3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Response regulator protein
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
2WJWA 4JX4A 3LSPA 3T95A 8ABPA 3Q0WA 3QLVC 2IEKA 5KQGA 4TLMB 3TMYA 1NXXA 5KQMA 5ABPA 5HODA 3OSFA 5JNWA 3M6MD 3SDGA 5KC8A 4Y7NJ 1DCMA 5IUKC 3LSJA 1MAVA 1BDHA 2LP4Y 4D7MA 4Y52J 2JVJA 1T34A 1Z2EA 4N0QA 1MBFA 1DCKA 2M1ZA 1NTCA 3GBVA 3Q0UA 1H8AC 2DA7A 5JLWA 5JNUA 2CHEA 5KQPA 3RZOJ 1JJ8C 3OLXA 3IPCA 1VFCA 2XGDA 1GLGA 2WB1N 3BG3A 2QVCA 2FLKA 3HM5A 1TWGJ 2VUMJ 2IKSA 3GTGJ 4OBBA 1MH4A 1ZVVA 4PYRA 5B3JA 2AO9A 2ECCA 3C97A 1TMYA 3HOVJ 5FKMA 1PHRA 3JY6A 3GWGA 2FEKA 3H5VA 4D6XA 4RK1A 3KLOA 1TM2A 1POGA 2JK3A 3F6PA 2Y0SN 1QP4A 2W42A 3CG0A 1VPWA 4LRQA 2CQQA 3NBMA 3JRAA 3OLZA 2LP0A 5FLVA 5M3MJ 4Q6BA 1Y1WJ 4RK4A 4RDUA 3HB9A 3MVPA 4IF4A 3TD9A 3D02A 2WWVD 3MIZA 4D5CA 1Z16A 2NZVG 1YRNB 1Z15A 5CNKA 5IYBJ 4RBOA 3GTOJ 4IHYA 3HZHA 3Q41A 1JFVA 2WB4A 3BR0A 1IJWC 4E7OA 1S7EA 1ZGZA 3EGCA 2VYCA 5F64A 4QICA 4MS4B 1ZKGA 2CHFA 1MNMC 1ZGGA 3RVNA 4XFKA 5GQSA 3H75A 1R9TJ 3RVKA 2RAEA 4O1HA 2HXIA 4RKRA 1AKHA 4G0ZA 1Z2DA 2Y2ZA 2ME0A 1UDRA 4MQEB 3EODA 2IPMA 4IGAA 3MKLA 1GUUA 4JB2A 2CU7A 4MS4A 2WMYA 3CS3A 1DG9A 5F1JA 1ABEA 2VUHB 4G0XA 1SXHA 5F0CA 5FKNA 3UUGA 1DU0A 2L2QA 2FEPA 3BG5A 2GWRA 3KS9A 1VKRA 3W6VA 3SG0A 4C3JJ 3A0RB 1LJUA 1BL0A 1FFGA 3LUGA 4RXTA 4RY8A 3IH3A 2Q5CA 2CD7A 4RU1A 4MGEA 1XS9A 4YGXB 2F8TA 2F8SA 1JUMA 4W97A 4DZJA 5IX8A 5HSGA 4XIDA 4RZSA 4WXEA 2B63J 1DRJA 4B3AA 1E3OC 3F6CA 5M5YJ 1USGA 1BDIA 4Z4GA 1ZITA 3OQMA 3NHZA 1ZAYA 4Z9AA 4EYKA 1FEXA 4MR7B 4MLCA 1GV5A 4UUSB 3CMYA 2IBDA 3MA0A 3BQZA 4MR8A 4XK4A 3NAUA 3FIWA 3QPSA 3S1MJ 5GPCA 4KRFA 4UUTA 1KGSA 2NT3A 3UK0A 2QVGA 1MBHA 3PO2J 2CQXA 4A3JJ 1JT0A 4NICA 4IMIB 3LSRA 3GRCA 4MR7A 5C5EA 4RWEA 1XWWA 1VLZA 2M34A 3EDCA 1JDPA 2DJNA 3IDOA 4RK6A 3E61A 4BKXA 4RK0A 2A9PA 1QMPA 2KDZA 1ZH4A 1QRYA 3LSGA 1DC7A 5JNRA 4ETNA 1JLKA 3RVOA 2QZJA 3OO0A 1DZ3A 1QKKA 4G0YA 4EYGA 1SD5A 3I42A 3QX8A 2E4VA 5EZHA 3WHCA 3Q7RA 4WXMA 3OQOA 5GPAA 3O1HB 2YHBA 4G0QA 4NCAA 4F11A 1USIA 5CNMA 1NXWA 2E4UA 5M3FJ 1NXPA 3VNBA 2PUCA 3GBGA 1ZQ3P 3JREA 1LJLA 3C6QA 1BDJA 3PM1A 9ANTA 2E4YA 1ITYA 3DLBA 2JCGA 1OXBB 4YCSA 1JGGA 2WV1A 2H1KA 2JA8J 2FJ1A 3JRHA 3QELB 4QPJC 2E2IJ 2D5VA 1CEYA 1GCGA 5CNJA 4FB4A 1IUFA 3BR2A 4M3DA 1LFBA 2R25B 2DMTA 3BTCA 2FMHA 2IOYA 1XG1A 4ZMRA 3ZOBA 2EBIA 3QLVA 1JKPC 3BTIA 1P2FA 4JP0A 2MSYA 5IC5A 3H1GA 1IDZA 1MIHA 4KQCA 1ETYA 1M2EA 2PE5A 1M5UA 1NK2P 1JHZA 1YMVA 2R4QA 2HXOA 1W9HA 4XRMA 4MR9B 4DN6A 1OXKB 1BVHA 3GTQJ 2L9RA 1AB5A 1JDNA 3TW7A 3CG4A 4RKQA 1E6LA 1YIOA 5F0FA 4Z4HA 5BRAA 2RJNA 2HI3A 3NNDA 3N0RA 3OLVA 5JNTA 5J1YA 4B4CA 2Y9YA 3HO1A 3ZQCA 2WRZA 4S0HB 3Q9SA 3LUKA 2L19A 4MR9A 4PE5B 6CHYA 3TEDA 2AHQA 1RXIA 2FQYA 4BBSJ 1U2QA 5CHYA 3Q7SA 5EWMB 2I10A 1JUPA 4LDZA 2FMKA 1VI0A 2JN6A 2IAIA 4JB0A 2QW1A 2HSGA 1VF9A 1JBEA 3LUAA 3C2BA 2ELKA 1Z25A 1GUDA 2ZWMA 2NVXJ 1NXVA 3ILHA 3L49A 1JKOC 5HQJA 1WI3A 3I5AA 5IOZA 3DGFC 2JVIA 2NUBA 1U2PA 4DZPA 1DRKA 1O4XA 4M3FA 4ZJPA 4DYCA 5EWLB 2GX6A 3S15J 1Z26A 3OIOA 5FWXB 5EF6A 3Q0VA 3SM9A 1ORKA 1IG7A 1TWHJ 3HV2A 1RZRA 4E7PA 3DEWA 1IGNA 3R0JA 3S17J 2FXIA 3LTEA 1OFCX 1YVUA 2HOSA 2PUBA 2LLKA 1ETWA 3CTPA 2E2JJ 5FWXA 4BXXJ 2FMFA 3KYIB 3GTKJ 1SXGA 3G1WA 2LFBA 4ETMA 4P1ZA 2GM4A 2DA1A 2W48A 2M0CA 1JH9A 2YU9J 3TP0A 2ID6A 3TO5A 1WETA 3A10A 1ETQA 1L5ZA 2ME6A 2WAQN 5BQ3A 2HJ9A 2Y30A 4W5TA 2LPMA 5M5WJ 3S2HJ 4A3DJ 3UKJA 1XHEA 1W0TA 2FMIA 3RKQA 3CCYA 1DCFA 4C3HJ 1JYFA 2M98A 3O74A 3C3KA 4DYRA 3BBLA 4LZLA 5GOTA 4G0PA 1MSFC 2B4AA 3JVIA 4LOCA 1LBHA 2JA7J 3HGYA 3G1MA 1X2NA 5EG0B 4RSMA 4PEVA 4JA2A 1LK0A 3M3YJ 2AYZA 3LUFA 3LUHA 4A69C 3IV5A 2PUEA 1SFOJ 1DBPA 5F27A 3O8HA 3M4OJ 5F08A 4N47A 1ZDMA 3QLTA 4EVQA 1QP0A 3CQZJ 4XASA 2L0KA 4Y9TA 4W5NA 4FISA 5FKKA 1U9OA 2LVSA 3GTJJ 1GT0C 1FFSA 4P98A 3MN2A 1SRRA 1H9CA 3LOPA 2PMCA 4DQDA 2FN9A 1HCRA 2H8RA 5C44J 4V2GA 3SFIA 1AB6A 3CDLA 3SAJA 2JK1A 2E19A 5CNIA 3F7NA 2R47A 2FQ4A 3A0UA 3TW6A 3QLUC 3NNNA 2EZIA 2MSWA 1LE8B 1DBQA 2IPNA 5KC9A 5E3MA 4LDAA 4EVRA 2NVTJ 1X58A 2XB5A 3S99A 4H3HB 1P7IA 2CJJA 4S05A 2PUFA 3HEFA 4JP1A 1B8IB 4OLAA 4AUXA 3ZQHA 3S2DJ 1MH3A 2GKGA 1ISRA 3H5IA 1ZTRA 1MBJA 5C4JJ 3TB6A 4RXUA 3HJFA 4XAQA 5EWJB 4HNSA 4I6ZA 1MB0A 2CUEA 3HCWA 1LE8A 3IP7A 3RVPA 3I4NJ 3GA5A 4N76A 4Z4IA 2NS7A 4CYCB 4Q7EA 2K9QA 2O20A 3HEBA 1T56A 1I3QJ 3RVMA 2ID7A 2L7FP 3FGZA 5KI6A 4M3EA 5EZGA 1GCAA 1B8IA 5JLXA 1YRNA 4KVFA 2KT0A 5J1UA 5IP7J 1JTXA 2MYUA 3JS5A 1C0EA 3HM9A 1HOMA 3WHBA 1A0OA 5EWJA 3KHTA 2X6OA 4YS6A 4NQRA 4NV3A 5C4XJ 4G0MA 3F0CA 3H6HA 2R93J 1X2MA 4G12A 2MSLA 2PAFA 2PL1A 3CLKA 3BRQA 2BGGA 1NXTA 1A6IA 4AYBN 2XPVA 1Z0XA 5IULC 1MSEC 1MB3A 4MQEA 2R92J 3O75A 3HKZN 3I4MJ 1E6MA 1MVOA 1VNDA 4HNRA 4ML3A 1RPJA 3SNKA 3FISA 2M8GX 3HDDA 1JT6A 4LE2A 4LE1A 2RJOA 3FKIJ 2XPWA 5E3LA 3IP9A 2O7OA 2FQWA 1WCMJ 1GUBA 2P4UA 1MBEA 4YV7A 3K7AJ 1JX6A 5KQLA 1KRWA 2R0QC 2B1JA 2M2EA 3JR9A 1Q1VA 2R7ZJ 2V0NA 4ZMSA 4FE4A 1RKWA 3JPYA 2I6FA 4YRZA 1TLFA 1BW6A 2NVYJ 4JX6A 3CZCA 1UMQA 2P81A 3JRFA 1D1QA 3OQNA 2MYTA 3KLNA 1U8BA 1ABFA 5JS1A 4TLLB 4UUSA 4J19A 4EEFG 1W25A 3OM1A 5J1RA 3FFTA 2VUIB 2JA5J 1FTZA 1FFWA 4YLEA 4N03A 3M9XA 4ETIA 3ZQFA 1G2HA 1RESA 5E3JA 2MYNA 5FJ8J 4FE7A 1JWLA 2GLOA 5DGCA 4IHXA 2DA6A 1FQWA 1QO0D 4GPAA 4D5FA 2OPTA 4LX8A 5D2CA 4MAAA 1ZR2A 3O2JA 1I6HJ 2PLNA 3KJXA 5IPAA 2COBA 5IUNC 3GT7A 3KCNA 4NCBA 3FMVA 5IEJA 4S04A 1H88C 2DMNA 1DBWA 1NXSA 4A3BJ 2OQRA 2LUOA 3KSMA 2IYNA 1TWCJ 2E1OA 2E2HJ 2LBPA 3TP3A 3SY8A 1ZESA 5IOYA 4B09A 4F06A 4JAVC 2FN8A 3DGEC 3RVSA 1A2OA 1ETVA 4OTZA 4RY0A 4F8JA 3O1JC 1HF0A 1HDPA 3T6KA 2HQBA 4HNVA 3DLHA 2HOAA 3EQZA 4IILA 5I4CA 4BY7J 1Y1LA 1YK0A 1QVUA 3N8IA 4TMYA 1TVMA 3QELA 4D74A 3DBIA 1RETA 2XGCA 4ZYLA 1DC8A 2QR3A 3JRGA 4GNRA 2M9HA 2AYXA 4XARA 1JFSA 3CFYA 2DMUA 1D5WA 3ZQGA 2L7MP 2QF7A 4IMJB 5F04A 4CBVA 2FSPA 4Z9BA 1YS6A 2JB9A 1H89C 4EY3A 1Z13A 2J48A 3OSGA 3GTPJ 3D1NI 5FKOA 5E3OA 3T8YA 4Z4CA 3HK2A 4A3LJ 1SANA 5BR1A 2GBYA 1PUXA 5FWYB 3NARA 3QLUA 4IHWA 4A3IJ 3LMKA 3ROFA 1PNTA 3HXMA 1D1PA 1EHCA 4WZZA 4RDCA 5FKLA 2X7XA 2Y31A 4XLTA 1FIAA 2PUAA 1FJLA 3CNBA 3C3MA 2PUDA 2K40A 5E3NA 3BR1A 3JPWA 3LUCA 5TPZD 1B00A 2QSJA 5EWMA 2JRLA 3HOYJ 5T3YA 5FWYA 5DTDA 1RKTA 3G1LA 2DA4A 3HDGA 3JRCA 3HUUA 1PUFB 3KKEA 3UKGA 4B1RA 3MF4A 2LKXA 2K9NA 2WJAA 4A3MJ 3HVRA 3LKBA 3CHYA 3FK6A 4OATA 2QU7A 2MYPA 1ZGWA 1GVDA 2FEWB 1Z12A 2HOTA 2L18A 2E4XA 7ABPA 3OO1A 2YHAA 5TE9A 3QEMB 2TCTA 2PL9A 2HPHA 5TQ0B 4MS1B 2JBAB 3BILA 1EF4A 3HOWJ 3NNSA 3CU5A 1PUFA 4H60A 4AC0A 3URMA 2DMQA 2HQOA 2O8KA 5EWLA 5IEBA 1CQTA 2L17A 4EGSA 1ZH2A 4UHJA 1GDTA 4BBRJ 3VPRA 2XSDC 9ABPA 1DU6A 5TQ0A 4KZKA 2JBAA 3MYYA 5K7FA 4HNQA 4M88A 4ZPJA 3SJMA 1K61A 1E2BA 3PO3J 3N0XA 2LR8A 1YK1A 4Z0NA 3HOZJ 3HS3A 1LBIA 3HGGA 3Q7TA 3H3VK 2PUGA 2VK2A 2RDMA 3BRSA 4KPYA 4QTRA 4MQFB 2ID3A 2MW8A 2NS8A 1AHDP 1NXOA 4UHKA 4JOQA 1FSPA 3IH4A 3ZQLA 4KK3A 5FBHA 1TJYA 1NTRA 3HUTA 4W5OA 1SXIA 3H0GJ 3EAFA 1P6QA 1Y1VJ 1RR7A 4MO7A 4W5RA 2ID9A 3W9SA 3IH2A 3GV0A 3S1QJ 2TRTA 2IPAB 1U9NA 3D8UA 4YO7A 4MIMA 1K83J 1F36A 3OOUA 4MQFA 3BTJA 1Z77A 4PICA 4EUKA 2X48A 3JVDA 2HQRA 1Z18A 2KYRA 3IPAA 3FFXA 4XXHA 5EG0A 4X6AJ 1MBKA 1RZRD 1U0SY 3GBPA 3H1FA 3I45A 3LOCA 1RXEA 2XGEA 2FW0A 4DYQA 1UG2A 2PMZN 1WH7A 2LY9A 2PKXA 5JNVA 4A93J 3MM4A 5EEAA 1F43A 3H6GA 2DMPA 1JKQC 3LUDA 3LKVA 3RVJA 5IYDJ 1QVTA 3RVRA 4F3TA 1U8TA 4A3KJ 1P8AA 1TWFJ 4L5EA 4TN5A 3EJWA 3FDFA 3BREA 2K9SA 4A3GJ 4Z99A 2EQRA 4MLDA 4G86A 4Z4FA 1IV6A 3CKMA 3C3WA 3DZDA 3L6UA 4Z4EA 2ECBA 4F12A 3NHMA 1AKHB 1BAPA 4ABZA 3HSYA 1P7JA 1PEYA 1K68A 2YS9A 2CUFA 2NOGA 2WY2D 2FQXA 2VKEA 3O1IC 2VI6A 2FKAA 2DN0A 1LFUP 2MSKA 5GP9A 2FVYA 4NDLA 2X9DA 2RGYA 2PJUA 3GL9A 3DCFA 1HEYA 2R5YB 4CYCA 2GBPA 2G0EA 2Y9ZA 4G97A 4RY9A 1PEAA 1DP4A 1D4ZA 4V2FA 3FK7A 2H0AA 4W5QA 1GV2A 3RQIA 4C3IJ 1JTYA 1KRXA 4IEJA 1A04A 4KFCA 1J56A 3H1EA 4KQ9A 1HDDC 3TX6A 1U78A 3N6VA 2ZAYA 1ZHHA 3RH0A 5C3EJ 1ISSA 5T7BA 2R5YA 1QO0A 2YUSA 2EH3A 3BR5A 3JRBA 4KNYA 1USKA 2H3HA 4RS3A 1RNLA 4I76A 5ED4A 2A9RA 4MR8B 5TPWB 1QPZA 3HOXJ 3OMWA 2N8GA 3OMXA 3A3KA 5DS9A 3KTOA 3BR6A 3OLWA 1QNLA 4WWHA 1XC5A 3GTMJ 4A3FJ 1ETXA 2R5ZB 5BRJA 5EYRA 1MBGA 4A3CJ 5EDNA 3H5OA 4JYKA 3LNQA 2FD5A 3JTEA 4O1IA 2CWDA 2HYJA 3MMNA 4BY1J 3ILYA 4EYQA 4KK4A 1NATA 5DCLA 1JUSA 2QXYA 4RK7A 5TPWA 2IDMA 1APLC 1URPA 3BTLA 4KREA 3HDVA 5PNTA 2FTKE 2FX0A 3OLYA 2R5ZA 3EQ2A 1WH5A 3HOUJ 1WPKA 1OCTC 5HKOA 1CYEA 1QQAA 1TC3C 2JMWA 1Z17A 3K2AA 5FBKA 3JRIA 2LD5A 3RVQA 4EVSA 1P6UA 2XRLA 4DW6A 5JNSA 4YR7A 2EZKA 4Q6WA 3IP6A 3BQYA 1JKRC 5B3JC 1EWVA 1JJ6C 2DA3A 4QYWA 1OCPA 3H5TA 1ZK8A 1I50J 5EGOB 2LTPA 5FLMJ 3KYJB 1QP7A 1ETKA 1QQBA 1CHNA 1TWAJ 2A9OA 2VPRA 1AU7A 3L1PA 1BJZA 5TQJA 3B6CA 3S16J 4WT7A 5M5XJ 2NVQJ 2L7ZA 2GI4A 3S1NJ 3QX9A 4L4UA 2MG4A 3GTLJ 1RPWA 2O9LA 5DLEA 3T38A 5C5CA 3OM0A 1YMUA 3LUJA 1ENHA 3MQ4A 2JVKA 4IRXA 2CRGA 1I3CA 4W1UA 3GYBA 3EULA 5EGOA 3O2SB 2JJ7A 1UHSA 5IP6A 5TPZA 1JYEA 1K66A 4MRMB 4O5AA 1ZY2A 4M6VA 4MS3B 1IRZA 2IPLA 3BG9A 4JX5A 5DTEA 2EZLA 2VKVA 2XDYA 1M5TA 3O21A 3E3MA 1D5YA 1JL3A 2P9HA 2LK2A 2XPUA 1BW5A 2EZHA 1S8NA 1JF8A 3M9WA 1IDYA 4C2MJ 2MGQA 2DA5A 2JWTA 3K4HA 4MRMA 4QSHA 4YWHA 4MS3A 3S1RJ 1PNRA 3N75A 4XRSA 4RXMA 4N0PA 4FCYA 1HLVA 1T33A 2OF7A 4WUTA 1XHFA 3SQNA 1BA5A 1A5JA 3HBLA 2OENG 3ZQIA 2XB0X 1NY5A 2QV0A 4MYRA 2N9UA 1EWTA 4JASB 4QYMA 1ETOA 3LFTA 3VNAA 1BA2A 4PZ0A 3QK7A 5KWSA 1OJLA 3IP5A 4OG2A 2HQ5A 5K7HA 1IIBA 3O8GA 5HM6A 3Q3SA 2LIVA 3JRDA 3N53A 1C4WA 5JS2A 3O2QB 4GFBA 2A9QA 3G1OA 4QIWN 2E4ZA 1IC8A 4XRSG 3CZ5A 2FLWA 3S14J 1APBA 3KG2A 1DJMA 3CRNA 4D6YA 4KMRA 3BR3A 3P9YA 4M3BA 1FIPA 4XICA 3RVLA 4X1EA 4OLBA 2DA2A 4M3GA 3A01B 4YP9A 1ZR4A 1W0UA 3G85A 4MFEA 3A02A 3FFWA 2HDDA 5IUJC 4MFDA 3ROTA 2E4WA 4L85A 1KMIY 1JFTA 5BNGA 5IYCJ 2NZUG 4RV5A 1E6KA 3Q15C 4RK5A 2JA6J 3BT9A 5IBQA 1EAYA 1YS7A 1U04A 4MLOA 4EYOA 4KV7A 3A03A 2DTZA 1D2AA 3H5LA 1B72B 5TQ2B 5J3LA 1EWKA 3A01A 3H5WA 4FTHA 4G0OA 2TMYA 3QQAA 5F0HA 2DRIA 1FTTA 3N0WA 3QEMA 1L5YA 1YTUA 1WGXA 4MS1A 3QEKA 2QCOA 2ZB9A 1ZN2A 4A3EJ 3B6AA 1B72A 5TQ2A 4HYEA 3I09A 3K9CA 5IP9J 4N41A 1M2FA 1VRVA 4DADA 1F51E 6ABPA 4MPTA 2R48A 3B2NA 4LE0A 4IHVA 5K7ZA 4D7NA 1F4VA 3F73A 1R8JA 3RZDJ 1EFAA 4H3KB 2NT4A 3E7LA 5DKFA 1QPIA 1NK3P 3QPLA
chains in the Genus database with same CATH superfamily
3WADA 4RGVA 3TR5A 5D5VB 1G3IA 2XXBA 1VB3A 1JDBB 1E9FA 2X14A 2COEA 5A3JA 2J5KA 1Y4DE 3ICPA 1UQUA 5BOSA 3SDGA 4K86A 4I8XA 4BLQA 1X7ZA 4JK1X 3T5TA 1MX9A 3PE6A 3RBXA 2DKOA 1I7LA 3DKYA 4I6JA 2DA7A 1H42A 1IFXA 2XBLA 5L7YA 2XGDA 1BMFD 4A2QA 3IQFA 3O8LA 4L7QA 4Q3EA 1XGSA 1DEXA 1DMRA 4RMJA 2AHRA 4IDQA 2ZI3A 1U9ZA 1A9XA 2CXUA 1JGSA 1Z22A 2V9ZA 3QZUA 3PIPF 3RKXA 4L15A 5JAHA 3RYCB 3E4DA 3IQGX 2DFFA 4IQGA 5LQNA 3CR8A 2I2AA 3CZAA 4GYIA 3UW3A 2V7QA 1BHO1 5CW1A 5CFZA 5A2QZ 4UNRA 3WMFA 2IYXA 5L51A 1WXGA 4J7AA 2XOKD 5FTKA 1HI9A 1Z75A 1ZHFA 4XONA 3UJ6A 2O2GA 2WWFA 4Q6BA 1R27A 3U3ZA 4ZO4A 1FYWA 3LAWA 1W75A 4QEZA 3A6DA 1R5OA 5FBQB 5CNKA 3WK9A 5E3HA 3H8JA 2WSLA 4P22A 3U48A 2GR9A 1SPBS 1TQDA 2ZBVA 3H2IA 4OMDA 4E13A 4ZC1A 1ZGGA 2Z9OA 4C4RA 2AOWA 3WE2A 5GQSA 3K15A 4O1HA 3PFIA 3GR6A 2YXPX 2B8JA 2W8BB 1G20B 4WX9A 4WESA 1R16A 1YR1A 3NCTA 2WMYA 1NPYA 3M8FA 4WLEA 2UZ0A 1WJDA 1R0LA 3OKAA 5HKKD 1BU8A 3PKJA 1QNFA 4LVOA 4NYJQ 5LHHA 2YHSA 4RTLA 3VUEA 4ZDPA 4R81A 2VH2A 4YXFA 3HKCB 3KDSE 4P7KA 1FFGA 2REBA 3PHBE 1WB6A 3CO5A 4HFNA 1Q20A 2JNWA 1WQ1R 5CIYA 1PUEE 3T5CA 1QLJA 1ZAOA 1WJ5A 3GJ3A 4UMFA 3MTIA 1O6BA 4MMXB 3BEOA 1E3OC 2QLJA 1LRJA 3V7WA 2HRBA 1U7OA 2HSEA 4B45A 3OU2A 4MR7B 1ADCA 3MZ8A 3HCRA 4HLUA 2YN4A 3MW8A 4C2TA 2VLBA 5JZVA 2LWIA 1YRAA 3F1KA 2O0LA 1H8EA 3TZQA 3L7DA 2IC5A 1PTJC 2D1QA 2B8WA 2CQXA 1VE7A 4MTLA 1B6AA 3NBZC 2OB1A 1LCIA 3V8LA 4MDHA 1WEKA 1MIOB 4DGSA 3DLCA 4BKXA 1OR7A 2OPHA 1ZH4A 4K26A 4DIKA 2X0DA 4O25A 2FQ1A 4Z2AA 1U8UA 1R6XA 3I42A 3QYPA 1IZ8A 3TS1A 3AK4A 2LDBA 4UXJA 3BGSA 4P33A 4AZVA 3Q85A 2C2XA 1S8OA 3PR2B 3CRQA 3ZGOA 1GZUA 3DCJA 4L8LA 2JRTA 3EA4A 2WV1A 2JCBA 1QRUA 4UUMA 3HQ4O 3DLLF 4PSKA 3RYTC 3BTCA 3KHSA 3TLYA 1BI3A 2E49A 2EWWA 5GV7A 5E3IA 1PP4A 5IC5A 1GKKA 4L28A 3AFMA 1M2OA 4KO4S 4ZCMA 4WL0A 1C7QA 2PE5A 1Z4NA 1OR8A 4B3IA 1JHZA 1P6RA 1W44A 2AJCA 2FV8A 2NACA 2QRJA 6AT1A 5JADA 1T5HX 3A1UA 1CDEA 1NKVA 2L9RA 2QEXI 4YMUA 3C3PA 4JI1B 1DI0A 5TS2A 1KEWA 4AJHA 4AKGA 3BL8A 1EVIA 2QKMB 2N0SA 3ZDQA 1TRKA 4M55A 1CPYA 3AVVA 3H9EO 2ZG6A 3PCXA 1GRVA 1I2ZA 4BVBA 3ORSA 1YZVA 4NNPA 3IQXA 2XQVA 1ZOOA 1N2BA 5M29A 4DV2B 1O9HA 3OOPA 4FQGA 5J58A 3BQNB 3HACA 3N2YA 3GRVA 3D0RA 4KR0A 1KFKB 5J4LA 1QVRA 1X8XA 2D5BA 1YQEA 4GGOA 4AJ2A 5DYMA 2WWRA 3BXOA 5IKMA 4BLSA 4M3FA 3VBCA 3TDMA 2EHJA 1OYWA 2XF5A 2K3FA 4DVJA 2AV6A 3J7AO 3BMCA 4B2IA 3A05A 4FKMA 1M8JA 3OEYA 3CMAI 1BC5A 2CJWB 2ODNA 4J1TC 3OX3A 2FVXA 2A0YA 1U9IA 1F5TA 1UJNA 5GJWC 2B4TO 1PDNC 3TRJA 4HAUA 3ONVA 3PEEA 5C8YA 3KC2A 2YKGA 2RAVA 3FSRA 3GRRA 1QYDA 1UL1X 3CH7A 3LLVA 4DMRA 2E2JJ 4FOTA 3M6UA 1RR8C 4HTFB 4DSOA 2GWHA 2C4UA 5FT9A 2LFBA 3R5SA 3PQ8A 4HVTA 1SQ0A 1XL0A 2NOAA 3CKYA 1SCIA 2ACEA 1NXQA 3MWJA 1RPZA 4XJXA 3TP0A 2ME6A 1A9RA 3HR7A 2X13A 1OKRA 5TT1A 4RD1A 2O3JA 1PR6A 1X39A 1OBHA 5LB4A 1J5XA 2CNOA 3BX1A 4L08A 3WBFA 2JGFA 4DYRA 4G0PA 2HYFA 3GG9A 3NRBA 1BC7C 1X6VA 3DOEA 3PZRA 2ISZA 2RDPA 2R7VA 1U3TA 3UJCA 1B74A 3O8HA 3FF1A 3DSRA 3SLRA 3JV7A 2IZ6A 1W5SA 3I28A 4LWOA 4MW7A 3QLTA 5BORA 4PG8A 3CQZJ 4ZOEA 4BJ6C 2GEDA 2WUDA 2V1XA 2KM1A 1FYEA 3DM9B 1F7VA 5EJCA 2FETA 4BVJA 1ISGA 3EUWA 2O4CA 1SKUA 4PX9A 4UREA 3NP9A 3FPHA 2O9JA 3RFVA 5JNLA 4O1MA 3BL6A 2JRMA 1ZVMA 1DAOA 5EKUA 3VNRA 1XE3A 5DHTA 3V8RA 4OK3A 1NUAA 4XD7D 1E3DA 1Z21A 2E5NA 4PZZA 1N5LA 2HPIA 2F2EA 4LDJA 4I3GA 4P9UA 1YRWA 2L0XA 4PYQA 2RV8A 4GLOA 2FR0A 1QPMA 5CCBA 1AZTA 4LG3A 3DDZX 4OLAA 4UULA 5I7VA 1AWCA 5AO9A 4Y17A 4DDTA 1ZJZA 4YAKA 1W52X 4I6ZA 4HDMB 5CB0A 1UP6A 3G0BA 2CXNA 2F3RA 3X2QH 4LMYA 4CYCB 1BXGA 5HCIA 4CW7A 4GOJA 4LJ6A 5KYTA 3O82A 1TCCA 5KI6A 4BRSA 1GNLA 3HO6A 2H9IA 4FYHA 1B8IA 2P5TB 3ZQQA 3ZPXA 1W4RA 1LDNA 5FQNA 1W4CA 5HK9A 1GHCA 1O8CA 4WY2A 3QG5A 4KGXA 3KJEA 4U7BA 2FA5A 2O7RA 1GZ4A 4MYSA 4XDHA 4RX1A 4M0KA 4YT5A 1AQ6A 3D6MA 4Q66C 2MSLA 3JQEA 3KVRA 2XV1A 2IDJA 1IZ1A 3ZGVA 5HF9A 1YVPA 1A6IA 4BS9A 4J4BA 3F96A 1C9MA 2HF9A 3RC3A 1ZMOA 2EV0A 3ZYCA 2PH7A 3ND5A 1AA7A 4XM1A 1VDZA 4HGZA 3DKRA 3E84A 4LS3A 5IASA 5LL6P 1KH1A 4GZ5A 4HWSA 3KXPA 1E79A 3TDUC 1Y6IA 1XZJA 4HKTA 2H09A 3K70C 1GNQA 2KQUA 4HDQB 4WV3A 3HSSA 2CFRA 1JX6A 4NOJA 3PCTA 3N8NA 5M04A 5KQLA 3NV7A 3VR4H 2B1JA 4YDRA 2HIMA 4DNQA 1PFUA 1ZELA 4AUMA 2R6R1 3ZHUA 1NI4A 1VRWA 3AVWA 1Q1AA 4M1OA 3GRAA 3VZSA 3DE0X 4F8YA 4V0NA 1D1SA 1DT5A 3C6YA 1B4DA 4GZ3A 1IWOA 3LBHA 3RRXA 5JS1A 2KZVA 3U7HB 1GPMA 3UJHA 3EUEA 3D8HA 2YN2A 1D4FA 3OM1A 2WWIA 4PFKA 3OAAD 4FYWA 1IHPA 3LPLA 4N03A 1MBZA 2DLCX 1Y8RA 1NUQA 4KWHA 4FDAA 5L7TA 3E3LA 4K8OA 1K8XB 3GPLA 4IXDA 3M3DA 3NEPX 4REOA 3Q8LA 3R4KA 4L9NA 3L93A 4RF3A 1PZEA 3CW8X 1XNJA 2DMNA 3UXMA 2E2HJ 1R5GA 4FCVA 3HUDA 3SY8A 2PEXA 4DJAA 3U1KA 5D5XB 3V8PA 1WXEA 2LTAA 2FP4A 1E2NA 2P69A 2A0WA 2V7FA 2YY5A 3D4BA 3EVDA 1C7JA 2VDUE 5ARBA 4AL4A 4QL3A 5KSPA 1DRVA 4RQUA 2ZWPA 4IILA 3OZAA 1XMAA 4AVPA 2R7RA 1GAQA 3N8IA 3NALA 4PZAA 2QM8A 3MCZA 2HJGA 4N5DA 2QR3A 3WLLA 1D5WA 4Q05A 4PSAA 3MZHA 3JVEA 3Q8XB 4I4TB 2IHZA 2A8YA 3DE4X 4G0VA 3I4CA 3AG2H 1ZSVA 2NTYC 1MG5A 4PAQA 3IVCA 5HF5A 4OMZA 2OPBA 4OIRF 1ZNYA 3EGWA 2QV7A 1XLVA 2BGUA 4UAGA 2W4SA 3R3WA 1XTUA 1VGQA 4TTTS 1E4EB 2VG8A 1CUFA 3SHWA 5ALPA 3PQDA 2YX1A 3CNHA 1XU4A 5DIFA 1NKTA 3EIFA 3WLOA 4ZHQB 1D1PA 3QGMA 4WZZA 1D4AA 5BSGA 1U9JA 4CMIB 4CYDA 3CNNA 2B0LA 2Y31A 1FK8A 3JASA 4AKSA 4LYYA 3OIPA 3KSZO 3K4MA 2Z30A 5E9WA 2RGNC 4WKBA 3B3FA 4M37A 4ZQBA 2CLIB 3JRCA 1TKBA 1CJBA 2PLRA 1MQ9A 4XEHA 3EYIA 1FYFA 4IPAA 3UAXA 1QE3A 3N59A 5JCPA 5CH8A 3G0GA 5DX1A 2NSLA 3TLBA 2JFYA 4QSMA 2UYOA 1YHYA 4M76B 1TVKA 5KTNA 4ARZB 3LECA 4WFQA 4KR2A 2GYWA 3AR3A 1QDLB 1R4ZA 4ZVSA 4WXDA 2FU5C 1S7AA 5IXYA 3PFYA 1CR6A 4LYAA 3LSTA 2OHFA 3HWSA 3TBHA 2JLBA 1WTAA 3ZXUB 1PJ4A 3CCEI 2QHXA 2O8XA 4KOAA 3RHZA 2H11A 1DX4A 2QX4A 4OK5A 2BMEA 3F6SA 3QY0A 5H70A 1K89A 4ZANA 1C3VA 4GE3A 1K61A 4QOFA 1QGUA 4Z0NA 4DREA 1AGYA 1XRSB 3H3VK 3L84A 2ODAA 4GGGA 4I02A 3THWA 1IXRC 3U7EB 1AD2A 4NOMA 3IPXA 4EARA 3A1SA 1JAHA 1OXMA 1F4KA 1XAHA 2Z9BA 3B9BA 1UAGA 3UICA 3VKVA 3UOGA 1BW9B 3OI7A 1EFVB 1RCUA 4OQLA 3HUTA 4KWTA 3F22A 5KWJA 4UFOA 3LYLA 1P1KA 4LYGA 4HGOA 4KYUA 2Z9CA 2JHAA 4LJ5A 3GZTB 1QQTA 4JSTA 3STVA 1XL1A 2I34A 3FYUB 4D44A 1X1QA 4IKEA 1ONNA 1W1IA 1II8A 2WSSD 3NTUA 3IVXA 5BXYA 1DPGA 4KACA 1LXCA 1E5DA 3C2GA 2ZR9A 3MTDA 2YWXA 3K9WA 2CYBA 1S96A 2KKOA 4RJIA 4TS4A 3K10A 1WH7A 4HYTA 2HLHA 3LVBA 2NO4A 4ROSA 1Z9CA 3NRJA 3ETLA 4EL5A 2GUWA 4YALA 1LPPA 2X3FA 2P41A 4XWYA 1YNSA 1OTYA 3R3VA 2D2FA 2UUAB 3K8QA 5D01A 1KFCB 3EG9B 2ATXA 1Y1KE 3LYAA 2ZIEA 4UMEA 3HO8A 2VQCA 1P18A 2QENA 1SVMA 1P7JA 3D8TA 4MTCA 5B1BH 2BVMA 1P9OA 4AKIA 3PLNA 5CCEA 4FWTA 4HDSB 3MIIA 1J0XO 3AJEA 2PQ8A 4NDLA 5K3BA 1SU8A 5E8IA 3W2TA 1XTQA 3R2JA 2B8TA 3BC8A 1LPAB 4ZAVA 2ICWG 3CEMA 1LH0A 4L5AA 1XEXA 3E23A 2VPXA 2UU9B 4J0JA 5GWXA 2REOA 2YDXA 2O48X 5CEFA 1F0KA 1G21B 4BJ3A 1H69A 4MUGA 4A03A 2XF8A 1IY0A 4TYMA 4DL9A 1L9KA 2OAEA 5DYYA 4WINA 2WLSA 1XQVA 2YUSA 3F4BA 2SCUA 5DK6A 1SM4A 2QS9A 1EUDB 3NEAA 4K87A 2O2HA 1T8PA 3CZQA 2W85A 1M6YA 2AXNA 1M2VA 2WJVA 2GJSA 4IS2A 5EYRA 1UH5A 1KY2A 3I6IA 2WUFA 3H5OA 1EB8A 2REQA 4FGKA 2AK3A 4NK5A 1HDRA 1P6XA 3UAZA 4P3NA 3V8BA 1I8TA 2FX0A 1G3MA 1HBJA 4FSHA 3L46A 2I8LA 4KT6A 4XCQA 3KLBA 4B6SA 3KCQA 3B8HA 4B2PA 1PQ4A 1FFEA 1XVTA 4EABA 3NTXA 4QGAA 2YC4C 2FE1A 5DLDA 4BXFA 4P34A 2I4OA 2XCTB 3UK7A 3VYUB 4AAYA 3BG7A 3BQYA 3JVUA 4M83A 4RB2C 1TTPB 1XRJA 4XZ3A 4Y8VA 1SUWA 2BYTA 2WT4A 2C5GA 5KYGA 4BB9A 4FN5A 3MINA 3DB1A 3O90A 3IAM1 3L7WA 4ABYA 2C9CA 4GVLA 3D6FA 1EXWA 3AUTA 3NAQA 3WFIA 3OM0A 4MQUA 3LUJA 4WCFC 3EOZA 1KYXA 1FPMA 4KVGA 1DIAA 1I3CA 2C99A 4IKFA 4DCTA 3AIIA 4MAMA 3EYYA 4A27A 4QBHA 1JYEA 1K66A 1VDMA 3RTEA 1YDFA 2VBGA 5EOVA 2D5CA 4LJ9A 1VE3A 4F5WA 2P1DA 3IJEB 5LQCA 1C0PA 1SD2A 1KH2A 3B70A 4RLSA 1R1VA 1VTKA 1JQ5A 4ZZLA 3KHKA 4JQYA 721PA 4DR1B 4L9WA 4R4JA 3H16A 3WL3A 4TS9A 2LH9A 3A4IA 3EXIB 2JCXA 4Q9LA 4UBKA 5A03A 2W37A 1DIOB 5JQGF 3DBHB 3WK5A 2VYND 4GCVA 3SQNA 1C7IA 1UK8A 2XTNA 2QVYX 4BNZA 4OI0A 4E70A 4DMKA 5C2JB 1SWVA 2Q9BA 4CJXA 4MLPA 3D6JA 5EMHA 4C4OA 5HDBB 2CNLA 1TQ4A 4PPNA 2WG2A 4XYMA 3PHJA 2PNJA 1VMKA 2KMUA 3ZI0A 2W93A 3N53A 1Y8QA 3P0JA 2NOJB 2VN2A 2NUPB 3NJ4A 4J00A 2EF0A 3KG2A 4H6WA 1F9AA 1UJ5A 1FIPA 2GS9A 4BE0A 2BSXA 3KEYA 1HDZA 1VMEA 3RTGA 2FZ5A 2XMSA 1S7CA 4BQEA 1Z5WA 5IYZB 5IUJC 3GGGA 1YZYA 3B6EA 1O95C 3JZDA 1IDN1 5BW5A 4AQDA 5BR8B 2FMYA 2VSQA 2A9JA 1RYBA 1S0UA 1EWKA 3DA8A 1I5RA 1QHFA 1HKQA 1L5YA 4LCEA 1BCRA 3HGMA 3ASOH 1A8IA 4ND2A 2VZ0A 2R5FA 5KNBH 3NHJA 1JT9A 1M2NA 2Q28A 4F2DA 1Q1NA 2V6MA 5ES4B 1YVDA 2NAFA 1X3SA 3PICA 4TKVA 4L4SA 3FWYA 2D2XA 4EGCB 1KPGA 2F5CA 1R8JA 2BI4A 4C4AA 4DLBA 1XXHB 3P0EA 1D8JA 5A3QA 3AKDA 1O94D 2C9YA 3VZQA 1M72A 1T6SA 4JX4A 5FHRA 3JQ6A 3EIOA 2AMYA 1WMAA 2F4VB 4NEGA 3OR1C 2WJ6A 2QQ8A 5AMXA 5ABPA 2FWJA 3NH6A 3FPLA 3OSFA 5BQPA 3M6MD 5KJCA 4LHYA 2FWIA 3IUBA 2YUIA 1X7YB 1VLLA 3CIFA 1QKJA 4QXOA 2WU4A 3QU3A 1T34A 4ZVMA 1JFLA 3F90A 3Q3JB 1U98A 5A3VA 2AQKA 1NA5A 1QBKC 1Y5NA 3T3GA 4WNIA 5BMVA 4A0RA 3QOPA 1MV8A 2C0QA 4OBBA 1MH4A 4PQFA 4QUBA 3DMRA 2XA2A 4M1YA 1Q0PA 1NV8A 1ZD1A 2JFGA 1ZREA 2I9PA 5SZHB 1G8FA 2ZYGA 1JIIA 4D6XA 2EYUA 1XB2A 2VNHA 5JH7F 2XZLA 1KZ4A 1MOPA 1VQ5I 2PJRA 3P26A 2H1IA 3L9XA 2GVNA 4RSGA 4AO6A 4KFSA 3TD9A 3CPSA 3W5JA 4D5CA 1USVA 1XQWA 1Z15A 3OVMA 4N0BA 2QY6A 3M6LA 2VXYA 1ZKGA 3PXXA 4R5HA 1CF7B 5C35A 2Z2KA 1E59A 1U8XX 1PO7A 1NBMA 1TYZA 1XDSA 4BYMA 3N7AA 3R6TA 1L1EA 1LEAA 2BM1A 1OLXA 5HGJA 5ICGA 4HGPA 2QYSA 4NH4A 4IGAA 4BLOA 1I6KA 1U9YA 1ABEA 5EMJA 1KMHB 2NVOA 4G0XA 6Q21A 3THRA 2RCYA 3IULA 2CW7A 2L2QA 2O2CA 3MERA 3ROXA 4QBGB 4C0SA 3UMCA 2IW5A 3H0CA 4C78A 2NO5A 1Y9DA 2YC2C 3B1XA 1SAXA 1MZVA 2ZKLA 1RQ2A 5HSGA 1DAFA 3NEUA 2ZUWA 4LIVA 4WVLA 2C7VA 4RTKA 2IH4A 3QBJA 3PENA 2MR5A 4F3RA 4P1WA 4MLCA 4AYBA 1RJDA 3VH2A 4J0DA 3NM6B 5D7NA 2OKGA 3OSUA 3OCXA 1KGSA 1V7ZA 3KP2A 3D4OA 1VIMA 5CA1F 3OETA 3PO2J 2ZIAA 2I99A 3GRCA 3D8BA 1C1YA 3EFOB 2IYPA 5D4SA 2H6CA 2QPAA 1DQRA 5M5BA 1QRYA 2FDXA 2I76A 4P3XA 2HADA 3U44B 3DZIA 3LHSA 2PH5A 1M34E 1PT7A 5LRSA 4WN9A 1CRQA 4HBGA 4OHMA 2VDLB 3RAJA 1CE8B 3Q72A 3LX6A 2ES4A 1B73A 4KLZA 2YXEA 3EZ7A 3JYQA 1U0TA 5F77A 2E4YA 1ITYA 2WQZA 3MHPA 3NXKA 1BN6A 1RI1A 2R1TB 1W0KD 5E1XA 3R5XA 3AR8A 4Y98A 5KO2A 1BH6A 2FMHA 2J07A 2ANCA 4UU1A 3TVDA 1E5XA 3D3WA 1CEXA 1E0KA 1N2XA 5ADVA 2LXNA 3FYTA 2ZSBA 1SFKA 3B3AA 4IL5A 1TJPB 1CC1S 2EFWA 1VP9A 4ASNA 3QPTA 1OY1A 4R79A 2J9FB 3HYRA 5ALDA 2H48A 2R4QA 3W5BA 4XRMA 1MJGA 4KO2S 3M5CA 2YCBA 4W5HA 2BWJA 3B1FA 5DBEX 4YV0A 2QWWA 2Y9YA 1WJFA 5JANA 1A36A 3KT8A 4IUYA 4BGVA 3N7UA 1SCUB 1O03A 3JQ9C 2Y1FA 2UXCB 2EFOA 1RS0A 1E8NA 1VHJA 1RWKA 3M1YA 1JUPA 1ZRDA 3L1IA 4BTEA 4BLUA 2YVQA 5HS9A 3PQEA 1ML4A 1L2TA 3FFAA 1QU2A 4AUNA 2PJZA 3VKGA 3THYA 4HSRA 1GUDA 2WTUA 4BVFA 1ODTC 4RMIA 2ZLBA 3IH5A 3Q0EA 1A77A 1WI3A 2E6KA 3N2KB 1CUIA 2F55A 5HNKA 2WZQA 4QTUB 4WK4B 4KTTE 4R9SA 4JKYA 4P4NA 1R0SA 3GRFA 3C4JA 2ZJRF 2Y48A 1E7RA 4LXXA 1PEKE 2P68A 2OD5A 3S15J 3OIOA 1N2IA 1LI4A 2R11A 4XQ0A 2VDQB 1ISMA 1PQYA 3DE3X 4YAJA 2QX8A 1AKNA 3WL4A 4KN9S 4B3DA 2P4HX 1RYDA 4DV0B 3Q0VA 2NVUA 1G4AE 3CZMA 4OQPA 3RTRA 2BHNA 3HKEA 1L7EA 2F1JA 2AE1A 2WC1A 4QX6A 1CY7A 1JQLB 1PR0A 3I3OA 4HRAA 1ZIOA 2GEBA 4POAA 4HQ6A 4TTPA 3DLTA 3DLIA 4P1ZA 2PLFA 1WZUA 1VL8A 4UU0A 1ULAA 4DCOA 3F0TA 4HAIA 1R71A 3A10A 1XLTC 1H9BA 3D3EA 5IJAA 3S2HJ 1JMVA 3PL5A 1XHEA 5FFNA 3GUUA 1XVLA 1WX1A 5EE3A 1DCFA 2YV3A 3HYNA 1YS4A 5FV4A 3ZQ4A 1UQRA 3WKAA 4EKNB 4LC9A 3K6SA 2OHXA 4HEA6 5JAZA 2NU7B 1PBNA 4NU0A 1UZNA 3GEIA 3IV5A 2KRFA 5DHPA 4CCNA 4ZN6A 1T5SA 3LIPA 2HLPA 1T39A 3S70A 1QP0A 4DIBA 1K7YA 3DPIA 1C41A 4LFBB 1TCUA 3PEVA 3A28A 3HB7A 1HCRA 3HRKA 1EA7A 4JUAA 1GAJA 4LZWA 2APJA 3SICE 2QL6A 2HD4A 2VQLA 2FA9A 3ZZMA 2OB2A 4EY5A 2NTEA 1RVDA 1OBVA 4LK2A 1B0UA 3R6DA 2Z4TA 3N8DA 4XFDA 1CUHA 3USZA 4GLBA 1LS1A 3T4UA 3HEFA 2UYGA 5EJ6A 1UQTA 2XNDD 1XK6A 4HF2A 4EYEA 1D9XA 3RUFA 1ZRCA 4RVGA 2K6GA 1EG7A 4KO8A 2DPMA 1XN7A 1SELA 4INJA 1OXVA 2AOTA 3UQYS 4OLFA 4B6GA 4M9ZA 4DB2A 2BFDA 1UPAA 3AY7A 5C8ZA 5E79C 4I3FA 1AKUA 1XP5A 1RPAA 1XTVA 4I81A 2GK4A 1RQPA 3GLSA 4QG3A 4TL7A 1HOMA 3A4CA 1QH8A 1LTHR 3DUFA 2JAXA 2CW8A 3HVHA 1G41A 5JY1A 1I51A 3CLKA 4YRMA 5CLIA 1RKQA 4LSMA 5BSEA 2V0GA 3C2HA 2WZCA 4DIDA 2W58A 1RPJA 4A0ZA 2HBRA 4EF4A 2XGJA 4E14A 4UVAA 1DSSG 2QA5A 4KE9A 1DQNA 4KPUB 1TYCA 1WF3A 2PZJA 3KEFA 4BUZA 1GQYA 5NLLA 4EG5A 5TMPA 1LB2A 1W30A 3LXUX 1HZJA 1W85B 1FSFA 3WSVA 3NG1A 5CJ2A 3B3JA 3L8MA 3OHPA 1WVRA 4BQQA 3JR9A 4I9FA 1JGTA 2PZLA 4F3YA 4IY1A 5C4MA 2HS5A 3CJRA 1SEUA 1VZ3A 1YA4A 1K6OA 1HL3A 2FXVA 4AJNA 1SHKA 2YJ4A 1BX0A 1NVFA 5CBPA 5LXTA 2IPOA 1LQUA 3FZEA 5DHAA 1CZOA 3T3EA 5DYWA 4ZDIA 1ZN9A 1W25A 4DCJA 2WSMA 3M5PA 1U2GA 5LQAA 2FPOA 4J75A 4M3NA 5F21A 1G7CA 1TMOA 1WKMA 1RESA 3RSQA 3DT8A 2NP7A 1JKJB 2GO1A 2P27A 4NONA 4JBGA 3WO0A 5LD2C 1H2ZA 1E32A 5FF9A 4REQA 4I14A 3ICQB 4EG8A 5CR9A 3CPJB 3S29A 2NYRA 4E3ZA 4MUYA 5F12A 3KSMA 2H92A 2GZAA 4C7XA 3H9UA 1FC0A 3I53A 5FDFA 1RABA 4WKOA 2FZLA 2NU6B 4BN4A 4PJ0C 2UVPA 4Q37A 2C9BA 4CG2A 4BO5A 5F78A 4GBED 1RJ9B 1ZVQA 3F8NA 5MN6A 1D2CA 3FTQA 4G4SO 3MMPA 5E8RA 4HRYA 3KTAB 2C96A 4A8HA 1CIVA 3MJEA 3U19A 1G5RA 1F1JA 3BA1A 4Y1RB 1QORA 5L7WA 1GUYA 1Z68A 2Z98A 1JFSA 1Q1HA 1UMBB 2L7MP 4K6OA 2A6EF 1SA0B 1X77A 5THKA 1B6GA 1ZJJA 2PZGA 4C06A 2JC3A 4UEJA 2IUUA 3OMYA 3ETEA 2OXTA 3GRYA 2UUBB 2J48A 2MDTA 4RVCA 4IGKA 1C5KA 4LZAA 3GMEA 3HK2A 1TUBA 1TEXA 4KQEA 3A06A 5KU7A 2PWPA 2QRPA 3ZMDA 4E7LA 4A3IJ 5AFSA 4PHTA 5LKAA 1XTAA 2WZBA 5F4BA 4RDCA 2YUTA 1ABBA 2IQIA 2AMVA 2FUG6 4PSDA 2DQLA 3CNBA 1YOBA 4FI3F 1ZUHA 4EFNA 4LJKA 3NGMA 2G28A 3SXPA 3OZIA 5CB6A 2OJED 1L3LA 3OE1A 4C6SA 2Z58A 2JTVA 3UEOA 1GDDA 3HUUA 4HS9A 3N05A 3ORRA 2MYPA 4LOAA 4DR6B 1ZGWA 3KQPA 3QU2A 3O93A 2ONYA 4KPFC 5FOSA 5JCZA 4K2AA 1ZYUA 2KIFA 3KTDA 1USUA 3AEUB 1ZS9A 2H17A 3NQOA 4YDQA 3EGOA 4YCLA 3U3JA 4H60A 1ZI6A 2DMQA 5FL7A 4N7BA 3CP8A 4MUFA 4D9KA 2ZYSA 4AVYA 3GLUA 3LU1A 3GAAA 1AURA 4M4SA 1VSTA 5HOOA 2Q6KA 4WY8A 1BS2A 4PSCA 4UTRA 2ZTUA 1D3AA 5TQ0A 4X7RA 3STTA 5BNTA 3N0XA 1KJ8A 5CURA 2Y2UA 2QMZA 4BAYA 2J45A 4ZI7A 5EHXA 4DOMA 4NFSA 1R1UA 2RDMA 3GT3A 3B53X 1NW8A 3HG7A 3QBTA 3OD1A 5LU9A 1T0UA 1H3FA 2GZHA 2ACKA 2AN4A 1WKBA 2D3WA 4HX8A 1ZQ1A 2ZTHA 2OGTA 2QROA 1V5FA 5J8FA 2LV8A 1HM5A 2YBEA 5A9SB 3T4PA 1U2SA 1CERA 4JQSA 2ESRA 5LZ2A 4EW6A 3BZBA 5EFOA 1O54A 2YNMA 3QVOA 5I6DA 4OYRA 1VL2A 3WL6A 3E9NA 4UTPA 5MDHA 4LHXA 3FR7A 4IJKA 4B4UA 2HA4A 1VL5A 4R3NA 1BCSA 4C5AA 4M36A 3OG9A 5BQOA 3NZEA 5K45A 3RVRA 4OSOA 3N39C 1CF4A 1Y9ZA 3ZCVA 1KQOA 4ZYTA 4PDKA 3QE0A 4IOAF 8LDHA 1OTHA 3W5SA 2Y0PA 3B6MA 4X7MA 1G7RA 5HQ3A 3DONA 3NHMA 2PLWA 1J5PA 2Q5IA 4AZ0A 2PAAA 2AZMA 1O97D 3LS2A 3TUJC 1QUEA 5KSWB 4ZEVA 4BNMA 1VQOI 3EFHA 1N9GB 1RWMA 2VSXA 2R2AA 2Y0SA 3OYKA 2FVYA 4KR3A 3L2QA 2PL3A 2Y9ZA 3RC9A 1XTRA 1BXZA 4NI5A 4U39A 1E0SA 3L5OA 4OGWA 1G9XA 3OJEA 3WGGA 2VR1A 3OCZA 1UXGA 1HDDC 4IHJF 1U78A 5TNXA 2ZAYA 1KVTA 3CLRD 4FC6A 5DCYA 4CI0B 3DLAA 3B6ZA 1RNLA 4J91A 2DKFA 1W7PD 1WM1A 3AG1H 2BW3B 4IKPA 1Q0UA 2H2GA 1UKCA 5B4UA 4EUEA 4DBVO 5FOXA 3FB4A 2FRHA 4X3OA 1TYDE 4OOEA 4NJMA 3FCYA 3V2UA 2P2DA 1S2IA 2P2GA 5HGXA 1PW5A 3P9KA 2Q4OA 2IV3A 4XWTA 2KISA 4QO8A 4C6RA 1I3OA 1OF1A 2IDMA 1APLC 3TAUA 2VRBA 4X8OA 2P11A 1BJKA 3HDVA 3T35A 3KPHA 1NN1A 4S2UA 1XYVA 1OU4A 2H52A 4Q9IA 2V4MA 3B02A 3KP3A 1SUFA 4IGIA 5CQGA 3GUCA 3TEJA 3BK7A 1HMPA 4R8HA 1QAQA 4YAGA 3PC8C 3E5NA 5JLAA 1QKIA 4NXNB 4B44A 2C78A 4L6AA 5HKOA 5PGMA 3AVXA 4RIGA 3FKQA 3DEJA 5LA6B 2Y77A 2IF0A 4K05A 5IPFA 9GPBA 3MGAA 3OEHA 3FDZB 4MV4A 1EWVA 3JALA 1GDHA 4QYWA 4M71A 3ZIDA 4GPIB 4OEHA 2GT1A 1O2DA 1F2UA 5EGOB 1YZUA 5E1ZB 3SHFA 1KS2A 1CB0A 4TPKA 3RBVA 1F8YA 1RI3A 3KL4A 2FY8A 5B1AH 4ESBA 1AU7A 5ITZB 3IV7A 1XTIA 3IMFA 1ZA2A 4YREA 3ZGYA 1T13A 4I19A 1YOVA 1VYTA 1J7KA 2Z8ZA 3SIWA 1RWOA 1QQ6A 1P0CA 1BWQA 3IHTA 4X85A 1ESDA 3QUSA 4MRMB 5HS8A 2H2DA 3GFFA 2PPLA 2D3TA 1RI7A 4RNDB 1V4NA 1JG7A 3ILSA 1RAHA 1IRZA 1YDHA 5BSKA 5CU7A 4FYPA 2D8MA 1I7PA 1O4WA 3W5HA 2XQGA 4C3OB 3EMBA 3VEPA 2EARA 2XVXA 2XHZA 1K3TA 2IEYA 1X14A 3ZXYA 4QDUA 4RZ2A 3RWOA 4IHTA 3W90A 3QSYA 3VV3A 5A6SB 1XRPA 2X4HA 2GMWA 3TVTA 1JYSA 2ZTVA 3OQIA 4X66B 5BURA 3PGLA 1UMKA 2OAZA 1QMGA 3DTYA 4D0RA 3HRTA 2NX2A 3IR5A 5JXHA 2H1OA 4ZCSA 1NY5A 1QHIA 2VTVA 2B30A 3LQFA 1ETOA 3AIMA 3SR4A 3MJ4A 3SF8B 3OOYA 4FMDB 5K7HA 5GONF 5DM70 4WUVA 2IUSA 2DF8A 5LUBA 1MZBA 1C4WA 4P9NA 1TT5A 1QGOA 4Q00A 3O2QB 3D3NA 4PRYA 1ZBQA 4UTXA 4BV9A 3S14J 3A3NA 2A0XA 5BOVA 3I9V6 1RCTE 5T64A 2PX4A 3R40A 1OXTA 2PRJA 2GCOA 6PFKA 3G1UA 3RSGA 1YHZA 1U1EA 1JFTA 3ECOA 3Q0IA 4Z1OA 2QOEA 3ENKA 4ALKA 2JA6J 3AUXA 1NYLA 1X1RA 3A1TA 4L9SA 4EYOA 4HPXB 4X93A 4B4OA 1X19A 5F5XA 5IAOA 3R0ZA 5J3LA 5DGXA 4C3ZA 4B7ZA 3HSRA 3HSFA 3GFBA 4PZLA 5F0HA 2DRIA 1M7BA 1IVSA 3QKTA 3N0WA 1KA9H 5HBRA 4YR9A 1UFMA 4WSOA 4DDVA 3R7NA 3MKYB 3KZKA 5LIRA 3PG5A 1M1NA 3BICA 4WLFA 5TQ2A 4Y9RA 1GCIA 2A4KA 5B3KA 2W6ZA 1FYMA 4DADA 1BVUA 2GYVA 3FPBA 2BBYA 7YASA 2P62A 1H3EA 3DXJF 1TM1E 5A5GA 2EIXA 3EAGA 4QDZA 5E6SA 2AOUA 1E3MA 4HMPA 4D3DA 1JVBA 1V26A 4B6QA 4QFDA 2QUJA 1H05A 1OT3A 2MT9A 2XQIA 1RCFA 3V34A 3AHCA 1Z5VA 2P1ZA 3FWZA 1Y8AA 4L78A 2ZYUX 3DV8A 4UDOA 4BAGA 2VCEA 3OL3A 3ZK8A 3SWWA 3R61A 1NVVR 2FFBA 5C1BA 1ZGAA 4TYQA 2JVJA 4N0QA 2IXTA 3Q0UA 4P0TA 1EU1A 1XQ6A 4DPKA 1VP3A 1CZRA 1UK7A 3LT1A 4L9TA 3BY6A 3UAVA 3BE8A 2VUMJ 1OCCH 1RRKA 1YI2I 3GTGJ 5KMGA 4ZCLA 4ZOQI 1A4UA 5DTJA 1MEOA 2E85A 1HKSA 2Y68A 3WY9A 3IP4B 3L0PA 4OIFA 3WU0A 1KEKA 3W2VA 4F56A 1M7GA 1K3FA 1NNSA 1MJ5A 1U2RA 1HK7A 1XGNA 2ILTA 3HBFA 1CUZA 5AJYA 2W42A 3CG0A 1U5TB 4JGIA 5AK4A 3W8DA 5C8VA 5EKTA 2R7TA 2VHTA 1DKRA 1IUNA 2ZRCA 4BFXA 3AHFA 1Z16A 4P36A 1YRNB 3TL4X 4G9EA 4LDPA 4TKZA 4LRSB 2I1VB 4MMZB 2Q0QA 3LFKA 2QP9X 3PA6A 2CCKA 3CCLI 3BR0A 1L8QA 4G5XA 3GMSA 1Z2CA 4OSEA 3E53A 2CHFA 3OKPA 1MNMC 1NI5A 1DO8A 4Q4JB 3DF9A 4LF4B 4PIPA 1WAMA 1M6NA 3M6VA 3OMLA 3MT7A 1E3LA 3ZD6A 4K3UA 3P2YA 3G2OA 1DKLA 2FKNA 3I58A 1I4OA 2XVMA 2HPMA 1NZJA 2PRKA 3T3IA 3ZBTA 4MKZA 1FFCA 2BBOA 2HFKA 1TQHA 4JB2A 2J5QA 2C0CA 3G5TA 4D4HA 4QVGA 3FD8A 3GZJA 4ASUD 4IIHA 3N2GA 1P3Y1 4GX1A 2ZSDA 5EN4A 4KNVA 4FE3A 3HLTA 4XTRA 2HIGA 1Z6ZA 2WKPA 2Q1YA 3DQZA 1FL9A 3GVAA 2I1QA 4C4PA 4ZHSA 4YJ3B 2HZDA 1GCOA 3LWBA 2COKA 3BG5A 1QLHA 1J07A 2ZBPA 1FFHA 5FNVF 4DMUB 4ZYHA 3C7KA 3CJNA 4IRUB 2EP8A 2Q5CA 2IY7A 4RU1A 1YS2X 4EY8A 4TRRA 1V4RA 1FU4A 3AEQB 4XIDA 1C81A 1DRJA 4YB8A 2O4UX 1GVJA 2HT6A 4Z4GA 5U9CA 3U5ZB 3BQMB 3H19A 4EAQA 2A7XA 3R24A 3KB8A 2YHUA 3TFOA 1GV5A 4UUSB 4JVNA 2CFIA 1YGPA 5HIJA 1NQVA 3BSFA 2WWTA 2YYAA 1V1MB 2WKWA 5FCDA 3EF0A 3A9WA 5TJJA 4JKOA 4CSWA 5IT5A 1QYCA 2BL4A 1PN3A 1R3UA 2H57A 3O4HA 4BZWA 3OCJA 3I0NA 3JSXA 4MNUA 3C1AA 1B9NA 1DC4A 3AF0A 1Z2NX 3JQAA 1U02A 4O4LA 4BNUA 1DC7A 1RRPA 1RMQA 2DDAA 1S01A 4E7JA 1GP2A 2ZI7A 1Q83A 3C8DA 1N0HA 4MI9A 4EY7A 4PRLA 2GEJA 3FBTA 2EIMH 2OO3A 2XAQA 1NG9A 1LJLA 1N8SA 2ZJFA 4MKHA 1JGGA 2NZ2A 3FROA 2BBWA 2ZR0A 4M9SA 2Y1XA 2R5NA 2ZJ2A 4U6QA 5HZHA 3BR2A 3ZGXA 2R25B 3COWA 2JH9A 4EM0B 4OUDB 3KDPA 5KYYB 4LHSA 2BONA 3HDYA 4OO3A 1C9JA 4MV1A 5L45A 3F67A 3Q3EA 3KYCA 2YWFA 1EJ6A 4N6OA 4R1HA 2QLBA 1NK2P 1KDPA 4CT4B 5JASA 2XCIA 3OIDA 4N5LA 1WZIA 2WAXA 4QBIA 3VDQA 3V1LA 4Q03A 4YUVA 3V8KA 4GZLA 4FI3C 3CINA 2HI3A 2DUNA 5I7SA 1DQZA 2LW7A 3LBYA 4MWTA 3QY9A 4FYVA 1CFZA 1IHUA 2L19A 3GFOA 4BNVA 4XFJA 2WDZA 2OHJA 3ABUA 3GUYA 4EJVA 4EF6A 3GLLA 1GGJA 5I9TA 3QQPA 4X20B 1VHLA 3KEMA 3IQEA 4CM4B 1JJ7A 3DNPA 1C29B 4Y2GA 1ELOA 1XALA 3FPAA 3ILHA 2EFYA 2RI1A 3EW9A 1J42A 3RS8A 5GPBA 1HEUA 4DZPA 5TX7A 4F9GA 1WBDA 3GELA 3GGDA 4PC2A 4ENJA 1H6AA 5D5WB 3OTIA 3W9YA 1T6ZA 2BEWB 3U31A 1E3QA 5G1OA 4BKQA 3C8ZA 4EUHA 5LP6B 3PX2A 1V54H 4Y2UA 5FI5A 3IAHA 3TSAA 3WJAA 1TWHJ 4DMLA 3WGHA 4ODIA 4F4FA 4HAZA 2AT1A 5AUPB 1JIXA 2BKVA 3U3DA 2FMFA 1SXGA 3QIVA 1T95A 2QRGA 1CY1A 2FR1A 4C7MA 3IT1A 4FR2A 4B83A 3WTZA 4G37A 4NHEA 3DCYA 4EF5A 1J6UA 3TO5A 4C3UA 2B5OA 1FQKA 1Q19A 2ZUSA 2Y30A 3TTVA 1NBWB 5M5WJ 1T8RA 2BZSA 2FMIA 2R7DA 5HMMA 3TTWA 1T3SA 3K2ZA 1L4HA 1FYXA 4QOEA 2Y05A 5KOJB 2G76A 3GCGA 1FSGA 2OBNA 2BCJQ 1Z8HA 5JCXA 2B4AA 2YOGA 3T3NA 4TTJA 2BR4A 3OF5A 1YKGA 2OCGA 1Z3IX 3JQGB 1LRKA 1LGYA 4M2LA 3I1IA 3VJMA 1DNPA 4XL9A 5L4SA 1QHHD 1ZDMA 1IEVA 2BI8A 4TVOA 4XGNA 3VHXA 5HIKA 3R7AA 2OVBA 4W5NA 5B7PA 2LVSA 2X5JO 1FFSA 2DOKA 3TOXA 5LQSA 4MMYB 4RWZA 2I4IA 1SVUA 1X80B 2WJPA 3SS7X 4I50B 3HYCA 1MC5A 3GW8A 1HETA 5J2UA 3S1AB 2B6HA 4TS3A 4XH9B 1I3MA 2G7UA 4DNFA 1IZ7A 4RH3A 1H0KA 3JQPA 1XPUA 3C4QA 3U09A 4EVRA 4BDSA 5AW7A 1IY8A 4HQKA 1IPFA 2KL4A 3CCRI 3TI9A 2PD4A 1UAAA 2RKHA 1FJHA 1TADA 4KXXA 2VA9A 5FLXK 3UFBA 4V3BA 4RDXA 2ID4A 5CVIA 3L4BA 4Z4IA 1CBUA 2BHRA 3DEYX 1T1RA 4CUZA 1Q1BA 4BMNA 3EH1A 5EZGA 1U3DA 2PX5A 2I3DA 3PJGA 3HDQA 2KT0A 2G1KA 4PLVA 1ECBA 5AI6A 4CQMB 4EI2A 1DEHA 3KWMA 2WHRA 3WK6A 4EM2A 3ZE0B 3MZ0A 5TF4A 1KWKA 3ZU6A 2ODWA 3IUYA 3BWDD 4FIDA 4I09A 4BECA 2M32A 2QUBA 4JUFA 5AW0A 4ZYAA 2CKMA 5HRUA 1J0RA 2RARA 2YVUA 4LF9B 4FETA 3R3JA 4DDUA 1P5HA 1VE5A 1XR3A 1DARA 1XAIA 3GLGB 3G5AA 3OUUA 1RLMA 3E3AA 2AXLA 2CXQA 2WIAA 2XZPA 2O7OA 1ZIXA 3SVTA 3OWXA 2H8WA 1TNDA 2NSHA 5KREA 5CLHA 3K4KA 3C5VA 2HLDA 1Z2PX 2XKOA 3SBXA 1K5PA 4IRMA 3GXBA 1VJTA 3LY9A 3MTJA 4R2KA 4QXRA 4JX6A 2JI4A 4LCJA 1GITA 4HV5A 1OCOH 5CDTA 3TIFA 1XPJA 3TIVA 4CR6A 3FDJA 4EEFG 4OHVA 2NU9A 4ENNA 3DDNA 3MTGA 3Q6MA 5ER6A 5DBHX 2I6TA 2CLDX 5FI3A 2BFCB 1A8PA 2DY1A 4B5LA 2XCSB 1M6EX 4LQDA 2OXCA 1FC3A 4JOCA 2VKDA 5M3BA 4KXMA 1FQWA 5HS6A 3TCNA 4QUEA 4P5OA 3H4MA 3TNFA 4F7WA 4NV1A 5DJ5A 2ROQA 3NC4A 1XRQA 1TK3A 5AKGA 4F3CA 1I9GA 1C9EA 4UPDA 2FZCA 3P9SA 1XIVA 1QV7A 3KOXA 3S44A 1NXSA 1UZAA 2Q0HA 3HKBB 3DKKA 4AICA 2FMXA 2VDRB 1I01A 2MHCA 4FCTA 1KJNA 3R6SA 4FFBA 3DFFA 2VWPA 3WWEA 1W76A 2RNGA 2ZMEC 2FN8A 1XTSA 1GNRA 5AVYA 3U7RA 3L4JA 3QVGB 1B15A 3MQ0A 4NOKA 2BKUA 1OMOA 2ZP1A 5DHQA 4I5DA 4UNSA 1O87A 4G65A 5B5SA 1EQ2A 5KYVA 1Y1LA 4E3WA 2B7CA 2UUPA 1SXJA 1JEQB 5E9JA 4RAFA 1FZTA 4EEZA 2UYQA 3ICVA 1FFXA 3RSZA 3ZHOA 2A5WA 2PO5A 5BN3A 3WKCA 4RGXA 2BZGA 1JLHA 1UM9A 4G23A 3AKZA 2V3CC 4JI4B 1CZUA 4HLXA 2V9VA 2VZLA 3I9KA 4K28A 3DYVA 2XH8A 4IHWA 2WPDA 2UUOA 3AHIA 3V8VA 5FLEX 1XAGA 3WGTA 3I2IA 4KDCA 1TUEA 4BVLA 3DAFA 4CXFA 1B93A 3ELYA 3IBSA 5KYUB 2L7KA 1FJLA 2GFIA 4RZ3A 4IM7A 3C3MA 3QWAA 4YV1A 1J39A 4QGBA 1N3BA 4BJ1A 2J0UB 4PZPA 2XDQB 2D1HA 4FFSA 4XX1A 3R5HA 5A7FA 5AKZA 3PFCA 1JAYA 5DP2A 1Z36A 1A7JA 1DV2A 2WJAA 1DS6A 1V11A 3WFJA 1TL8A 1N2JA 2VBYA 2R8PA 4F2HA 1X3ZB 3D6UA 2Z08A 2PZFA 2F3PA 1G7TA 3ID6C 4LXGA 1KKLA 4JLSA 2MMGA 1OIVA 3NNSA 3E9MA 3QMMA 4G1CA 4O2AF 1PUFA 2ZYAA 5DPMA 2PD6A 4KQWA 5EQJB 5IEBA 4CF3A 4MVJG 3KFXA 4I01A 2XD4A 2I6GA 1R4AA 4KW7A 1V9LA 9ABPA 3WYAA 2QYOA 4HB3A 3GOQA 3FSJX 4MGZR 4INZA 4KMMA 1KU7A 1LS6A 4YONB 4O5VA 3IOEA 5DM4A 1YK1A 3CF4G 1PUIA 4WNYA 4WK8F 4TX1A 3TSCA 2XR1A 1MJBA 1FQJA 4C7OA 2QTWB 1RLOA 1W36B 3I83A 1XDUA 2ZDQA 4JOQA 2WTNA 4ZU6X 5LZ8A 4EMSA 1CUEA 1UPBA 1FTQA 2B7BA 1P7VA 2WPNA 2KIMA 4GBGA 3AM3A 3RIHA 5KSOA 4D96A 3ZI7A 2DODA 2GSDA 2OUIA 3KUUA 5IABA 1ENPA 1F36A 1QZXA 5J43A 2FW8A 3S28A 4DNPA 3H8SA 4ABTA 1XQXA 1K4YA 1O08A 2IXFA 1EFRD 2HA2A 3ROPA 1ZEJA 3CZ9A 4ZV4A 2HHCA 3KXIA 5B2FA 4YUZA 3GBPA 1P44A 2N47A 2H7VA 4P7JA 3T1NA 3SSMA 2PMZN 3ZN2A 2LR0A 2PKXA 1WULS 1KGDA 1ZC3A 5DNVA 3RU2A 5B4VA 1LUAA 1ZSYA 3S5JA 2ZNYA 4F3TA 1VJ1A 4M1ZA 1Y0UA 1G2IA 2J0QA 1T5LA 1G5QA 4MV7A 4QTYA 4QOSA 4WOBA 3W6ZA 2GLUA 4L07A 4I8IA 7MHTA 4FK8A 2VPIA 4HX9A 4Z4EA 1VL0A 2RGGA 3JSOA 3ENNA 4V02A 4DMFA 4GQIA 3UJ9A 1I6LA 2ZB7A 5ESXA 4Z6YA 5FORA 3F3YA 2R7MA 3BIJA 2R84A 3T1YB 1R9JA 4EHAA 1TECE 3HA7A 3OJWA 5L3RA 1L5NA 2CJFA 1OC2A 1OH5A 2DCMA 4GSLA 1KK3A 2M7AA 3ISPA 2LBFA 1DADA 2F6CA 3BULA 4X3PA 3A4LA 5K8LA 4A8JB 3FNBA 4DV7B 4BDYA 3T4EA 3GQBA 2TRSB 3N6VA 1UZUA 5T7BA 3EB9A 3RADC 1XLWA 3MVEA 3ZGNA 3BR5A 2Y0MA 4KNYA 1USKA 1N3IA 1LFAA 4QNRA 2A9RA 4MR8B 4Y6QA 1NQWA 1RHMA 1OB5A 3KXKA 3RWBA 3HOXJ 1T91A 2N8GA 2W82A 4D42A 1CUGA 3D0QA 4YMLA 4ZZ3A 4F4IA 3GVHA 2DAOA 4NJEB 1ETXA 4PQGA 4BB6A 4ZMBA 3BDVA 5KJFA 5DGDA 3LNQA 4Y7CA 4J1QA 1A3CA 3GF2A 1A9YA 2HYJA 4A15A 4ZOLB 4WEQA 5I4IA 2QXYA 3WLJA 5KX5F 3EC7A 3KOWA 4E07A 1OTXA 1LUJB 3QKIA 5JFRA 3HJHA 3U5TA 2KP6A 1KEPA 2GIZA 4LYHA 2DG2A 3L2VA 4E15A 5JTTA 2HZ7A 3DPSA 3TD2A 1Z47A 3A2LA 4MQ6A 3GLRA 5FUVA 1CYEA 3T5DA 2ZRGA 1HKHA 3K2AA 1IOVA 1Q11A 4HMOA 2LD5A 2XRLA 1JQKA 4JDUA 2WA1A 4ESHA 2M30A 4HFMA 2CW5A 2C20A 4MHSA 3USCS 2RH9B 1ETKA 4NZZA 1K78A 1QQBA 2L01A 4KUGA 5KYXA 1JKIA 3ABKH 1Z2AA 2AX3A 2EFHB 4CLOA 4G07A 5DCWA 4WT7A 5I7UA 1U0OC 4RANA 4L4UA 4JVSB 2O9LA 3CVUA 4DWVA 2HMUA 4G0NA 1T2VA 3I52A 16PKA 2JAUA 2JJ8A 4D25A 1CIPA 4R8SA 2XMQA 1PWEA 2ZEJA 1IHDA 2E0IA 4Y2VA 4M6VA 3BH0A 3ZJVA 5BQFA 1BHJA 2CUJA 5CVVA 1MUUA 3SLKA 5KDOA 4RB0A 1OX5A 2GARA 3TE6A 3S2EA 5L40A 4JLNA 2QLMA 4UQLA 1VB5A 1LDJA 2E4AA 3VDNB 4GSKA 1WDKA 2DW4A 5JBQA 3NM5A 2MGQA 4EJSA 1W93A 3HI4A 2Q3EA 2QBYB 3ABZA 4Q12A 3T5GA 1DJQA 4RXMA 4FCYA 4WXPA 1HLVA 1IOLA 1WE2A 4C7BA 1J0DA 4XDGA 3AFGA 1ULSA 3AVQA 5IDQA 2C7QA 1LF0A 3CCUI 2GN0A 3GNSA 1HG0A 1SC9A 4G8JA 4MYDA 1VGVA 1KORA 4YRKA 3H4VA 4Q4ZF 5DLYA 2H5EA 1E1LA 4GVXA 1IIBA 1WSUA 2DBZA 5ALQA 2VP6A 3ZX4A 2VPWA 3F3SA 3QVVA 4AC9A 5GVRA 1KHHA 4H77A 2LIVA 2L4AA 1YFJA 4QIWN 3AM4A 2QUKA 4X8LA 3K5HA 5ICMA 1HNZB 2X0KA 4BFUA 1BZYA 4AIRA 2C2HA 2D1SA 3DL7A 4W7HA 2H6EA 1H6DA 5AXAA 4KBGA 3DEIA 4MFDA 3ROTA 1F3LA 1UINA 4EGJA 4MGRA 2PX0A 2GZWA 5BQXA 1KI8A 4RK5A 2HX1A 4MLOA 4V0QA 3ZXXA 2DTZA 1UEJA 2CDCA 3REFA 4RHTA 2QQ5A 1MRNA 3GNLA 1E3JA 3JAMK 3UM9A 3GZNA 3BTSA 3QEKA 2VYVD 2C2KA 2Q1TA 3JTMA 3QVUA 4DR3B 1A8HA 5BR7A 3VR5A 2VAMA 3FJ1A 3GFJA 4JL8A 1WXHA 3MN1A 1SBYA 3ESAA 3E7DA 2GO7A 2QNBA 2YZ7A 1X3LA 3WHIA 1RE0A 4NEQA 4ZTBA 4A91A 1NP6A 5DKFA 4MVJD 2HO5A 2HPVA 5G1PA 4AT1A 5H0IA 1GGFA 1KXJA 3L7KA 3LSPA 3AHHA 2FPUA 4M9UA 4L5BA 2FZKA 4H4CA 3CUOA 3ZWWA 1TEVA 1LQ1A 1QV6A 2O8BA 5F6FA 3HSKA 3ONFA 4BAZA 2YVAA 3B9PA 1GPDG 4KGVA 4R1MA 3VKFA 3TQRA 5DD8A 3RZOJ 4WBSA 3LHKA 1LFPA 2J6CA 4RM2A 2GXUA 3S4YA 3EA5A 4DDWA 1BYIA 4FD2A 4BFVA 4J3JA 4HWRA 5SYAA 1HF3A 3PDHA 3TLZA 3KD2A 5T6BA 4AKHA 1BN5A 4JWTA 2AO9A 2WTBA 3OZDA 2ODPA 3TZCA 4PX2A 3GWGA 3ABIA 1OHHD 1PFVA 2EJTA 4BQAA 2ZJ1A 2B4KA 4KXNA 4I5FA 4V39A 1QP4A 1LC3A 3NBYC 1VPWA 2OILA 2RGXA 3G3EA 1CWUA 2NO9A 2PQMA 9MHTA 3IIKA 4IF4A 1GU7A 2WWVD 4GO1A 5EERA 2NZVG 3PR3A 4CZZA 3UAOA 1CSEE 3NAMA 2Z2SB 2CDRA 2DH5A 2JF0A 5LGTA 3O6BB 3EGCA 5F64A 1YB1A 4MDFA 3M6IA 2O0HA 4C0WA 3TFWA 5DMXA 4EG1A 1Q0SA 4E4YA 3W6JB 2OV1A 4KUEA 1YMQA 1BEUB 3AB8A 1XSXA 3EXFA 2Y2ZA 2CUTA 4HN9A 2VJJA 4MQEB 3BERA 1J2TA 2VO1A 4L5IA 2Q0OA 2HQ1A 3CGGA 2I2DA 3I2JA 2O5CA 5J63A 5C37A 2VHQA 1C1XB 2K7FA 3T7AA 1EQUA 4IZZA 3JQQA 1B41A 4CT0A 2GOXB 3O8QA 3H5AA 2ZITA 1D0IA 1YIDA 1RI4A 2ZE6A 2K3PA 2BP7B 2P0EA 4MJ7A 3GZ5A 1XZKA 2GH1A 4O2BB 1IUYA 4AIKA 4EELA 1O89A 4KQJA 3OV8A 1MH1A 2FGJA 1UMCB 1GFIA 1OFGA 3I59B 2JLSA 1EWQA 1Y7HA 2PQ0A 3EGXA 3O8OA 4KRXA 5JEEA 1AE1A 3M2PA 5LOVA 4CM8B 3IXMA 2JJ2A 1S1MA 4ZT5A 3HBJA 1IQPA 1ENYA 1Q7CA 3E58A 1ZG3A 1FT9A 4QYSA 3NHLA 2OM2A 1ONOA 3OS0A 3LUBA 2ZULA 1KDYA 4G3XA 3L02A 5KS2A 4KWIA 2BZ0A 4CEJA 1X7XB 3LH5A 5C46F 2A33A 2L02A 3DYIA 2Q1WA 4XGKA 2H3EA 4FGZA 3H04A 1NURA 1Y1RA 2C82A 3PUZA 5FBZA 4ALNA 1H9GA 2HJVA 3VVBA 1K75A 1H9TA 1BOOA 1YKFA 2YJZA 2W2VA 2X9QA 2C3OA 3SMQA 3T61A 5BV8A 4O4JB 2BUCA 3WHCA 3HVKA 2HT1A 2WKSA 3KFLA 4BH9A 4MDYA 1IN8A 4UUAA 5T4HA 3G9UA 2E4UA 4WDQA 4AP5A 1HW1A 1JEYA 3D7SA 1GPNA 1YITI 1BDJA 1OT5A 4OF4A 3PM1A 1B0ZA 2QAIA 2HF2A 1CYDA 3U3RA 4W1QA 4LNHA 4QXAA 5HS4A 1GSIA 1E2GA 4HLQB 3H3XA 1ZGBA 2DMTA 2DCEA 5GVSA 3V7YA 4MLZA 5BYAA 2Y1CA 1PNVA 4KISA 2YVLA 4XTCS 2MSYA 5FFZA 3DCNA 1P9NA 1XWIA 3AJRA 1PL6A 3IV9A 4KQCA 2CVZA 3BWCA 3E9EA 2J67A 1W9HA 4GX0A 1JXAA 1ANKA 3RPQA 3LQQA 2JIPA 5BXQC 1HSTA 3ZKWA 3BZ6A 1KXZA 3SZMA 3HN7A 4EPRA 3NW9A 3QI2A 5B12A 2VNAA 2IA0A 3MCWA 2V26A 2CXHA 4ZKDA 5FPHA 2Z33A 4JBAA 2B7EA 5AIBA 2C42A 2EJBA 1V96A 3QWIA 3GQVA 5LZ9A 4TV9F 4D46A 1XA3A 2A2ZA 3OT1A 5K0TA 2WEKA 5K6TA 5GM2A 3JWHA 4W8HA 2GNOA 3DZCA 2MTBA 5E2IA 3MLEA 3N74A 4HLUC 4O4IA 4Q39A 4MYTA 2E6UX 3KR0A 5L3DA 5JDCC 3SJAA 3DGFC 4I9HA 3FTCA 1OFTA 1C7RA 3WFZA 3FNIA 4G1UC 3I2KA 1VLMA 1ZFNA 5EWLB 1Z26A 2HKXA 2AG1A 2OLJA 3CXUA 3GJXC 2Y4OA 5C5IA 4EHFA 3SC2B 4MP8A 5A5DA 3DAGA 4EPWA 1D0VA 2O2IA 1G19A 1EHIA 5CDYA 3C41J 1RQNA 4M7OA 1PJRA 5JECA 3DDUA 3R0JA 1YNOA 3ZRGA 3PNQA 2H0QA 4LFAB 2LLKA 1A4XA 4IO9F 3TGNA 4ND8B 2OBBA 2AFIA 3ICWA 2ZRMA 3RC7A 5FBWB 1WCXA 1YD7A 2W48A 3QVMA 1QLWA 4G6DA 4NG4A 2C59A 1SD7A 5C80A 3R0IA 3OZFA 2WZDA 3TD6A 2IS1A 3EEQA 4HUJA 1X8LA 1E3IA 1X0VA 1W0TA 3QV1A 3LF1A 5KK1A 1TZJA 5I5EA 3C3EA 1Q3TA 1NG6A 3WTUC 2X5KO 4QOIA 2JA7J 2XAJA 1N2ZA 1UBOS 3LBFA 4HAYA 4DJ5X 2JEYA 3HGYA 3G1MA 4WADA 3C6MA 3EEYA 4KWEA 3HPHA 5JRJA 1INLA 3GDHA 1PZHA 3RT9A 4RPJA 3TRFA 4G5OA 1FSHA 1Q16A 1JDZA 1U9OA 3OEED 4DAEA 2PKQP 3KD3A 2JFZA 3LOPA 3ZGLA 1GTSA 3BMQB 4JV5B 1BOAA 1R0ZA 3PQ5A 1N9ZA 5AVWA 5K6RA 4R8MA 2W4IA 3SSNA 5JS8A 4JJZA 2G9WA 3ISVA 1YO6A 3IHUA 2DFIA 3DTKA 4ZYXA 1EGQA 5KC9A 2HGZA 4LDAA 4UD6A 5E1DA 3FXKA 1LX6A 3UK2A 1P2BA 3IT0A 3CONA 2C7BA 3PJDA 3E2MA 1Q84A 1ODSA 4JUDX 3R9XA 3DOIA 1RXVA 2QTHA 1GIAA 4WLOA 5JZ9A 2LF7A 4EITA 4NKRA 5SZJA 4AB1A 2FOWA 1LW7A 3W2GA 4QEDA 1G20E 1PV2A 4AD9A 3IP7A 5JMPA 3FHTA 3EPRA 1HE3A 4I4LA 3BPXA 1WMSA 2IYFA 2WTAA 3JQ8A 4ZXPA 2MYUA 1T35A 2M4KA 2ZKIA 3WKEA 3JQDA 4YS6A 3ZVKA 5ISMA 1FP4A 2FWBA 1M1YB 3TTYA 1T5TA 3CV3A 2FUEA 1K6XA 2BYVE 2I55A 4UHFA 1GZ3A 4EO4A 3SF0A 2BGGA 5AIAA 1X74A 3BSSA 4JS0A 1IJBA 3AW9A 2JAHA 3VSLA 3HA5A 4ML3A 4KQGA 1AGRA 2XKJE 4QT0A 2WK1A 3DULA 2GZ1A 3GX4X 3GUVA 4LGYA 2RJOA 5IVDA 3R41A 1MT0A 3CNOA 2A5DA 1XTTA 2IV2X 3KQUA 2IDKA 2L3DA 3SXUA 3QX3A 1C14A 2M2EA 3G2HA 5KWVA 2O8FA 5G0VA 4HDKB 4TYPA 4U0WA 5JYEA 2HMSA 4FWBA 2QN2A 5G02A 2NVYJ 3LA8A 4L7VA 4TLEA 4WRRA 3CCBA 4XKBA 3JYNA 3JQ7B 4Z7JA 1LJ8A 2I1WA 2IU6A 3JRFA 2MYTA 1N6LA 4ID3A 2ZQYA 4GECA 2R8OA 2KFDA 2OG1A 3L0IB 3Q7QA 3GJ5A 1A5TA 3VHQA 3IYLW 4GG1A 1LLDA 5MN5A 1DTWA 1OCRH 4OJNA 1FBSA 4YO8A 1L7DA 2LKDA 1TAHA 4MEJA 1N5KA 3ER9A 3BZWA 3K8YA 2Y76A 1QO0D 3T1OA 4HDVA 1DRWA 3LO5A 1T8YA 5A62A 5FBLB 2XSJC 1RWXA 3O2JA 5KTRA 3RJ5A 3ZTTA 5KJ6A 4CGYA 3BRCA 3QYBA 4J2HA 1JWBB 2XE4A 3N76A 1H88C 2PZMA 1MC8A 1EV7A 2IGKA 2D0OB 4AJLA 1LA2A 2ZUUA 1YCFA 2XVCA 1GAWA 2VJNA 3SS8A 5EZSA 4DS3A 2A88A 3HWWA 3RRYA 3PE4A 2H2HA 2HQBA 3H5NA 1WQ4A 8OHMA 5JQWA 3OZCA 4TMYA 3EC1A 4Z7NB 3FNFA 1W46A 2ZYIA 4RVHA 5BQ5A 4FFVA 3DXXA 1QHSA 1SO8A 2V7WA 4UBNA 2Q4EA 5CLLA 2M9HA 1ZK0A 4CMEA 3U4QB 3C0KA 2FCAA 2NZ8A 5BW8A 2GJKA 2COMA 4MVJE 2CG4A 2NO7A 4Z9BA 1TW3A 5DYNA 2JB9A 1H89C 4E5UA 2E87A 1WXXA 3F1LA 1EH5A 2GPBA 4YCNA 1OYOA 4DC0A