3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transcription
molecule keywords Response regulator protein
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
3RQIA 1QPZA 1D5YA 5J1UA 1GLGA 3N0RA 1X2NA 1ETKA 1APBA 2NZUG 2LK2A 1MAVA 5GPAA 5DKFA 3KLOA 3MA0A 3MVPA 2F8TA 1RPWA 3L6UA 3B2NA 2K40A 5K7FA 2JBAA 2DMQA 2FJ1A 2RDMA 1TWCJ 4E7PA 1PUFA 1RPJA 1U9NA 2FEPA 4KREA 4EEFG 3CHYA 2GBYA 3TX6A 1F43A 4OTZA 4W1UA 2ID7A 1E3OC 2NVYJ 3N75A 5F64A 2FKAA 3RVLA 2XB0X 3S2DJ 2HQRA 2PE5A 4NCBA 1BJZA 1P6UA 4MQFB 1ZR4A 3N0XA 3O1HB 2H3HA 2WWVD 1YK1A 4Z0NA 2DA1A 5JNVA 2M8GX 3JR9A 1U0SY 1IGNA 2QF7A 1JX6A 2ID9A 5F1JA 1NXWA 5KC8A 2FMHA 3KTOA 4BKXA 3BG5A 3RKQA 1FTTA 1TWAJ 1QRYA 3OO0A 2R47A 3O1IC 3LMKA 1RETA 2VPRA 2VK2A 3BREA 4JYKA 3BR2A 2IPLA 4MPTA 2HI3A 2PUBA 3KYIB 1FTZA 1DG9A 1JUPA 2JK3A 3N8IA 3HUUA 2J48A 1Z2DA 2ECBA 3WHCA 2QR3A 2O7OA 5B3JC 1NK3P 1CHNA 1SXIA 4AC0A 1ABFA 2PL9A 3JS5A 1DBWA 4A3LJ 3I4MJ 2WJWA 1SFOJ 3CKMA 4OLAA 4RKQA 3LUFA 3GYBA 1JJ6C 2JA6J 3GTKJ 1B72B 6ABPA 3H0GJ 1E6LA 2VUMJ 4F12A 5D2CA 2RAEA 4O1IA 4LX8A 1IRZA 4DW6A 1JT0A 3ZQIA 3KLNA 3JRBA 2RJNA 5E3JA 3BBLA 2M0CA 2NS8A 1Z77A 1ZKGA 1SD5A 2IYNA 1LFBA 2DMPA 4RY9A 2L7FP 2Y2ZA 2DA2A 2FQXA 4OATA 4RK4A 2CQXA 3JRCA 2NOGA 2B4AA 3IP9A 4IEJA 2R4QA 2COBA 3H1FA 5F0CA 3HOYJ 2L18A 2TMYA 3FDFA 1B00A 1M5TA 2G0EA 1JKOC 3TP0A 1DU6A 1QNLA 2JWTA 3DGFC 4FE4A 1OCTC 5M3MJ 5C3EJ 1ZH4A 3GTGJ 4ZPJA 3GA5A 4YV7A 4OLBA 1Y1VJ 2YHBA 5KQPA 2IBDA 4NDLA 4TLMB 2XRLA 1RNLA 1DC8A 1U2QA 4M3FA 4MR7A 5BRAA 3F6PA 4G12A 2DA4A 2GLOA 3SJMA 1HDDC 1HDPA 1ISSA 4MS1A 4WXMA 1KRXA 2IEKA 1JBEA 2A9PA 2LVSA 1TC3C 1VFCA 1DJMA 2LTPA 4G0YA 1BW5A 1Y1LA 4W5OA 5F27A 3RVRA 2YHAA 1EAYA 1FSPA 1U2PA 2HJ9A 1FFGA 1ZQ3P 3LSJA 3HS3A 1HCRA 2P4UA 3TMYA 1VF9A 4EVSA 4RK6A 2HYJA 1MH4A 4BBSJ 5JNUA 1KRWA 3GTPJ 2LLKA 3FIWA 2NZVG 2M34A 3ZOBA 3HDGA 2GI4A 2WAQN 3CG0A 1K68A 5EYRA 2HXIA 1MNMC 4MAAA 1ENHA 3BR5A 4PYRA 1WCMJ 1YMUA 4BY1J 2CWDA 3F73A 1IIBA 1VLZA 1JYEA 5IYCJ 4X1EA 3S99A 4JASB 3A0UA 5EWLB 4M3BA 1W9HA 3S1QJ 4G0XA 4KFCA 2H0AA 3GRCA 5FLMJ 1Z13A 1WETA 5J1YA 1VPWA 1Z16A 2E4VA 4AUXA 1JDPA 2AYXA 2MYTA 1GUUA 1VI0A 1R9TJ 4MFEA 5IP9J 1BW6A 2PMZN 3H5OA 1XG1A 1QQAA 3BG9A 4UUSB 1TLFA 4A3MJ 1AKHB 2JA7J 2BGGA 4WZZA 1OFCX 1ETWA 3S1RJ 4A93J 3UK0A 4D6XA 2DMUA 3EODA 3O75A 1MB0A 4IMJB 3I09A 4F11A 4I76A 1C4WA 4JB0A 5IPAA 1MSFC 5IP6A 3H1EA 3QK7A 3RVKA 2W42A 3TP3A 2VKVA 5CNIA 4W5QA 1E6KA 3HXMA 1UG2A 1DBQA 3LUDA 3FGZA 1EHCA 4C3JJ 2EBIA 3H5WA 3RZDJ 1YK0A 4N47A 4CYCB 4XRSA 3HOZJ 1USKA 4RWEA 3C6QA 3DLHA 2CRGA 3A01B 2ME0A 2FEWB 1U9OA 4UHKA 2FTKE 4L4UA 3QX8A 1RKTA 1RZRA 4DYRA 3JRAA 4Z4HA 1D2AA 4XAQA 5DTEA 1ETXA 5FBKA 3RVOA 4IHVA 2HOTA 3LSPA 3D02A 3CQZJ 2L0KA 2FQWA 3MM4A 3M4OJ 1YS6A 3O8HA 3FK7A 3T8YA 3BR3A 4QICA 4Z4IA 4XRMA 1APLC 3LOCA 5TPWA 1DCKA 4MIMA 1JTYA 1MBFA 5BNGA 1R8JA 3JREA 3HOUJ 3L49A 1S8NA 1H89C 4RDCA 3BRSA 2Q5CA 4QPJC 3H5IA 5EWJA 1JKRC 5IUJC 4YRZA 5KQMA 3HGYA 1X2MA 4RY8A 3CMYA 2FLKA 1P8AA 3OSFA 1JF8A 5BRJA 3C3MA 3OQMA 1SXGA 1T56A 4TN5A 3RVSA 3H3VK 3OSGA 1DC7A 3DEWA 2LBPA 1MSEC 4MR8A 2FX0A 3GTMJ 4MGEA 4BBRJ 2WV1A 1JLKA 3M9XA 3CNBA 2VUIB 3EDCA 3EJWA 3KYJB 3UUGA 4TMYA 3DLBA 5IC5A 4DZPA 5GP9A 5JS1A 2V0NA 1ZR2A 1XHEA 1JKPC 3QLVA 5CNMA 3JRHA 3S15J 3QLUC 4Q6BA 3BTIA 3KS9A 4D7NA 5TE9A 3W6VA 2CU7A 1Z25A 3QX9A 2PLNA 1ABEA 4Q6WA 3Q15C 3E7LA 4M3GA 2CHFA 1B72A 2QU7A 3GBVA 3BT9A 3CG4A 1POGA 4YO7A 2XGEA 3HCWA 4YWHA 2FMKA 5TPZD 4ETNA 4ABZA 2E2JJ 1GVDA 1J56A 3GWGA 3FISA 3VNAA 5TQ2A 3SY8A 3Q0WA 4IMIB 3OO1A 1AHDP 5K7ZA 3UKGA 2M98A 4H3HB 5IOYA 3A3KA 3O21A 2R5ZB 2QV0A 2MSWA 3IP5A 2YS9A 2E4UA 3HOWJ 1P2FA 4KQCA 2E2HJ 5EZHA 2FSPA 3OM1A 5HQJA 4MR9A 5PNTA 2N9UA 3GTJJ 4W5TA 2E4XA 1MH3A 1PUXA 1LBHA 4OG2A 5M5WJ 3FFWA 3G1LA 4JAVC 3O8GA 3HK2A 4MS4B 3IDOA 2IDMA 2CHEA 8ABPA 2XPWA 5IYDJ 1I3QJ 1M2EA 4IHYA 3HVRA 4RXMA 1X58A 3NHZA 4Y9TA 3LOPA 3LUGA 2IOYA 4WWHA 3DZDA 5DCLA 3HM9A 1Y1WJ 3FMVA 4HNRA 4XRSG 4Z4FA 3I45A 4CBVA 4LOCA 2WY2D 1W0UA 1ZDMA 2E1OA 2GM4A 1G2HA 1DU0A 3RVNA 1ETVA 4QYWA 4B1RA 2VI6A 2JA5J 2JCGA 3CZ5A 2JBAB 1T33A 4EY3A 1Z26A 1WH5A 4NCAA 1T34A 2E4WA 1A0OA 4S0HB 1JWLA 3NNNA 5F08A 1DBPA 2X48A 3QELB 3B6CA 5C44J 1Z17A 5I4CA 1ZY2A 2CUEA 2K9NA 5FKOA 5ED4A 1P7IA 4RKRA 1QVTA 1IV6A 1DCMA 3SDGA 3A03A 1NTRA 2I10A 2QVGA 3Q9SA 1A5JA 3C97A 5FKKA 1P7JA 4MFDA 2JN6A 3FFXA 3K7AJ 2ME6A 3BR1A 4L5EA 3IH4A 2HDDA 3E61A 1QP0A 3NARA 3OMXA 1FIAA 5CHYA 1TVMA 2QW1A 5EWMA 1JUSA 4N76A 4O1HA 1A04A 3O74A 1SRRA 4A3GJ 1ISRA 4WT7A 3MMNA 2X9DA 2MG4A 1CEYA 1IDZA 3NAUA 2OF7A 3OLYA 2PUEA 4Z99A 3N0WA 1ITYA 4Q7EA 2ELKA 5JNRA 3EULA 3BTCA 5IOZA 2H8RA 1XS9A 3GV0A 1HEYA 2FVYA 3H5VA 1JH9A 2VUHB 3VNBA 3O2QB 2FMFA 2FD5A 4FCYA 1KMIY 2R0QC 4DYQA 3K4HA 3LNQA 5HODA 2PUGA 1JHZA 3WHBA 3TB6A 1EF4A 4MS3A 5T3YA 3KG2A 1P6QA 4MRMB 1VNDA 1PEAA 4BXXJ 1YMVA 1F4VA 3CRNA 2JRLA 3MF4A 1LE8A 3A0RB 3QEMB 2HOSA 4N41A 1OXKB 2HXOA 3VPRA 3E3MA 3DBIA 3SFIA 2HQOA 2JVIA 3EQZA 2JJ7A 3JVDA 4WUTA 2GX6A 2L9RA 4Y52J 4N0PA 4YCSA 1W25A 3JY6A 2WRZA 1YRNB 2W48A 3BRQA 2FQYA 4G0QA 1I6HJ 2ZAYA 2GBPA 1GCGA 1QMPA 4G0ZA 1WGXA 4YR7A 1U8BA 3ILYA 2WMYA 2LR8A 2O8KA 4UHJA 5EEAA 4LDZA 2K9SA 2LPMA 1ZESA 4KRFA 4RK7A 2FMIA 4N03A 4G97A 5C4JJ 1FEXA 1B8IA 1NXXA 1QP7A 2FLWA 1D1PA 4FB4A 3NBMA 1OXBB 2R93J 4D5FA 2Y30A 1CYEA 5DLEA 3RH0A 3FKIJ 4JP0A 4A3DJ 5FKLA 1K61A 1ORKA 3QELA 4DYCA 2E19A 2NVTJ 5IUKC 4KK3A 4ML3A 2HQBA 2NT4A 2N8GA 1M2FA 1WI3A 4M6VA 1TWGJ 2GWRA 2XGDA 2PUDA 3GTQJ 3RVQA 1EWVA 2FXIA 2MSLA 5IX8A 2EQRA 2LY9A 2CD7A 1JFVA 3SNKA 4LE0A 3RVPA 4YGXB 2JK1A 2WJAA 3ZQLA 2LUOA 4RXTA 4MQEA 5HSGA 3D1NI 1NXPA 4H3KB 1RKWA 1AB6A 4A3BJ 1JL3A 2EZLA 2F8SA 1RZRD 1UDRA 5TQ0B 3TW7A 3CZCA 1KGSA 3BTJA 3EQ2A 5FLVA 1XHFA 1HLVA 4A3EJ 2CUFA 4A3JJ 3GTLJ 1EWTA 4XARA 5CNJA 1OJLA 1I50J 2DMTA 2QVCA 3BR0A 5C5CA 5FJ8J 1LFUP 1ZVVA 4MLCA 3FFTA 1IDYA 2IPAB 1YS7A 5GPCA 4D74A 4E7OA 3N6VA 4MQEB 2Y31A 4GPAA 4KZKA 1L5ZA 1K66A 3OLZA 4XASA 3EGCA 2WB4A 2R5ZA 3IPCA 1RXIA 4QTRA 2HPHA 2M2EA 4DZJA 3Q3SA 3D8UA 3Q7RA 1OCPA 2YU9J 1H88C 3JPWA 1W0TA 1YTUA 1DRKA 2EZIA 2XPUA 3QPLA 5TQ2B 2R25B 2QZJA 1D5WA 5J3LA 3MYYA 4RXUA 2R5YB 4B3AA 4P1ZA 2QCOA 3T38A 2LKXA 2ID3A 1JFTA 1GV2A 2HSGA 2IPNA 3PM1A 4MO7A 2D5VA 5KQGA 1LK0A 4JX4A 2KDZA 2AO9A 3TO5A 3CFYA 5IEJA 1B8IB 2DTZA 1QPIA 2OQRA 3MKLA 2PKXA 3HZHA 1NXTA 3SG0A 3OMWA 4JX5A 2ECCA 1MBEA 2L7MP 1F51E 2QSJA 3IV5A 3HJFA 5ABPA 3MIZA 5JNSA 2NS7A 1YRNA 5BQ3A 3HKZN 4HNSA 1IG7A 9ABPA 1D4ZA 2GKGA 4I6ZA 1NY5A 5DS9A 3HEBA 3I4NJ 4B4CA 3G1WA 2XGCA 3HB9A 1RR7A 1PHRA 4FTHA 4FISA 3PO2J 2R5YA 1K83J 1IJWC 5IUNC 1PNTA 1XWWA 1CQTA 1JDNA 1EWKA 1I3CA 2L19A 4HYEA 3OLWA 4P98A 1GUBA 1LBIA 4XK4A 2ZB9A 2ZWMA 3IH3A 4EGSA 4LZLA 4RDUA 2FQ4A 4JA2A 4RK0A 2M9HA 1S7EA 2LP4Y 5DGCA 3GTOJ 1GUDA 3ZQFA 5FKMA 3H5LA 3K2AA 4EYKA 4L85A 3H6GA 2QXYA 4EYQA 1JTXA 1U8TA 3Q7TA 1UMQA 1FQWA 2PUFA 4ZMRA 3O2JA 4LE2A 9ANTA 1FFWA 1SXHA 1GCAA 3P9YA 3IP6A 3OM0A 3A01A 1BDJA 2KT0A 1ZGWA 5E3OA 1JYFA 3HOXJ 3OOUA 3KSMA 1E2BA 2VYCA 4IGAA 5FBHA 3URMA 2NT3A 5JNTA 5B3JA 3JPYA 1GDTA 2PL1A 2RGYA 1F36A 4EVRA 5FWYB 1H8AC 1A6IA 1AKHA 5M3FJ 7ABPA 1DZ3A 3QLVC 1E6MA 1BDIA 4C2MJ 3B6AA 4EVQA 3H1GA 3HDVA 1BA5A 3BQYA 4A69C 4RU1A 2MYUA 1URPA 4ZJPA 4V2GA 1BAPA 4KPYA 2X7XA 3F6CA 1ZGGA 1SANA 4ETMA 3PO3J 3C3WA 3CDLA 5HM6A 2A9OA 3OLVA 4IF4A 3JRGA 4KNYA 3HDDA 3K9CA 5FWYA 4IHWA 4RV5A 1BVHA 3ZQGA 3LSGA 3S14J 1ZTRA 3TW6A 5IYBJ 3I42A 2NVQJ 1LJUA 5EWLA 5IP7J 4JOQA 2XPVA 3Q7SA 3CLKA 2AHQA 3G1OA 3ZQHA 3S1MJ 4G0PA 1MBJA 5K7HA 5CNKA 5KC9A 1IC8A 3S16J 3NHMA 4XLTA 4ZMSA 4F8JA 4NV3A 1DCFA 1ZITA 2PAFA 4JB2A 3BG3A 2MGQA 1HOMA 2DMNA 2NVXJ 4M3DA 4C3IJ 1C0EA 3KCNA 4LDAA 3M9WA 1QO0D 3DGEC 2FN9A 1QQBA 3HSYA 2A9RA 2MSYA 2I6FA 4QSHA 3LKVA 3QLUA 5T7BA 1MVOA 2LD5A 3GBPA 4XIDA 4RBOA 4W5NA 1LE8B 4MR9B 3R0JA 3CCYA 2FN8A 2PJUA 4S04A 2VKEA 4MS3B 3O2SB 2FEKA 2MYPA 2H1KA 4C3HJ 3FK6A 1ZN2A 4LE1A 4N0QA 3CU5A 4RSMA 4IHXA 1PEYA 1MBHA 1VKRA 3NNDA 2JVKA 1QKKA 3Q41A 1WPKA 4EUKA 4MR7B 5KQLA 3QEKA 5F0HA 1USIA 3W9SA 4XICA 4G0OA 4KMRA 4Z4CA 4Z4EA 3F0CA 1HF0A 2MSKA 3BQZA 4EYGA 3M6MD 4RK5A 3QPSA 3H5TA 4ZYLA 1ETQA 3QLTA 4F3TA 1BL0A 2B63J 1JGGA 2LIVA 1ETOA 4MLDA 4D5CA 1NTCA 2XSDC 4RZSA 3CS3A 5EZGA 2ID6A 3T6KA 4Z9AA 3DCFA 4RS3A 2IPMA 1BDHA 4J19A 4RK1A 2OENG 3M3YJ 2PUCA 1Z15A 3H75A 4Z9BA 3GBGA 4MYRA 5TPZA 4NQRA 3G1MA 2IAIA 1JUMA 3Q0VA 4X6AJ 1Z0XA 4D6YA 3UKJA 5TQJA 2P9HA 5BR1A 5GQSA 1ETYA 2X6OA 1GT0C 4A3IJ 2FW0A 1TWFJ 1ZHHA 3HO1A 5EWJB 5EDNA 1MBKA 4A3CJ 4DN6A 5E3NA 3ZQCA 3JRFA 4AYBN 1D1QA 2HOAA 3EAFA 3RZOJ 2B1JA 2LFBA 4PEVA 1NATA 5F04A 3LFTA 3BTLA 3TD9A 2L7ZA 1NXSA 4DQDA 3HGGA 2WB1N 1Z12A 5J1RA 3A10A 1TJYA 1NXOA 1GV5A 1FFSA 3OQOA 3TEDA 4YP9A 3BILA 2O20A 1AU7A 2NUBA 1DRJA 5JLWA 1YIOA 2R7ZJ 4XFKA 1VRVA 1JJ8C 4XXHA 2CJJA 2DN0A 5M5XJ 4MS4A 2XB5A 4MLOA 3OIOA 2R48A 4A3FJ 3S1NJ 2TRTA 1A2OA 4RY0A 4ETIA 5IULC 2EZHA 1MBGA 1ZK8A 2XDYA 5TQ0A 3A02A 1Z2EA 5JNWA 4QYMA 1MB3A 3C3KA 3S17J 4YS6A 3Q0UA 3HOVJ 4DADA 3LUAA 1IUFA 2E2IJ 4NICA 5GOTA 4W5RA 2PUAA 1AB5A 4MQFA 2RJOA 3NNSA 1WH7A 1RESA 3ILHA 4B09A 3H6HA 3LUCA 3MQ4A 1PNRA 3IPAA 1LJLA 2CQQA 4Y7NJ 4BY7J 3JVIA 4UUSA 1TM2A 2DRIA 2KYRA 2Y0SN 1PUFB 4TLLB 2JA8J 1FJLA 1QP4A 2AYZA 4UUTA 5HKOA 5KWSA 3F7NA 1O4XA 3HV2A 6CHYA 1MIHA 3GL9A 5JS2A 4M88A 2JMWA 3OLXA 4GNRA 3G85A 2L17A 1ZAYA 3MN2A 5F0FA 2R92J 2MYNA 3HBLA 2K9QA 4QIWN 5JLXA 3SM9A 3JTEA 5IBQA 2A9QA 1USGA 4W97A 2TCTA 3T95A 3S2HJ 4IRXA 4PZ0A 2MW8A 4IILA 3LUKA 1ZGZA 4H60A 3JRDA 3KKEA 3IH2A 1U04A 3KHTA 3IP7A 4KVFA 1M5UA 2JB9A 3SQNA 1U78A 1EFAA 1UHSA 4JP1A 2DA3A 5EG0B 3ROFA 3L1PA 4V2FA 2E4YA 3SAJA 5KI6A 2EZKA 2Y9ZA 5C4XJ 1DP4A 4KV7A 2HQ5A 3BR6A 5EGOA 2EH3A 4MR8B 1BA2A 1QO0A 4A3KJ 2IKSA 3QEMA 3I5AA 1L5YA 3CTPA 4MRMA 2PMCA 3RVMA 1QVUA 4G0MA 5FWXA 1Z18A 1JFSA 4KQ9A 4HNVA 3LTEA 3HEFA 4MS1B 1Q1VA 2P81A 5DTDA 4HNQA 1ZH2A 4M3EA 2M1ZA 3GT7A 3OQNA 1H9CA 5TPWB 5EF6A 3LUHA 3JRIA 1XC5A 1JKQC 4GFBA 3N53A 3RVJA 2DA6A 2JVJA 1YVUA 5FKNA 4Z4GA 3LUJA 1TMYA 4KK4A 2E4ZA 4D7MA 5E3MA 1RXEA 4YLEA 4S05A 3O1JC 2DA5A 5FWXB 4FE7A 2L2QA 2OPTA 1FIPA 2DA7A 3ROTA 1TWHJ 3C2BA 1NK2P 4O5AA 5M5YJ 5EWMB 3LKBA 3KJXA 5E3LA 2O9LA 4WXEA 5EGOB 2DJNA 4CYCA 3HM5A 3QQAA 4F06A 4OBBA 5C5EA 4PICA 4LRQA 4PE5B 3LSRA 5EG0A 1JT6A 1NXVA 2LP0A 2YUSA 4EYOA 5IEBA 4G86A 3HUTA 4JX6A 2Y9YA
chains in the Genus database with same CATH superfamily
4ESVA 1OASA 2Q5JA 4BQFA 5TF4A 2B25A 4P3KA 3NLLA 2XYGA 4LAFA 4I08A 5BYKA 1Q44A 2HZBA 3EPZA 3GZ5A 2R6AA 3I6ZA 5EUBA 2QEXI 1P77A 5E9JA 5JFOA 3ZDAA 2VF4X 1WY7A 5D8KB 3P9ZA 1RS0A 1WMBA 3GEMA 4ROSA 3V7RA 1XVIA 2WHRA 3BL5A 5HS6A 2HMTA 1ENPA 1TRHA 2P4EA 1GG5A 3RTBA 1X2NA 1TQ6A 5TY0A 4ZT2A 2UV1A 1PEDA 4F4CA 1QBJA 3Q98A 1P80A 3VI3B 2M30A 2HPAA 2QQEA 4BDTA 4P6VF 1O3TA 1CRQA 1MAVA 1CE8A 3KLPX 1KYWA 4MWGA 2EF1A 4NBKA 5DKFA 3T9DA 2VF7A 1SKYB 4BMXA 1NVMB 1NVAA 3CN9A 3HCRA 1A9ZA 1AUQA 1H1DA 3NU1A 4GT1A 4MW9A 1ULBA 4MIYA 2HFHA 4R7ZA 3SDSA 3Q11A 4N54A 3DEKA 3I3SR 4TX1A 5F6FA 4EQZA 3V4SA 2GZWA 4M3NA 3L6UA 5HJ2A 4KU4A 3X3HA 2CNWA 3BWYA 3O26A 1ZA2A 1K06A 4BJHB 3MEXA 1ZNWA 1A5TA 3S44A 3WTBA 4TYWA 4M83A 3PXCX 4ZC3A 5I9NA 4KAFA 1STOA 1E3DA 1GV1A 1YRBA 3I2GA 2ZJRF 4P33A 4QOFA 1EVIA 2PQ8A 2QRZA 4ZAFA 3Q5EA 1ULTA 5FORA 4E7PA 1JQBA 3VOTA 5GJVC 5ES4B 3R3JA 4UDNA 1GWNA 4CQLB 1S6LA 5KYXB 2ETVA 4OLFA 4DVGA 3NHSA 1RPJA 4RTMA 4EEFG 1YDGA 2H5EA 3EE6A 2YX1A 5EL0A 4CTNA 4XR4A 3Q7PA 2CXOA 4BGDA 4HX4A 1VQPI 2NYRA 2VJAA 4OTZA 4BO1A 1FLNA 1NU8A 1R0SA 3IC7A 4EFKA 3K6SA 1CRLA 3ICEA 1L4UA 1Y0NA 1HT3A 4FQ7A 3RTRA 3X0DA 2RVCA 4ETWA 5A2QA 4QVIA 3DWFA 4WXYB 5BN3B 4P36A 4F97A 4YPVA 5BMVB 3UMYA 3QG1A 1F5NA 2XB0X 3TLZA 3UBTA 3S2DJ 2Z57A 5J2UA 1J39A 4J2TA 1OYIA 3ROEA 4WLOA 2OTJI 3IB6A 1EBBA 3O4GA 4RHXA 4BMDA 2V55B 1FA9A 1QGYA 5BWOA 5K2OA 1FRZA 3LOQA 4NFLA 5D1HA 5KO2A 3DLTA 3AESB 1V48A 4M9CA 2OEPA 3HYRA 4N9HA 2B1IA 3NWPA 4UATA 1HMYA 1YZKA 4EA8A 3LSYA 4DILA 1JQ5A 5EZ5A 3IAS6 2ES4A 2CW7A 5ED0A 4N4AA 1PD1A 3OY2A 3COVA 3EQ7A 3ORSA 4RACA 5E1XA 1R3UA 3LECA 4M1QA 5EKTA 1TO6A 4LOLA 5J63A 3W4IA 5K7SA 1IV8A 1XAGA 4Z0NA 4TS4A 2HKIA 1G3TA 1XLUA 2HRRA 2H85A 4FNMA 1DQYA 1J5EB 3X1JA 4JJ8A 1N6KA 4DTCA 1YO5C 2XEDA 3A1YA 2ET6A 4TWZA 4YJ3A 4DRXA 3DE0X 3TTYA 2QX4A 1J59A 1RHJA 1TU3A 2XMGA 1FPQA 1B8VA 4HVAA 4ZCQA 2NSLA 3SBOA 3URKA 4YJ2A 1R64A 2FMHA 2CMDA 1NTOA 5E4TA 1QFSA 4I1YA 2C2KA 3W4KA 2AE2A 2JG3A 2CL7X 2ZI4A 1TUBA 1QX3A 1QWSA 3KTOA 4LY3A 1U0BB 2KZGA 4BKXA 4NCJA 3BG5A 1DVRA 1HF3A 3NXKA 4ZZ0A 3RKQA 1QM5A 2CN1A 4OY3A 3H9BA 4CHGA 5B1HA 1R9MA 3ZQUA 1FTTA 1A50B 4G23A 1C8VB 1DPGA 4P82A 1VE6A 2QB5A 3FPAA 4XIJA 4Q9DA 1XKLA 2IELA 5DHUA 5JARA 1E6CA 3AUXA 1QRYA 1SB9A 3KDPA 4GLJA 4MI9A 1VIVA 3RLFA 2QUFA 1SUBA 4YELA 4A6EA 1U0OC 4HVLA 4DWWA 1RETA 1XBTA 3C70A 3IUNA 2VXDA 3H17A 3ZWXA 2IIVA 5KNDA 1IWBB 1U2ZA 1ZNYA 1TJ3A 1SC4A 3HN6A 4B83A 5JANA 4DM7A 4NXNB 2A0XA 3D7MA 5JFRA 1VSUA 4FEGA 1A69A 4CCOA 1XEXA 5AVKA 5FOUA 4A73A 2IBSA 2ZSJA 2VOOA 1LVAA 4OU4A 3SYLA 3KKMA 2IPLA 3OESA 1KS9A 4HTAA 4MV6A 2IHJA 1DXQA 2JVHA 4ZDOA 2CW5A 2QDXA 4LBWA 2BEJA 1OXTA 3EMBA 2C5BA 1PDNC 1E7SA 1QZZA 3MW8A 4GYJA 4MB6A 3DKVA 5IAEA 1M6VA 3ICCA 2ISYA 3CLOA 2BEKA 1E79A 1WXWA 3VR4D 2YDXA 3AJ8A 4O4JA 2ZB3A 3RF7A 4M37A 3UG6A 1IBMB 3V7WA 3ABMH 2J48A 1A8UA 1U2RA 2VQ3A 2WUDA 3QWIA 1N6IA 5HE9A 3WHIA 1KQOA 4PGFA 4GUAA 2ODEA 2BXYA 2IA0A 3N2NA 4NZOA 4XH9B 3WHCA 4LQCA 3I6IA 2C98A 4BEHA 4MEXF 2HZ7A 4IHJF 4X44A 2GPSA 1SXIA 4EJMA 3IYLW 2LDUA 4AC0A 5AVQA 2RH8A 4A3LJ 3I4MJ 2R84A 1T4CA 2XPCA 3I9OA 4MQMA 3ZPXA 3BMNB 2WDZA 4RKQA 2ZWPA 4IGIA 5IVDA 3LUFA 1XRLA 3UJBA 2ZYVX 1VA5A 5AJZA 1BIBA 2BOVA 1T5HX 2EIKH 2AWOA 3RYFA 1VG1A 1JJ6C 1S7CA 1Z8DA 1MT0A 3TOZA 2MH2A 3AZQA 3E4CA 5LZ7A 4B1FA 1WQ1R 2GN9A 2GZRA 3K10A 3PHCA 3AUTA 4ZHQB 4WJZA 5HGJA 1FY2A 1NQOA 3GJYA 4Z7NB 3RAEC 2V7WA 3IBCA 1Y6JA 3QE0A 1R1VA 1W4BA 1FJGB 3MPOA 2ZS7A 4F12A 1A71A 5LU8A 1JEDA 1U5CA 1GL9B 2RAEA 1II9A 2O3UA 3GF2A 3G68A 3ISJA 3LG2A 3MUEA 4JHXA 4NHJA 4LX8A 3V9AA 2P5YA 3WIDA 3BM5A 2V9VA 2R68A 3DMTC 1O6BA 3RQ4A 1X8LA 5E6SB 2NTVA 3GEIA 3H5AA 1XCLA 2N3ZA 4EW3A 1JPVA 4IRHA 4MKXA 1BMDA 2Y9MB 4YRCA 5DZSA 1ACLA 2W6JD 4LITA 3KJEA 3HCCA 4J0IA 3B3QA 4C5AA 4LK1F 3JRBA 2C0QA 4IHTA 3NBKA 1HE3A 3OZTA 5AXDA 5PGMA 3AONB 1KDVA 3N2KA 1T9DA 5E3JA 3ABIA 3LT2A 1N8SA 4C3ZA 3S8EA 2Q9CA 1CT9A 1L8AA 1QIMA 3R76A 2VOPA 1IXZA 3MQ0A 1JJBA 2WHPA 3GLKA 3FBIB 4MZDA 4QDJA 3V8KA 4X5OA 2WZQA 5CJ2A 2A1UA 1TL8A 3S2EA 5D5WB 5DU2A 4HXYA 2HF8A 2LBFA 4JBGA 3UAOA 1FVOA 4AMZA 4DT1A 2E2WA 2P7VB 3GFQA 3NQ41 4ND7A 1P1HA 2M4GA 3L6OO 3KLBA 1ESNA 1UAYA 5HF8A 1B9NA 2WMDA 3UT6A 4RSHA 1V16A 2NZXA 2XQJA 3HUFA 4R9SA 4BN4A 1JV2B 1BEZA 2JDID 2YMMA 1Z7UA 3ODGA 4INJA 1P0PA 4OATA 4RK4A 4YJFA 2CQXA 1T6SA 4EF5A 2RQPA 4LVOA 3GYHX 4KR7A 3SE7A 1G5TA 2B2CA 2R4QA 1T2UA 3DZIA 1GGEA 1BE6A 2D4HA 1CR6A 2D8MA 3DZHA 5F0CA 5L3DA 1CQJA 3LWBA 4URZR 5HEKA 3MJSA 5BNTA 1IVYA 5DNCA 3THXB 4LYFA 3WISA 3H04A 4GO1A 1TNSA 3PDUA 1T8TA 4AJ1A 4YX9A 4ZOCA 1EWRA 2OO5C 2WA1A 4C7MA 3UXEA 3WTVC 4AUMA 3PTLA 1W47A 1ENZA 2RI6A 2LYCA 1RUNA 1G7CA 1M5TA 1W5BA 2G0EA 4M38A 4ZIRB 4ZA2A 2IYZA 4JU8A 1JIIA 4JI6B 4NDZA 1XD9A 1ZLJA 2ZT6A 1PLJA 2NM0A 3AUKA 3CIFA 3R6DA 3DFIA 1DBRA 4LA4A 1FDWA 2DPLA 4WCDA 1RQRA 5JROA 5CM8B 1TQDA 3QXHA 3O91A 4GS5A 3OE7A 4YUVA 2JWTA 1DI0A 1QS0A 2PA0A 4QULA 4B73A 1JHOA 6ABPA 2ARKA 3L1HA 4WZAA 2MABA 3DE5X 1R16A 2VJIA 2PS9A 1OCTC 1YE5A 4P80A 5CEEA 3LSHA 1KYXA 3FPSA 4LC9A 2Q0QA 5C3EJ 3RFCA 4J9VA 2O54A 4EK9A 5D5PA 4CVNA 4ABYA 1BNCA 3SS8A 1SH7A 2X7HA 1JHXA 4RQTA 2PAAA 1JZTA 1ZW1A 1OU4A 4WKGA 4YV7A 1U4OA 2JVGA 1YH3A 1Y1VJ 2GK3A 4KR3A 1YZ3A 5KQPA 2DWOA 2P77A 2IZZA 1EX7A 3RQSA 5AKLA 4KHPB 5CVTA 3R44A 2GZHA 1DC8A 3B5IA 3ENQA 3B9RA 3OHMA 4M3FA 3R3YA 3HYSA 4MKGA 2JLXA 2Q6KA 4EY7A 4ZCMA 5CVVA 1IH8A 3KT8A 4OI0A 5BRAA 3PQ2A 4KLAA 5KSYA 5SV2A 4FIDA 4EF4A 3M34A 4UBLA 2GLOA 1PSWA 2CYCA 2HJRA 4MLPA 4BP8A 3ABZA 4JKYA 5IXJA 2I6QA 4DY6A 3EIQA 1G21B 1TTHA 2DULA 3R7BA 2XLBA 3MINB 4OK3A 5L3SB 3DZFA 2IEBA 3C4VA 3R7FA 3CF0A 1TC3C 1UXJA 3LX8A 2ZVDA 3OZEA 1SFKA 2LTPA 2ECPA 2XIQA 3PSHA 1Q2XA 3N8KA 2W37A 5TR9A 1D6NA 1ZVKA 5DTQA 3IXQA 2BFBA 4KW7A 1DAGA 1ZAOA 3P2MA 3D6MA 2XKKA 1Z6PA 1S0UA 1X1CA 3N59A 4Q3BA 5G2OA 4URVR 5DNYB 4JELA 2X0FA 1FSPA 1X3SA 2LRHA 4ZCSA 6Q21A 4IJMA 1L5HA 5AONA 5E6RA 2W2LD 3L06A 1GGKA 3MWJA 4F6LA 3HM2A 2WTMA 3TLJA 1J33A 1OSNA 2YWGA 3OEED 2LNBA 4F4FA 3EPKA 1KGDA 2AKEA 1JZQA 2HRZA 1X92A 4IM7A 4N5HX 4FDAA 1UZAA 3JU3A 4CLXA 1X39A 2LKPA 2YIJA 2VPYA 3SQWA 1YFHA 3E6MA 2IXDA 4LF4B 4HF0A 4J76A 4RK6A 1MH4A 1P61B 1PRYA 5JNUA 1HEUA 5MHTA 1V1JA 5TT0A 1Q2UA 3GTPJ 1H0HA 4MXDA 4OHXA 2K4BA 3MWMA 3ZMZA 4JXZA 4AW9A 3ZOBA 4L73A 3IBGA 3BWBA 1S6YA 1T1EA 3ZWNA 4A5OA 4US2R 3CG0A 3HWRA 2I3GA 2Q7XA 4GL4A 3KEGA 4H0NA 1K6MA 1N4DA 2PO5A 4JLJA 3PA6A 4JR0A 4BNNA 1NIJA 1VPLA 3V1KA 5IJXA 2QUJA 3L8GA 3MKZA 2OHOA 1IK4A 3DLAA 3HGMA 2VYFA 4C6TB 1QP8A 2IUSA 4LNHA 4ZVOA 2DCUA 2VAVA 5H9VA 3DG9A 3USZA 5DEQA 2F5DA 3IKVA 4LJ9A 4H6WA 1FU8A 4MH0R 1ESEA 3GJ8A 3HLYA 3H9GA 2G7MC 5D01A 1B2LA 3H2YA 4PYRA 4XSVA 2BZ1A 1LWOA 1ZLYA 3P52A 4X90A 5BO5A 3V8BA 2HA4A 4BY1J 2EINH 5CMLA 4R2LA 4RGYA 3RFXA 5CDFE 3KZOA 4IRGA 1Z7GA 2WSYB 1BW9B 1E7RA 1H69A 1II0A 2IDZA 3UWOA 1RZVA 4X1EA 4F6RA 3A0UA 2JPBA 2XCOA 5JS8A 5IZ4A 2OFFA 1T2DA 1JE8A 4YFNF 3WADA 3WLOA 4LV6A 1KHTA 3JYHA 1E0DA 4ZYUA 1CEEA 2NU8B 2XB8A 3EISA 4YXWD 3PL1A 2YQ5A 4I7EA 4KFCA 4ISBA 2QQ0A 4V0KA 4G6QA 1H2WA 4WESA 2QQBA 2FPIB 4HMOA 4QUKA 1C9JA 2J9XB 3T06B 2Y05A 3H0DA 4UU0A 1I7SB 1TZJA 5AHRA 2O3SA 2LZ0A 3HMQA 5EOVA 3V7FA 2IODA 2BTEA 1Z16A 1D0ZA 2Z3YA 1UOQA 1N1DA 2E4VA 3DZBA 3ECCA 4NZ9A 1YITI 4AIJA 3AUAA 2G5GX 3P8ZA 1PR0A 2AFHA 4PYLA 2O3RA 4HZIA 3K05A 1K89A 1W88A 1ZD1A 2JCXA 1QR6A 1WABA 4MUBA 1J07A 2OBFA 3FA2A 3KXKA 1GUUA 1ODTC 2P8SA 3A0BC 3N2YA 2P9FA 1R9TJ 3FY4A 3H0CA 5D4SA 3O2NA 5TJHA 1BQ4A 2PMZN 2JAXA 3CCVI 1I5EA 2C0PA 4BB9A 1OC2A 3IDZA 3INTA 1XG1A 1DIGA 3D7NA 3K1MA 3NWTA 1IZ8A 5L3QB 1LNSA 2JIDA 3WL4A 3WY9A 1XJ0A 6REQB 1D1TA 1T2FA 5GVSA 4ZFNA 4UEJA 1ZFNA 3CKYA 4GP6A 5J5AA 1BW9A 2VS1A 3GYGA 4M6WB 1ETWA 4WZZA 2BGGA 4KYIB 1UBSB 4IZOA 4RM2A 2HL6A 3ELYA 3ZTWA 4Z6YA 1MH9A 4WEQA 5JASA 3EODA 2V7FA 2C3YA 3O75A 1OWMA 3H11B 3IEKA 1G20A 4OK5A 4AFNA 3B9PA 1BI1A 2PUHA 2VC1A 2WKPA 4WFQA 1EINA 1NASA 3GLQA 4YI5A 4IMJB 1U7PA 1VZ3A 4NHOA 2EIXA 3BVPA 1WZUA 2OMKA 5LHHA 4LXUA 5AH0A 4FYMA 4MVJE 1N2CA 4L2IA 1GRNA 1MSFC 2AXEA 2R2GA 2GCOA 2YHUA 2EJUA 2J9RA 3F8MA 1PE0A 1YACA 3CE9A 4N0DA 2SKCA 3BPSA 1TM7E 2YFHA 5CNIA 2ELJA 3UCXA 1VMIA 3HXMA 2AC4A 5M5BA 3EX7C 5BN5A 5F2OA 2Z5VA 3ED5A 3MCZA 2G0AA 4QDTA 2DBRA 5BSUA 2X40A 4C3JJ 3EZFA 3I9FA 1PWZA 4HH1A 3U3RA 1XMXA 3Q8WA 1MQ8B 3DMDA 1TK3A 4L75A 4LPSA 1K2WA 1YK0A 4U0KA 4CMIA 3TG8A 2NMVA 3IVXA 2QTAA 5K20A 4N47A 2P9CA 4Q9KA 3K5PA 1BYIA 2P2DA 4M86A 5LBTA 4RWEA 1VI5A 4D3SA 4YXFA 2PMHA 5D4RA 1J24A 4J8PA 5TMPA 4GX5A 1NBEA 5AMXA 4OA5A 2CRGA 4QXQA 5DV5A 3A01B 1YFLA 2AQ8A 2BHTA 2ME0A 4QTTB 1E2GA 1G1MA 1RKBA 4I09A 4HGQA 2DQKA 2NTEA 1U9OA 3EDRA 5AT1A 2C5EA 2D00A 3IR7A 4OGFA 2QUBA 5CAEA 3TOCA 2JRCA 1FS6A 1K8RA 3OZXA 3OS2A 1BG6A 3D2CA 1YZGA 3ISTA 2FTKE 5CT4A 2P9ZA 1C0KA 4XWWA 1XNQB 1Y5RA 3G8DA 3D64A 3Q2KA 4NZMA 3SOZA 3OT5A 1F3OA 4G5GA 4X63A 4O0MA 5F98A 2CDRA 1V1MA 5ECGC 5KTKA 1RKTA 2YWRA 4DYRA 3JRAA 1RZRA 1BEEA 3E18A 3ZP5A 5FNVB 2EKDA 4G5FA 4RPCA 2M45A 1IRGA 5BQ5A 1NHGA 4DABA 4C7VA 5F7JA 4IHVA 1WOMA 5I51A 4K9KA 3THYA 5L3SA 4BGEA 4IKOA 3RU3A 4EMSA 4DQVA 2HOTA 1E5VA 3HPGA 4GCVA 1SC1A 2XCRB 3BJIC 4AO8A 1GRQA 4Y7CA 3SEAA 2V1UA 1RP1A 3CQZJ 2FQWA 3JV7A 3FM3A 2IOFA 3WBJA 2EV9A 5AM0A 3A25A 1JJFA 3KPWA 3P26A 3T8YA 1ZP6A 4L8WB 1VDMA 4MVWA 1A8QA 1JQKA 1PFVA 4QICA 4B33A 1PVOA 4TWJA 1CZUA 1XHLA 1QFYA 1SUPA 1XQWA 2BONA 2X76A 4YRTA 5DWQA 3SMQA 2PMDA 5BVHB 2ZRQA 1WDKA 2BKLA 4RZ3A 4WXPA 1N32B 2JFHA 3ZWYA 4JK1X 3N2GB 5DLQC 5CDYA 5BNGA 1XP8A 4DBVO 3LDHA 5G4LA 1NP7A 1SIBE 3WB0A 3WS7A 1IPHA 4ARAA 1B0PA 2DG2A 1R4MB 1Y8RA 2ZI7A 3C45A 3LXMA 1L5VA 4IIXA 2H09A 1S3GA 2YZNA 4A0GA 2GEKA 3ZX5A 1PVEA 1F1BA 4KT5C 4BU2A 121PA 3TS1A 2G88A 4YRZA 1Z74A 5H4HA 2IWRA 3CEPB 4J0KA 2CEKA 4AJ9A 1QS0B 2MSCB 5L6MB 3PD7A 5JO0A 1X2MA 3DFFA 4B85A 3UT5B 1U3EM 1E4VA 3DEIA 1P8AA 1PVVA 4NYMR 2ZAIA 1VYHA 5BRJA 2O9JA 4HAYA 3T34A 3E1KA 3C24A 5L3ZA 4K88A 4NE7A 1SXGA 1V8OA 3GNTA 5SYNA 7REQA 3N76A 1NI3A 4HLCA 3RVSA 1G4HA 1T5SA 3H3UA 1T1JA 1V41E 3L1IA 1T4DA 3QYJA 5T41A 5IU6A 1Q84A 1N75A 1PP7U 4IUBS 4OJYA 5ILQA 3K2EA 4FFWA 4HNHA 1PP8F 2IITA 2X2OA 2RGAA 2XRNA 1P2UA 2HPVA 2JA1A 1GKIA 2HW8A 1W7PD 4L9SA 1Y42X 4EI7A 3DVQX 4XB1A 3VNRA 3V8LA 3AO0B 4YCMA 4LGMA 4F3QA 1C9MA 1KPHA 1JLKA 2R6R1 3GLXA 4UCQA 4WDQA 4OI4A 2PKEA 4E5DA 1KR2A 4DA6A 3HXQA 1DC5A 1H2YA 3X2QH 2NW6A 4LRYA 2C5HA 4KQ6A 3QOPA 4P35A 2WV0A 4G7OF 3BZWA 3L46A 4K26A 3ABTA 4B3GA 3AEUA 1SKAA 4PLCA 5DSZA 4UC0A 2CFXA 2UUBB 4DM4A 4DUGD 2ST1A 3DMTA 2O8CA 1ODFA 1N3YA 3P94A 1OTHA 2D5IA 3ADOA 1WDTA 1WEKA 4R7TA 3TVTA 1TCBA 4Y6SA 3Q6MA 2V0NA 1X7HA 3Q9NA 2BMVA 3HCFA 5EE1A 1WF6A 1E69A 1JKPC 1XHEA 1W94A 2VOEA 2JGMA 1DFHA 5DN6A 5IN4A 5FFFA 5L3FA 3LS2A 4YALA 1FMCA 3UXMA 1BWQA 2AEFA 3BTIA 1R0CA 4HKTA 4YA6A 1IBSA 4A8PA 1CS0B 2B2XA 3LDFA 2BLNA 3QV1A 2CU7A 1EK6A 1BR1A 3PIOF 1KI3A 4IIDA 3R7NA 3TZEA 3V1NA 4D98A 1F17A 3E8MA 2XA9A 4HX8A 3LZDA 3P9IA 5D6OA 5K03A 3EK2A 1O4WA 3ABUA 1HKTA 3U09A 2NS0A 2XASA 5GWXA 4ZJYA 5KDOA 4GEKA 4KPUA 1LDJA 2I2WA 5F3DA 2QU7A 1CJVC 3GBVA 4O08A 4URUR 2OYCA 3RO7A 3W4JA 2FXAA 3WNQA 2WUVA 1GG8A 3R8FA 4CUGA 1Z62A 4LHVA 4YO7A 2CXPA 2W2TA 1KWGA 2CMHA 2COUA 3ROPA 3WWZA 4BBJA 3A58B 2ZW9A 3FTDA 1ZLKA 2JBHA 5AKIA 5JAMA 4C1NA 2RGVA 1OAOA 2UUPA 3E35A 4TL9A 2B5WA 2J4CA 4ABZA 3PQCA 2JIZD 4X71A 2OXFA 1DO8A 2P6NA 3ZGNA 4B6OA 2E6UX 4I55F 4PQEA 4DR4B 2ZAOA 4LBZA 1J56A 1JH8A 2IYXA 1U8FO 1T39A 2DJIA 3WQQA 5FUQA 5JFTA 3RIMA 2HKOA 1E1QA 2FWJA 1RHRA 3QGMA 3OJCA 4YMIA 3R6LA 3RYHA 2JGAA 1DQRA 2UUAB 2XCUA 3A7DA 5DWDA 3WLNA 3C6ZA 1N0WA 2OXRA 3TL2A 2AL7A 2AG1A 3G2HA 3MK31 3SY8A 5TSDA 1XFAA 4HWGA 4ACBA 2I3AA 2IW3A 3FSGA 5HDQA 2XGOA 1AHDP 4DCPA 4GYIA 3VDXA 1O4VA 4Z4QA 3FWZA 5FBVB 3CPSA 4LGYA 2ZRMA 4POAA 2X1DA 3ZQQA 2A3SA 2BFWA 3A4TA 1OZFA 1C8KA 1FS5A 4REQA 4TV9A 5G0VA 1CUGA 4DBRA 2EQBA 2E71A 2C57A 3MBKA 5SY4A 4FW8A 3SMVA 2F3QA 2O8DA 3PC4A 5B6PA 3O21A 4C7KA 4D0RA 3W2VA 3JARA 1LKXA 2OKCA 1L7QA 3N7AA 3PU6A 3M3HA 3M07A 4NJMB 2E36A 3EXHB 5IY5H 1P2FA 1DGWY 1HYHA 1FMWA 1M66A 2E2HJ 2HVRA 1KNXA 1VRCA 1XWFA 2D7JA 2IYLD 2QAGC 2WABA 2AJLI 3OE4A 4HDNA 4X95A 2Z04A 3TDKA 4AJ2A 4B3JA 4OAZA 2CNBA 2FSPA 2F5VA 3FGNA 3WGQA 1KJYA 4HT3B 2F1HA 1GAQA 2J31A 3NFYA 3JR7A 4TMTA 5FEMA 4MR9A 3NJRA 2W7NA 4B8ZA 4N6GA 3U6KA 1Z34A 2WAEA 2NSDA 3ZCOA 2OLKA 2CJWB 5KVRA 2QTLA 4LHSA 1FRFS 2J0QA 3DS8A 4HLNA 2OZVA 1RACA 1RWOA 3P9SA 4UUMA 3RT9A 2XZLA 4OQDA 5JD6A 2GJSA 5HF5A 3E22A 1LTQA 4OG2A 5KYGA 3RAJA 4BPRA 2GN6A 1TAUA 2JASA 1SZCA 4EG0A 3HB0A 2BF7A 2ROQA 5K0BA 1HT0A 1H3NA 3FMFA 3B8HA 4Q18A 1WWXA 2BW3A 1TQHA 2DQSA 4EDHA 1IB6A 4Y7DA 1MRZA 2Z1NA 4HF7A 8ABPA 4DIBA 1Z7LA 4OH1A 4B35A 4JIMA 3ZMTA 4EW2A 1BJRE 2HR3A 2XPWA 2OILA 3AESA 1Y4ZA 3W2WA 3AHEA 1MD9A 4MEJA 2VDPB 1QTIA 2OZLA 1F2UB 2AXTC 1WU8A 1PQPA 3TMOA 1CY1A 1Z7WA 2WU0A 1YLFA 3TRIA 1KP2A 4GI1A 1GPJA 3AXTA 5CA1F 2C2OA 3RKUA 1PT8A 3MB5A 4CDNA 2QL6A 1CHDA 5IK2D 3AINA 5IVKA 2GEDA 2W93A 4R2JA 1NVXQ 3H97A 2UXCB 4B0PA 5JAOA 1BCRA 3K3PA 3H13A 2VP5A 1J90A 1VJ5A 1MTZA 1X1SA 1YZHA 3KQOA 1V7PC 4PS1A 1ZDMA 2HXSA 4MUMA 1TQ4A 3FRJA 4I5EA 3GG9A 1OC4A 4QLOA 1YUBA 4QBIA 4XLCA 1G2HA 1AN0A 1KARA 2BSAA 5EP1A 4MV5A 3MWEB 1ETVA 1SIWA 1N2XA 4UFPA 5EY5B 2JA5J 1O94A 4QYWA 3HCEA 4PFPA 3D8RA 2X4LA 4M46A 1ULZA 3LKDA 3A32A 3SZGA 3OC0A 3P1JA 4A0FA 2Y1FA 2IZ7A 2OG1A 3T0IA 5CDTA 2H1SA 4IVRA 4AIRA 5K8LA 4JI2B 4LJ6A 2AX3A 1F8FA 1BS9A 2DOAA 2PX3A 1L4LA 4J3JA 4NB5A 3GDFA 4D9IA 5KNDH 4FCCA 3KQKA 5DT9A 1RFLA 4PONA 2ABWA 1GEGA 3CJRA 3G2KA 3W8RA 1FSFA 5L53A 2RGUA 2Z5LA 2OWDA 3K1JA 3ZJVA 1DB3A 4CR8A 2IYSA 2VHWA 3G0DA 1MW9X 3OHPA 1A88A 3PGKA 3QFRA 1ESDA 1TE2A 2D0PB 4NE9A 2WG1A 3MJHA 2ORWA 1PW7A 1SUCA 5AKGA 5C44J 2D3WA 3RSQA 3DF7A 3CCSI 4MVYA 5JVDA 1KBZA 4N49A 4CYMA 1QBGA 9LDTA 4KJXA 2ESNA 2VWHA 1QVTA 1DCMA 2Y68A 3VR3D 1K7XB 3EY4A 4JEUA 3RD5A 1P0FA 3M3DA 1NJ1A 5CYFA 1G21E 3K4MA 1XU9A 1XCJA 4KQKA 2Y2UA 3UK1A 4KEAA 1G1AA 1V71A 2L69A 1EQ2A 1G6NA 2O2DA 4L4RA 4O2AA 3SF0A 4BASA 1JEJA 3PP8A 3QOYA 3W1EA 4RLHA 4EB6A 1MFPA 4RPIA 1ZW6A 2PDAA 2Q5EA 5FKKA 5B3KA 1Y3IA 4TXJA 3W5SA 2WQ7A 2W2VA 4P3NA 3BJOA 4WKBA 1D4FA 3F7TA 4K9QA 1I13A 3HXKA 2PZFA 2UV8A 3EXEA 1M1ZA 2DC1A 5FFMA 5LMCA 3FFXA 2ZIXB 4EB3A 3P7NA 3F3SA 3ZKWB 1XJWA 2LC2A 3CJTA 4KAXA 2FHSA 3OS1A 5I6DA 4ARVA 1NVVQ 4RTRA 4J3NA 1QU2A 2HVQA 3MS4A 3PXXA 4HRXA 3DUFB 4MW0A 4RIGA 2FP4A 3VVLA 3NARA 1G7SA 1EE2A 1U2EA 1PQYA 3DWEX 4QHSA 4UULA 1AY0A 3F4BA 4DZZA 2OV1A 1DKNA 1FIAA 2D1YA 4FD2A 5EJ8A 3DV8A 5CHYA 2HGSA 4ZDKA 2CSOA 1L9XA 2GEBA 4DDMA 2PXCA 1QE3A 2E34A 2MFZA 1FJHA 4TTJA 4EFLA 2PJRA 1C5KA 5FWNA 1O96A 2EJWA 4OQMA 1EXDA 1OGYA 1U3GA 3O7MA 4R2HA 2HXGA 4QREA 1N9GB 2RD2A 3PEEA 3WZ2A 4WT7A 4LJYA 2BFFB 1QC5B 3PIDA 4L02A 4GKVA 4WK2B 2HDWA 4BO6A 3OWTA 3P97A 3QW2A 3KQVA 5GONA 2X9DA 3CT4A 2MG4A 1EU1A 4MVJH 5FJIA 3LYHA 3O0DA 1N5JA 3O8BA 4JLUA 4MA0A 5AJTA 3UJ9A 4BAGA 3PEWA 1IZ9A 1CEYA 3FUCA 5C2JB 3E9EA 1XJQA 3RFTA 2OF7A 3H2IA 3FTPA 5ILVA 1BOAA 4BWYA 3OLYA 3UWMA 1GGJA 1KZ7B 4N48A 1TJPB 2VP9A 2KQUA 4QPOA 5HUJA 1E3QA 4DUGA 1O08A 3LUPA 2B9SA 4RHYA 3GCWA 4PFOA 5GAGJ 2AQFA 2AJDA 2WNIA 1LD3A 2Y8EA 4CKCB 3K09A 4C2TA 4BIMA 2ELKA 4N4OB 2G07A 5JQWA 5L9AA 2WBMA 2XRFA 3ZLBA 1Y80A 1A9XA 4IDDA 3WLAA 2HNAA 4BLVA 1SQ5A 5IVPA 4W1PA 4ZODA 1CUUA 4C4PA 3AG1H 1XS9A 1P9RA 5FOXA 4PJJA 3JD2A 4DWJA 3WJ7A 2FVYA 2FNPA 5CLGA 1Z2OX 2KIFA 1XL1A 3V6MA 4EO7A 5CVDA 2XROA 2VUHB 4UAGA 4EHAA 4C4ZA 5JSYA 2Z4TA 4IX7A 1H2HA 2FSGA 1Z6AA 2G6BA 4M0MA 4MLZA 1JR3D 1OBOA 4FS3A 1SUIA 5LLSA 3EFEA 5CYVA 3HDTA 3WDSA 2FMFA 3ZYCA 1KEEA 5F33A 1J8YF 1EV7A 1S72I 1AUVA 1CY2A 1N2SA 1X86B 3V8VA 1L3CA 4D5GA 4DMMA 1O8BA 5FT9A 4EFMA 4INAA 1KMIY 1OR7C 2R0QC 3ORRA 1T6BY 4FILA 4JUDX 4GVXA 1WP9A 3WGJA 3TB6A 4K0KB 1Q7EA 4MS3A 4GOXA 2H2IA 1V4RA 2H2WA 1YBFA 2YJTD 1DG3A 3GEPA 4P3YA 2HRDA 5EE9A 1UJ5A 3KG2A 3TO9A 5GTIC 1P6QA 4ZRMA 4OJMX 4ALNA 4O59O 4PN3A 1NVDA 3TRJA 1I94B 1BD4A 4F5YA 1ODLA 1UJ4A 4MVJA 4ALMA 3AJDA 2HU9A 2HTSA 4IOLA 5BXQC 3TLGB 5KKCA 2X2PA 2VOJA 1QDEA 3MF4A 5G0WA 5T7BA 1LE8A 5EGSA 2O0YA 1UKVY 2G77B 5JZMA 4JGIA 4AWBA 3ZS8A 3TX2A 4EABA 1GV0A 4JJKA 3GVHA 3VSDA 2FE3A 3SFIA 1X6VA 1JLMA 2HQOA 1MAAA 3BD7A 4M1EA 3NV9A 1Z4OA 2ISQA 4BWGA 4EITA 3MTIA 5DCUA 5LZ4A 3DF9A 1SVMA 3PF8A 4J6FA 5HLHA 4N7BA 1J1IA 3PQKA 2CV2A 3EUAA 5T6BA 1V9SA 1T2EA 4H7PA 3ROKA 2Y4OA 1VMAA 5DRTA 5JSKA 1N36B 4GM4A 2PMUA 1Z4KA 2VPXA 2WF9A 2X8LA 1W25A 4KXWA 2DWPA 4N0PA 3KFXA 3D81A 4UKDA 4Y2VA 2VDQB 5E9AA 5LZ5A 4EKNB 2WRZA 2ZI5A 2QWWA 2XLCA 5HK9A 1Z39A 1VDZA 2W48A 3CONA 4NSNA 3NS7A 5EIXA 2ZAYA 3FXRA 3BG6A 1IEWA 5I5GA 3C98A 1T24A 4QBGB 4OI1A 1LVGA 4TKUA 1QMPA 1L3BA 1N7IA 4WCVA 1SKBA 1U8BA 3ILYA 3MTAA 3CBQA 1YAJA 2WMYA 4IFTA 3O8QB 3Q3IA 2Q2EA 4KI0A 3BQ9A 4EM1A 2LR8A 1D3AA 2DYRH 2X8BA 2VJMA 5EEAA 3GFBA 2C99A 4I5GA 2X9LA 4ODIA 3NHAA 3WO0A 3VHXA 4AECA 1XMQB 3QU7A 4IL5A 1UELB 3J7YJ 2IKQA 3FHZA 4TPKA 1XZPA 3OM9A 4FR5A 4KRFA 3R20A 5FHQA 2OHXA 4J7XA 4RK7A 4ZVRA 2R7XA 1ODSA 1ZM4A 1FL9A 4G97A 4NP6A 4OB6A 4MMZB 3F6RA 2G8LA 2OY0A 1T8RA 4DJJA 1IBKB 1B8IA 1ZQ9A 4GVPA 4XM3A 4GDFA 3BCSA 3P71T 1M0WA 2B2NA 4FGLA 4GR4A 2DYKA 4JLNA 4Q4AA 4D8UA 1PJBA 2BY1A 1XRMA 4IG4A 1SAYA 1U4SA 1VE9A 3QVJA 5TRTA 2R93J 3MT9A 4UCFA 2GAIA 2WU4A 2P3LA 4Z5XA 3PFNA 1MX3A 3DEZA 3CUUA 3HCOA 3IXMA 1P9WA 4H4DA 5AKJA 4ZTUB 4EH1A 3D3KA 4NU8X 5ITVA 4W9MC 3PFHA 1W0KD 1XUOA 1GSOA 2RHWA 3RBXA 5LB4A 3TNFA 2LGJA 4PPYA 4FGZA 3FN4A 3CPHA 1VP3A 3BT7A 3DMGA 2IFTA 3JWPA 4NVRA 5EMKA 1ZJJA 1GHCA 1OYVA 1B1BA 1U0EA 3O47A 1Z9BA 2VYND 3QELA 3U31A 2DP4E 4DJDC 3EEOA 4CEJA 4DYCA 5GOZA 2CLSA 2ZBUA 3A6KA 3HFJA 4FYHA 4GI2A 2DFNA 2CJXA 4IXTA 3T7DA 3B8EA 1G4UR 4UHDA 5FRMA 3GFPA 2M7BA 2WINI 1W7PA 4B17A 1B6RA 3OWXA 4DC9A 3BWGA 4JSYA 4ZZ3A 2PYIA 2HIMA 3KB2A 1HR0B 3WTSC 2N8GA 1PIWA 4ETSA 1P5FA 1M2FA 1KSHA 1XZCA 2Z09A 5DCMB 3NASA 4OQLA 5IK2A 5EHGA 1NT2A 2XGDA 1L4BA 3IOYA 2FOKA 1XZDA 2WAXA 4G2NA 2PS0A 4MDHA 3AI2A 3UWSA 2KRFA 1EWVA 2KSQA 2W5UA 4BNKA 5J2TB 2QVBA 1IJEA 4U4AA 2H1HA 3ET5A 4LXTA 1UPFA 2EQRA 1GGFA 2CD7A 2WAMA 4OLHA 3WDLA 4J29A 3UHPA 1DKRA 1T8SA 2PANA 2OXEA 1PZFA 2Q5OA 4KTTE 4LUCA 5E38A 1WMDA 2PKQO 5HFAA 2R00A 4OUDA 3LWZA 5AW1A 3T5DA 3HADA 1CIPA 3F3YA 3OFKA 1H05A 4MIOA 3P0IA 2SKDA 4OVKA 4YGXB 5DN9A 1T3TA 2B35A 2C9BA 4ZI2A 2B21A 1BE1A 3EDQA 4P3XA 4LMYA 1DTWB 2ZXHA 2I2FA 3T99A 2CXNA 2VJKA 2WYUA 3AJRA 3SYRA 3GLFE 2ZUDA 4RXTA 2CK3D 3V7UA 4EB8A 3PX7A 2QVZX 1RKWA 3BH0A 4PGHA 3KJGA 4A3BJ 1GU7A 2UZ1A 3NAZA 4KMFA 1OBHA 1TIKA 2PD4A 2HEGA 4G1BA 1RWKA 4IEFB 2BGNA 5F1YA 2EZLA 3WLSA 4CEIA 1MJHA 3GMSA 3OT4A 4K6FA 3VH2A 4N8DA 1JHFA 3HL2A 4B4UA 5KPDA 1MZBA 1L7RA 4IOKA 5A4MS 1QH8A 3R5TA 2IHTA 3NALA 4HDCA 5TQ0B 5T57A 5C35A 3PNPA 5HKKA 1P1FA 2FZWA 2ZS9A 1E9EA 4KUGA 3HYNA 5A5VA 1KGSA 2Y0SA 3BTJA 2H52A 2SICE 5K6RA 4XOPA 2VQLA 2EZTA 2XSJC 3L7NA 1RI2A 4NMWA 4TYQA 3SJAA 3GHYA 4CRWB 1BN6A 4B40A 2YXPX 2CUFA 3K0AB 6PAXA 721PA 5FTNA 2VXCA 1EWTA 5H1YA 3KWMA 4BB6A 2KM1A 1FSZA 4AIIA 2W2LA 4X1YA 3F5MA 3OTWA 3B1XA 1GKKA 2VG8A 4HDSB 2ACEA 1NI4A 4MVJI 1W4CA 2UVDA 1XCBA 1OJLA 3TM4A 1I2DA 2R7UA 4DUPA 2NRAC 1VKHA 4NAUA 2DMTA 1UKAA 2GBLA 3HFSA 1M72A 4FX0A 3ZMDA 2QD3A 2YJNA 4G89A 4JL5A 4KBYA 2QVCA 3BR0A 3UCEA 1L7AA 1KZ4A 1LFUP 2WUWE 4DRZA 1ZVVA 1DBVO 3QJGA 2I34A 3U9GA 1E9DA 1R5NA 4WCFB 4IX1A 1YT5A 4MQ6A 4RLSA 1V96A 2CJYA 5F3WB 3NHJA 2C6YA 2VAWA 2VHQA 3MWLA 4RIIA 3EXIB 1OH6A 1SIOA 4A6DA 5GPCA 1CDDA 2Z3VA 3A1VA 4HZFA 3I76A 5GV7A 3DV2A 2UXDB 3OQHA 4DOMA 1FJXA 1GEEA 3LX6A 4B2LA 1S2LA 2KLBA 3ZE6A 2GASA 4F4JA 3RC3A 5KNBD 3WTWC 3P9XA 3QBEA 1EVZA 4URXR 4MQEB 2V6JA 1X7GA 2Y31A 3RS2A 2ZYIA 5H6QA 5CB4A 2RREA 2BOLA 1E1MA 3QKIA 1DUXC 3V8NA 2AC2A 4XASA 1KY2A 3B51X 4KLCA 4EB6B 2AXNA 1PG2A 2R8RA 2Q4DA 4Y13A 4WCGA 3IPCA 3T1NA 3T3GA 2HPHA 3FXQA 1DIRA 4FHZA 3LO8A 1UFKA 3E05A 5ILSA 3OPNA 1J09A 1C0IA 2GZ2A 3F9CA 4GHWA 4R8KA 4UU8A 4G0UA 1SY7A 3FDYA 4FUTA 3D8UA 2Z99A 1CY4A 1DEKA 3HWSA 5A4AA 1OZGA 3ZDCA 4U88A 3WKDA 4HPQA 1GO2A 3LK6A 3ZWCA 4BEJA 1H88C 2WMNB 1C14A 1TKAA 3M33A 5TT1A 5I8ZA 4BXOB 2X4GA 2RHHA 1BGVA 3WLKX 2HEOA 3AHIA 2V96A 5FUBA 3H1AA 3VR5D 5KIAA 2M0MA 2EZIA 5DCMA 1EFDN 3HG9A 4FXOA 1OX6A 1DWPA 2ZJPF 2V7UA 2FFQA 3FYUA 3I8OA 5E1DA 1SRQA 5FLXK 3U0VA 5ERIA 1D6JA 3MYYA 1TKCA 4M8KA 5JXIA 2QW0X 3U21A 3WG9A 2FA9A 2EAUA 4Y2PA 1PKXA 1MPXA 4TV9F 3HGQA 3WTTC 3WL5A 3EETA 1MC1A 2P40A 2ZIAA 1DEXA 3CR7A 4O2AF 4Y2TA 2BN4A 3TGPA 3PTAA 4TZ0A 2ID3A 1IWOA 1QA6A 3AEQA 3GUVA 4O3FA 4R8RA 4LMPA 3SD7A 3L8FA 2O2XA 5CX4A 4GKBA 1D2EA 2QPTA 5IANA 4MAFA 3QYEA 2OB1A 2YJ6A 1FUEA 3N86A 5EMMA 4ZYZA 2IS1A 3ZWVA 4M1YA 1K75A 1NULA 3HTSB 3FVWA 2AX4A 3I6MA 3WTUC 4Q3LA 1RD4A 3PUBA 1LK0A 2AKAB 4JX4A 3WP1B 4YECA 3QPCA 1NNSA 2ZYGA 2KDZA 3HG7A 4AZ3A 4I1RA 4QFMA 4MO9A 2XNCA 2CD9A 2ERYA 3EQ8A 4N9QA 3ZMSA 2X14A 1CUHA 3CFYA 3EGVA 4ARBA 3L0ZA 1P31A 3FGPA 1VCIA 1B8IB 1UM8A 1R6BX 2OBYA 4OSOA 1ZIXA 3NOVA 1JDSA 4F9FA 1QPIA 1XZFA 4BL0B 2AOUB 2ZE5A 4TTVA 2OQRA 4N8EA 5A3SA 2VWQA 3K09C 4UMFA 1E5XA 3WTXC 2H08A 2XZOA 2XOKA 3ZHRA 5KOHA 1DV2A 1XCOA 4S24A 4HH4A 3BCUA 2DU9A 4JX5A 2Q0HA 2BUAA 1LBTA 2OFOA 2GBCA 1OLSA 2JAQA 4EPVA 1F51E 4EENA 3A6HA 3KOOA 4UCWA 1DDGA 4R1QA 1Y37A 1MMSA 2EBUA 5FB3A 3ZNOA 3V4PB 5DBHX 4B6FA 4YRAA 4DR2B 4JLWA 1JEYA 4EECA 3DTYA 3E8SA 3KU1A 1OLSB 2BMEA 3AR8A 4XJXA 1N92A 3KB1A 2J85A 1JT9A 1EH7A 2AOVA 1TTYA 1O94D 3L7LA 1DXOA 1SUAA 1HLDA 2JZOA 2VZEA 4AUEA 1E1RA 4FZJA 2J7KA 2JANA 4H31A 4PFKA 1E2DA 3GFRA 5BQ3A 2QQAA 1ZYUA 3W5CA 4X1IA 4I3HA 4PZPA 1IXRC 5FOTA 2HF9A 4JJZA 1BEUB 4CZ2A 1TI7A 3R3HA 3SXUB 1CTQA 3DMHA 4ZTFA 1QE5A 2F00A 3DQZA 2Q3HA 2BVMA 3O94A 3WLEA 1KO5A 1NVKA 4HAOA 4WACA 1Y33E 1BQEA 4AZ3B 3LDGA 4F3RA 4RCZA 3K4BA 3TL4X 3BCHA 1RC8A 5HRAA 4P93A 5EHQA 1UCRA 3FNRA 3KEMA 3MJRA 3IUBA 4JJGA 3SZMA 2FR0A 3WMRA 5ADVA 1C3OA 1LPBB 2X41A 2IGNA 4KQ2A 3WAKA 2WNSA 2CLIB 3BJ6A 4KODA 1GZ6A 2BBTA 3VPSA 4KIUA 1V6AA 1ENOA 1CJCA 3KT0A 3SHQA 1ST3A 4C7OB 2DB3A 5JT1A 4CT4B 3HEMA 2DBVO 2VF5X 3HB9A 1J75A 4GZ3A 1X3ZB 1MEOA 3E0JB 1PHRA 3N8NA 4X6YA 5DULA 3PEFA 1LRJA 4BZWA 1IJFA 2Q3DA 2ZT5A 1Q57A 1M8JA 3IAS1 5JISA 4FI3C 5KHDA 1K83J 3I6BA 3JYNA 1XZMA 1VGVA 4RVFA 4IIBA 4UMVA 2I4LA 1P7PA 3OX2A 5DX1A 5TX7A 5JR3A 2A0WA 2PX9A 3DBHB 4YP0A 5K99A 1JDNA 4TSRA 4EG4A 3U4DA 1YV9A 2QZPA 4ZQGA 5IT9K 4YDHB 1P9QC 3R7SA 3TAXA 5BT8A 3ELUA 5EVJA 1MO2A 2XMBA 2OHFA 4ON9A 4D42A 3WJ1A 1P2GA 4AK9A 4CI9A 5H83A 1SFRA 3DFUA 1GLVA 4OIPF 2AK3A 3VHLB 3VYWA 1GTRA 3C5CA 3X1YA 1GUBA 3KLMX 4ZOBA 2FKNA 2OBMA 2Y71A 4BNVA 3RF6A 3MOIA 2D0OB 2E60A 3K4CA 3QYFA 2ZWMA 1LPAB 3SC6A 2EF0A 1AMOA 2H2FA 1FUUA 1GYQA 2QQGA 1AZWA 1E8DA 4L76A 5JMWA 3CO0S 3IT3A 4LZPA 2WLSA 4FWBA 2AI1A 3H4MA 1QAOA 2DECA 3OWHA 3H0KA 4GE0A 4D74A 1S7GA 4AB1A 5JHHB 3K70D 2OVBA 5FKJA 1LGYA 2X9GA 4NXMB 1KK1A 5C46F 2Y69H 1PVDA 3K5IA 3FF4A 3RRJA 2QLFA 3TNDA 4BZZA 5JEDA 4EKYA 3STVA 1FRNA 2W1OA 2YR0A 3G2JA 4W4TA 4CM9A 1Y6FA 3V00A 2ZR7A 1FVHA 1WWKA 2HNKA 3A1UA 1KY3A 3AUSA 3ILSA 3IVRA 3L0PA 3LKZA 5AI9A 1EVKA 4QOJA 3NO4A 1MMNA 2ZC2A 1LRLA 3M0EA 1DEHA 5FKMA 1Y6RA 2WU1A 1WS6A 2YCBA 3K2AA 4F7ZA 4FJ0A 4XVHA 5HQTA 3REFA 4EUEA 3TQOA 4QOHA 2V5VA 5BR8B 4L85A 5HRCA 4EHNA 4YFYA 4CLEA 5DTIA 4EYQA 4B84A 1CR0A 4WCFA 4EQQA 2K2QB 1WVGA 3OYGA 1JTXA 1HLFA 3QP5A 4RFSA 5DYNA 1U8TA 2BKEA 2QLMA 4P7JA 3Q7TA 2P4HX 3Q12A 4Q93A 3DR3A 3JAWA 5SYMA 3PUFA 1XZEA 1R15A 1S5PA 3KX2A 2GF9A 2R2AA 4DE5A 1U9CA 2NV6A 1E63A 1O3QA 9ANTA 1SXHA 3KALA 4IJQA 1A82A 2YVAA 4HW0A 1O96B 2IYPA 4LY6A 3HU2A 1RQPA 5AO9A 1RHKA 3PYXA 3L8HA 5AJVB 4TSFA 1OCOH 1PWYE 3MKYB 3KBOA 5LP6F 3OPMA 1AO0A 1IAWA 3OZBA 4FFOA 1IN4A 2DFVA 4Y6QA 2FAXA 1GTMA 3AQ4A 5TVKA 2KT0A 2VHEA 3AKCA 4W9RA 2I29A 3RI3A 4DRXB 2PUWA 2WD7A 3W5JA 1M2OA 2ACKA 2GPTA 1QH8B 2XGSA 3JZFA 4I9NA 1OFTA 5MDHA 3GLGA 4KDFA 2ZFUA 2VAPA 3CJTB 3ZN1A 1RKVA 3JYQA 3OFVA 2HK7A 5ERYA 2ZG6A 9GPBA 3F3MA 2JZNA 4EX6A 1GUAA 4X64B 3MLEA 5D87A 1U80A 3WK9A 4ICIA 1G4DA 1EJ0A 1VKJA 4LZAA 4RGBA 1E2BA 3CCQI 2BJHA 3QPWA 4FBGA 3CNHA 2BM8A 3CLHA 4I1SA 3K2ZA 3R4VA 4KVAA 4RHEA 3I34X 1L7BA 3LZ6A 3FRIA 2YH2A 4N9WA 4D96A 4IDEA 1NUTA 2AFRA 4ZKEA 3ZI4A 4GYYA 2A86A 4EJFA 1GZ7A 1OI7A 3F23A 2RGYA 4EI8A 5CIWA 1HFWA 2UYOA 1YAHA 1K9SA 4K3VA 4I7HA 5DM60 3ESBA 2XQKA 5JCXA 1UWVA 1B3RA 5C52B 1WMSA 4BE7B 1JIUA 1VKNA 1JI0A 1KAEA 2CVZA 3E9YA 3JVVA 3JQBC 3REQB 3ZDZB 4XB6B 3L4SO 1VKOA 3E1GA 2WJ3A 2O7SA 4RAZA 1AKHA 3ODPA 3R0IA 4UE3S 4DCGA 5JVDB 3JQFC 1N5OX 4O5VA 3UBMA 3R5JA 3U2QA 2J4FA 3UOGA 1A77A 1E6MA 1SK8A 2OCYC 3ONNA 4HRVA 4UHFA 3PNLA 5DASA 5IWCA 4EVQA 2ACVA 3D2BA 3H1GA 4RZ2A 3A6PC 1V45E 1IVNA 2Y6VA 3WNCA 5GAHJ 1VFNA 3E82A 4TMZA 4A69C 1QIIA 1PEKE 1P1IA 4A5MA 2FOXA 2R1VB 5CBPB 4E1BA 5B3AA 1URPA 2ZJ1A 3NHRA 2OBPA 4DF3A 4CEJB 4HUQA 4N65A 1SXJD 2I4RA 4ZJPA 1BAPA 1X7ZA 3ZHYA 1CLEA 4RF2A 3AG2H 1C1DA 4IS3A 4DA8A 4NLLA 2RC6A 3H19A 3OSUA 3BH7A 4MJXA 2WA0A 2AFVA 2ZMEC 4IF4A 1MDMB 3JRGA 4KNYA 1E1LA 1MDFA 3TTTA 5HZKA 2QBYB 1E4EA 2RHGB 5BSFA 3KZYA 4N39A 5JRJA 4HC4A 1O03A 4PC1A 4UHBA 4TMFA 4B8XA 4WLUA 3VR0A 4BTLA 1W1UA 4OMUA 5C8XA 3ZQGA 5M04A 3LSGA 4YQEA 3QPTA 5ISMA 3S14J 2WG2A 2FE4A 2QRVA 1ZTRA 4OMCA 3A9TA 4GLBA 5T5QA 3VV2A 2NVQJ 4CQNA 5EWLA 4L74A 4YGYA 3DU5A 1NT4A 1JAIA 1R4ZA 3HZRA 3M8KA 4NH4A 1ACJA 2AUTA 3ZI0A 2AHQA 2FBIA 3QVSA 1J21A 4Y2HA 1ZVQA 4Y67A 5E1MA 4TTPA 1MBJA 5K7HA 3GDWA 4QFCA 3D4PA 3IHTA 4XJSA 4R8LA 1KQ8A 5CNKA 2C4NA 3VDMA 5GPBA 4F92B 2GLUA 3PX2A 1IC8A 2AS5F 3NHMA 3NC1C 2BFDA 4Q0MA 1JHMA 4IYJA 3T5TA 3OR2C 1GNRA 4GMFA 5ILGA 3CH4B 4TKUB 1P81A 2VTDA 2L01A 3BG3A 4CV2A 2DMNA 5TB5A 4M3DA 3SS7X 3TZKA 1XU7A 3HKEB 2FP3A 1TLHB 1WSUA 4ZVQA 2DFEA 1EPUA 2XF8A 3BD9A 4Q7JB 3K5WA 1AKEA 1JJIA 5L7TA 1MW8X 2D62A 1S9DA 1FQJA 3EVTA 4RJTA 2PWBA 4I2NA 3B6ZA 1Y7TA 3L9WA 3OUZA 3PDWA 4Q5SF 4FKZA 3TKLA 3D3EA 5KB3A 2IXSA 2BFPA 2W6ID 3KIPA 4YRNA 3KYDA 1V2HE 4FHDA 3UUEA 3C3BA 2MSYA 3DKRA 3VX4A 3NBZC 3PFIA 1P7CA 2QOEA 1DP7P 3AHGA 1GCOA 3NQOA 3B85A 3EFBA 3G2MA 3L4BC 3QLUA 3HDJA 3COAC 1C3LA 4HH3C 5DSXA 4AUNA 2C7QA 2FVXA 3GBPA 4XIDA 3OA0A 4RBOA 4DA9A 4UM8B 5FAKA 2B7EA 1XGNA 4IVQA 1F0YA 1UMBA 1IBCA 4KXNA 4I99C 1OPRA 4EL5A 4LX0A 4OREX 3KEYA 3R0JA 1VHLA 3K94A 1SOVA 3JQCA 4LZOA 4RGQA 5FPYA 2QDKA 1QB7A 3AFGA 4PXSA 3UOWA 5J23A 2O06A 1AQYA 2ZZNA 4ZYAA 4S04A 3RJPA 4EQ6B 2ZSHA 5IH7A 4I99A 4M7RA 4EEXA 3EUHA 2ZTVA 2AN9A 4MS3B 2ORYA 5LD2B 3UR3C 1FMVA 4Y6PA 2HHAA 1XZQA 3I0NA 1M2HA 2C42A 3O4IA 1RM4A 3K9WA 4PO8A 5IYZB 1N2HA 2RI1A 2V4JC 2ZBQA 5B3LA 2VQGA 4DG9A 2H1KA 1U3TA 4A92A 5ADUS 3EGDB 2F3PA 4A6PA 2FSHA 4F4DA 2EWNA 3EVEA 1NM5C 1XTKA 1FMTA 1FDSA 1T1SA 4WCFC 4FX2A 1OR8A 1FSGA 5BUQA 4REQB 2EFQA 1EVQA 1JI3A 2F43A 3A9UA 3BXZA 2B1GA 4AM3A 2JVKA 5AIAA 3R75A 1UG0A 4YP1A 4IIGA 1WKCA 5H0IA 4HLXA 2IP4A 4NX2A 5JPIA 1NBMA 4DLBA 4WK8F 1U8XX 4YFVA 3W9BA 2FJ0A 1ISHA 2XODA 4MR7B 1T6XA 1YBVA 3BE4A 3DOEA 2C2BA 1P73A 2XMCA 3PS9A 1E3JA 3ZS9A 5HTOA 3R9WA 2XVAA 4HEA6 5F0HA 1KTVA 1KJNA 1T25A 1USIA 3DAFA 5EXTA 5J59A 2IQ5A 3NX4A 4ES6A 3OJEA 4QUDA 4R2MA 2B94A 2NZYA 1V5FA 1X94A 2FN4A 2NYVA 3M4JA 4RDIA 5LZ2A 4EP1A 1CUXA 1WU7A 2CBXA 3OZSA 4Z4EA 4CKCA 3Q2OA 2O8VA 4Y4RA 2P2GA 3ZU2A 2P5KA 1SQ6A 3WGUA 4KGDA 1T9GR 4UZSA 1JDBC 1D0VA 1JAHA 3KKQA 2V5UA 3FF5A 1M8GA 1YCGA 1F6DA 4KYTA 2Z58A 4QGAA 5FBZA 4HJRA 3GY0A 1WRJA 4R8HA 4B3XA 2NO1A 3MGGA 1K97A 1B6AA 3R61A 4N01A 4PFJA 1B73A 2R6HA 4XN3A 3AL0C 4FFPA 4ER7A 2XJ9A 1K5HA 3ABQB 2O2JA 2HYDA 4TWRA 5ICSA 1XA4A 1LPMA 3QPSA 3H5TA 3O31A 2X0DA 3G9XA 2W70A 2EJTA 3KP3A 1E0AA 3CEJA 4ZYLA 2RAPA 3ORFA 3QVMA 2Z6VA 4E5NA 1EESA 2PI0A 1XD7A 5CW2A 4F3TA 1BE8A 2FNAA 1STZA 1N9GA 2I7DA 2PSHA 2ZJOA 2FOWA 1W87A 1G41A 2O0MA 2QT9A 1JGGA 3N3AC 3NYQA 4OLJA 4L9VA 3FDZB 5L3RA 3QUAA 4FBMA 3ZN2A 3HXOA 2PJRB 4D80A 4YONB 1OWOA 1CQPA 2LIVA 2QVYX 3B78A 3ZQ7A 1H2ZA 2DFTA 3OOEA 3KP5A 4BKMA 4X62B 4YIFA 3HBMA 2Y48A 2BMFA 5B53A 2XTMA 1IMJA 3NYIA 2IZ1A 3GVCA 3K6GA 4F1WA 1MXFA 1L4EA 1U7XA 4Y2GA 1V6SA 2VK4A 2RIRA 4UEQA 1T8UA 2AE1A 2I6GA 1QHIA 3CS3A 2P4WA 4RFLA 4RE5A 2DK8A 5E6UB 2ID6A 3VODA 5E1WA 1CJKC 2XRYA 1DX9A 5ICEA 2EFEB 2IHVA 4FFRA 3HSSA 3KD2A 1JDUA 1C9EA 1HYQA 1R50A 1RI5A 3I73A 4G84A 3V48A 3DZKA 3EXEB 4XIIA 4Q47A 3AH8A 3OFSA 1FRQA 1ISGA 1NVVR 4M73A 1ZCZA 3FIUA 1EM8A 3CTAA 1X7DA 4EUFA 1HT1E 4LJAA 2IV7A 2OMEA 3KB6A 3CP2A 3FZYA 1K88A 2D13A 4HS4A 5GVRA 1S4QA 2BY2A 1LDBA 4I1OA 2VVTA 4PZUA 2HLDA 1Z15A 3KKZA 4X54A 5EP2A 2H27A 4H3SA 2R1TA 4HWTA 3H75A 4L4YA 4OPMA 5BS6A 4GMHA 3ZHXA 1E8MA 1Q83A 2CHUA 1DBSA 1YQXA 1FP1D 1JKXA 1OKKA 1Q22A 2A6TA 4NQRA 3CW8X 4JC5A 2AUMA 4IIEA 4JC0A 3GPBA 1JUMA 2J3IA 5KYYB 3B6JA 2D0IA 1Z0XA 4EM6A 1JQ3A 5EIBC 5JBNA 1P17A 3F8SA 4DMCA 1RJDA 5AKYA 1PDWA 2PWAA 3EC1A 3KU4A 5IHPA 5GADl 3ELDA 5TQJA 3EA0A 4DCSA 5E8GA 3BJAA 1I5OA 1ZGCA 2QRKA 4R8VA 1ZD8A 5CD1A 4GKJB 1RRGA 4XPIB 2F59A 1ZJ5A 4XOIA 3MJ4A 2X6OA 3WR5A 4WBXC 5FADA 1KORA 1VPTA 4RA6A 2ZIFA 1Y98A 3QKSA 5ILUA 1VL5A 2QRLA 4FZ3A 4I4NA 4YDQA 2Q5QA 2K3FA 5EKDA 3E58A 1AGXA 3HJUA 5E1BA 1Q3KA 3NH6A 2DQLA 1DKUA 1P9LA 1TZMA 5KAPA 4YUZA 5EDNA 3FTEA 3HO1A 1EAMA 4KACA 4A3CJ 4ZV9A 2CSUA 2YOFA 4AJKA 3ZQCA 4XVCA 1E3MA 3DULA 3K71B 2W2MA 4AYBN 3FNQA 4YIHA 4KUHA 1D1QA 1ZOPA 3RCBA 5KX5A 2HOAA 4CZCA 1DC3A 2I54A 2JIPA 4LVNA 3BMXA 1NQAO 4CLDA 3Q8MA 4PQYA 3QYBA 5CGQB 2BFNA 1RBZA 3SFZA 3O4HA 3X1XA 4PEVA 3ZVRA 4UDOA 2H16A 4F8EA 3IRVA 2WADA 1T26A 4G4SO 2BC9A 1I4LD 3KOXA 4HF1A 4CLOA 1SVOA 5HUHA 5I3CA 1N5RA 1ZN8A 3HXTA 4E4HA 1N78A 4N3BA 3T3IA 1U2WA 4U7WA 1KIFA 3WSWA 2BE9A 4Z8YA 3QYPA 1OBFO 5DHFA 4ZCPA 3UB3A 1ZUWA 4IQ4A 1ZX1A 2DTDA 3R5XA 3KOUA 3C3PA 3AILA 4ZV4A 3KE8A 2HYFA 2H5LA 1GV5A 1FFSA 2VP0A 3WODF 1JR3E 3I2HA 4IKFA 1YQ9A 3UH1A 1YJCA 4OHPA 1RJWA 1Z83A 3KJFA 3LGAA 1E92A 4NC9A 4MQVA 4XR9A 2A5GA 1QZEA 4P4SB 3ZCPA 1W85A 2ZR8A 3P19A 4GSLA 2NUBA 1VLVA 2FF7A 3R5KA 3R7DA 3VR2D 3TBHA 5JLWA 4ESOA 1SOAA 1EIWA 4LD5A 4HD8A 3RREA 1YIOA 5ECYA 5BW6B 4IXAA 3A6GA 1GPH1 2JS7A 1J0EA 3PEVA 4KDCA 2EFHB 4TLDA 1VRVA 3GFTA 2ZBRA 1SBZA 3M6FA 1SVLA 3IDQA 3D59A 2Y1LA 3C3DA 2V8OA 4MOWA 3GLTA 4OHZA 4BQPA 5HKAA 2CJJA 4P86A 3M7GA 1G7RA 2IV3A 5G53C 1EFCA 1GOTA 1ODCA 1UM9B 1YE3A 4MS4A 1KK0A 3IUPA 4OOIA 1JG7A 4LI0A 3TB4A 4E31A 4ZEVA 4GRIA 3KSZO 1OQAA 4FQ5A 5JBIA 1T3ZA 3UC5A 1REPC 4ND2A 2UWMA 3AVQA 3E22B 3LFHA 3L3BA 3NTLA 3O73A 4Y6GB 1S96A 4BX2A 1TYEB 1P4HA 3SLGA 5ER9A 5IW8A 3OPXA 2W82A 4RMHA 4YUAA 3K15A 1SHTX 2CXRA 1VLJA 3OZWA 4AWAA 3QVLA 2CJWA 5LQMA 1Z2EA 4G3XA 4UY8I 2ZYRA 5DEOA 2Q28A 1L0OC 1X1AA 1IG3A 2LDXA 1C30B 4JFRA 4NDAA 4PC3A 3VZSA 3PQ5A 3C3KA 3WOHA 2VCHA 4C04A 2I22A 4ZICA 4LS3A 4L57A 3Q0UA 2OKGA 1LB1B 1T0BA 4Q02A 2CUZA 2CMFA 3MRXA 3ETHA 5BN5B 5H7XA 4HDNB 1IUFA 1WJAA 3M9AA 1YHZA 3UMBA 1U4NA 4NICA 2WIBA 5AW4A 3CBGA 2HMUA 2Q0XA 2VSYA 1D4AA 3IAUA 4IWXA 4OQFA 1AKY