3RQGA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 76
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqgA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqgA02
1OW6A 1K05A 3JZ0A 2Q00A 2HSBA 1ZZPA 3GM2A 3MFNA 3S9OA 1PV3A 2JPUA 2L6FA 1JOGA 3C8GA 2L6GA 3GM3A 1QVXA 3L8IA 3W8HB 2LK4A 4NQFA 1WTYA 3RQFA 4GEHB 3L8JA 1WWPA 3K7DA 1KTMA 1KNYA 1K04A 3B71A 3RQGA 1OW7A 3C18A 3U3FA 3W8IB 1WOLA 3BRJA 3C8GD 5F28E 3TULA 3C8GB 1K40A 1O3UA 4XEVA 2PBEA 3U0CA 4R32A 4XEKA 1UFBA 3GM1A 3JYYA 4EBJA 2KK1A 3RQEA 4EBKA 1OW8A 3O10A 2L6HA 2YWAA 4XEFA 3AJMA 2JX0A 1V4AA
chains in the Genus database with same CATH superfamily
2PBPA 3S90A 5BQGA 3LEOA 1RMVA 4PJJA 1SYQA 3LAYA 2EPOA 256BA 4IAOA 3ATPA 3EH1A 1LS4A 2DI3A 2M64A 2YKZA 1SZIA 3T4RA 2NUPB 4J30B 4NNQA 1VK5A 1VYKA 1VOMA 3K66A 4G0HA 4I1OB 4CS8C 2BC5A 4IGGA 1AVOB 3C8ZA 4JZAA 2R05A 1Z3IX 5KYUA 4MI2A 3H2UA 4NY3A 3OC7A 3QMKA 4BG0A 1T9KA 4M63A 1RJ9A 1OR2A 2B0HA 3L34A 3KMIA 4JJFA 3UMIA 5KYXA 2JX0A 1D0YA 1RJNA 2R9RB 2J0XA 4CS8A 4NEKA 1HY5A 3EGDA 2XM4A 4OIOF 5KYYB 2G3VA 3SYNA 4JKVA 4Q4ZF 1YYJA 3ASOC 3HKKA 3MX3A 1QVXA 2FGYA 3S29A 4PJLA 3U3BA 1AEPA 2OCCC 4MW8A 5L0GA 4JYLA 4YL0A 5HSWA 4HEAJ 4B6IA 3IQ5A 3VAYA 1UX5A 2GWWA 1B68A 1GM5A 2Y3GA 3DE8A 1PD0A 3K1HA 4CS7A 2FW2A 3LS0A 3VRCA 2ZPAA 3QVYA 4I44A 4JRZA 2GTRA 5DLJA 1PCXA 1APCA 2QLAA 3OEOA 3V7OA 2L7AA 1NZEA 5JS5A 2IOQA 4EBJA 2HMZA 2YQYA 4YT8A 1WATA 2L9JA 2BE5F 4MVMA 4U5EE 1T6QA 3HNIA 3V5YA 4CDVA 2RSEB 3QTHA 2UZFA 2Z15A 2XLOA 4JOTA 1UG7A 1Z5ZA 2XRHA 4I4ZA 3RKOF 1TWAA 4NTAA 1TWGA 1PV3A 2AU5A 2JPUA 2KC3A 2EILC 2WVNA 1M57C 4H4KC 2BL2A 4MNDA 4O6MA 4YN0B 3WHNA 5AC5A 3CQZA 4P9TA 1OR3A 1E85A 2WB7A 1S05A 1FTSA 3U5SA 2A0BA 1ZVZA 3ZVRA 1KNYA 4L6RA 2H7BA 1YDIA 3J06A 3SXYA 4DVYP 4G7OF 4CIHA 4JWVA 5KYWB 3V5XA 2J8WA 3NYMA 2DGJA 4ULWA 1O3UA 3L0IA 3K1IC 1LIHA 4R32A 2YLIA 2XL6A 3A4MA 2P61A 1JPJA 3ZWIA 3B0VC 4CSAC 4H54A 4IRUA 2LD6A 5JT4A 3AGTA 1YYXA 3SNHA 4E17A 4AX2A 1HW1A 2ASRA 4QIJA 3Q0GA 4NTFA 1VMAA 1ZU5A 4CDYA 1CGNA 1XZQA 4AE4A 3B9QA 3FHDA 3KQFA 2W4BA 2Q4FA 3I5PA 4F4BA 5A6BA 4J7YA 1M2OA 5FZTA 5B3IA 1QSPA 2LFDA 3O6XA 4NC3A 1CPRA 3QXZA 2QY9A 1I5NA 4XPXA 5B1BC 2HUJA 3H65A 3V5ZA 2KGOA 4I3MA 4UDVA 2ZXWC 2I8BA 4LDRA 4EHPA 4GEHA 1HMOA 1GS9A 1YLMA 3LLKA 3POVA 5T3TA 1LI5A 2R7RA 3E70C 2KW3C 2VCBA 3Q0JA 1SF8A 2XXAB 4ELSA 3AGUA 2XL8A 1ORYA 1TR2A 2WVOA 3ECSA 3LESA 4PFOA 5TJ5E 3S27A 3W2WA 3X2QC 4E0IA 4HFFB 1NFNA 2J46A 3W8HA 3NDBB 5JLIA 3JYYA 3M79A 2CGEA 5JSLA 4EKWA 4JE9A 1ST6A 1OW8A 1VLTA 4JTAB 3S0XA 1BR2A 2YWAA 4U9DA 2FBMA 1NG1A 1T01A 3T8AA 2A0UA 4IARA 2XLEA 4FZWA 1Q0KA 3EJNA 3G4ZA 4BJ1A 5A69A 3Q1TA 1UIYA 2OG2A 1RCPA 1YAUO 3N2ZB 1TFKB 1MMAA 2NG1A 4NTBA 4K7BA 2DYRC 3C7JA 4YL1A 4YJWA 1D0XA 2WZLA 3US6A 2YL7A 2WZFA 3C63A 3CSKA 1CGOA 2AWYA 2GFHA 5EK0A 4WABA 3TRRA 4JW1A 4CX9A 4RBNA 1BBHA 4NCQA 2J45A 2P63A 2CDQA 4N6HA 1C03A 3UGOA 4P6IC 3EZIA 3PHF2 3JTLO 2ICWG 3G4XA 4JURI 1QQ3A 1DOVA 2TMVP 1U0BB 4RD9A 1BDJB 3JSEO 4XTKA 1AUEA 3EFOA 4LERA 3TD7A 1JXZA 1FFTC 4ULVA 1J8YF 1NU7D 1ORJA 1XWJA 1MMGA 3F46A 1ZHTA 3ZG1A 5KYNA 2NSFA 2XS1A 3K6BA 2IXMA 4W8KA 4E0HA 3DJUB 5D91A 2P6VA 1FFHA 2HV7A 2CCYA 3DJNB 1YA7O 1LM3B 1A0BA 3L1MA 2YL1A 3NKEA 5JRAA 2F22A 4CSAA 2AP3A 3QZCA 4DVZA 2VREA 2FFHA 3SXKA 1DUBA 2E87A 2C03A 3QW0A 4GEHB 4PFPA 1EY3A 3G64A 3GEHA 5KYWA 4OIRF 3U9JA 3FAJA 3U9MA 5FCLA 3RVZA 1YARO 1GQAA 1ORSC 1RKEB 2QE9A 2QTVA 1OCCC 3W2VA 3DM5A 3ZDLA 2B0JA 4JEBA 5B3SC 3Q6NA 3DE9A 4KNPA 4OG1A 4DRJB 1EF9A 1MNDA 4BEJA 5BQIA 3M1CB 3U8VA 4O6NA 1E84A 5A6JA 5HV9A 1G8XA 4QI2A 4C3EA 3ZQVA 2EPMX 3KL4A 5L0CA 4XEVA 2R7UA 3ITFA 4XLNF 1M6TA 4EUKB 1DOWA 2H7VC 1OCZC 4CBEA 4Q7CA 2LP4A 3AQBA 3TOMA 3ABKC 5KJPA 4OLQA 3FOPA 1Q0GA 1WTYA 1YZAA 3NMJA 3O39A 2PFDA 3RVYA 3TK0A 4BPMA 4YWQA 4ZLCA 5L0HA 1FAPB 2R7XA 4ZU2A 1VLSA 2OEXA 1G4US 3C18A 2EJ5A 1V54C 2IXPA 1S7ZA 1OCRC 2CNWD 3F47A 4IZCA 1HE1A 2HFIA 3AG3C 1G5ZA 5DS6A 4U5FE 2J9WA 4U1AA 3FOOA 1MMNA 1UX4A 3R0OA 1E2XA 3FAPB 1I4ZA 2KJGA 4ELXA 2LFFA 3MYFA 5B1AC 4BEMJ 2P7VA 4AL1A 2M4EA 4F47A 3M4BA 5AC4A 2J9UA 5EHHA 3KYJA 5IY5C 2WL8A 1JMWA 2PX0A 3KPHA 1ZW2A 1K05A 2Y3HA 3ABLC 4MVUA 1LI7A 2Q00A 5COFA 5T3WA 4ER9A 1YZCA 3ASNC 3LNMB 4FESA 4O7GA 1Z7Qc 4DOZA 5DQTA 3OA1A 3UR3C 3M15A 3DXJF 1NBBA 4ZLDA 4PR9A 2YEVA 2CW0F 5JVEA 4A4AA 4MVQA 3L8JA 2PX3A 3HNKA 4MVOA 4E7ZA 3S84A 2HW5A 4BJ6C 3PDMP 3HRXA 4MTOA 4CDAA 1HW2A 3EHMA 4OINF 3Q7LA 2R7QA 4U5HA 2MYSA 1QZXA 3BRJA 2MWQA 4O79A 4C7OB 1EQ1A 1RJ9B 4N06A 4K2NA 3N0TA 2IYLD 4U9EA 3T6GB 1YVIA 3EGDB 2WVQA 5A6KA 3LS1A 3B0PA 3EHNA 4JTCB 1L7CA 2R7VA 1KU2A 4AL0A 3B29A 1T5OA 1VTMP 3QW1A 4DRIB 2XLHA 4XEFA 4I52A 4PJMA 4XWJA 5COMA 4K3WA 3AJMA 4BJ5A 3HNJA 1JPNA 1LS1A 2G3KA 2R02A 3MOYA 2KQ9A 2XLDA 4I1MA 4U5DE 4Z9IA 2YZSA 1ZZPA 2J9BA 2W9YA 2OU6A 3AQCA 3DMDA 2VX2A 2CNWA 2VCCA 3E9VA 2NUTB 3SXMA 3IRBA 3ZIBA 1M2VA 2OOCA 3HINA 4ANJA 4NQFA 1U89A 4X0RA 3P5MA 1H7IA 2VCAA 1NU9C 3T9OA 3FDQA 3K7DA 5CI9A 2YLGA 3TQOA 4JC7A 2DB4A 3LLIA 2EIKC 4GYTA 1LE4A 1R4TA 1RXQA 4BJ5C 1E86A 1C17M 3KKBA 2ZXOA 3BEHA 1OXKA 2NUPA 2IXOA 3IEEA 1K40A 1NLXA 2HV6A 4G78A 4JCHA 1RJMA 4FAPB 3U0CA 2NPUA 1OCOC 3EQLF 3U2LA 1N1CA 2XLVA 4EBKA 4U18A 4DBQA 5JBXA 1U6HA 3ZTMA 1ZW3A 4CIPA 3N24A 4RDAA 2VASA 3LJBA 2EPKX 4YL3A 3VYWA 3DI5A 3GM3A 3JRMO 4Z9JA 1OW6A 2YHSA 4IB4A 4D4XA 3R2PA 1A41A 1HE9A 2R7WA 5KYXB 3GM2A 3MFNA 2LQGA 4JVSA 2PF4E 3IQTA 2QUPA 3A4NA 2W45A 5KYYA 1NZYB 1Q51A 3WAQA 4OD4A 1TFOB 2IM8A 1VYIA 3O55A 4PACA 3GWNA 1HZDA 1LPEA 3CAXA 1YA9A 5E3AA 5F5HA 2P0NA 4XPWA 4A2NB 3RSIA 1OW7A 4HFKB 1I4YA 4DXWA 1A7EA 3RH3A 1D0ZA 4XPYA 5AGFA 4EBBA 1WN0A 4BJTA 2R7SA 1FMWA 3SLLA 2IBFA 2J7PA 4ELWA 1D1BA 4MVSA 5JP7A 4QI0A 3H81A 2G62A 5CI8A 4YK5A 1PD1A 1WASA 3IPMO 2EPNA 2Y39A 4LACB 1H6GA 4KC9A 4MW3A 3JRTA 2HS5A 4QDLA 1EKYA 3DKAA 4N4WA 5KYUB 4KNWA 3PZKA 1ZHZA 1XZPA 1E83A 1IW7F 3M4CA 5F5FA 2L6FA 3VM6A 2C04A 4MOUA 2KYHA 2WZGA 1W2WA 2IXNA 3ABMC 1H9GA 1HMDA 1FMVA 5L0FA 1LKXA 4WJ0A 3FDUA 3TLFA 2L81A 2UUIA 3GANA 3HTKC 3VF0A 2H8AA 3GEIA 4JEAA 1ZHYA 2OEVA 4DJ9A 3T6JA 2IEXA 3AM1A 1WOLA 1M56C 2OKUA 2A6EF 2J7PD 2YVKA 2ZD9A 2X0CA 1V55C 1Y6DA 4GQHA 3T6BA 3TOLA 3ZQYA 4K1OA 4MS2A 4MTFA 4CJOA 1UFBA 5K0IA 2KK1A 4I42A 4Z9HA 2O9XA 4K0DA 1R5ID 3AOUA 1F1MA 3AG1C 2LSEA 1TWCA 2A6HF 2H7OA 3U8PA 2ZQQA 2X51A 4E7SA 4YT5A 3FXHA 4IZBA 3NRHA 3S28A 5CIVA 3MLGA 5L0JA 3C8GA 1JOGA 4C3DA 1Z23A 1A7DA 1Y64B 2Y3BA 4MQ9F 3L8IA 2LK4A 3DAGA 4CS9A 1DCIA 4FX5A 4D4NA 4MTGA 1K04A 1L3PA 3SP1A 1JAFA 2HSQA 1CGME 3WODF 2OJED 3W8IB 1SR2A 5A6BD 2LCHA 4EIYA 4OD5A 2Q9AA 3JYHA 1OKKD 4XQ1A 4P9FA 5E33A 2YL3A 2I15A 3EGXA 4XEKA 2EIMC 2VB6A 1MQVA 2GDCA 2VC9A 4WGZA 1QKRA 3MYIA 2F6QA 4U5GA 5GPGB 3Q6MA 3SXZA 4EWCA 2LIGA 4U19A 3U2MA 3C62A 2GAQA 3MBGA 1QPUA 3EG9A 4C7OA 2YLDA 3UMHA 3UMKA 5E3CA 3W4YA 3FMSA 1C02A 3K33A 2AWCA 3S9OA 3WG7C 3X1OA 3ZC4A 1EI7A 1RKEA 2Q9BA 2MHRA 3EZHA 1J8MF 3RQFA 4DBRA 4AE4B 2R7OA 3UNGC 4CJGA 1NFOA 2Q7RA 5EGYA 3PCVA 1O5HA 5D92A 4XLPF 4JFCA 2R03A 1BR1A 1TKNA 3JSZA 3NMIA 3ADDA 1T6UA 2KNHA 5COGA 1Q0MA 2XSEA 2V26A 2ZXRA 5L0IA 2XM0A 3GM1A 2V3CC 3LNRA 1A7VA 3DZAA 3CZ6A 3NMKA 2JD3A 2PP4A 4N6CA 4WCZA 2XS8A 3H2VA 3JZ0A 3ADBA 2HSBA 3DAFA 3GODA 3NYLA 2P1AA 2XLMA 1V74B 4JJGA 4U5CE 3RIPA 2L6GA 4AK9A 2EPLX 3ADCA 1MJ3A 3SWXA 2HJ3A 2DYSC 2J0WA 4HE8D 3RYLA 3SEOA 1WWPA 1TWHA 2KSFA 1TQGA 2A1DD 3LUTB 3B71A 3R7CA 1FNTc 1KTMA 2XL4A 4IWBA 4KI2A 1WGWA 1OXBA 2Q9CA 5C9GA 1D1AA 1ZU4A 5F28E 2NUTA 1G4WR 3TJ6A 1EF8A 2QQ3A 2HMQA 1ZHXA 3OWTA 1EA8A 1IZMA 2HZ8A 2YRFA 1MNEA 3JT1A 3NG1A 1NZYA 3QVZA 3RF3A 4LLCA 3K1IA 1VB5A 3LEVA 4KNVA 2D5RB 3RQEA 3TJ5A 4E18A 3O10A 5JUAA 2CYDA 4G7ZF 3EFOB 3AG4C 4O6YA 4KBLA 3R9SA 3IHUA 4LDKA 4PJNA 5L3QA 2A68F 3EG9B 4OIQF 3DD7A 2ETSA 3O4XE 4EMLA 4FJWD 3ZSUA 3QK8A 3QXIA 3GWLA 5DS4A 2PPYA 4W8PA 1FR0A 3A9CA 3GORA 2AVKA 3R9TA 3T89A 2QNLA 5L0DA 3G50A 1Q0DA 2Y69C 5A6AA 3A4LA 1JR8A 2W4MA 4FWVA 4G7HF 3EH2A 3CEXA 4JCSA 5DS5A 1NSGB 2Y3DA 4J7TA 4Q5SF 3I47A 3RW0A 3W8IA 4DRHB 4YT4A 3NYJA 1QLEC 4JTDB 4MVZA 2R7TA 2ZQRA 2Q3TA 3HNLA 4IAQA 1ZYRF 2FAPB 2XLWA 3B0UX 2XXAA 2PBEA 1LE2A 1WZ8A 1GGQA 3EGXB 1BR4A 4U5BE 1ZHWA 4IJJA 4WGYA 3T88A 2EINC 1Z63A 2ZXPA 3AG2C 4BJ6A 4C3BA 2YL0A 3PMRA 1RKCA 2L6HA 4PK4A 3Q7GA 4JCZA 4CS9C 1MMDA 2RD9A 2HKVA 2UUHA 1OKKA 5JBWA 3MYBA 4IZDA 2PNOA 3KH2A 1JRAA 2D4UA 4YT2A 3DWWA 1M2VB 1LVKA 3EPVA 3I5QA 3ZTZA 1D1CA 5L3VA 2OQMA 5BQHA 4J32B 2R25A 2DUBA 2VH3A 4JIOA 2EIJC 3W8HB 2GA0A 1Z6AA 3FVYA 3IQ6A 1Q0FA 5E2QA 1H9TA 3DM9B 3RQGA 1CPQA 1BZ4A 2NSGA 3JCUQ 1T6IA 4OIPF 2A69F 3U3FA 2HJMA 3I4UA 2OJQA 5BUOA 3GEEA 3C8GD 3TULA 3IQCA 4QIIA 3C8GB 1SMYF 3H02A 3A11A 3HJCA 4FZWC 2J9VA 3NKDA 5T1DB 3SZRA 1YJGA 4LDQA 1OQCA 3UGPA 5DVWA 4LLEA 4ONSA 3KYIA 3HLZA 3RFYA 1Q52A 1O87A 5DQZA 1Y4CA 4MVRA 1V4AA
chains in the Genus database with same CATH topology
1OW6A 3O4XE 1K05A 3JZ0A 3ADBA 2HSBA 1ZZPA 2Q00A 3GM2A 3MFNA 3S9OA 1PV3A 2JPUA 2L6FA 1JOGA 3C8GA 3IRBA 2L6GA 3A4NA 1Y64B 3GM3A 3ADCA 1QVXA 3L8IA 3A4LA 3W8HB 2LK4A 4NQFA 1WTYA 3RQFA 3L8JA 4GEHB 1WWPA 3K7DA 1KTMA 1KNYA 1K04A 1UX5A 3RQGA 4NNQA 2P63A 3B71A 1OW7A 3C18A 3U3FA 3AM1A 3W8IB 1WOLA 3BRJA 3C8GD 5F28E 3TULA 3C8GB 1K40A 1O3UA 4XEVA 3ADDA 2PBEA 1RJMA 3U0CA 4R32A 1UX4A 3A4MA 4XEKA 1UFBA 3GM1A 3JYYA 4EBJA 2KK1A 3RQEA 4EBKA 1OW8A 3O10A 2L6HA 2YWAA 4XEFA 3AJMA 2JX0A 1V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW6 A;  1K05 A;  3JZ0 A;  2Q00 A;  2HSB A;  1ZZP A;  3GM2 A;  3MFN A;  3S9O A;  1PV3 A;  2JPU A;  2L6F A;  1JOG A;  3C8G A;  2L6G A;  3GM3 A;  1QVX A;  3L8I A;  3W8H B;  2LK4 A;  4NQF A;  1WTY A;  3RQF A;  4GEH B;  3L8J A;  1WWP A;  3K7D A;  1KTM A;  1KNY A;  1K04 A;  3B71 A;  3RQG A;  1OW7 A;  3C18 A;  3U3F A;  3W8I B;  1WOL A;  3BRJ A;  3C8G D;  5F28 E;  3TUL A;  3C8G B;  1K40 A;  1O3U A;  4XEV A;  2PBE A;  3U0C A;  4R32 A;  4XEK A;  1UFB A;  3GM1 A;  3JYY A;  4EBJ A;  2KK1 A;  3RQE A;  4EBK A;  1OW8 A;  3O10 A;  2L6H A;  2YWA A;  4XEF A;  3AJM A;  2JX0 A;  1V4A A; 
#chains in the Genus database with same CATH topology
 2PBP A;  3S90 A;  5BQG A;  3LEO A;  1RMV A;  4PJJ A;  1SYQ A;  3LAY A;  2EPO A;  256B A;  4IAO A;  3ATP A;  3EH1 A;  1LS4 A;  2DI3 A;  2M64 A;  2YKZ A;  1SZI A;  3T4R A;  2NUP B;  4J30 B;  4NNQ A;  1VK5 A;  1VYK A;  1VOM A;  3K66 A;  4G0H A;  4I1O B;  4CS8 C;  2BC5 A;  4IGG A;  1AVO B;  3C8Z A;  4JZA A;  2R05 A;  1Z3I X;  5KYU A;  4MI2 A;  3H2U A;  4NY3 A;  3OC7 A;  3QMK A;  4BG0 A;  1T9K A;  4M63 A;  1RJ9 A;  1OR2 A;  2B0H A;  3L34 A;  3KMI A;  4JJF A;  3UMI A;  5KYX A;  2JX0 A;  1D0Y A;  1RJN A;  2R9R B;  2J0X A;  4CS8 A;  4NEK A;  1HY5 A;  3EGD A;  2XM4 A;  4OIO F;  5KYY B;  2G3V A;  3SYN A;  4JKV A;  4Q4Z F;  1YYJ A;  3ASO C;  3HKK A;  3MX3 A;  1QVX A;  2FGY A;  3S29 A;  4PJL A;  3U3B A;  1AEP A;  2OCC C;  4MW8 A;  5L0G A;  4JYL A;  4YL0 A;  5HSW A;  4HEA J;  4B6I A;  3IQ5 A;  3VAY A;  1UX5 A;  2GWW A;  1B68 A;  1GM5 A;  2Y3G A;  3DE8 A;  1PD0 A;  3K1H A;  4CS7 A;  2FW2 A;  3LS0 A;  3VRC A;  2ZPA A;  3QVY A;  4I44 A;  4JRZ A;  2GTR A;  5DLJ A;  1PCX A;  1APC A;  2QLA A;  3OEO A;  3V7O A;  2L7A A;  1NZE A;  5JS5 A;  2IOQ A;  4EBJ A;  2HMZ A;  2YQY A;  4YT8 A;  1WAT A;  2L9J A;  2BE5 F;  4MVM A;  4U5E E;  1T6Q A;  3HNI A;  3V5Y A;  4CDV A;  2RSE B;  3QTH A;  2UZF A;  2Z15 A;  2XLO A;  4JOT A;  1UG7 A;  1Z5Z A;  2XRH A;  4I4Z A;  3RKO F;  1TWA A;  4NTA A;  1TWG A;  1PV3 A;  2AU5 A;  2JPU A;  2KC3 A;  2EIL C;  2WVN A;  1M57 C;  4H4K C;  2BL2 A;  4MND A;  4O6M A;  4YN0 B;  3WHN A;  5AC5 A;  3CQZ A;  4P9T A;  1OR3 A;  1E85 A;  2WB7 A;  1S05 A;  1FTS A;  3U5S A;  2A0B A;  1ZVZ A;  3ZVR A;  1KNY A;  4L6R A;  2H7B A;  1YDI A;  3J06 A;  3SXY A;  4DVY P;  4G7O F;  4CIH A;  4JWV A;  5KYW B;  3V5X A;  2J8W A;  3NYM A;  2DGJ A;  4ULW A;  1O3U A;  3L0I A;  3K1I C;  1LIH A;  4R32 A;  2YLI A;  2XL6 A;  3A4M A;  2P61 A;  1JPJ A;  3ZWI A;  3B0V C;  4CSA C;  4H54 A;  4IRU A;  2LD6 A;  5JT4 A;  3AGT A;  1YYX A;  3SNH A;  4E17 A;  4AX2 A;  1HW1 A;  2ASR A;  4QIJ A;  3Q0G A;  4NTF A;  1VMA A;  1ZU5 A;  4CDY A;  1CGN A;  1XZQ A;  4AE4 A;  3B9Q A;  3FHD A;  3KQF A;  2W4B A;  2Q4F A;  3I5P A;  4F4B A;  5A6B A;  4J7Y A;  1M2O A;  5FZT A;  5B3I A;  1QSP A;  2LFD A;  3O6X A;  4NC3 A;  1CPR A;  3QXZ A;  2QY9 A;  1I5N A;  4XPX A;  5B1B C;  2HUJ A;  3H65 A;  3V5Z A;  2KGO A;  4I3M A;  4UDV A;  2ZXW C;  2I8B A;  4LDR A;  4EHP A;  4GEH A;  1HMO A;  1GS9 A;  1YLM A;  3LLK A;  3POV A;  5T3T A;  1LI5 A;  2R7R A;  3E70 C;  2KW3 C;  2VCB A;  3Q0J A;  1SF8 A;  2XXA B;  4ELS A;  3AGU A;  2XL8 A;  1ORY A;  1TR2 A;  2WVO A;  3ECS A;  3LES A;  4PFO A;  5TJ5 E;  3S27 A;  3W2W A;  3X2Q C;  4E0I A;  4HFF B;  1NFN A;  2J46 A;  3W8H A;  3NDB B;  5JLI A;  3JYY A;  3M79 A;  2CGE A;  5JSL A;  4EKW A;  4JE9 A;  1ST6 A;  1OW8 A;  1VLT A;  4JTA B;  3S0X A;  1BR2 A;  2YWA A;  4U9D A;  2FBM A;  1NG1 A;  1T01 A;  3T8A A;  2A0U A;  4IAR A;  2XLE A;  4FZW A;  1Q0K A;  3EJN A;  3G4Z A;  4BJ1 A;  5A69 A;  3Q1T A;  1UIY A;  2OG2 A;  1RCP A;  1YAU O;  3N2Z B;  1TFK B;  1MMA A;  2NG1 A;  4NTB A;  4K7B A;  2DYR C;  3C7J A;  4YL1 A;  4YJW A;  1D0X A;  2WZL A;  3US6 A;  2YL7 A;  2WZF A;  3C63 A;  3CSK A;  1CGO A;  2AWY A;  2GFH A;  5EK0 A;  4WAB A;  3TRR A;  4JW1 A;  4CX9 A;  4RBN A;  1BBH A;  4NCQ A;  2J45 A;  2P63 A;  2CDQ A;  4N6H A;  1C03 A;  3UGO A;  4P6I C;  3EZI A;  3PHF 2;  3JTL O;  2ICW G;  3G4X A;  4JUR I;  1QQ3 A;  1DOV A;  2TMV P;  1U0B B;  4RD9 A;  1BDJ B;  3JSE O;  4XTK A;  1AUE A;  3EFO A;  4LER A;  3TD7 A;  1JXZ A;  1FFT C;  4ULV A;  1J8Y F;  1NU7 D;  1ORJ A;  1XWJ A;  1MMG A;  3F46 A;  1ZHT A;  3ZG1 A;  5KYN A;  2NSF A;  2XS1 A;  3K6B A;  2IXM A;  4W8K A;  4E0H A;  3DJU B;  5D91 A;  2P6V A;  1FFH A;  2HV7 A;  2CCY A;  3DJN B;  1YA7 O;  1LM3 B;  1A0B A;  3L1M A;  2YL1 A;  3NKE A;  5JRA A;  2F22 A;  4CSA A;  2AP3 A;  3QZC A;  4DVZ A;  2VRE A;  2FFH A;  3SXK A;  1DUB A;  2E87 A;  2C03 A;  3QW0 A;  4GEH B;  4PFP A;  1EY3 A;  3G64 A;  3GEH A;  5KYW A;  4OIR F;  3U9J A;  3FAJ A;  3U9M A;  5FCL A;  3RVZ A;  1YAR O;  1GQA A;  1ORS C;  1RKE B;  2QE9 A;  2QTV A;  1OCC C;  3W2V A;  3DM5 A;  3ZDL A;  2B0J A;  4JEB A;  5B3S C;  3Q6N A;  3DE9 A;  4KNP A;  4OG1 A;  4DRJ B;  1EF9 A;  1MND A;  4BEJ A;  5BQI A;  3M1C B;  3U8V A;  4O6N A;  1E84 A;  5A6J A;  5HV9 A;  1G8X A;  4QI2 A;  4C3E A;  3ZQV A;  2EPM X;  3KL4 A;  5L0C A;  4XEV A;  2R7U A;  3ITF A;  4XLN F;  1M6T A;  4EUK B;  1DOW A;  2H7V C;  1OCZ C;  4CBE A;  4Q7C A;  2LP4 A;  3AQB A;  3TOM A;  3ABK C;  5KJP A;  4OLQ A;  3FOP A;  1Q0G A;  1WTY A;  1YZA A;  3NMJ A;  3O39 A;  2PFD A;  3RVY A;  3TK0 A;  4BPM A;  4YWQ A;  4ZLC A;  5L0H A;  1FAP B;  2R7X A;  4ZU2 A;  1VLS A;  2OEX A;  1G4U S;  3C18 A;  2EJ5 A;  1V54 C;  2IXP A;  1S7Z A;  1OCR C;  2CNW D;  3F47 A;  4IZC A;  1HE1 A;  2HFI A;  3AG3 C;  1G5Z A;  5DS6 A;  4U5F E;  2J9W A;  4U1A A;  3FOO A;  1MMN A;  1UX4 A;  3R0O A;  1E2X A;  3FAP B;  1I4Z A;  2KJG A;  4ELX A;  2LFF A;  3MYF A;  5B1A C;  4BEM J;  2P7V A;  4AL1 A;  2M4E A;  4F47 A;  3M4B A;  5AC4 A;  2J9U A;  5EHH A;  3KYJ A;  5IY5 C;  2WL8 A;  1JMW A;  2PX0 A;  3KPH A;  1ZW2 A;  1K05 A;  2Y3H A;  3ABL C;  4MVU A;  1LI7 A;  2Q00 A;  5COF A;  5T3W A;  4ER9 A;  1YZC A;  3ASN C;  3LNM B;  4FES A;  4O7G A;  1Z7Q c;  4DOZ A;  5DQT A;  3OA1 A;  3UR3 C;  3M15 A;  3DXJ F;  1NBB A;  4ZLD A;  4PR9 A;  2YEV A;  2CW0 F;  5JVE A;  4A4A A;  4MVQ A;  3L8J A;  2PX3 A;  3HNK A;  4MVO A;  4E7Z A;  3S84 A;  2HW5 A;  4BJ6 C;  3PDM P;  3HRX A;  4MTO A;  4CDA A;  1HW2 A;  3EHM A;  4OIN F;  3Q7L A;  2R7Q A;  4U5H A;  2MYS A;  1QZX A;  3BRJ A;  2MWQ A;  4O79 A;  4C7O B;  1EQ1 A;  1RJ9 B;  4N06 A;  4K2N A;  3N0T A;  2IYL D;  4U9E A;  3T6G B;  1YVI A;  3EGD B;  2WVQ A;  5A6K A;  3LS1 A;  3B0P A;  3EHN A;  4JTC B;  1L7C A;  2R7V A;  1KU2 A;  4AL0 A;  3B29 A;  1T5O A;  1VTM P;  3QW1 A;  4DRI B;  2XLH A;  4XEF A;  4I52 A;  4PJM A;  4XWJ A;  5COM A;  4K3W A;  3AJM A;  4BJ5 A;  3HNJ A;  1JPN A;  1LS1 A;  2G3K A;  2R02 A;  3MOY A;  2KQ9 A;  2XLD A;  4I1M A;  4U5D E;  4Z9I A;  2YZS A;  1ZZP A;  2J9B A;  2W9Y A;  2OU6 A;  3AQC A;  3DMD A;  2VX2 A;  2CNW A;  2VCC A;  3E9V A;  2NUT B;  3SXM A;  3IRB A;  3ZIB A;  1M2V A;  2OOC A;  3HIN A;  4ANJ A;  4NQF A;  1U89 A;  4X0R A;  3P5M A;  1H7I A;  2VCA A;  1NU9 C;  3T9O A;  3FDQ A;  3K7D A;  5CI9 A;  2YLG A;  3TQO A;  4JC7 A;  2DB4 A;  3LLI A;  2EIK C;  4GYT A;  1LE4 A;  1R4T A;  1RXQ A;  4BJ5 C;  1E86 A;  1C17 M;  3KKB A;  2ZXO A;  3BEH A;  1OXK A;  2NUP A;  2IXO A;  3IEE A;  1K40 A;  1NLX A;  2HV6 A;  4G78 A;  4JCH A;  1RJM A;  4FAP B;  3U0C A;  2NPU A;  1OCO C;  3EQL F;  3U2L A;  1N1C A;  2XLV A;  4EBK A;  4U18 A;  4DBQ A;  5JBX A;  1U6H A;  3ZTM A;  1ZW3 A;  4CIP A;  3N24 A;  4RDA A;  2VAS A;  3LJB A;  2EPK X;  4YL3 A;  3VYW A;  3DI5 A;  3GM3 A;  3JRM O;  4Z9J A;  1OW6 A;  2YHS A;  4IB4 A;  4D4X A;  3R2P A;  1A41 A;  1HE9 A;  2R7W A;  5KYX B;  3GM2 A;  3MFN A;  2LQG A;  4JVS A;  2PF4 E;  3IQT A;  2QUP A;  3A4N A;  2W45 A;  5KYY A;  1NZY B;  1Q51 A;  3WAQ A;  4OD4 A;  1TFO B;  2IM8 A;  1VYI A;  3O55 A;  4PAC A;  3GWN A;  1HZD A;  1LPE A;  3CAX A;  1YA9 A;  5E3A A;  5F5H A;  2P0N A;  4XPW A;  4A2N B;  3RSI A;  1OW7 A;  4HFK B;  1I4Y A;  4DXW A;  1A7E A;  3RH3 A;  1D0Z A;  4XPY A;  5AGF A;  4EBB A;  1WN0 A;  4BJT A;  2R7S A;  1FMW A;  3SLL A;  2IBF A;  2J7P A;  4ELW A;  1D1B A;  4MVS A;  5JP7 A;  4QI0 A;  3H81 A;  2G62 A;  5CI8 A;  4YK5 A;  1PD1 A;  1WAS A;  3IPM O;  2EPN A;  2Y39 A;  4LAC B;  1H6G A;  4KC9 A;  4MW3 A;  3JRT A;  2HS5 A;  4QDL A;  1EKY A;  3DKA A;  4N4W A;  5KYU B;  4KNW A;  3PZK A;  1ZHZ A;  1XZP A;  1E83 A;  1IW7 F;  3M4C A;  5F5F A;  2L6F A;  3VM6 A;  2C04 A;  4MOU A;  2KYH A;  2WZG A;  1W2W A;  2IXN A;  3ABM C;  1H9G A;  1HMD A;  1FMV A;  5L0F A;  1LKX A;  4WJ0 A;  3FDU A;  3TLF A;  2L81 A;  2UUI A;  3GAN A;  3HTK C;  3VF0 A;  2H8A A;  3GEI A;  4JEA A;  1ZHY A;  2OEV A;  4DJ9 A;  3T6J A;  2IEX A;  3AM1 A;  1WOL A;  1M56 C;  2OKU A;  2A6E F;  2J7P D;  2YVK A;  2ZD9 A;  2X0C A;  1V55 C;  1Y6D A;  4GQH A;  3T6B A;  3TOL A;  3ZQY A;  4K1O A;  4MS2 A;  4MTF A;  4CJO A;  1UFB A;  5K0I A;  2KK1 A;  4I42 A;  4Z9H A;  2O9X A;  4K0D A;  1R5I D;  3AOU A;  1F1M A;  3AG1 C;  2LSE A;  1TWC A;  2A6H F;  2H7O A;  3U8P A;  2ZQQ A;  2X51 A;  4E7S A;  4YT5 A;  3FXH A;  4IZB A;  3NRH A;  3S28 A;  5CIV A;  3MLG A;  5L0J A;  3C8G A;  1JOG A;  4C3D A;  1Z23 A;  1A7D A;  1Y64 B;  2Y3B A;  4MQ9 F;  3L8I A;  2LK4 A;  3DAG A;  4CS9 A;  1DCI A;  4FX5 A;  4D4N A;  4MTG A;  1K04 A;  1L3P A;  3SP1 A;  1JAF A;  2HSQ A;  1CGM E;  3WOD F;  2OJE D;  3W8I B;  1SR2 A;  5A6B D;  2LCH A;  4EIY A;  4OD5 A;  2Q9A A;  3JYH A;  1OKK D;  4XQ1 A;  4P9F A;  5E33 A;  2YL3 A;  2I15 A;  3EGX A;  4XEK A;  2EIM C;  2VB6 A;  1MQV A;  2GDC A;  2VC9 A;  4WGZ A;  1QKR A;  3MYI A;  2F6Q A;  4U5G A;  5GPG B;  3Q6M A;  3SXZ A;  4EWC A;  2LIG A;  4U19 A;  3U2M A;  3C62 A;  2GAQ A;  3MBG A;  1QPU A;  3EG9 A;  4C7O A;  2YLD A;  3UMH A;  3UMK A;  5E3C A;  3W4Y A;  3FMS A;  1C02 A;  3K33 A;  2AWC A;  3S9O A;  3WG7 C;  3X1O A;  3ZC4 A;  1EI7 A;  1RKE A;  2Q9B A;  2MHR A;  3EZH A;  1J8M F;  3RQF A;  4DBR A;  4AE4 B;  2R7O A;  3UNG C;  4CJG A;  1NFO A;  2Q7R A;  5EGY A;  3PCV A;  1O5H A;  5D92 A;  4XLP F;  4JFC A;  2R03 A;  1BR1 A;  1TKN A;  3JSZ A;  3NMI A;  3ADD A;  1T6U A;  2KNH A;  5COG A;  1Q0M A;  2XSE A;  2V26 A;  2ZXR A;  5L0I A;  2XM0 A;  3GM1 A;  2V3C C;  3LNR A;  1A7V A;  3DZA A;  3CZ6 A;  3NMK A;  2JD3 A;  2PP4 A;  4N6C A;  4WCZ A;  2XS8 A;  3H2V A;  3JZ0 A;  3ADB A;  2HSB A;  3DAF A;  3GOD A;  3NYL A;  2P1A A;  2XLM A;  1V74 B;  4JJG A;  4U5C E;  3RIP A;  2L6G A;  4AK9 A;  2EPL X;  3ADC A;  1MJ3 A;  3SWX A;  2HJ3 A;  2DYS C;  2J0W A;  4HE8 D;  3RYL A;  3SEO A;  1WWP A;  1TWH A;  2KSF A;  1TQG A;  2A1D D;  3LUT B;  3B71 A;  3R7C A;  1FNT c;  1KTM A;  2XL4 A;  4IWB A;  4KI2 A;  1WGW A;  1OXB A;  2Q9C A;  5C9G A;  1D1A A;  1ZU4 A;  5F28 E;  2NUT A;  1G4W R;  3TJ6 A;  1EF8 A;  2QQ3 A;  2HMQ A;  1ZHX A;  3OWT A;  1EA8 A;  1IZM A;  2HZ8 A;  2YRF A;  1MNE A;  3JT1 A;  3NG1 A;  1NZY A;  3QVZ A;  3RF3 A;  4LLC A;  3K1I A;  1VB5 A;  3LEV A;  4KNV A;  2D5R B;  3RQE A;  3TJ5 A;  4E18 A;  3O10 A;  5JUA A;  2CYD A;  4G7Z F;  3EFO B;  3AG4 C;  4O6Y A;  4KBL A;  3R9S A;  3IHU A;  4LDK A;  4PJN A;  5L3Q A;  2A68 F;  3EG9 B;  4OIQ F;  3DD7 A;  2ETS A;  3O4X E;  4EML A;  4FJW D;  3ZSU A;  3QK8 A;  3QXI A;  3GWL A;  5DS4 A;  2PPY A;  4W8P A;  1FR0 A;  3A9C A;  3GOR A;  2AVK A;  3R9T A;  3T89 A;  2QNL A;  5L0D A;  3G50 A;  1Q0D A;  2Y69 C;  5A6A A;  3A4L A;  1JR8 A;  2W4M A;  4FWV A;  4G7H F;  3EH2 A;  3CEX A;  4JCS A;  5DS5 A;  1NSG B;  2Y3D A;  4J7T A;  4Q5S F;  3I47 A;  3RW0 A;  3W8I A;  4DRH B;  4YT4 A;  3NYJ A;  1QLE C;  4JTD B;  4MVZ A;  2R7T A;  2ZQR A;  2Q3T A;  3HNL A;  4IAQ A;  1ZYR F;  2FAP B;  2XLW A;  3B0U X;  2XXA A;  2PBE A;  1LE2 A;  1WZ8 A;  1GGQ A;  3EGX B;  1BR4 A;  4U5B E;  1ZHW A;  4IJJ A;  4WGY A;  3T88 A;  2EIN C;  1Z63 A;  2ZXP A;  3AG2 C;  4BJ6 A;  4C3B A;  2YL0 A;  3PMR A;  1RKC A;  2L6H A;  4PK4 A;  3Q7G A;  4JCZ A;  4CS9 C;  1MMD A;  2RD9 A;  2HKV A;  2UUH A;  1OKK A;  5JBW A;  3MYB A;  4IZD A;  2PNO A;  3KH2 A;  1JRA A;  2D4U A;  4YT2 A;  3DWW A;  1M2V B;  1LVK A;  3EPV A;  3I5Q A;  3ZTZ A;  1D1C A;  5L3V A;  2OQM A;  5BQH A;  4J32 B;  2R25 A;  2DUB A;  2VH3 A;  4JIO A;  2EIJ C;  3W8H B;  2GA0 A;  1Z6A A;  3FVY A;  3IQ6 A;  1Q0F A;  5E2Q A;  1H9T A;  3DM9 B;  3RQG A;  1CPQ A;  1BZ4 A;  2NSG A;  3JCU Q;  1T6I A;  4OIP F;  2A69 F;  3U3F A;  2HJM A;  3I4U A;  2OJQ A;  5BUO A;  3GEE A;  3C8G D;  3TUL A;  3IQC A;  4QII A;  3C8G B;  1SMY F;  3H02 A;  3A11 A;  3HJC A;  4FZW C;  2J9V A;  3NKD A;  5T1D B;  3SZR A;  1YJG A;  4LDQ A;  1OQC A;  3UGP A;  5DVW A;  4LLE A;  4ONS A;  3KYI A;  3HLZ A;  3RFY A;  1Q52 A;  1O87 A;  5DQZ A;  1Y4C A;  4MVR A;  1V4A A; 
#chains in the Genus database with same CATH homology
 1OW6 A;  3O4X E;  1K05 A;  3JZ0 A;  3ADB A;  2HSB A;  1ZZP A;  2Q00 A;  3GM2 A;  3MFN A;  3S9O A;  1PV3 A;  2JPU A;  2L6F A;  1JOG A;  3C8G A;  3IRB A;  2L6G A;  3A4N A;  1Y64 B;  3GM3 A;  3ADC A;  1QVX A;  3L8I A;  3A4L A;  3W8H B;  2LK4 A;  4NQF A;  1WTY A;  3RQF A;  3L8J A;  4GEH B;  1WWP A;  3K7D A;  1KTM A;  1KNY A;  1K04 A;  1UX5 A;  3RQG A;  4NNQ A;  2P63 A;  3B71 A;  1OW7 A;  3C18 A;  3U3F A;  3AM1 A;  3W8I B;  1WOL A;  3BRJ A;  3C8G D;  5F28 E;  3TUL A;  3C8G B;  1K40 A;  1O3U A;  4XEV A;  3ADD A;  2PBE A;  1RJM A;  3U0C A;  4R32 A;  1UX4 A;  3A4M A;  4XEK A;  1UFB A;  3GM1 A;  3JYY A;  4EBJ A;  2KK1 A;  3RQE A;  4EBK A;  1OW8 A;  3O10 A;  2L6H A;  2YWA A;  4XEF A;  3AJM A;  2JX0 A;  1V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...