5KYUB 1YJGA 3EH2A 3K1IA 1Z6AA 3EGXA 2J8WA 4AX2A 4I42A 4H54A 3UMKA 1O3UA 5L0IA 1TR2A 2ZXPA 3GEHA 3U3FA 2Q00A 3W8HA 5KJPA 1HMDA 3T89A 3ASNC 4AE4B 2KC3A 3PCVA 2OJED 2EPKX 4MW3A 4J7YA 1FAPB 1W2WA 2WB7A 3C62A 2QTVA 1LM3B 1Q0GA 3NYLA 2R03A 1H6GA 2IOQA 3QVYA 2IXOA 2QLAA 2LK4A 5AC5A 2FW2A 1NG1A 1EA8A 3G64A 4I1MA 1M2OA 5B1AC 1HE1A 2Y3GA 2R7SA 1TWAA 1VYKA 2HV6A 1QPUA 4U9EA 3RVYA 4GEHA 2TMVP 4NNQA 3JSZA 5FCLA 3PHF2 1Q0KA 4MNDA 2KGOA 3C63A 2VC9A 3LAYA 1LS1A 3LLIA 1HMOA 1Q0DA 4E17A 2A0UA 2NUPB 3HLZA 1CPQA 2OKUA 4EHPA 1FNTc 2NSFA 4U9DA 2IM8A 3A9CA 4JRZA 3QVZA 2PPYA 4LACB 3GM1A 3QW0A 4GQHA 1OXKA 3EGXB 3V5YA 4AL1A 2B0HA 3LJBA 1D0ZA 2E87A 3JYHA 4I1OB 3W8HB 1A7EA 5JBWA 4JCHA 3EGDA 2C04A 1Z7Qc 2XLDA 4MQ9F 1TFOB 3ZQVA 1C02A 4XEVA 4MVOA 4U5GA 5A6KA 3IQ6A 3B0UX 1IW7F 3H2VA 1F1MA 2ZXRA 4BJ1A 5EHHA 2PF4E 4E0HA 3U2LA 1LVKA 4BEJA 4OIQF 4EKWA 4CS9A 1OR3A 2F6QA 1LE2A 3CZ6A 2GDCA 1Q0MA 1M2VA 4JYLA 4HFFB 3FDQA 3T6GB 1L7CA 2YL3A 3QTHA 3EZIA 4PFPA 4OINF 1MMNA 5B3IA 3MYBA 4E18A 3RQFA 4B6IA 3HRXA 2A0BA 4ELXA 3TQOA 1Y4CA 1UIYA 1H9TA 2VCAA 4JE9A 5KYYB 2Q7RA 3JT1A 1NLXA 1NU9C 2HFIA 3FXHA 3ZDLA 1UX4A 4FZWC 3NMKA 2YEVA 2G62A 3LNMB 4CDVA 3IQ5A 1YA7O 3B29A 2PNOA 2V3CC 3AGUA 3SNHA 3TD7A 2Q9AA 4IGGA 4FWVA 4NY3A 2CW0F 4BJ5A 4JCSA 3E70C 4IZBA 2VREA 3DXJF 1GQAA 5JSLA 3S0XA 3ZIBA 4CSAC 5JVEA 3R2PA 4JJFA 3EGDB 2VCCA 2GA0A 5D92A 3C8GB 4RDAA 1GS9A 3FHDA 2XM0A 3DJNB 1A0BA 1E86A 1WGWA 1JOGA 4W8KA 3HINA 3S29A 4BJ5C 3X1OA 1QZXA 4JTCB 1V74B 4O6YA 3SP1A 5L3QA 1NZYB 2Z15A 2J9VA 4MTOA 2OJQA 3NG1A 4LLCA 2WVQA 4YT4A 4CBEA 3M1CB 2FAPB 1UG7A 2W45A 1RXQA 5BQHA 4JEAA 4IB4A 3KQFA 3SXMA 5FZTA 2UUHA 4KNPA 4CJGA 2P1AA 3I5PA 1RCPA 3ABLC 2JX0A 2XLWA 4I3MA 5T1DB 4ONSA 4Z9JA 3RIPA 4F4BA 1VOMA 4E7ZA 2CYDA 3A11A 1ZZPA 4O6NA 2PX3A 2CCYA 4YL3A 2QY9A 3DM5A 1T9KA 5COGA 2UUIA 3DE9A 4ZU2A 3NKEA 1C17M 1ZU4A 1EI7A 2X51A 4EBJA 4QI2A 3LS1A 3I4UA 3DZAA 3POVA 3H2UA 2Y3HA 3RKOF 5CI9A 4XPYA 4JEBA 1Y6DA 4U5FE 4P9TA 3EHMA 2NUTA 1YZCA 4OG1A 2XLOA 4DJ9A 3AQBA 1Z23A 2HMZA 2HS5A 4YL1A 3O10A 3OEOA 2VX2A 1QKRA 2G3KA 5DS4A 4MVUA 4O79A 3DM9B 1I5NA 2LFDA 3FMSA 4XPXA 2JPUA 2CDQA 1RJNA 3MOYA 2XLEA 3RH3A 4BEMJ 4WABA 5JLIA 2YLIA 1ZW2A 4KNVA 4U5HA 4DVYP 2J45A 2EIJC 3R7CA 2H7VC 1XZPA 5L0CA 4IZCA 3T6JA 1H9GA 3PDMP 4YT5A 2DI3A 5KYXA 1YA9A 3AG2C 5F5HA 4DOZA 3Q0GA 1ZYRF 4HE8D 4JCZA 5JP7A 1VB5A 1UX5A 3NMIA 3Q1TA 1ZHTA 2M64A 4QIJA 1ZHYA 4H4KC 4ULVA 3VM6A 1D1CA 3W8IB 3G50A 3CEXA 3RF3A 4U5EE 5JT4A 4MI2A 2WVNA 2YL7A 1KNYA 2AVKA 4JKVA 3S28A 3GM3A 1E84A 3OA1A 2MWQA 4YL0A 4MVSA 2QE9A 2AU5A 5DVWA 1T01A 3S90A 3ABKC 3TRRA 3LEOA 3ECSA 2HKVA 2HJMA 1BBHA 3M4CA 4O6MA 4G7HF 3GWLA 4G7OF 4JOTA 1O87A 3VAYA 3KH2A 2J9BA 4U5BE 3QW1A 2L6GA 2J7PD 3VYWA 1VK5A 2XLHA 3J06A 4BJ6A 1WWPA 2HMQA 1K05A 1WZ8A 5D91A 1MMDA 4MTFA 3GODA 3LUTB 2A68F 5COMA 3GANA 3RFYA 1T6UA 4GYTA 3K6BA 5DQZA 3NDBB 5A69A 4JTDB 2A1DD 2EINC 2I8BA 1BR1A 3TJ6A 4F47A 5KYXB 1RMVA 4LERA 1EF8A 2NSGA 4NEKA 1YYXA 3FAJA 1HY5A 4OIOF 1AUEA 4CIHA 4BJ6C 3K1IC 3Q6NA 3MX3A 1E2XA 4KNWA 3AG1C 1RKEA 2EIMC 2Q9BA 1HZDA 4G0HA 2VCBA 1TWHA 3U8VA 3US6A 4J7TA 3EQLF 1H7IA 2VB6A 1SR2A 2PFDA 2UZFA 3N2ZB 2AWYA 3CQZA 4C3BA 4X0RA 2FFHA 2L9JA 1LKXA 3T88A 1BDJB 3CAXA 2DYRC 2Q3TA 4I4ZA 3N24A 3EPVA 5DS5A 3JSEO 2DYSC 2HW5A 5EK0A 2L81A 2YWAA 1OQCA 4NCQA 4C3EA 3G4ZA 5KYWB 4EMLA 4ANJA 2YLGA 3I47A 1RJMA 3RVZA 3EG9B 5HSWA 3TULA 4A2NB 1AEPA 3NRHA 5T3TA 3G4XA 2AWCA 5B3SC 4C7OA 3F46A 3KPHA 4IARA 1NFNA 4OD5A 2I15A 5B1BC 3AM1A 3A4LA 2R7WA 1FMWA 1SMYF 1S05A 2YKZA 4HFKB 3S9OA 2DUBA 2F22A 3O4XE 2CGEA 2L6HA 3TJ5A 3E9VA 2L6FA 3LS0A 1APCA 4N6CA 2EPOA 3DAFA 4JWVA 3ADBA 1LI5A 1OCZC 5DS6A 3GEEA 3ZG1A 3UMHA 5GPGB 3U5SA 1TKNA 3JTLO 2R7RA 1D0YA 1FR0A 4AL0A 2W9YA 3HKKA 1RKEB 2GFHA 3DKAA 4PJMA 3NYJA 4N06A 3SXYA 1MJ3A 3HJCA 2J7PA 4LDQA 2PBEA 5F5FA 2KW3C 2PBPA 2RSEB 4GEHB 3HNIA 3OC7A 3ZVRA 2G3VA 1DUBA 4JTAB 5F28E 2R9RB 3QXIA 4WJ0A 3KL4A 2P7VA 4I44A 3RYLA 4CS9C 1LIHA 4Z9IA 2VH3A 2J0WA 4FX5A 3DAGA 4XLPF 4IAOA 2J9UA 1D1AA 3DE8A 1G5ZA 4BJTA 1VLSA 5BQGA 4C7OB 1C03A 3RQEA 5CIVA 5EGYA 2M4EA 3WG7C 4P6IC 1S7ZA 2MHRA 4MVRA 4XEFA 4YK5A 3UNGC 1MMGA 3QMKA 2IEXA 1KTMA 1DCIA 3Q0JA 1BR4A 3NYMA 2KQ9A 1NZEA 3JRTA 3U8PA 2XRHA 2QUPA 3HNJA 2QQ3A 4YN0B 4LLEA 2HV7A 4BPMA 2XL8A 2ZXOA 3QZCA 2XXAA 1K40A 3T8AA 3KYIA 1GM5A 4PJLA 3QXZA 1HW2A 3B9QA 3NMJA 2V26A 4ZLCA 3FOOA 5L0FA 1M2VB 3T9OA 4PK4A 4A4AA 4FESA 4Q5SF 1BZ4A 3JRMO 1HE9A 4N6HA 1R4TA 4JC7A 1D0XA 3MYIA 1VTMP 2LIGA 2YLDA 3DD7A 2GTRA 3SXKA 2HSBA 3BRJA 4EIYA 4XLNF 2HZ8A 1G4WR 4U5CE 2GWWA 1EY3A 4XWJA 1XWJA 2BC5A 1U0BB 4J30B 4MVQA 3K66A 5A6AA 2O9XA 2YHSA 1OKKD 2OCCC 1UFBA 1TWCA 1LPEA 4K1OA 4K0DA 3GORA 2AP3A 4XEKA 3KKBA 2WL8A 1WOLA 1ORSC 3ZWIA 2PX0A 4FAPB 4PJNA 2IXMA 2EILC 2R25A 3HNKA 2R7UA 3EFOA 4EBKA 4MOUA 4M63A 3Q7LA 1VMAA 4MTGA 4NTFA 1MNDA 2J9WA 2ZQRA 2ZXWC 5AC4A 2KSFA 1TFKB 2ZQQA 3B71A 1T6IA 5BQIA 3MBGA 3AQCA 3L1MA 3MYFA 3LLKA 2ZD9A 4G7ZF 3P5MA 4U19A 3O55A 1NSGB 3ZSUA 3A4MA 2YL1A 1LI7A 4K2NA 5KYNA 4YWQA 5AGFA 3S84A 4K3WA 3GM2A 2HJ3A 4Q4ZF 3I5QA 2Q9CA 1SF8A 4DRHB 2IXPA 1CGME 3LESA 4QIIA 4AE4A 1YAUO 4CS8A 3B0VC 1FTSA 4BG0A 1HW1A 1Q0FA 2DB4A 1OW8A 1CGNA 3H02A 3N0TA 5C9GA 256BA 2WVOA 4EBBA 1YLMA 2A6EF 2Y3BA 1ZHXA 4IRUA 5E33A 1AVOB 4ER9A 4DBQA 1PD1A 3GWNA 1ORYA 5K0IA 3AJMA 5JUAA 3OWTA 2NUTB 1M56C 3UR3C 1E83A 4AK9A 3C8GD 2D4UA 2KYHA 2NPUA 2H7OA 3X2QC 3EFOB 1EQ1A 2YRFA 1JMWA 3ATPA 4IJJA 2EPLX 4P9FA 3W4YA 1L3PA 1MMAA 5IY5C 5HV9A 1M57C 1NFOA 1R5ID 3WHNA 3H81A 5JRAA 3DI5A 1PCXA 1NBBA 4IWBA 2YZSA 2Y69C 2LQGA 5A6JA
chains in the Genus database with same CATH topology
2L6FA 3K7DA 3ADDA 3C8GB 1KNYA 4XEFA 2P63A 3ADBA 3L8JA 3GM3A 1KTMA 4NNQA 1UFBA 1WTYA 3U0CA 2KK1A 1JOGA 1OW6A 3O10A 3A4NA 3RQGA 1OW8A 4NQFA 3RQFA 4XEKA 3MFNA 1WOLA 2JPUA 1K40A 1OW7A 1O3UA 4EBKA 4R32A 3U3FA 2Q00A 1V4AA 2L6GA 1UX4A 2YWAA 3AJMA 3GM1A 2PBEA 3C18A 3IRBA 4GEHB 3C8GA 3C8GD 1Y64B 3B71A 1RJMA 1WWPA 2JX0A 3TULA 5F28E 1K05A 1QVXA 3W8HB 1PV3A 1ZZPA 2HSBA 3L8IA 3BRJA 3AM1A 3A4LA 3A4MA 4XEVA 1UX5A 3ADCA 2LK4A 3S9OA 3GM2A 1K04A 4EBJA 3RQEA 3W8IB 3O4XE 2L6HA 3JZ0A 3JYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3F A;  2Q00 A;  1V4A A;  1ZZP A;  2L6F A;  1OW8 A;  2L6G A;  3K7D A;  2YWA A;  3AJM A;  3GM1 A;  4NQF A;  2HSB A;  3L8I A;  2PBE A;  3BRJ A;  3C8G B;  3RQF A;  1KNY A;  3C18 A;  4XEK A;  4XEF A;  4GEH B;  3MFN A;  3C8G A;  1WOL A;  3C8G D;  4XEV A;  3L8J A;  3GM3 A;  2JPU A;  3B71 A;  1KTM A;  1WWP A;  1K40 A;  2JX0 A;  2LK4 A;  3TUL A;  1OW7 A;  1O3U A;  1UFB A;  5F28 E;  1WTY A;  3S9O A;  3GM2 A;  1K05 A;  1K04 A;  3U0C A;  4EBJ A;  3RQE A;  1JOG A;  2KK1 A;  3W8I B;  1QVX A;  3W8H B;  1OW6 A;  1PV3 A;  2L6H A;  3JZ0 A;  3JYY A;  3O10 A;  3RQG A;  4EBK A;  4R32 A; 
#chains in the Genus database with same CATH topology
 4CDY A;  4O7G A;  4ELW A;  2LSE A;  2ZPA A;  4QI0 A;  3R9T A;  3L8J A;  1QQ3 A;  1QSP A;  1OKK A;  3V5X A;  3MLG A;  3Q7G A;  3M15 A;  2XL4 A;  1CGO A;  1ZU5 A;  3O6X A;  1ST6 A;  3NKD A;  3U9M A;  3M79 A;  2XS8 A;  4I52 A;  2PP4 A;  4CDA A;  1SYQ A;  3M4B A;  4JVS A;  1LS4 A;  1V4A A;  2WZF A;  2XM4 A;  5T3W A;  2P6V A;  3U3B A;  4KC9 A;  3U9J A;  4DXW A;  3IRB A;  1Y64 B;  1ZW3 A;  1WAT A;  2GAQ A;  3H65 A;  1JAF A;  3K33 A;  4ZLD A;  4L6R A;  3SXZ A;  4IAQ A;  2R7T A;  3LEV A;  1QVX A;  4RBN A;  2FGY A;  4JJG A;  4NC3 A;  1J8Y F;  3SLL A;  2OOC A;  4JZA A;  2FBM A;  2OG2 A;  1T6Q A;  2EJ5 A;  2J0X A;  5KYY A;  2LP4 A;  4OIP F;  3TK0 A;  1D1B A;  2R02 A;  2JD3 A;  1TWG A;  4PR9 A;  1JPN A;  2R7O A;  2KK1 A;  5L0H A;  1XZQ A;  4W8P A;  4Z9H A;  5BUO A;  4MVZ A;  4JW1 A;  4NQF A;  2L7A A;  1J8M F;  2OQM A;  4G78 A;  4J32 B;  1YYJ A;  1CPR A;  1YVI A;  4MW8 A;  5DQT A;  1MQV A;  3PMR A;  2ETS A;  4D4X A;  5L3V A;  4OD4 A;  3C7J A;  1PD0 A;  3JCU Q;  3C8G A;  2H7B A;  3DJU B;  3ABM C;  3B0P A;  5E3C A;  2XSE A;  3RSI A;  2LD6 A;  3EHN A;  1SZI A;  1Q52 A;  4WGZ A;  3L8I A;  4EUK B;  4FZW A;  2VAS A;  2BL2 A;  3O39 A;  1NZY A;  2IXN A;  4PAC A;  3FDU A;  2OEV A;  4YT8 A;  1V54 C;  4JFC A;  1Z5Z A;  1RJ9 A;  1DOV A;  3JZ0 A;  1QLE C;  1VYI A;  1OXB A;  2X0C A;  1FMV A;  3K7D A;  2XS1 A;  5L0G A;  4QDL A;  3ADD A;  3KYJ A;  2P63 A;  2WZL A;  2MYS A;  3HNL A;  4RD9 A;  1DOW A;  1A7V A;  3RW0 A;  2EPN A;  1T5O A;  4MVM A;  3U0C A;  1E85 A;  4CSA A;  2XL6 A;  3EZH A;  5E2Q A;  1BR2 A;  3HTK C;  3GEI A;  3SYN A;  3L34 A;  1YZA A;  3DMD A;  1OCO C;  1OW7 A;  2KNH A;  1ZHZ A;  2A69 F;  3VF0 A;  3SZR A;  2XLV A;  1B68 A;  4R32 A;  1YAR O;  1G8X A;  3IQC A;  3IPM O;  2WZG A;  4E0I A;  1U89 A;  1TQG A;  2XLM A;  4JUR I;  3TOL A;  2Y39 A;  3EJN A;  4D4N A;  3U2M A;  2BE5 F;  2HUJ A;  5TJ5 E;  3V7O A;  2OU6 A;  1ZHW A;  1VLT A;  3FAP B;  4XQ1 A;  1JR8 A;  4OLQ A;  3ADC A;  1OCR C;  4OIR F;  2HSQ A;  2R7X A;  2R7Q A;  4YJW A;  4C3D A;  3K1H A;  1EF9 A;  2LFF A;  1Q51 A;  3R9S A;  4KI2 A;  5CI8 A;  3AOU A;  2Y3D A;  1MNE A;  4NTA A;  1RJ9 B;  5A6B D;  3IHU A;  3IEE A;  4WGY A;  5JBX A;  1OW6 A;  3V5Z A;  4LDR A;  3BEH A;  1EKY A;  1V55 C;  3FOP A;  4PJJ A;  2CNW D;  4CX9 A;  1FFT C;  3MFN A;  2R05 A;  4Q7C A;  2YQY A;  1YDI A;  3PZK A;  3UGP A;  1WAS A;  4WCZ A;  4YT2 A;  4UDV A;  2DGJ A;  3ZTZ A;  3W8I A;  3DWW A;  4DBR A;  2OEX A;  2EIK C;  3CSK A;  1JXZ A;  1JPJ A;  3C18 A;  3QK8 A;  3Q6M A;  5COF A;  4PFO A;  3ITF A;  1ZVZ A;  4FJW D;  3LNR A;  2C03 A;  3KMI A;  5L0D A;  2A6H F;  3W2W A;  3S27 A;  2IBF A;  1OR2 A;  4U18 A;  4N4W A;  1JRA A;  2XXA B;  5E3A A;  3SWX A;  1Z3I X;  5DLJ A;  3L0I A;  4KBL A;  2W4M A;  2H8A A;  1K04 A;  1IZM A;  5L0J A;  4U1A A;  1M6T A;  4ULW A;  4JIO A;  4DRJ B;  4XTK A;  4ELS A;  3AG3 C;  5KYU A;  1G4U S;  3T4R A;  2EPM X;  3TOM A;  4CS7 A;  2J46 A;  4DRI B;  4U5D E;  4NTB A;  2ICW G;  3EH1 A;  1I4Z A;  1Z63 A;  3SEO A;  2P61 A;  1ORJ A;  4CJO A;  3UGO A;  1N1C A;  3ZTM A;  2W4B A;  1KU2 A;  1NU7 D;  4IZD A;  3FVY A;  3WAQ A;  1A7D A;  1GGQ A;  3ASO C;  3W2V A;  1O5H A;  2LCH A;  2YL0 A;  2ASR A;  3F47 A;  1OCC C;  4K7B A;  4XPW A;  3AGT A;  4MS2 A;  3ZC4 A;  3T6B A;  2NG1 A;  3ZQY A;  4CIP A;  1PV3 A;  2B0J A;  2YVK A;  1RKC A;  4HEA J;  2P0N A;  4CS8 C;  4E7S A;  2KJG A;  2IYL D;  3R0O A;  4DVZ A;  3TLF A;  3JYY A;  1WN0 A;  1A41 A;  1FFH A;  3WOD F;  2R7V A;  5KYW A;  3AG4 C;  1U6H A;  5JS5 A;  2NUP A;  3VRC A;  3IQT A;  2D5R B;  5A6B A;  1I4Y A;  1WTY A;  3EG9 A;  4EWC A;  3UMI A;  1LE4 A;  2QNL A;  3A4N A;  3RQG A;  3C8Z A;  2RD9 A;  2Q4F A;  4LDK A;  2CNW A;  5KYU B;  1YJG A;  3EH2 A;  3K1I A;  1Z6A A;  3EGX A;  2J8W A;  4AX2 A;  4I42 A;  4H54 A;  3UMK A;  1O3U A;  5L0I A;  1TR2 A;  2ZXP A;  3GEH A;  3U3F A;  2Q00 A;  3W8H A;  5KJP A;  1HMD A;  3T89 A;  3ASN C;  4AE4 B;  2KC3 A;  3PCV A;  2OJE D;  2EPK X;  4MW3 A;  4J7Y A;  1FAP B;  1W2W A;  2WB7 A;  3C62 A;  2QTV A;  1LM3 B;  1Q0G A;  3NYL A;  2R03 A;  1H6G A;  2IOQ A;  3QVY A;  2IXO A;  2QLA A;  2LK4 A;  5AC5 A;  2FW2 A;  1NG1 A;  1EA8 A;  3G64 A;  4I1M A;  1M2O A;  5B1A C;  1HE1 A;  2Y3G A;  2R7S A;  1TWA A;  1VYK A;  2HV6 A;  1QPU A;  4U9E A;  3RVY A;  4GEH A;  2TMV P;  4NNQ A;  3JSZ A;  5FCL A;  3PHF 2;  1Q0K A;  4MND A;  2KGO A;  3C63 A;  2VC9 A;  3LAY A;  1LS1 A;  3LLI A;  1HMO A;  1Q0D A;  4E17 A;  2A0U A;  2NUP B;  3HLZ A;  1CPQ A;  2OKU A;  4EHP A;  1FNT c;  2NSF A;  4U9D A;  2IM8 A;  3A9C A;  4JRZ A;  3QVZ A;  2PPY A;  4LAC B;  3GM1 A;  3QW0 A;  4GQH A;  1OXK A;  3EGX B;  3V5Y A;  4AL1 A;  2B0H A;  3LJB A;  1D0Z A;  2E87 A;  3JYH A;  4I1O B;  3W8H B;  1A7E A;  5JBW A;  4JCH A;  3EGD A;  2C04 A;  1Z7Q c;  2XLD A;  4MQ9 F;  1TFO B;  3ZQV A;  1C02 A;  4XEV A;  4MVO A;  4U5G A;  5A6K A;  3IQ6 A;  3B0U X;  1IW7 F;  3H2V A;  1F1M A;  2ZXR A;  4BJ1 A;  5EHH A;  2PF4 E;  4E0H A;  3U2L A;  1LVK A;  4BEJ A;  4OIQ F;  4EKW A;  4CS9 A;  1OR3 A;  2F6Q A;  1LE2 A;  3CZ6 A;  2GDC A;  1Q0M A;  1M2V A;  4JYL A;  4HFF B;  3FDQ A;  3T6G B;  1L7C A;  2YL3 A;  3QTH A;  3EZI A;  4PFP A;  4OIN F;  1MMN A;  5B3I A;  3MYB A;  4E18 A;  3RQF A;  4B6I A;  3HRX A;  2A0B A;  4ELX A;  3TQO A;  1Y4C A;  1UIY A;  1H9T A;  2VCA A;  4JE9 A;  5KYY B;  2Q7R A;  3JT1 A;  1NLX A;  1NU9 C;  2HFI A;  3FXH A;  3ZDL A;  1UX4 A;  4FZW C;  3NMK A;  2YEV A;  2G62 A;  3LNM B;  4CDV A;  3IQ5 A;  1YA7 O;  3B29 A;  2PNO A;  2V3C C;  3AGU A;  3SNH A;  3TD7 A;  2Q9A A;  4IGG A;  4FWV A;  4NY3 A;  2CW0 F;  4BJ5 A;  4JCS A;  3E70 C;  4IZB A;  2VRE A;  3DXJ F;  1GQA A;  5JSL A;  3S0X A;  3ZIB A;  4CSA C;  5JVE A;  3R2P A;  4JJF A;  3EGD B;  2VCC A;  2GA0 A;  5D92 A;  3C8G B;  4RDA A;  1GS9 A;  3FHD A;  2XM0 A;  3DJN B;  1A0B A;  1E86 A;  1WGW A;  1JOG A;  4W8K A;  3HIN A;  3S29 A;  4BJ5 C;  3X1O A;  1QZX A;  4JTC B;  1V74 B;  4O6Y A;  3SP1 A;  5L3Q A;  1NZY B;  2Z15 A;  2J9V A;  4MTO A;  2OJQ A;  3NG1 A;  4LLC A;  2WVQ A;  4YT4 A;  4CBE A;  3M1C B;  2FAP B;  1UG7 A;  2W45 A;  1RXQ A;  5BQH A;  4JEA A;  4IB4 A;  3KQF A;  3SXM A;  5FZT A;  2UUH A;  4KNP A;  4CJG A;  2P1A A;  3I5P A;  1RCP A;  3ABL C;  2JX0 A;  2XLW A;  4I3M A;  5T1D B;  4ONS A;  4Z9J A;  3RIP A;  4F4B A;  1VOM A;  4E7Z A;  2CYD A;  3A11 A;  1ZZP A;  4O6N A;  2PX3 A;  2CCY A;  4YL3 A;  2QY9 A;  3DM5 A;  1T9K A;  5COG A;  2UUI A;  3DE9 A;  4ZU2 A;  3NKE A;  1C17 M;  1ZU4 A;  1EI7 A;  2X51 A;  4EBJ A;  4QI2 A;  3LS1 A;  3I4U A;  3DZA A;  3POV A;  3H2U A;  2Y3H A;  3RKO F;  5CI9 A;  4XPY A;  4JEB A;  1Y6D A;  4U5F E;  4P9T A;  3EHM A;  2NUT A;  1YZC A;  4OG1 A;  2XLO A;  4DJ9 A;  3AQB A;  1Z23 A;  2HMZ A;  2HS5 A;  4YL1 A;  3O10 A;  3OEO A;  2VX2 A;  1QKR A;  2G3K A;  5DS4 A;  4MVU A;  4O79 A;  3DM9 B;  1I5N A;  2LFD A;  3FMS A;  4XPX A;  2JPU A;  2CDQ A;  1RJN A;  3MOY A;  2XLE A;  3RH3 A;  4BEM J;  4WAB A;  5JLI A;  2YLI A;  1ZW2 A;  4KNV A;  4U5H A;  4DVY P;  2J45 A;  2EIJ C;  3R7C A;  2H7V C;  1XZP A;  5L0C A;  4IZC A;  3T6J A;  1H9G A;  3PDM P;  4YT5 A;  2DI3 A;  5KYX A;  1YA9 A;  3AG2 C;  5F5H A;  4DOZ A;  3Q0G A;  1ZYR F;  4HE8 D;  4JCZ A;  5JP7 A;  1VB5 A;  1UX5 A;  3NMI A;  3Q1T A;  1ZHT A;  2M64 A;  4QIJ A;  1ZHY A;  4H4K C;  4ULV A;  3VM6 A;  1D1C A;  3W8I B;  3G50 A;  3CEX A;  3RF3 A;  4U5E E;  5JT4 A;  4MI2 A;  2WVN A;  2YL7 A;  1KNY A;  2AVK A;  4JKV A;  3S28 A;  3GM3 A;  1E84 A;  3OA1 A;  2MWQ A;  4YL0 A;  4MVS A;  2QE9 A;  2AU5 A;  5DVW A;  1T01 A;  3S90 A;  3ABK C;  3TRR A;  3LEO A;  3ECS A;  2HKV A;  2HJM A;  1BBH A;  3M4C A;  4O6M A;  4G7H F;  3GWL A;  4G7O F;  4JOT A;  1O87 A;  3VAY A;  3KH2 A;  2J9B A;  4U5B E;  3QW1 A;  2L6G A;  2J7P D;  3VYW A;  1VK5 A;  2XLH A;  3J06 A;  4BJ6 A;  1WWP A;  2HMQ A;  1K05 A;  1WZ8 A;  5D91 A;  1MMD A;  4MTF A;  3GOD A;  3LUT B;  2A68 F;  5COM A;  3GAN A;  3RFY A;  1T6U A;  4GYT A;  3K6B A;  5DQZ A;  3NDB B;  5A69 A;  4JTD B;  2A1D D;  2EIN C;  2I8B A;  1BR1 A;  3TJ6 A;  4F47 A;  5KYX B;  1RMV A;  4LER A;  1EF8 A;  2NSG A;  4NEK A;  1YYX A;  3FAJ A;  1HY5 A;  4OIO F;  1AUE A;  4CIH A;  4BJ6 C;  3K1I C;  3Q6N A;  3MX3 A;  1E2X A;  4KNW A;  3AG1 C;  1RKE A;  2EIM C;  2Q9B A;  1HZD A;  4G0H A;  2VCB A;  1TWH A;  3U8V A;  3US6 A;  4J7T A;  3EQL F;  1H7I A;  2VB6 A;  1SR2 A;  2PFD A;  2UZF A;  3N2Z B;  2AWY A;  3CQZ A;  4C3B A;  4X0R A;  2FFH A;  2L9J A;  1LKX A;  3T88 A;  1BDJ B;  3CAX A;  2DYR C;  2Q3T A;  4I4Z A;  3N24 A;  3EPV A;  5DS5 A;  3JSE O;  2DYS C;  2HW5 A;  5EK0 A;  2L81 A;  2YWA A;  1OQC A;  4NCQ A;  4C3E A;  3G4Z A;  5KYW B;  4EML A;  4ANJ A;  2YLG A;  3I47 A;  1RJM A;  3RVZ A;  3EG9 B;  5HSW A;  3TUL A;  4A2N B;  1AEP A;  3NRH A;  5T3T A;  3G4X A;  2AWC A;  5B3S C;  4C7O A;  3F46 A;  3KPH A;  4IAR A;  1NFN A;  4OD5 A;  2I15 A;  5B1B C;  3AM1 A;  3A4L A;  2R7W A;  1FMW A;  1SMY F;  1S05 A;  2YKZ A;  4HFK B;  3S9O A;  2DUB A;  2F22 A;  3O4X E;  2CGE A;  2L6H A;  3TJ5 A;  3E9V A;  2L6F A;  3LS0 A;  1APC A;  4N6C A;  2EPO A;  3DAF A;  4JWV A;  3ADB A;  1LI5 A;  1OCZ C;  5DS6 A;  3GEE A;  3ZG1 A;  3UMH A;  5GPG B;  3U5S A;  1TKN A;  3JTL O;  2R7R A;  1D0Y A;  1FR0 A;  4AL0 A;  2W9Y A;  3HKK A;  1RKE B;  2GFH A;  3DKA A;  4PJM A;  3NYJ A;  4N06 A;  3SXY A;  1MJ3 A;  3HJC A;  2J7P A;  4LDQ A;  2PBE A;  5F5F A;  2KW3 C;  2PBP A;  2RSE B;  4GEH B;  3HNI A;  3OC7 A;  3ZVR A;  2G3V A;  1DUB A;  4JTA B;  5F28 E;  2R9R B;  3QXI A;  4WJ0 A;  3KL4 A;  2P7V A;  4I44 A;  3RYL A;  4CS9 C;  1LIH A;  4Z9I A;  2VH3 A;  2J0W A;  4FX5 A;  3DAG A;  4XLP F;  4IAO A;  2J9U A;  1D1A A;  3DE8 A;  1G5Z A;  4BJT A;  1VLS A;  5BQG A;  4C7O B;  1C03 A;  3RQE A;  5CIV A;  5EGY A;  2M4E A;  3WG7 C;  4P6I C;  1S7Z A;  2MHR A;  4MVR A;  4XEF A;  4YK5 A;  3UNG C;  1MMG A;  3QMK A;  2IEX A;  1KTM A;  1DCI A;  3Q0J A;  1BR4 A;  3NYM A;  2KQ9 A;  1NZE A;  3JRT A;  3U8P A;  2XRH A;  2QUP A;  3HNJ A;  2QQ3 A;  4YN0 B;  4LLE A;  2HV7 A;  4BPM A;  2XL8 A;  2ZXO A;  3QZC A;  2XXA A;  1K40 A;  3T8A A;  3KYI A;  1GM5 A;  4PJL A;  3QXZ A;  1HW2 A;  3B9Q A;  3NMJ A;  2V26 A;  4ZLC A;  3FOO A;  5L0F A;  1M2V B;  3T9O A;  4PK4 A;  4A4A A;  4FES A;  4Q5S F;  1BZ4 A;  3JRM O;  1HE9 A;  4N6H A;  1R4T A;  4JC7 A;  1D0X A;  3MYI A;  1VTM P;  2LIG A;  2YLD A;  3DD7 A;  2GTR A;  3SXK A;  2HSB A;  3BRJ A;  4EIY A;  4XLN F;  2HZ8 A;  1G4W R;  4U5C E;  2GWW A;  1EY3 A;  4XWJ A;  1XWJ A;  2BC5 A;  1U0B B;  4J30 B;  4MVQ A;  3K66 A;  5A6A A;  2O9X A;  2YHS A;  1OKK D;  2OCC C;  1UFB A;  1TWC A;  1LPE A;  4K1O A;  4K0D A;  3GOR A;  2AP3 A;  4XEK A;  3KKB A;  2WL8 A;  1WOL A;  1ORS C;  3ZWI A;  2PX0 A;  4FAP B;  4PJN A;  2IXM A;  2EIL C;  2R25 A;  3HNK A;  2R7U A;  3EFO A;  4EBK A;  4MOU A;  4M63 A;  3Q7L A;  1VMA A;  4MTG A;  4NTF A;  1MND A;  2J9W A;  2ZQR A;  2ZXW C;  5AC4 A;  2KSF A;  1TFK B;  2ZQQ A;  3B71 A;  1T6I A;  5BQI A;  3MBG A;  3AQC A;  3L1M A;  3MYF A;  3LLK A;  2ZD9 A;  4G7Z F;  3P5M A;  4U19 A;  3O55 A;  1NSG B;  3ZSU A;  3A4M A;  2YL1 A;  1LI7 A;  4K2N A;  5KYN A;  4YWQ A;  5AGF A;  3S84 A;  4K3W A;  3GM2 A;  2HJ3 A;  4Q4Z F;  3I5Q A;  2Q9C A;  1SF8 A;  4DRH B;  2IXP A;  1CGM E;  3LES A;  4QII A;  4AE4 A;  1YAU O;  4CS8 A;  3B0V C;  1FTS A;  4BG0 A;  1HW1 A;  1Q0F A;  2DB4 A;  1OW8 A;  1CGN A;  3H02 A;  3N0T A;  5C9G A;  256B A;  2WVO A;  4EBB A;  1YLM A;  2A6E F;  2Y3B A;  1ZHX A;  4IRU A;  5E33 A;  1AVO B;  4ER9 A;  4DBQ A;  1PD1 A;  3GWN A;  1ORY A;  5K0I A;  3AJM A;  5JUA A;  3OWT A;  2NUT B;  1M56 C;  3UR3 C;  1E83 A;  4AK9 A;  3C8G D;  2D4U A;  2KYH A;  2NPU A;  2H7O A;  3X2Q C;  3EFO B;  1EQ1 A;  2YRF A;  1JMW A;  3ATP A;  4IJJ A;  2EPL X;  4P9F A;  3W4Y A;  1L3P A;  1MMA A;  5IY5 C;  5HV9 A;  1M57 C;  1NFO A;  1R5I D;  3WHN A;  3H81 A;  5JRA A;  3DI5 A;  1PCX A;  1NBB A;  4IWB A;  2YZS A;  2Y69 C;  2LQG A;  5A6J A; 
#chains in the Genus database with same CATH homology
 2L6F A;  3K7D A;  3ADD A;  3C8G B;  1KNY A;  4XEF A;  2P63 A;  3ADB A;  3L8J A;  3GM3 A;  1KTM A;  4NNQ A;  1UFB A;  1WTY A;  3U0C A;  2KK1 A;  1JOG A;  1OW6 A;  3O10 A;  3A4N A;  3RQG A;  1OW8 A;  4NQF A;  3RQF A;  4XEK A;  3MFN A;  1WOL A;  2JPU A;  1K40 A;  1OW7 A;  1O3U A;  4EBK A;  4R32 A;  3U3F A;  2Q00 A;  1V4A A;  2L6G A;  1UX4 A;  2YWA A;  3AJM A;  3GM1 A;  2PBE A;  3C18 A;  3IRB A;  4GEH B;  3C8G A;  3C8G D;  1Y64 B;  3B71 A;  1RJM A;  1WWP A;  2JX0 A;  3TUL A;  5F28 E;  1K05 A;  1QVX A;  3W8H B;  1PV3 A;  1ZZP A;  2HSB A;  3L8I A;  3BRJ A;  3AM1 A;  3A4L A;  3A4M A;  4XEV A;  1UX5 A;  3ADC A;  2LK4 A;  3S9O A;  3GM2 A;  1K04 A;  4EBJ A;  3RQE A;  3W8I B;  3O4X E;  2L6H A;  3JZ0 A;  3JYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...