3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
b'DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator protein
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transcription
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
1DC7A 5FKNA 2R48A 4XAQA 1FFSA 5DCLA 4UHKA 4NDLA 2MW8A 1B00A 1U2QA 3HK2A 1BAPA 4BBSJ 2CQXA 1MH4A 3B2NA 3RZDJ 4YLEA 2YHAA 3M6MD 3HEBA 4IGAA 3O2SB 1APBA 1WH5A 3QLVC 3IP6A 4D6YA 4XICA 3MA0A 1DP4A 3QELA 4FCYA 3BQZA 3CG0A 4IHWA 3LMKA 1ZH2A 2FEWB 3KG2A 3FK7A 2NZUG 1Z15A 3N0RA 3F0CA 3CMYA 4RZSA 1USIA 1GLGA 5TPZA 3C2BA 4MPTA 3GRCA 4C3JJ 4Q7EA 1X2NA 2K40A 4BXXJ 3K7AJ 1ORKA 1F36A 4BBRJ 4B3AA 2WB4A 2E19A 4XLTA 4LZLA 4D5FA 3LUGA 3A0RB 1IRZA 1YK1A 1P7JA 3G1MA 1VI0A 3ZQIA 1DC8A 2E4ZA 2WJWA 4LE1A 3LUJA 1A04A 3BT9A 2OENG 2VI6A 3VNAA 1RR7A 2FEKA 1GV5A 2DN0A 3I42A 4Y52J 3O8GA 2R5YB 1AKHA 3CZ5A 1DBPA 3HCWA 1YK0A 5ED4A 2ZB9A 5FLMJ 1LJUA 3MMNA 2KT0A 3BG3A 3QLUA 2JA7J 1ETVA 5TPWB 5TQJA 3NHZA 5T7BA 1E6KA 3R0JA 3QEMB 2DMPA 3HZHA 3HM9A 4PZ0A 3CNBA 4M3DA 3HOWJ 4A3MJ 1HCRA 3JR9A 1IDZA 2E4XA 2X9DA 2A9OA 3F6CA 2R5YA 3M9WA 1BJZA 2DA1A 4N76A 3H5TA 2LP0A 4G0MA 4JYKA 5K7HA 1ZKGA 2LVSA 1EWVA 2FMIA 3GBVA 3LOCA 3RQIA 3C3KA 2CWDA 5IUKC 3DGEC 3O8HA 3QEMA 3GTJJ 2XGEA 3QPLA 4HNRA 3A02A 4WXMA 5JNRA 1QP0A 2LBPA 3CRNA 3CG4A 4D74A 4MAAA 3K9CA 1NK3P 1IJWC 2O8KA 4KZKA 5J3LA 1QVUA 3NNNA 1ENHA 2FQYA 2H1KA 5C5CA 4RK1A 5IUJC 3JRAA 5C4JJ 2H0AA 1M5UA 1XG1A 1TWCJ 3JRGA 5EZGA 2M1ZA 3N75A 2IPMA 3FGZA 3ZQFA 5EYRA 4IF4A 2HOTA 4RXUA 1JJ8C 1SXGA 2DA3A 3LSGA 4G0OA 4YWHA 1VNDA 2PMZN 2DTZA 1ZQ3P 2E4WA 2CUFA 3TEDA 3H6GA 5E3NA 3Q9SA 4X6AJ 1DCMA 1JYEA 3O74A 4LDZA 5EDNA 5FJ8J 2A9PA 2L9RA 2ECBA 2FLWA 1ZITA 2GM4A 1LBIA 3OIOA 2X48A 3IDOA 3H5VA 1MBJA 4B1RA 3JY6A 4TMYA 4EVRA 1BW6A 5KQGA 3C97A 4Z0NA 4QYWA 3S1QJ 3GTOJ 2CQQA 3HDVA 3OSFA 4MYRA 2YUSA 1IG7A 2R93J 1F51E 1U78A 2QSJA 2R5ZA 2HJ9A 3C3WA 5IULC 4RDUA 2OQRA 4WT7A 5E3MA 2FXIA 5JNSA 4JX5A 1Z26A 3H6HA 3BBLA 2GBPA 4JX4A 5F04A 1EHCA 3MIZA 1U9NA 1FTTA 2CJJA 3GV0A 1JJ6C 2ID3A 3S1MJ 3EQZA 3G1LA 1VF9A 1RNLA 3DBIA 3HKZN 4KQCA 3ZQCA 3RVOA 1IV6A 1MBFA 4UUTA 1A5JA 4MS3B 1ABEA 5GOTA 3HDDA 3KHTA 1WH7A 1PHRA 2FLKA 1B72B 1MSFC 2IPAB 4YS6A 2L0KA 3E61A 1JFTA 1GCGA 3OLZA 2LLKA 2FQXA 2FQ4A 3LTEA 3OLXA 1EWTA 1A2OA 4D7MA 1SRRA 1JT0A 2L7MP 2LKXA 3GTLJ 4XXHA 3HOUJ 4CBVA 2DMNA 2M0CA 5PNTA 3HVRA 1CYEA 3LUKA 1Y1WJ 3Q41A 4IHVA 4YV7A 3H1GA 3MQ4A 3IP7A 3TO5A 4YR7A 1R8JA 3NNDA 2DMUA 3SDGA 1DU6A 3TP3A 1ZH4A 5DTEA 2GLOA 1ETOA 1QQAA 3BQYA 4MS3A 3HUUA 3UKJA 4RY8A 3JS5A 4OLBA 1B72A 1ZY2A 3CZCA 1J56A 3FMVA 1D2AA 1D4ZA 2X7XA 2XB5A 2JMWA 4UHJA 5FLVA 4KV7A 3HV2A 5DTDA 3RH0A 3MN2A 3H5IA 4GPAA 4MS1A 2E4VA 1F43A 5FBHA 4QPJC 3NBMA 6CHYA 1W0UA 1JF8A 1OXKB 2N9UA 4RBOA 3A03A 3ILHA 4YCSA 3FFXA 1U8TA 3KCNA 2X6OA 2RJNA 1FFWA 5EEAA 4A3EJ 4Z9BA 1OJLA 1JT6A 2FD5A 2LFBA 5JLWA 3ZQGA 1TM2A 4G0YA 2HXIA 1JHZA 2JK3A 2IEKA 5FBKA 3DZDA 3BTJA 1YIOA 4WXEA 1DRKA 1I6HJ 2TRTA 3QLTA 1ZGZA 4F12A 4S05A 1T34A 3GL9A 3T38A 1VPWA 5J1RA 4F11A 2HQBA 1NY5A 1Z13A 5CNMA 3EODA 2XGCA 3EGCA 1IUFA 3HSYA 4RY0A 3H1EA 3HM5A 3SFIA 1LJLA 3KLNA 2JVIA 1JFSA 3HOYJ 2PUEA 2TMYA 1FTZA 2HSGA 4LX8A 3EAFA 4AUXA 4M3FA 3LUAA 5EF6A 1I3QJ 1YMUA 5M3FJ 1JH9A 1YMVA 1TJYA 5KC9A 3IH4A 5TQ2A 4LRQA 1P7IA 1GDTA 3HO1A 3BG9A 3GYBA 2OPTA 4UUSB 3B6CA 3HOZJ 1HEYA 1LBHA 2ECCA 4MR9B 1GT0C 1WGXA 4WWHA 5JNUA 4RU1A 3WHBA 4Z99A 4Q6BA 2QW1A 4RK6A 5KQMA 4GNRA 2JA5J 1JKOC 1URPA 2MSKA 4ZMRA 2IPNA 1FQWA 1NXVA 2HQRA 3M4OJ 3CLKA 4W5RA 3OSGA 2PLNA 3CHYA 4JASB 3HOVJ 4F06A 1H88C 2QXYA 2NT4A 3OQMA 4MLDA 2NVQJ 2XB0X 1JDNA 1KMIY 1YVUA 1GUUA 2P81A 1JUSA 3L1PA 1P8AA 4EVSA 4MR9A 2AYXA 4EYOA 3RZOJ 4KFCA 3C3MA 4D6XA 2B1JA 5F0FA 2D5VA 3HGGA 2HYJA 3MM4A 5TE9A 1ETYA 3BR5A 1SXHA 4X1EA 1TWGJ 1RXEA 3TD9A 5BRJA 1T33A 2XSDC 1Z2DA 1Z0XA 5HODA 3CS3A 2EQRA 3JREA 4G0ZA 2A9RA 3F73A 2DA6A 5BNGA 3JTEA 2HXOA 3HEFA 3JVDA 3TB6A 2VUHB 3SQNA 2JB9A 3MVPA 2L7FP 4KREA 1MH3A 1POGA 5EWJB 4W5QA 4A3LJ 3DLBA 2WAQN 3JPYA 3KTOA 2QCOA 4Y9TA 2P4UA 1ZK8A 1E6MA 4TLLB 4IHXA 4Z4IA 4QIWN 2O20A 1IDYA 1JGGA 2MGQA 4NICA 1PNRA 2W42A 2WB1N 3BTIA 3BILA 5HM6A 1AB5A 3TP0A 4HNSA 3RVMA 1HDPA 1UMQA 2WMYA 3ZQHA 3W6VA 3RKQA 1YS7A 4A3IJ 1W0TA 3EULA 4KMRA 2IBDA 1ZHHA 4A3JJ 2MSYA 3CDLA 3GTPJ 4ZMSA 2L2QA 3G85A 1EF4A 1S7EA 4NCBA 4KK3A 3KJXA 5F0CA 1RKTA 3QPSA 2FEPA 4KVFA 4CYCB 1XHFA 3GA5A 4MIMA 4DZJA 2LUOA 4HNVA 3JPWA 1DCKA 4B09A 4OATA 3LFTA 1A6IA 4N03A 3BR0A 2ZAYA 5IOYA 4EUKA 4ZJPA 4M88A 2ID6A 4ETNA 2E2HJ 4DYCA 2HDDA 3BRSA 2KDZA 4EYGA 1OFCX 4XARA 1SANA 4W5TA 4YO7A 2PAFA 2JA8J 4XFKA 5IPAA 5C4XJ 3S16J 3KS9A 5B3JA 5TPWA 4Z9AA 1GUDA 1ISRA 2XGDA 1Q1VA 2I6FA 1QP7A 2Y30A 4C3IJ 3LKVA 5M3MJ 2IAIA 2YS9A 5IX8A 2B4AA 1JX6A 5FWYB 5TPZD 3OOUA 4FB4A 3UK0A 5BQ3A 4EY3A 2M2EA 2WRZA 2LP4Y 3IH3A 2O7OA 4IHYA 1DRJA 4DN6A 1IC8A 2M34A 3A0UA 2VUIB 2R92J 5KC8A 3D8UA 4I6ZA 4NQRA 2BGGA 1WI3A 1JTXA 4RSMA 3SNKA 1GUBA 1KGSA 1BVHA 2VPRA 2HQ5A 3A01B 5C5EA 3Q0VA 5DLEA 1C4WA 5KWSA 1ETKA 4E7OA 1ZVVA 4MQEB 4JX6A 5FKOA 3QLUC 4N41A 3BG5A 4H60A 2DMTA 3RVKA 5FWYA 1LE8B 1JBEA 2Y0SN 3CQZJ 3JRBA 2I10A 4MFEA 1BDJA 4PICA 1MBKA 5DS9A 4A3FJ 2Y2ZA 2V0NA 2YHBA 2W48A 2E1OA 2HPHA 1USGA 4RK5A 9ABPA 5EWMB 2PL1A 3NNSA 3GBGA 2L18A 2JBAB 4JP1A 3TW7A 2MYTA 1JFVA 4ML3A 2JJ7A 1NK2P 3H5WA 3EDCA 3H0GJ 2LD5A 2EBIA 3KYJB 4F3TA 1F4VA 3M9XA 1PUXA 4KPYA 2JK1A 4KNYA 2HOSA 3I4MJ 4WZZA 1BA5A 5B3JC 2MG4A 4MR7B 2R7ZJ 3FKIJ 1LE8A 3D1NI 1JUMA 5JS2A 1X58A 2J48A 3BTCA 3HJFA 1KRWA 2ZWMA 4JB0A 4KRFA 1Z16A 3PO3J 5TQ0B 3RVJA 3GBPA 3P9YA 5FKKA 3Q3SA 1NXTA 1NXWA 1I50J 1ZGGA 4TLMB 2YU9J 3W9SA 5IP9J 3CKMA 3KSMA 1JUPA 4A69C 1ITYA 2FTKE 1XC5A 3O1JC 4HYEA 4DW6A 4FE7A 3HB9A 3LNQA 1RXIA 1RKWA 4MR7A 3S2HJ 3KLOA 2E2JJ 3OM0A 2WY2D 1AHDP 4RK4A 3GTQJ 3T95A 5TQ0A 3N53A 4IEJA 4H3HB 4A3GJ 1D5WA 1EWKA 3BR3A 1NXOA 3I45A 3CCYA 1TWFJ 1FFGA 4G0QA 4OLAA 3C6QA 4XIDA 1Z2EA 3MYYA 5EWLB 1QMPA 1VLZA 5ABPA 2RAEA 2MYPA 2COBA 2JN6A 1QPIA 4Z4FA 1PNTA 2Y31A 1XS9A 2GWRA 5E3JA 4N47A 1E6LA 5F27A 4D5CA 2NZVG 3OLWA 5JLXA 5BRAA 2LK2A 3BR2A 4OG2A 2WJAA 2DA7A 4YGXB 4RK7A 4I76A 8ABPA 2JCGA 4WUTA 3CTPA 3HXMA 1P2FA 1JKQC 1RETA 2PKXA 3F6PA 5HSGA 2XDYA 2FW0A 4E7PA 3E7LA 3WHCA 2IYNA 4EVQA 5CNJA 3PM1A 1FEXA 4C3HJ 5JS1A 5K7ZA 2FN8A 3OLVA 1MB0A 1NXPA 1ZN2A 1ETWA 1NTRA 4MQFB 2PUCA 4ETMA 2M8GX 3O75A 1HLVA 1BW5A 5HQJA 1IGNA 2FMFA 4JAVC 5KI6A 1WPKA 2FN9A 2K9NA 4G0XA 2DA4A 3IH2A 4IMJB 3OMXA 3QLVA 3RVLA 5F08A 3VNBA 4B4CA 3ILYA 3OMWA 3ZOBA 4C2MJ 4Q6WA 4RKQA 3EJWA 3S14J 1BDIA 1P6QA 2WV1A 3S99A 2F8SA 4MRMB 3H1FA 4MQFA 1U0SY 3FIWA 5IEBA 3RVRA 1M2FA 3LUFA 4BKXA 3FISA 3JRIA 2M98A 1RESA 2CU7A 4FISA 2RGYA 3NHMA 5FWXB 3N0WA 2XPUA 2FKAA 5FKLA 3CFYA 4LOCA 4ZPJA 1Y1LA 1LFBA 1TLFA 3HS3A 4G12A 3H75A 3Q7RA 2L17A 3QEKA 5GPAA 2AYZA 3S2DJ 3A3KA 3KKEA 3GWGA 1ZR2A 1JTYA 2AO9A 2EH3A 1MAVA 4Z4HA 3QELB 1YTUA 2NVYJ 4QTRA 1D5YA 1OCTC 4A3CJ 5F1JA 4FE4A 3JRCA 1I3CA 4UUSA 1QRYA 3HUTA 1AU7A 5FWXA 2FX0A 3DGFC 4AYBN 5C44J 4DYRA 3Q0WA 4P98A 3TX6A 2P9HA 3IP5A 2ELKA 5KQPA 3K4HA 1JKRC 1Z25A 1DJMA 2ID7A 4EGSA 4W5NA 4V2FA 3I09A 5BR1A 4RDCA 2IOYA 3VPRA 4GFBA 2E2IJ 1GV2A 3B6AA 1USKA 4O5AA 1MIHA 2K9SA 3LSPA 2KYRA 3BR1A 4TN5A 3RVQA 4N0QA 3TMYA 2JA6J 2Q5CA 5DGCA 1HOMA 2R25B 1AKHB 1QNLA 2FQWA 1DCFA 3CU5A 3PO2J 3NARA 4M3GA 1H8AC 3BRQA 1BA2A 2JWTA 1S8NA 2NVTJ 1JKPC 1NXSA 1M5TA 5HKOA 1ZTRA 1LK0A 4G0PA 1UHSA 1GVDA 1O4XA 1JWLA 5J1UA 4OTZA 1DZ3A 2LTPA 1X2MA 2PL9A 3LUDA 1R9TJ 1Z18A 3GT7A 3IV5A 2R4QA 1XHEA 1U04A 4A3BJ 4PE5B 1Z12A 5EWJA 2DA5A 4RXMA 1RPWA 1ETQA 1RZRA 4Z4GA 4AC0A 4G86A 2G0EA 5JNVA 1K68A 3O2QB 1DBWA 5IBQA 5IEJA 2H8RA 2VYCA 2NVXJ 3MKLA 4JA2A 2PJUA 3LSRA 4DADA 2FMKA 2CUEA 3LSJA 1FIAA 2NUBA 1W25A 4RWEA 1MNMC 3RVSA 5K7FA 3UUGA 2QR3A 3URMA 2QZJA 3IP9A 1ABFA 2LPMA 2GI4A 1LFUP 1MVOA 4ABZA 5EZHA 4MR8B 1Y1VJ 5GP9A 3UKGA 1PEYA 5IP7J 4W5OA 2Y9ZA 3H5OA 1QO0A 4A3DJ 3I4NJ 2PUFA 4RXTA 3ROFA 2HI3A 3S1RJ 2QF7A 4XASA 2DJNA 3HGYA 2RJOA 5IYDJ 4CYCA 2R0QC 5CHYA 2VKEA 4W1UA 1UDRA 3IPAA 4IRXA 4XRSG 2PE5A 2MYUA 1TC3C 3T6KA 1NXXA 2N8GA 1APLC 6ABPA 1QKKA 4M3BA 4J19A 4NV3A 1H89C 1ZAYA 1XWWA 3LUCA 4DYQA 2DRIA 3Q15C 4ETIA 4MR8A 1HF0A 5GQSA 3S15J 3HDGA 2F8TA 3FFTA 3N8IA 4W97A 4O1HA 4QYMA 1P6UA 4S04A 4PYRA 3DEWA 2DMQA 2LIVA 2QVGA 2EZHA 1JL3A 1JDPA 4L4UA 2JVJA 4V2GA 4A93J 3OQOA 1TWAJ 4Y7NJ 3QQAA 3QX8A 1Z77A 4EEFG 1QQBA 5T3YA 1OXBB 1ZR4A 3DCFA 4MS4B 4IMIB 4MLCA 1TWHJ 3RVNA 3OO0A 1K61A 2EZKA 3O21A 1RZRD 5M5YJ 1JYFA 2R5ZB 4Z4CA 1EFAA 1D1QA 3F7NA 5IC5A 3A01A 4BY7J 4DZPA 1U9OA 3FFWA 4DQDA 2LR8A 2QU7A 4MQEA 1OCPA 1CHNA 1TMYA 2JVKA 3O1HB 4LE0A 3SG0A 3BREA 1H9CA 1PUFB 1B8IB 2PUAA 2VK2A 2RDMA 5IYCJ 3H3VK 2FSPA 4XRSA 2WWVD 1AB6A 2Y9YA 2E4UA 3A10A 5EWMA 3GTGJ 4MS4A 2JBAA 1C0EA 3LOPA 3GTMJ 1DBQA 1K66A 3OO1A 2MYNA 1NTCA 4M6VA 1TVMA 1QO0D 4PEVA 3QK7A 1QVTA 1MBEA 2OF7A 1SFOJ 1U2PA 4G97A 1L5ZA 2ID9A 3SY8A 1W9HA 1VRVA 5KQLA 1BL0A 4YP9A 3JRHA 5D2CA 3SAJA 2GBYA 4RV5A 1PUFA 5EG0B 1B8IA 3L6UA 5CNKA 2L7ZA 3H5LA 3QX9A 4S0HB 2NS8A 1IIBA 4MLOA 3HBLA 5JNTA 1SXIA 2XPVA 2FJ1A 1JLKA 3BR6A 5E3OA 5GPCA 4JB2A 3OM1A 1G2HA 4FTHA 3RVPA 1MBHA 2LY9A 5FKMA 5F0HA 3GTKJ 3HOXJ 2NT3A 1ZDMA 4KQ9A 3L49A 1QPZA 4RY9A 3G1OA 4D7NA 2NOGA 5IYBJ 4L5EA 2FVYA 5CNIA 1E3OC 2CRGA 1MB3A 3N0XA 1ISSA 4ZYLA 5IP6A 5EG0A 5J1YA 1E2BA 4MS1B 1QP4A 4NCAA 3MF4A 1MSEC 1VKRA 2PMCA 2K9QA 1Z17A 4F8JA 1FSPA 3LUHA 1M2EA 4HNQA 2A9QA 5E3LA 2AHQA 2QVCA 1D1PA 1MBGA 2XRLA 1WETA 1WCMJ 3E3MA 3O1IC 1NATA 2L19A 1BDHA 2CHFA 5EWLA 2CD7A 4P1ZA 3G1WA 5DKFA 2IDMA 2TCTA 5C3EJ 4RS3A 2IPLA 4XK4A 2E4YA 3ROTA 1GCAA 2R47A 2ME6A 7ABPA 1CEYA 3O2JA 3ZQLA 2M9HA 3T8YA 3NAUA 5EGOB 4JOQA 1A0OA 4H3KB 1DU0A 2FMHA 1ZESA 4MFDA 3N6VA 3BTLA 1YS6A 1U8BA 4QSHA 2PUBA 2O9LA 1T56A 3OQNA 1L5YA 4BY1J 3Q0UA 4LE2A 2EZIA 3JRDA 4OBBA 5IOZA 1K83J 3Q7TA 3JVIA 4RKRA 4XRMA 5F64A 2NS7A 5TQ2B 4IILA 2B63J 2HQOA 3IPCA 2PUDA 3FK6A 2VKVA 4O1IA 4EYQA 3M3YJ 2GX6A 3EQ2A 3SM9A 2QV0A 1ZGWA 5EGOA 2XPWA 5M5WJ 1FJLA 4A3KJ 5IUNC 2MSLA 1YRNB 4QICA 4L85A 4MO7A 2VUMJ 5M5XJ 2IKSA 2PUGA 1HDDC 4LDAA 2MSWA 1EAYA 4JP0A 1UG2A 1SD5A 1CQTA 3OLYA 1PEAA 3LKBA 2H3HA 3S1NJ 4N0PA 4RK0A 5I4CA 3KYIB 3FDFA 1ETXA 3D02A 2DA2A 2ME0A 3S17J 3JRFA 4EYKA 1FIPA 2EZLA 4Z4EA 3DLHA 1RPJA 3K2AA 1KRXA 1YRNA 4MRMA 9ANTA 4MGEA 2CHEA 3Q7SA 4KK4A 1VFCA 4M3EA 1DG9A 2GKGA 3I5AA 3SJMA 5JNWA 3TW6A 4YRZA 2HOAA 2JRLA
chains in the Genus database with same CATH superfamily
2Q8NA 1E5DA 1G66A 3SYRA 1J0BA 3EZXA 2VF8A 1SCDA 3EMDA 2NUTB 4WGFA 4EM0B 4ECAA 3MTEA 4DXAA 4D0SA 2ERXA 3AL0C 2DPXA 3OE7D 1WA5A 5B3AA 3SF8A 2POCA 3GQBA 2EYQA 2R7KA 4DCNA 5K1YA 1TGYA 1RYYA 1F4LA 3I01A 1WH5A 3WL3A 3IMKA 2O7QA 4X63A 1U3VA 2D1TA 4MQMA 4DBRA 5J40A 1ECPA 3O92A 5GADJ 1VSUA 3PNOA 3KG2A 4KLCA 4JI2B 3N0RA 2Z1MA 1KJ8A 2I4TA 1JLSA 5JFRA 5CFMA 2O2YA 2NN3C 1AUVA 4E1BA 2NV0A 4RH3A 4U5QA 5CA0F 2W83A 1A4UA 5TPZA 3C2BA 1WXQA 1J0AA 2OZEA 3B89A 2EIJH 3IIIA 2I2XB 2WFZA 2NIPA 4PRZA 3QODA 2A2ZA 4US2R 5HUJA 2V97A 4XLTA 4DZTA 3A27A 1OCRH 1TKCA 4WCFA 3T54A 4PG4A 4BDYA 1NG1A 3PHHA 4YRSA 1X19A 3UAZA 1JEJA 5KSZA 1MO2A 5JJBA 1DXYA 2JFHA 3NJ4A 5AI5A 4MO2A 1AKHA 3BG6A 5G2OA 1U2GA 2ZB9A 4DQUA 5FTLA 1SC3A 1SR8A 3MMNA 3K1PA 2P0YA 2CW5A 3QLUA 2A7XA 2V55B 1HC7A 2AZXA 3RS5A 5CB4F 3HWRA 4MVWA 3CVUA 4LHXA 4ESHA 1Z82A 5EGNA 1VL5A 5DW0A 2P6OA 1D1CA 4PC1A 5B6PA 2R5YA 4MRRA 2CBZA 4G9BA 4G1FA 3RR2A 3IAHA 3SXUA 3TTTA 3DAYA 2ZRQA 1Q1AA 3IQHX 2IJLA 3FXOA 3BMQA 1SPBS 3CX6A 3C3KA 5C31A 3JQFC 3DGEC 3PVZA 4XBFA 3GTJJ 4IFIA 3LPMA 2Q2QA 4L7VA 2ONYA 3UEOA 3E6CC 1YQUA 3EIQA 1XZAA 2V9PA 3QNMA 5HF6A 4BGVA 1X1DA 3ABQB 2WTBA 4QVIA 3MAAC 3MINA 4PLVA 4RK1A 2R8EA 1XVAA 5KSYA 4OHBA 2K2WA 1K2VN 3WGOA 5HBRA 2BFDB 1WLYA 2IPMA 4J1TC 2VJKA 4RXUA 2CBGA 1W9MA 2EQAA 5EESA 1XMJA 2PTHA 4RTOA 4XM1A 4Z3DA 2VTVA 4CIWA 3E4DA 3HRHA 4ZPXA 2E4WA 1JAZA 5K7SA 3AY6A 4M9XA 5E3NA 3GFRA 4EL0A 2BVLA 1BA3A 2R8PA 2F6RA 4BWVA 4KIUA 3OMYA 1ZC4A 2QL7A 5FJ8J 1KP3A 4A0ZA 4EQ6B 3WLHA 2NGRA 4MYHA 4XB2A 4R9SA 2IS2A 4M3NA 4PHTA 3WWDA 1JG7A 3JTMA 1G3YA 4ZDJA 3K6RA 1ZXBA 3HZRA 1QUEA 1XT6A 2DBZA 2IZ6A 4JMPA 3JARB 5HDQA 1WJEA 1QE3A 3M1LA 2X6YA 2OY0A 1JHMA 5HQ3B 4HXEB 4P3XA 4N9HA 5KVQA 2M3AA 2DPHA 5LYJB 4S1TA 3WKAA 1ETHA 1NBWB 1RQ2A 4L9JA 3ER9A 2ZXJA 4CUKA 2IC5A 1CE8A 2KWIA 1ABEA 3M8JA 2O5EA 3GXOA 4RE5A 3VBCA 3GN1A 2G1PA 3OSZA 3CJQB 4L8YA 1EQUA 4D97A 1UZCA 4MV6A 1IQUA 2PX0A 3UJ9A 3K8OE 2VQHA 4W8OA 4B31A 1U99A 4GC9A 1JT2A 2PUJA 4PN3A 2Q1YA 4O8ZA 4Q9DA 4N4OB 1MXHA 1R27A 2QTBA 4CEIA 3OS2A 1GYRA 3IELA 1L8AA 3LU1A 5JBQA 5BMOA 1BKDR 4WJLA 1X92A 4ZT4A 1QQAA 3ZHSA 1BXKA 3F8CA 5GV8A 2N1MA 4PG5A 1Y3HA 2PZMA 2WBLC 2DLLA 1ZD2P 4H1VA 3TTXA 5FLXK 1EJBA 4XSGA 4JODA 3RH0A 3WC4A 3T3OA 4MW6A 4UMDA 1IN8A 5ALJA 2IV7A 5FXMA 1YTYA 3SC2A 3WZMA 2EFJA 1R22A 4A8JB 1FFWA 1GUZA 4ZYVA 4J29A 4Z9BA 4QPZA 2P68A 1KERA 4AY2A 2ZDHA 2OD7A 2GXSA 4L6CA 4D41A 1MJ9A 1QGAA 2FJPA 3Q8KA 5IDXA 2ZJ8A 5AVWA 4EKEA 3UHJA 3L0OA 3T38A 5B30A 2WD7A 4RLHA 3OYMA 1NY5A 4KISA 3GJYA 1JBQA 4F2GA 2V74B 3QIVA 1XNRB 4F5WA 1SAYA 4BV3A 4N8DA 4JJ6A 1E1YA 3QE2A 4M8KA 6REQA 4MGZR 3E6AA 1IZ1A 1XDBA 3ELKA 1RAIA 4JJZA 4IFBA 1N4DA 4YMGA 1LXCA 2C00A 1TUBB 1JKJB 3WQQA 5EKDA 2H48A 3EBPA 4FP9A 1OWLA 4FCVA 4E03A 5KNDH 3EH2A 1KL7A 1ULHA 1QONA 1JMVA 2CLDX 5AKHA 4P32A 2Z09A 2OZLB 2ESNA 1YGPA 3WOHA 2QLBA 4LXHA 4CV0A 4WWHA 2CNLA 3LY9A 4U5XA 1GGNA 2C7PA 5SICE 1QG4A 1BR4A 3STHA 4R2IA 1FRNA 5AIAA 4FOPA 2M9MA 3LQFA 1RBMA 1T3LA 4V1CA 1BEZA 2NVUB 3OSGA 1L5FA 5L53A 3AVYA 1T8RA 1NX6A 1FIUA 3VR4H 2JLWA 4R0NA 1E2LA 2CCKA 1FLAA 2EL9A 2EW8A 3H3JA 4YACA 4HVLA 1I7SB 2HHHB 4EVSA 2OD9A 5JZMA 1X38A 3C3MA 1O77A 4AZTA 4PJ0C 2BGTA 1SXHA 2VBFA 2CJFA 3PDIB 3VR5H 1PW7A 5DP2A 3D0KA 3IQFA 3UT0A 3ZWMA 4J0EA 2A9RA 4KN5A 4LSZA 3NTUA 3FXRA 3U80A 3OZEA 1ENOA 4Q39A 7ADHA 5HZMA 3N7UA 4YJGA 3FOFC 1UPTA 1VA5A 4U7WA 4A3LJ 2WAQN 4YP0A 4FFBB 3DTVB 1YSCA 4MTDA 4PSVA 4B4OA 1XD2B 2QCOA 4J2OA 2HIGA 1ZK8A 3T1QA 4JV5B 1UK7A 1OWOA 1IDYA 4CTOA 4I50F 1RLTA 4WXHA 1HF3A 5AKEA 1LDMA 4EFKA 2C8JA 3D4OA 1ZMTA 3OPQA 3DZJA 5F98A 1T0HB 1PFVA 2F7SA 2J5RA 3ABZA 4FX2A 4DIQA 1SBNE 1IEVA 5CJPA 3OUZA 3GLUA 3CDLA 5LQSA 3RJMA 3E5UA 2PCLA 2CL5A 3G85A 2G5CA 5FQNA 3ZJ4A 2Y93A 1XQ1A 1G18A 2ZVQX 3GLLA 1YZUA 1UKAA 5F1OA 2VL8A 4COKA 1ZG1A 3BR0A 3UHAA 1Y5IA 4Y0AA 1MRZA 3GP3A 1SO8A 2KJBA 1KY3A 1FTYA 3TQFA 1LLQA 2BT4A 5FORA 1I3OA 3KS9A 3Q40A 5TPWA 3KHUA 4O2BA 4XX0B 1RZVA 2R5WA 5ALRA 4YJ3A 2NU6B 1HA8A 1LW6E 3J81K 4N40A 3LFUA 1A7UA 5IARA 3VDRA 1BW9A 3LKVA 1J09A 3IBTA 2H92A 5AW5A 1KO4A 4IQFA 1Z7EA 3ZHBA 3LXMA 3QXGA 2WRZA 2C84A 4HFRA 3LQKA 1Y8QA 3WLAA 2GBIA 3F47A 1S89A 3LT1A 3WU0A 1KH1A 2FJUA 1VE5A 4OHKA 1P0PA 2R00C 3A9VA 4ROTA 1XDGA 4OLHA 1AMOA 2I2BA 1MC8A 4TXHA 2ZYAA 4LHSA 4IKOA 1SCNE 2RKHA 1P75A 3STYA 1U5AA 2OO7A 1D9ZA 5FWYA 3CQZJ 1N8TA 2SKCA 3JRBA 3MERA 3RVDA 2Y2ZA 3WLJA 1H93A 3GBGA 5IBRA 1BVYF 1BS1A 4K9RA 5DRTA 3MD2A 2DQLA 4IJ5A 1A7KA 1W88A 1NK2P 4IRUB 4E5KA 4BX9A 2AQHA 3K94A 5CDUA 3ZPLA 5ALLA 1WBBA 1EUCB 4QFBA 1II8A 3BXEA 3CCBA 2HOSA 2QG9A 4R3NA 4KPUA 4JYZA 5C7OO 3LPDA 1YDGA 1HM5A 3MJVA 3IOEA 5ALXA 1A4IA 3MGKA 1TB4A 4MWGA 2CLIB 1FFBA 3HRSA 3RVJA 2FWAA 2ZT6A 5FKKA 4KHPB 4QTXA 1LKZA 3R4KA 3B1FA 4XTRA 3RAJA 3ZD6A 1QH8A 3PF9A 4Q4LA 4A69C 3T35A 3UPTA 1ITYA 1Y7LA 4AO6A 1LY1A 3IAUA 4H7PA 1D6JA 3HB9A 5D6NA 5K0ZA 1V11A 1RKWA 3OC6A 4R1MA 3RU9A 3RSGA 3U56A 2WY2D 8AT1A 1P4GA 3ZE1B 3T95A 4N5LA 2YBDA 3I45A 2RC4A 1T9KA 3D6MA 1USWA 3IDQA 5B3KA 1HETA 2C5FA 3ESAA 5G0TA 1QNFA 3B9BA 2VA9A 4Y6RA 5AONA 3ZWDA 5HKAA 3I5UA 3THYB 2H31A 2ZE6A 2E7ZA 5DYGA 3CLUD 3TLAA 2C7GA 5IAGA 1QH1A 3E7PA 1LWOA 2FSWA 3S81A 3WG9A 1FA9A 4BMSA 4MTLA 1ORVA 1PD1A 1B0PA 4JLAA 1W49A 3GRYA 1YHZA 3N6XA 3HKBB 3HWWA 4GGOA 3D7NA 2GEBA 4RDXA 3GPDG 5C3MA 3AR2A 3VU0A 1CQXA 4LI0A 4F2PA 3L6OO 2YTZA 3A2KA 5JS1A 4LC0A 1FUEA 3NT4A 3P0HA 2VJDA 4M0UA 2ZSHA 3CMCO 1QGUA 2HA3A 1NW8A 4QQRA 3Q0IA 2RAFA 3U4IA 4M1QA 1VKZA 5BPIA 4LJLA 1FPMA 4DLWA 1YIJI 5GAEJ 3MOGA 4I5DA 1U6GA 3D43A 4AKEA 2ZSKA 3R75A 4I19A 4NU8X 1YE9A 2B2CA 1M1UA 3VGPA 4B4CA 3BK7A 4NENA 1HUQA 1CNMA 1HZJA 4Q6WA 1IH8A 2LR0A 4B83A 2WV1A 1XF1A 4AJOA 5M3BA 4I3FA 1MX9A 1ORIA 2DI3A 1XJQA 1R0KA 4NG5A 1A9QA 1M1NA 3GLIB 4BN0A 5CURA 3W77A 3GOHA 1M2FA 1BWRA 3OOHA 4YP6A 1MDMA 4U88A 4G3XA 4ZRMA 3T61A 5LQNA 2RGYA 3RLFA 3UNGC 4EI7A 1L4BA 4FYIA 1E1KA 2QX6A 4GSLA 4N12A 1AU9A 1FRVA 4OB6A 4RZ3A 1BS2A 1YD7A 4H0CA 4M21A 1DIAA 4B3JA 3QEKA 3QG5A 3O6BB 1OZHA 5B1BH 1ZR2A 2PZBA 2FF7A 4RAZA 4KXNA 5ELXA 3S32A 2Y1LA 1X1RA 4IGFA 1JEQB 4HLXA 5F1JA 3OBIA 2AC7A 2IEGA 4UUSA 3FF4A 1FBNA 4ALMA 4Z8XA 1EAMA 3HUTA 1PYDA 1XKXA 1M2HA 2EYUA 3C1TA 3BIOA 4IH9A 1CHDA 3O7MA 1I4LD 4HQ0A 1SXQA 4HY3A 3T0IA 2COUA 3G2JA 2OCXA 5LQAA 3OS1A 5HMMA 1JLHA 4R69A 1AVTA 3AJEA 4GFBA 1E3EA 3HDYA 3C7DB 3B6AA 3RKXA 4ENSA 1PVDA 2AR7A 3DBRA 2WABA 1KI8A 2EEPA 3GFJA 4DYVA 1GZHB 1MEJA 1TD9A 3JQFA 3MMSA 3HN2A 2FOWA 1K8QA 1P72A 5BSWA 5A71A 4BFYA 4QPCA 3ZMZA 4UU8A 4OMFG 1SY7A 3CNHA 3HPQA 2OQIA 3T5BA 4TWIA 2BXYA 1B0AA 4RAQA 5B1SA 3QEOA 3WYCA 3GWZA 4XB6B 1R9TJ 4BEBA 3SZPA 3F1KA 5H68A 13PKA 3EYWA 3UOGA 2VYND 3OJWA 4G0VA 5JAZA 2NRAC 1XSDA 1XU9A 2WYVA 3WYFA 4CKEB 3D6FA 5IVKA 3HL0A 3VSEA 1U2ZA 4G86A 2I8LA 3DR3A 4ZAVA 2GZHA 3L4BC 3IQDB 1NXQA 1E5TA 3UZUA 2PJUA 2CUEA 1JXSA 2KW5A 1QBKC 1FYMA 3A3PA 5FUMA 1CB0A 2QG4A 3K1NA 1P9WA 2QLFA 3EGDB 5GP9A 3U62A 4JBYA 2YCBA 2WJIA 2QTTA 3TMKA 3A6HA 1HLFA 4MH0R 4RH1A 4XX1A 2Z8XA 2HO5A 2ID8A 1EA3A 4G85A 3VR6H 1NU6A 3ICPA 2CY0A 3VNSA 1KEVA 3GG9A 1IXCA 3PUVA 2XAHA 4PIMA 2A9FA 1APLC 2DUMA 1QKKA 2R6DA 3P7NA 4YVFA 5I7HA 5UKDA 2I67A 1MFZA 4DYQA 4ZDOA 1HG0A 3BJIC 1RKUA 3ANTA 3IUEA 1HF0A 5B1HA 2VBWA 3MILA 3ZY6A 3JQGB 4HH4A 1T8SA 4WX2B 3PUHA 4W97A 2OCDA 3WRYA 4LK3A 3VHXA 5IM5A 1BE6A 3DEWA 3RK1A 1KO8A 3OA0A 3O4GA 5FI5A 3P5JA 2A1TS 1QE0A 4H1HA 5HR5A 1W0JD 1WVGA 3ND5A 2B4QA 3TTWA 3IO5A 4TTPA 3FHJA 4MS4B 4IMIB 2QTFA 3F67A 1PR0A 2WM9B 4YELA 4G2NA 2Z8YM 2NO1A 4FM9A 4HWTA 2B5VA 4YMLA 1JEEA 4Y1GA 4JOCA 3DTKA 1LNSA 2JLXA 4BCBA 2DYKA 3I9MA 4MUIA 1L7BA 5ENVA 4H17A 2Z4TA 4GQAA 2HZ7A 3LOPA 1RS0A 3KP4A 5AR1A 3RSSA 1XIVA 2JFXA 4JLMA 3GCGA 3W6ZA 3BTVA 4MW2A 5AW2A 3G2LA 3L6UA 2L7ZA 2FEZA 3I62A 4UUMA 1YJQA 3T9AA 1N9KA 4O4JB 1JI0A 3QRWA 4I5GA 4IXTA 4IWXA 4AYTA 5F0HA 4M1WA 1X1EA 4TXMA 1T26A 1GA1A 1MMSA 4YRLA 1W59A 3GGSA 1N77A 4CKCA 1CRLA 3WTCA 2CFXA 3NZEA 3INNA 3V6LA 4P3OA 3S1SA 3TS1A 4GGPA 1E9CA 2X40A 4BL0B 2BF4A 4YMVA 4HDNA 3A4TA 4MJLA 1NLUA 3U17A 1UQRA 4HDRB 4PLGA 3FNGA 2XF8A 3OOSA 3BN3A 1W1IA 4DIDA 4LF8B 1Z5ZA 2C99A 2WKQA 4FGLA 2WADA 5H20A 3CP2A 1YR6A 3P0JA 2JH9A 4IIXA 4ZQGA 1UDBA 4BC1A 3KB8A 1KYIA 4YFVA 5FR1A 3LP5A 2FUNB 4K26A 2J6IA 4JFAA 2J7KA 3IR5A 1U0GA 4HX2A 2H4XA 4TMZA 3OICA 4ZVUA 2AFHA 4FDVA 1JT9A 1R2QA 1T56A 1BJRE 3OQNA 4H7DA 2PMKA 5ALPA 1JPUA 4LE2A 1UKEA 2PSDA 1WHSB 4LFBB 5IOZA 2E1MC 4Z3KA 1RMQA 2PBFA 1RBQA 4C6TB 4C5AA 1F7VA 2JEYA 4HA8A 5KX5A 3M3YJ 3BT7A 2QV0A 1O0CA 3LDHA 1SIOA 3VSLA 2HM7A 1QORA 2X0LA 3GVIA 5LP6C 4HXYA 3ZY3A 3RU3A 4LIVA 1ZXXA 1U8EA 3U09A 4DT1A 4E32A 4N8EA 4AZ3B 4DTIA 3DZCA 4JP0A 5DNEA 5D4RA 4WECA 5J4KA 1IXZA 1X7HA 4JBGA 4C0KA 4BYGA 1ETXA 2GA9A 3ZS8A 1RJWA 4IUBS 2PRKA 4NCNA 5CVRA 4FYJA 1XG5A 4ZEWA 4B17A 4M1OA 4CICA 4R01A 4X1OA 1C7JA 3GQBB 1S96A 4P83A 4MRMA 2YWRA 1LB2A 4YGYA 4JL5A 5IJZA 1FNMA 3WSVA 4U02A 2YZMA 1Z4JA 3AHIA 1JKFA 4JXXA 2RN7A 1FFSA 4UFOA 3QFRA 3A1VA 4EHAA 1I6MA 3V46A 1MH4A 4EX7A 1W2WB 2HFHA 4URFA 3U40A 4WEOA 2PMBA 2BFFA 5F73A 4QLAA 5JJLA 3TLCA 2B7CA 2HXYA 5DHSA 4WCFB 3BE6A 1L5HB 3KR9A 3MCTA 2FF4A 1QNTA 1SD7A 1ULYA 4PIVA 3PIPF 1TD1A 4GP9A 2DFPA 4DBVO 3CMYA 5JSFA 2ZZKA 4R8SA 1GVJA 3I04A 3GRCA 1Y39A 3QWBA 1R23A 2Z2KA 4A0GA 3BWEA 2A6TA 2I3ZA 4W1QA 2WB4A 5F2NA 1FFXA 1PJZA 1WW8A 1Z08A 3R7AA 3QKIA 1FMTA 2JJ2A 4GXRA 4URWR 2XA1A 2JLYA 3G1MA 2AXNA 1VI0A 1UJMA 3ZV4A 4A7PA 1P1KA 1EK2A 2R1TB 3QG1A 3ORFA 4Q9JA 2ZXUA 2R00A 3EOAI 2X0IA 3AONB 2R5YB 3NAMA 4FYHA 2QSHX 1N4AA 1O6GA 3HCWA 2QEQA 1UJ6A 3FTEA 2C77A 2F3QA 5J5VA 1KQOA 4GI1A 1YAJA 2ZTUA 4ARZA 1DIGA 3TSZA 1J0DA 1VIYA 4MJ7A 1Y1PA 3BMQB 3R5TA 4QO7A 3FHLA 5HXAA 3AVUA 4GECA 4EPRA 1NE2A 4R2LA 2AW3A 1ZW6A 1T4MA 1F4KA 1ZARA 1NOIA 5A5VA 3HOWJ 3NETA 1IDZA 3BSFA 3P9CA 4CLEA 3MINB 2EIMH 5LLSA 2O0MA 4Q7LA 3UCFA 4OFZA 3PEVA 4C2UA 4JC8A 1U0HC 4ZHQA 1DC3A 4HNRA 1YZVA 4DUYB 4QJ3A 4IS3A 1XPJA 4V19K 1J99A 2PU7A 4I3HA 4KAJA 3H84A 2XZTA 1IJWC 4YRIA 2MJLA 3NNNA 1SPXA 1DARA 3W7BA 4DSOA 2P6PA 3QBTA 1WWKA 3NXSA 1CJUC 2VPQA 3GEHA 4U7JA 3KKPA 2EJTA 1HW2A 2MSDB 1V39A 3F3KA 4DSAA 3H5AA 2REOA 3H7AA 5E7IA 3Q1KA 4RYLA 3PTLA 1MJGA 2FN4A 3PIDA 1TKRA 3ZTWA 3NTOA 3ZY5A 2BFOA 4UNOA 4CNQA 4WKBA 5EERA 1NW7A 1W85A 2QTRA 3DOCA 4X6AJ 1DCMA 1HKTA 1THTA 4PYNA 5JPCA 3CLTD 2WLSA 4G5HA 1TVEA 4N6GA 3ZI0A 2GA1A 3WWPA 2DWQA 4WINA 2PX8A 2AQIA 3JY6A 2A1UA 2OPHA 5KQGA 1M9NA 4GSKA 3K70C 4CW7A 3FHCB 3LPAA 2ZSJA 1WHUA 5CVIA 1CE8B 1KYTA 3FR7A 3FTCA 1YVDA 2Y1EA 4UCQA 2YUSA 1QTRA 1V4RA 2AA3A 3KQYA 3L4KA 4W63A 3R7LA 5IULC 3M33A 1UL1X 1XFDA 4RTPA 2ZBRA 4OLJA 2WWXA 2C7BA 1Q1QA 5CLSA 3A4MA 3IVAA 2ZYTX 1P5HA 1X6VA 3IB6A 1N5OX 4BGDA 1FX0A 2OU2A 4NY1A 5FRDA 4BQPA 4CEIB 4JUBA 3G1LA 3SQWA 3QXXA 2A6HF 1U0JA 3B8HA 4WLUA 1UEXC 1ZHOA 3NUQA 1IV6A 3P2OA 3UAOA 2WYOA 1YJXA 4OGWA 1UBMS 1FBQA 3CLVA 5JC8A 3M4ZA 4B5LA 1SRQA 1D5VA 2G9VA 1NZDA 4BRUA 4NTZA 3LT2A 1B3BA 3C8ZA 4HFMA 3HOUJ 3G3ZA 3HPRA 2F1OA 1JHHA 1CYEA 1V5FA 1YQ9A 3VDMA 3NGMA 5E95A 4YR7A 1O94D 3ZK8A 3SC2B 1JQ3A 2OSVA 1A77A 2GHRA 1Y80A 2DH5A 4D80A 1ONOA 4RJJA 2E4AA 1N8SA 3I8SA 4UDYX 1P80A 3IVGA 1OPRA 3UWPA 2AFIE 3BXOA 2HVRA 2WD7B 1R6VA 1HKUA 4DNXA 3MZHA 3MN2A 3J81A 2IYZA 3RUAA 5IH3A 2H7CA 2JAQA 4O0LA 1K89A 5KSPA 3PS9A 1F0NA 3NHBA 4N6OA 3IEPA 3GK3A 1VHQA 4PWYA 1YB1A 1OJLA 4GWLA 2LFBA 5LCXA 3DTTA 2Z3ZA 5M5BA 5JOQA 2BKLA 1E9BA 3F2IA 4ZQEA 1JXQA 3T5PA 4DQ0A 2TRTA 3G59A 2EHDA 4EZEA 2UUPA 3AMVA 2VJCA 5CNMA 3WWYA 3CNOA 2NM0A 3R6SA 1MNDA 4LZPA 2BFNA 3GGCA 4Q15A 2PUEA 2X6TA 2QZPA 2ZDQA 3JR7A 2DUWA 5JQGA 1I3QJ 1YMUA 3CPEA 3M6XA 4V1CB 1TJYA 4TTAA 3O84A 2AW5A 1K4TA 1I27A 3N2IA 3QA3E 3WGMA 2Y0MA 2AUMA 4UC0A 3B6CA 4HF1A 2VTKA 2QD3A 4XVQA 5DHQA 5CG1A 4GQIA 1H94A 2WUDA 3PWSA 4J3NA 2GT1A 1V2HE 3PRKE 3HGMA 2IEBA 2G80A 1QG0A 5HEKA 2IPNA 3DB1A 3BCBA 2W2VA 3FJOA 4CU5A 3EYAA 3G6WA 2JAPA 1X80A 2VHCA 3OIGA 2E7WA 1NMQA 1IZ0A 2GERA 4YK7A 4K6OA 2VPWA 2WR8A 1C81A 2YOGA 2VJMA 3L4BA 2IUSA 1P8AA 4ER3A 3W05A 4KGVA 4HUQA 1ZXLA 4W8GA 1WW3A 2HR3A 2LWIA 2QVXX 1LH0A 3MM4A 3BDIA 1VL1A 3EVDA 3PFCA 5K0BA 1NUAA 3BHNA 3PEUA 4AVYA 1KI2A 5IKXA 2A6PA 4ZDPA 2UYYA 3L6RA 2IYTA 3FMSA 1HY3A 4A9AA 3HEAA 3NHUA 1P6XA 2BZ1A 1N75A 2R85A 2VUHB 5JHUA 3M3HA 3SQNA 4G1VA 3C2HA 1D3AA 1TA4A 1DJQA 1CVLA 1NHAA 1H9BA 2GN1A 4AIDA 4MV1A 1JIUA 3HSRA 1GGFA 4IRMA 3JWHA 3W4KA 5B1EA 1RAHA 1JKXA 4WY5A 3KTOA 1RLJA 1QZZA 4ZOQI 2HMWA 2P4UA 4ARUA 4QDTA 2LKDA 2O20A 1CR4A 2CN1A 1OLSA 1RI7A 1PJSA 1DRWA 1CLUA 4AKSA 4E51A 3SMQA 3ST7A 5L6LB 3BILA 3INRA 3K6GA 1U0EA 3QKUA 3KCQA 4EFMA 3WYBA 5JAUA 3FRJA 2VH2A 5LEKA 4O2BB 3FJYA 4XWKA 3N86A 3TDUC 4WDRA 2FEPA 3L8YA 2ZSIA 3JPWA 1VYUA 1Q15A 2QT0A 2YKGA 4Y13A 2ZIVB 2B21A 1EWYA 1Z5PA 5IDWA 5CUQA 4PSKA 3M4YA 2F2EA 2BHTA 1J8DA 1AKMA 2DFDA 3PTAA 2RGAA 1Y8QB 4YO7A 2PAFA 3FYDA 5CK5A 5EIWA 3SOZA 1RQNA 3TXXA 2YH2A 4FQ5A 4DIUA 3T1YB 3ADPA 2QQAA 2HJVA 1ISRA 1Q1VA 1UJBA 5EJ7A 3CWQA 4KRXA 5K9ZA 1P0QA 5ICFA 4KQHA 2PBIA 5M3MJ 3F4LA 2Z56A 4PRLA 1R9JA 4BVFA 1XTPA 2MWMA 5FWYB 3OYGA 2ZS9A 3OOUA 3I54A 4EKGA 4EY3A 1E3TA 4OU0A 2QRVA 5IHPA 4XDZA 4ZQIA 5E2AA 3SLRA 5C7YA 4NQWA 1L8XA 5IDVA 1W88B 2PSEA 4RSMA 3SNKA 2O7NA 1JB9A 2K9LA 4KFRA 3IAAA 4Z2YA 4O4LB 4QOIA 3DZFA 4NBLA 2R7WA 4KPUB 5AW4A 4BKPA 3PNSA 1KZHA 1KFEB 1KVRA 5I7VA 4MFEA 3L6BA 4PICA 4NNJA 1HDGO 2J0VA 2HX1A 3S8MA 2HDHA 5HOQA 1RHMA 2IE0A 2GJ8A 2V7UA 2DTXA 4JP1A 4WKCA 2VHEA 1ZLXA 2WW8A 3R2JA 2VN2A 2O1EA 3UPUA 2AG0A 3W5VA 1GKIA 1G42A 2Q5LA 4U8GA 4FSXA 1Z28A 1S5LC 1MQ9A 5J6XA 1NI3A 1TZJA 1VL0A 4R3UC 1V11B 4Q24A 5GTDA 3RHSA 1VJ0A 2ECOA 2C58A 4ZO9A 4PC2A 1IXRC 2DK8A 3F23A 4CCSA 1MU0A 3AUYA 3BMCA 1HC8A 3GFPA 2JCVA 4Z0HO 1H2YA 3COVA 1D0ZA 5BOXA 3K35A 1NVBA 4XQEA 3RPUA 3CKMA 3PU6A 4YT2A 1NL3A 1PHPA 4B3XA 2PJDA 2C9ZA 2FTKE 3RFUA 3RYHA 5KYXA 4LK1F 4CEJB 3FZVA 4XKBA 2C92A 5AWFC 5L95A 2OWDA 1AHDP 5LXTF 3FNHA 1QGPA 2GK4A 4GM0A 4H3HB 1ECFA 3LRXA 4K7JA 2J5KA 4A3GJ 4EWLA 4JI1B 1I10A 5KDLA 4R0VA 4DJEC 1KYYA 2W2XA 3HP4A 4R8RA 1N0VC 2FSUA 3MYYA 3TO7A 5JARA 1L5GB 4JL8A 5LP6A 2PLRA 1PS8A 3HSFA 2ZYDA 2KIMA 1PNTA 5E3JA 2WFMA 4DUPA 5FP0A 2VF7A 4PNPA 2B0CA 2IU3A 4LGCA 2ZSHB 4V2UA 4CIXA 3BTUA 1QGUB 1E9FA 1EJ2A 1N9GA 4I9HA 4HT3B 1U1DA 4LQCA 1BMQA 2P6NA 2AXPA 3GUUA 1H0SA 3L7KA 3AL0B 2AN4A 3R44A 4DF3A 3FUCA 3IP8A 4FB5A 3F6PA 1TPYA 3H9GA 3QOWA 5NULA 2O8BB 4BBJA 1N36B 4JR1A 4NENB 3ZLJA 4W99A 1YI0A 2C5AA 2PT5A 2DPLA 4J0IA 5T64A 3K0AB 4LYGA 3KHKA 3ED5A 4KSCA 2CUTA 4QDUA 5JMOA 2B30A 3K53A 2AN5A 1KZ4A 4XQCA 3E3AA 4LJ6A 4TWBA 5DX1A 3P7MA 5A0FA 4A4DA 1EVLA 3WJ7A 4AIJA 2FMFA 3G17A 1WPKA 4NU6A 1FUYB 1XEXA 4PHGA 3ZXUB 4Q3EA 1EDEA 3RVLA 1MMFB 3V2HA 4UUBA 2C3MA 2VAVA 3WICA 1IBMB 3AP2A 5LZ4A 4LG0A 2D1YA 2I78A 3E7XA 5B1AH 4MQFA 1ADJA 3K92A 1JMKC 3KIPA 3EC7A 3JWEA 3CJTA 1F9NA 3EOZA 3QTLA 1XN4A 1PT8A 2C78A 2WQZA 2M98A 1AY0A 3MRVA 5CIYA 4X45A 2OHFA 2BTOA 1E3DA 1WSBA 3N0WA 1Z0JA 4ZCPA 1ETUA 2XPUA 2FKAA 1QAQA 3LZ6A 3VYRB 2JI9A 1B9NA 1TE2A 4ZAGA 5J2TA 2YV4A 3TSYA 4RB2C 1F2UA 1ORHA 2ZSFA 4ZRNA 1TO1E 1A9YA 1AKQA 2PZJA 3O83A 4BQRA 2NU9A 4K8RB 1OWNA 3N7TA 1MAVA 3ZKWA 3TKYA 3CRW1 4LJ9A 5HOEA 3B1YA 2J32A 4WIAA 2ZMEC 1VLJA 4M9UA 4IL5A 2VONA 2YBEA 4QYXA 4MUKA 2FX0A 2VFAA 1XTTA 2PMEA 3ZJYA 2DW4A 3ZHYA 1RXVA 4PNZA 3HGTA 2QMUA 1IHOA 3L0BA 1I7PA 4C08A 2CXNA 5LEJA 3LRPA 2OFWA 4YCMA 3TZ6A 2HCTA 3EGVA 1Z25A 1YZHA 3FKQA 2SKDA 1QYXA 4WW0A 2E2IJ 4M83A 5M7EA 1U8RA 2BHYA 1OXUA 4O5AA 4MVXA 3P5SA 4DANA 2FK8A 2IYRA 2PT6A 1GQFA 3T3EA 1X8JA 3TMYA 3WWEA 1SU6A 3N07A 1VPDA 2GZDA 1UJ4A 4ZU6X 3R7WA 3OZUA 1H8AC 1ZJ6A 3E9YA 2QTGA 3K69A 4F5EA 5TEVA 4AS2A 2GCGA 4D02A 3VM6A 3BTSA 2LTPA 2O2ZA 4JB8A 3HRTA 3LUDA 3D6UA 3TX2A 2EF0A 1DEXA 3G3EA 2BEOA 2CUNA 2W4SA 1B4AA 2X4GA 5CLIA 4XUGB 4W1RA 3MGAA 4AC0A 3FYHA 2G0EA 2LW7A 5U9CA 1H0MA 2D00A 3SZMA 1O9HA 3FAKA 3R0ZA 4AXXA 4QARA 3RNLA 3UUGA 5LDDC 4BKOA 3SZUA 3RUEA 3ELDA 1L9KA 1KJIA 3IOYA 1D0SA 2AG6A 4A91A 4HJRA 4Z7JA 3AM1A 1BOBA 2FZGA 3FCCA 2XB8A 2YXDA 2DJ5A 3Q4GA 2HI3A 3S1RJ 3QUBA 2WF8A 4X0EA 1KAMA 2JBWA 2I1WA 4X0GA 3VHXB 1UDRA 1ABBA 1WJGA 1SAUA 2B36A 4X3OA 1TC3C 2IHZA 1U7OA 4R1OA 5AW8A 3PPVA 3JQ8A 1E2IA 2CCJA 2OGTA 2DRIA 2YHUA 5MGNA 4EW6A 2LYCA 1RUNA 1TBXA 5DXJA 3QP6A 5GQSA 4NFSA 2VAWA 2VO1A 1PL0A 1WBDA 3ZZTA 2XTZA 3GCWA 3BB3A 3KKKA 1NRIA 5GP1A 2BHRA 2OHHA 4Y7NJ 3BGWA 3CIOA 5H6RA 2WQ6A 2GAUA 1M75A 3D4IA 1Z6PA 2CDCA 1BS9A 1DRUA 1H8HA 3ZHUA 4DV6B 1JYFA 4OHRA 1RADA 2Y27A 4IYRA 3V1YA 1E2FA 2JVKA 1B0UA 4B7AA 1YKGA 1DGWY 3TKLA 2E71A 4LG3A 3ND8A 2HI0A 3KTFA 3ESCA 3S3OA 1WQ1R 3EHEA 1RWPA 4U2KA 1C0EA 4JUAA 1U3FA 4GWKA 5BV0A 2G1AA 2MYNA 1NVMB 2A59A 3IBSA 1J00A 1E7WA 4ENWA 2ZR8A 2IH5A 1U31A 4H4KC 3RGWS 1P73A 3SK0A 4QUEA 4CKCB 2WICA 1CT9A 4AYXA 2GR9A 3CONA 4O25A 1Z56C 4H08A 1CQJA 1V37A 2ZB7A 3VH3A 1LQ2A 3DE3X 4BN4A 3WRYC 1Z7WA 5GPCA 3Q85A 5LJLA 2XGMA 3U60B 3MUEA 3LC2O 1CEQA 1BGWA 3CE6A 3V2GA 2P30A 2J5OA 4EGAA 5FO0A 1NNLA 1KBOA 2ZAOA 4NMMA 4I9GA 4NAUA 3L49A 3VC2A 3G1OA 4D7NA 1JECA 4RJ2A 2FUEA 2EEZA 5I01A 1E9EA 3WFIA 2CRGA 2FB9A 1N1GA 1ZD3A 2HHAA 1N6LA 2OCYC 4RSGA 1FMWA 4L6AA 4FHZA 3CCUI 5DEQA 4G8XA 1PDNC 3IUMA 1Z17A 2F5CA 4BE1A 1HNWB 2R7LA 3QVSA 4GX5A 1UAGA 2I76A 4ALKA 3E81A 3K2EA 5KB3A 4C0XA 4NDZA 1TIKA 5JR3A 4AWXA 2P9BA 3PNLA 3FPSA 3MTQA 3CT4A 4M54A 2CHFA 4UNQA 3Q6IA 1C9EA 1ADGA 2ACJA 2IVFA 3RTBA 3LLUA 4KFUA 1HYGA 4GZ3A 4P1ZA 3IKTA 3A6GA 2JEOA 3KZVA 1ZGJA 1PUIA 3KJIA 3OZDA 2PX5A 1M3SA 3DDHA 2EJCA 4X1IA 3T8YA 3UMBA 1YIDA 4M0CA 1F3LA 4DSTA 5EJIA 5CXXA 2D0PB 5K8VA 3SFTA 2ACWA 4JDUA 3RM3A 1B93A 3AKEA 2QLLA 4LQ4A 4C89A 1P60A 1XKLA 4F04A 1N3BA 2DR3A 4WKPA 1K0UA 5BORA 2XNSA 2XWJI 5D01A 2WF5A 5D4SA 4W5HA 5F78A 1JZQA 4K9QA 1TZLA 1ZGWA 4L5IA 4HX9A 4QUAA 2IYOA 4H0FA 3TQRA 5ECYA 1RWWA 1JILA 3U19A 1JBKA 4PNEA 3U4MA 1Z4MA 5G4KA 5CB0A 3N0TA 4ZOLB 5ICMA 1WP9A 3OYEA 5LFAA 1BTOA 3NAZA 2G7MC 4JYAB 1GA4A 3EBOA 2ME0A 3EQ8A 4X97A 3SYMA 3RTGA 3MPOA 1KDRA 1YS1X 4OMCA 1NF9A 3IE0A 3H35A 2F6CA 1J23A 4LEIA 4RS4A 3FNRA 2CFRA 3S93A 3TLXA 2IZ0A 3KSAC 1VFCA 1PYGA 1DG9A 4B71A 3W3ZB 4YJFA 1GZ6A 2XRZA 1E8NA 1FLVA 1CRQA 2WIFA 4IDBA 3BMOA 2OGWA 5FKNA 2R48A 1OSNA 2W6PA 4IX9A 3L6EA 4HNGA 1T10A 4FNMA 4F3NA 4PCQA 3L1IA 5A6VA 3QBJA 2OFOA 1A9RA 3O2SB 4HV5A 4FEEA 3HJGA 5T8KC 3WLSA 1J8VA 1C29B 3ZDCA 3COWA 3WBJA 2AQ8A 5IT4A 1PJAA 1K6YA 2ZB4A 1KU7A 4R54A 3F0CA 1X0VA 3C3XA 1II0A 2PLYA 5JH7A 2XCLA 1NPYA 4FWBA 5BO5A 4URYR 2OECA 1X2NA 3OYBA 2KLBA 5AXBA 3KKZA 5IT0A 1OILA 4BV8A 2ZWOA 3D31A 4HLCA 1XHLA 2ORED 4JUFA 1T13A 5HDGA 1XXHE 4PFQA 4ZHSA 3LUGA 2MD5A 3WLIA 4EOGA 1PE0A 4TYPA 3AF0A 1DC8A 3ADOA 2ECQA 2P9CA 2JFYA 3EUKL 3BT9A 3ZV3A 4QGAA 1I4DD 4LMRA 5ICGA 4YRVA 5DHTA 2MMGA 1EKXA 3ZDZB 4RVFA 1LFDB 5ED4A 3DF9A 1YR9A 3K4NA 3Q98A 1R64A 5AK4A 4NYIR 2JA7J 5ILOA 3QPUA 1E6KA 4DXDA 4UUVA 4CG3A 2BVMA 4OU5A 4OK3A 4LJKA 4ZHQB 2D3WA 1MH9A 1CERA 1MT3A 1AO3A 4D3DA 3ZRGA 3SYTA 3OY2A 1P7YA 3CPSA 4ER0A 4OREX 5EIBD 4UPDA 1M6EX 2KIQA 2FBIA 2UXXA 3H5TA 4DCOA 3TDMA 2HHLA 2NX2A 2XY4A 2YWDA 3AG5A 3WXBA 2GF2A 4JYPA 3NCTA 1F6WA 1SG0A 3MMZA 4UZFA 4CIBA 4Q12A 4XFDA 2ZRMA 2ZE8A 3O8QB 3A02A 1PZGA 3PYXA 5LGUA 1WCXA 4BE9A 4MAAA 1S0UA 4Q1CA 1W85B 5AVXA 3IUPA 4RL4A 4KZKA 3Q8LA 4M8IA 3O8CA 1PR5A 4KT5C 1X87A 2O2IA 5JFGA 4BQFA 4B73A 3U4DA 4C14A 4KXLA 1SEPA 3DQPA 5EZGA 3IAS2 4KE6A 2BCEA 3AF3A 4GPTA 2CLEB 3ISPA 3VVLA 2ZRGA 3K9NA 1RQGA 2J59A 1VZ2A 5EMKA 2ZI6A 4IQ8A 2XZLA 4JT9A 2JIPA 5T4BA 1KYZA 2JKZA 1UMDA 4J9VA 1G20E 2NVOA 1L1EA 2AF3C 3ZD7A 2OG1A 2J5XA 1THMA 4PHCA 3O74A 4EB6A 4KNVA 3GI1A 3C48A 2GFHA 3GDHA 2D54A 4DQKA 1P4XA 1P4SA 1DDOA 4I1SA 1UBCA 3N05A 4TV7A 4GMHA 2X1DA 4OSEA 5C8XA 1KIFA 1SFXA 1BMFD 1HYBA 1RRFA 1JTFA 4P7JA 1QHFA 1Z4PX 5HNFA 3BGSA 4S0ZA 1NF8A 3HO6A 3GUHA 4HN4B 5BUZA 3TFOA 4MW0A 3Q7PA 3U3RA 1NVFA 4L0QA 2DSTA 2EW2A 3TTVA 3GD5A 1ZJWA 4Q4AA 4WUVA 4CM4B 5F04A 3DPTA 1EHCA 1EUYA 3DL4A 3ABLH 4O0MA 1IM2A 2D5BA 2DWUA 3EQZA 2E3JA 1VF9A 3LP8A 4MUAA 3HKZN 3U1VA 1S1CA 5D3ZA 3HCAA 3I4LA 2O8CA 4CYDA 5FOUA 3HDDA 5B4TA 9ATCA 4LVUA 2EARA 4WASA 1W0KD 3EUAA 3ZDAA 3A04A 4OAOA 5G1OA 3KZKA 3LZCA 1RIIA 4WXCA 2CMHA 1NASA 2UU9B 2JIDA 4LF5B 3M1EA 5F7XA 2X41A 2E2WA 5DMHA 5CJ9A 2Z9DA 1BKSB 4MKHA 1GXSA 3SDGA 3TP3A 3E5NA 1N2SA 4BTVA 3F9RA 3Q11A 3LCUA 1K5HA 3HUUA 4JVSB 4O4IA 3W78A 1JP7A 4DR3B 1DAIA 2Z2IA 1J42A 2NU7A 1LC0A 3VFZA 3QYAA 2OD2A 3E27A 4LJAA 3VVBA 5ILGA 2CL0X 1NUQA 1GT6A 1F43A 2YWGA 4IH4A 3V8EA 2W6OA 5JCJD 5CFRA 4YCSA 4OOEA 3KCNA 5E20A 1SVKA 5THQA 4P4GA 1R0WA 5JQGB 4ZICA 2FGKA 4HRXA 1IBRA 1OH8A 2ZMEA 5K6TA 3U4QA 3WL7A 3T7CA 1CQIA 4P7GA 3WZ2A 3NRBA 1NP3A 5CM9C 1RACA 3SJ7A 1DRKA 3BJOA 1B1BA 3RJ9A 3F6SA 2B34A 4R51A 1UKZA 3O31A 1XMKA 1HR0B 5BNIA 3UYKA 2I8DA 3H1EA 4IHQA 1KJYA 2XV4S 4XLPF 3W5DA 3HUGA 1PG2A 1GHCA 5CFNA 4M46A 1SZCA 1RDFA 4HPWA 5HKKA 3JWJA 4YQEA 1LVAA 5I3CA 3NFYA 3BIJA 2HSGA 1D1SA 4GOXA 4NONA 1Q19A 5JAHA 4RJKA 3ZMUA 3A4YA 1X80B 2OT3B 1KI3A 3IH4A 4AMGA 2PXXA 2OPBA 5DWVA 3VO1A 2G72A 4QQFA 2Z6AA 2C04A 1XNJA 3S7ZA 3HOZJ 2J0QA 1HEYA 2VJMB 3KVYA 1ZFNA 1UP6A 4DZZA 2G7ZA 5A3RA 1YDEA 3FCXA 5L3VA 3OAAA 2EFCB 1WXHA 2P3LA 2PEXA 4FHDA 1NXVA 5B4UA 3CLKA 3TR0A 1HKSA 1UKYA 4E15A 1GZ7A 1G5HA 4FQ7A 3SYNA 4JASB 4MUXA 4B45A 1AQNA 4F06A 4DOMA 3AUTA 4GZLA 1WPXA 1JDNA 1XD8A 1JJVA 1F20A 2EPFA 4IOJA 3L1PA 4BNLA 2Z8ZA 5H82A 1T0FC 2Y48A 4KQ2A 3H36A 1SXJD 1JNXX 4KR6A 4YX9A 1E3PA 4GM4A 4HL6A 1KFBB 3TD9A 1YBHA 1U3WA 1OLSB 1Z0XA 5HODA 1PGOA 1QXSA 2ZJOA 5TMBA 1KDVA 1U98A 1VIMA 4L74A 4BNNA 5I5EA 3PHCA 2EILH 1CUBA 1Q92A 3QVUA 4PXYA 2P2DA 4ZFNA 4IZHA 3BKWA 4ERXA 3MVEA 2RBKA 4R3WA 2ZSIB 4TLLB 1W4RA 3EG9A 4BNVA 3RC2A 5T3UA 4N7BA 1QBJA 5TSDA 4YRFA 4MVJM 1MD0A 5B66C 2ANCA 4IWYA 3W6VA 2WMYA 4YRQA 1SC1A 1XQVA 3OUUA 4FBMA 3NM5A 4GO1A 1SHUX 1SKYB 5IYZB 4Y9RA 4EGQA 1Q17A 3KJXA 1RKTA 1EFRA 4PG7A 2JFNA 3W7AA 5AIPA 3ESWB 2OA0A 1E9RA 4RTNA 2FW8A 2QRVB 1E0JA 3P26A 4DYCA 5JO9A 1OFCX 4TUYF 4PPNA 3BICA 3RB8A 4NQWB 3GPCA 4QWMA 1U2DA 2Q3BA 3DKYA 5JZSA 5AJXA 1QZXA 3Q7IA 1XZBA 1OPXA 3D6JA 1KOFA 3ICOA 1VQ7I 2CNBA 2I3AA 2Y30A 4ASUD 2XDQA 3VJRA 3KZYA 4XQ0A 2BM0A 4ZI2A 3W2TA 2IXTA 2J7PD 3QUCA 2VUIB 4WLVA 1PUJA 3N59A 2IXGA 2W0SA 1PEDA 4HN9A 3CUEF 3NM4A 2VATA 2BGGA 4KU4A 3TZLA 5L4NA 3A26A 3VTAA 2ZUDA 2R68A 3INGA 5BSGA 2XNHA 2J9XB 2EKDA 3N74A 5DLEA 5D8KB 4F4IA 1M1YA 3QA9A 3L8HA 4HGYA 4FE3A 4C6HA 3K9GA 1LVKA 2YHIA 1ULSA 4DXHA 1R3DA 2QP9X 2NYXA 1NBIA 4NOLA 2XKKA 2I10A 1LV8A 721PA 4BHBA 4IP0A 3BCSA 3TR5A 1ZL2A 3O94A 1I13A 3BMCB 1VHLA 1D8TA 4OJNA 2MYTA 1PP4A 2BGJA 2OMKA 4XLCA 1COWA 4MW1A 5EG5A 4V0MA 2FG5A 3H5WA 2MR6A 5EZYF 4C3ZA 2RKBA 1AXRA 3GMIA 1RWQA 1SBTA 3RYHB 3MHPA 1QIGA 5KYXB 1GNVA 5C1OA 1S3GA 4KCGA 3IJRA 1HQDA 1QGOA 2E1MB 2ZWMA 3KEYA 2CE2X 1AUPA 3ZWYA 2ACEA 1V35A 1JG2A 4ZWNA 4BVAA 3V42A 1V7QA 3NKFA 1IO2A 3OESA 5B1DA 4LXQA 3KSMA 1JUPA 3KXDA 5LP6B 3FE2A 2E6UX 3O1JC 5SY9A 5SYNA 1JR3A 2JGIA 3KEFA 2RBEA 2ZYHA 4BQQA 1W2GA 3FSRA 3L8FA 4ZQFA 3KLOA 1U7WA 3A37A 1CUWA 1EVQA 2WJHA 3A0HC 5K4GA 2YIVX 5JZBA 2ZSDA 3NEYA 1N9GB 2Z30A 4QNMA 2W4QA 3K10A 1T6BY 1HLPA 1I2CA 1Z2EA 3HE3A 3C5EA 1QMPA 4PFOA 4XCQA 1DQYA 5EGSA 1Q11A 2WWFA 1OFUX 4UATA 2BY1A 4Z4FA 3V7FA 2FPPA 2IXAA 1HE2A 2HTFA 3K4MA 5BYAA 2O0YA 1W52X 3BWBA 3OVMA 3D0OA 2NVBA 4YGXB 3HNOA 1CDEA 3LO8A 4IIEA 4HW0A 1P19A 2FSGA 3CJRA 1XEXB 1JKQC 3E22A 3DE4X 1SXJE 2Y92A 4Q5SF 3CEAA 3IAM6 1JJIA 4LG0B 1U8FO 2ZREA 1VJ1A 2AS5F 4O2LA 4V2IA 1R71A 4MEXF 4MQFB 2M8GX 1PO7A 3CJTB 1C30A 2ECKA 2J87A 1OFVA 1G4AE 5EHIA 1WD7A 4IMJB 3UC9A 5T8KA 4PS1A 1Z6TA 3ILYA 4K9KA 1NBMD 5J2TB 5I8ZA 1F2UB 1VI5A 1QR6A 4RF5A 1G5IA 3B3FA 1YW9A 1J59A 4PFPA 3RYRA 1WNTA 2NU9B 2BN4A 3QOFA 4BUCA 2CNDA 3CX7A 1ZREA 4HXGA 3ZKWB 3HYCA 2L69A 1C9MA 1YF3A 2VVTA 1Z47A 5JWRA 4BKXA 3NWSA 4YO8A 3F74A 3NVMB 2ZCUA 1QGZA 1QIHA 1G3WA 1XLUA 4IVNA 1DHTA 2HIAA 5K05A 2NXNA 4M9ZA 3SF8B 1S72I 5GPAA 3A3KA 3LJKA 3MHTA 2I54A 5HP4A 1WEHA 2YYZA 1D09A 4PAMA 4MKZA 2K5UA 2DT7B 2VR1A 4M8NE 4ENNA 5IHXA 1NRXA 4LOLA 1NULA 1KORA 1X2BA 2FZ5A 2O7SA 3D5EA 3DLPX 1W73A 2G6TA 2N42A 4E5DA 5F3WB 3VPAA 3R7WB 3CSUA 4R98A 4V03A 2P9HA 4NE2A 4IO9F 1JKRC 1ADFA 3K4HA 1V4BA 1DJMA 5FLXZ 5AVKA 3I32A 4V2FA 5BR1A 3F71A 3BB1A 3AR7A 1IN6A 1EFUA 3V7CA 2I03A 1L5NA 1USKA 1HTBA 2EKLA 3LSPA 3JQDA 4J0QA 4TN5A 2G63A 3M70A 2JA6J 2ZE7A 3FXAA 4EKYA 4KLAA 1AKHB 3P4YA 3IT1A 3PO2J 2HOQA 3NARA 4JBWA 4NESA 4QG3A 2HNHA 2NVTJ 1G8AA 1G4HA 4G5FA 1LK0A 3PC3A 1TEVA 2QD1A 1D8AA 1KAEA 5K8UA 5D86A 3WV4A 2E7XA 2I2CA 3LCVB 5CRIA 1B14A 4KR2A 3OZAA 4DDMA 4PE5B 3I53A 2XMPA 2FBKA 4EJ6A 2JANA 1UPXA 3PQCA 1U3UA 4AKTA 4XIGS 3ABTA 3K70B 1A76A 4H18A 1U8AA 3SXUB 4ZO8A 2FDXA 3P94A 2VBGA 4JA2A 1E3LA 3PC8C 3RTRA 1M74A 1ZVKA 5DGDA 1S1MA 3I5MA 3JQ8B 1VQ8I 4GFDA 3A36A 4TRJA 1XTIA 5H16A 2V7BA 5FD6A 3B9PA 1W96A 4JXZA 2YASA 1RKVA 3M83A 5C9ZA 3VMMA 3ROFA 1MGPA 2JGMA 5C5DA 2YNMC 4EX6A 2O9JA 3LHIA 1ND5A 1SBCA 4IRXA 3TLKA 4PPQA 3BEDA 2XGGA 3TZKA 2XAJA 1F8YA 2ON6A 1ZOIA 1U9IA 3GLGA 2VDMB 2FXVA 2ZXIA 4TM7A 2X1VA 3SHFA 2ZJZA 5EXDA 3LV8A 2MH2A 4X1KA 3PL8A 2Y0BA 3DXYA 4JJAA 5U4QA 1YBMA 1P6UA 4ARBA 4BXOA 4D3ZA 5E4YA 1VI6A 4L4UA 1WU8A 5TF4A 4KWIA 3OQOA 1TWAJ 4RPLA 2NYVA 1KP2A 1ZEMA 4EEFG 3GJ8A 3EDPA 3BD8A 4MLCA 1IJKA 3RRNA 3DTVD 2IEAA 3U1TA 3CZ9A 2QVYX 3IKLA 3G5AA 4KN4X 4MQEA 4LE0A 2AOTA 1GPJA 3WDLA 2Z5GA 1CQJB 3CLRC 1IXYA 3YASA 2Y0PA 5CT5A 3ERED 3ANMA 3PUBA 5BSRA 4NG4A 2KP6A 5B7PA 1YHYA 2ZYWX 1TAQA 1IY1A 4TS3A 1JLLA 4CE6A 3IB3A 1FSHA 3UR3C 3GUYA 1W581 4JQSA 3QU7A 4XEHA 3AR5A 1GLVA 2HV9A 4N49A 1NBME 3CMEI 1Y9EA 1ZNWA 5CNKA 3H5LA 4S0HB 4WFQA 2EAUA 1IIBA 3HHGA 3T3MB 5KNCA 3NB0A 3DT6A 5KMGA 2R1UA 5AXDA 1CDOA 5F6FA 4BFSA 4P4SA 4CODB 2YXNA 1WWXA 5FKMA 4EHFA 1I0IA 1E3MA 4RIIA 1SKMA 3UAWA 4JBHA 2O2JA 3HOXJ 2VJLA 5EE1A 3WLFA 3O26A 4KQ9A 3J81Z 4A15A 1RFGE 1P0CA 5K20A 1E17A 5DN6A 1DUIA 2AR0A 5JAQA 2D5LA 4Y7DA 4ZYLA 3I9JA 1E2BA 4R7TA 1QP4A 1NNUA 1FUKA 1PK7A 3RK0A 1VKRA 2K9QA 4X1IB 2AQFA 3LUHA 4PY2A 3TIXB 5KTMA 3QKWA 5E1MA 2AHQA 4BQNA 1V4NA 4HRVA 4B32A 1S6LA 1CEEA 4IS2A 1WCMJ 3O1IC 5I4KA 3HLTA 1IF1A 2O2CA 1ENPA 2IS1A 2RV8A 1J2JA 4TT8A 1H66A 1TQ6A 2Z99A 1DUXC 3ZC3A 1CP3A 1NZFA 2TCTA 4LY9A 4AMVA 1FXWF 3USZA 1TNDA 3C7TA 5CCXA 1VCHA 2OP1A 4KAXA 1VHWA 1X15A 1E0EA 1PQ4A 4MFDA 6REQB 3I76A 1VYVA 3WISA 1PTJA 1XALA 4B0PA 1EBBA 3L8DA 2V5AA 5G4KB 5KQRA 3ZHXA 4H7FA 3WJAA 5K5QA 3GVAA 4EGCB 1T0FA 5G40A 2MT9A 4URHA 4ZT5A 1V25A 4OYLA 2C3YA 4N54A 2QRHA 2DTEA 4BWGA 3SXPA 3COZA 2VHTA 5D8LB 1Z06A 1Y37A 4GMXA 1G6NA 1YLFA 2WTMA 1C9DB 4H4EA 4FOTA 4GXTA 5IMBA 1EFVA 4TM8A 1U90A 2QSYA 3UM9A 3IAS1 3KYIB 3T5AA 4NBNA 1AS2A 3BMOB 3BJAA 4F52A 1P31A 4IYJA 3S17J 3MRXA 1XMSA 1Q6ZA 3JRFA 1E1MA 1EZ1A 3G73A 3HSSA 4R9RA 3TOSA 1UBLS 2UZ1A 1P81A 3ETGA 1K5DA 3UC5A 4CUJA 1NAHA 4DLSA 5DLYA 3QYBA 4YI3A 3ESQA 1C2YA 5D5PA 2C8LA 5DCLA 5KDDA 2QW8A 4WOJA 3LO5A 2C59A 5KHDA 3OT5A 5LOVA 4YJGB 2C5BA 2D74A 2BFAA 3IHLA 2QAGC 2BH2A 2KS6A 4D0NA 2IYQA 3FPHA 3CNEA 1F8FA 3MWKA 2QGUA 1NVKA 2I3GA 4IG9A 3AKCA 1Z15A 5K3FA 4RELA 2PSHA 1W5TA 3GLTA 4W7IA 2W2OA 4ZZ3A 3V8NA 4OWRB 4QUBA 3NR2A 2R6HA 4P5DA 2GZ2A 2P1ZA 4EUHA 1ZJJA 3ZWQA 1OCOH 2IGKA 3CCVI 3LG2A 3V9AA 5LIRA 2JFFA 1N5MA 2IXDA 4OO3A 1I6LA 2V6JA 1Z34A 3IOCA 4V38A 3W3AD 1CKEA 5FOVA 2WJWA 4LE1A 2M45A 5ELMA 5CB8A 3GA7A 1QE5A 3TM5A 1UAAA 4AAYA 2AWOA 3SZGA 3I42A 4ALJA 1O0BA 3IMFA 3OTIA 4KE8A 2UYHA 5GOZA 2ZUVA 2CC2A 3R9WA 2IDKA 5TPWB 3ZQQA 1GU1A 2IHUA 4LOHA 4YJ3B 2P2ZA 4Z6KA 2UXDB 2FZWA 3BGVA 2M4GA 3TM4A 2JLCA 4MV7A 4H1UA 1ZH5A 2GPJA 3GY0A 1BW9B 2ZSUA 1XZQA 2FWIA 2GN6A 2CMDA 1QQIA 1XAJA 5A2QK 5AKIA 3OCCA 5A9SA 3IS3A 3FR8A 3H9QA 3RSHA 4JYKA 1H3NA 2LVSA 1K6XA 1A27A 1Z36A 3RQIA 4KH0A 3W6NA 2DDBA 3KR1A 1LQUA 5DSZA 3O8HA 4KUMA 4HH1A 3QEMA 2GNAA 2FOKA 2HPVA 5B2EA 3SEZA 3S3NA 2AGVA 4XOTA 4RDIA 3QX7A 1Z9BA 4GI2A 3ZCVA 1UMDB 2G5GX 5BWOA 1R0BA 1TM4E 1GP2A 3OYIA 3LE8A 4EB6B 2OBYA 2NZJA 3TQOA 1IBKB 1N9ZA 3KXKA 3B1ZA 4KMFA 1N0UA 1PQYA 2UXBB 2HLNA 4U0JA 4MI9A 2IPXA 1SVOA 1GU0A 2M1ZA 1FW6A 3B8EA 2ATIA 2BW0A 2HOTA 1K8XB 3I55I 1XTKA 2XZPA 3WBKA 3VHRA 3UW3A 1II8B 1VNDA 4CCAA 2XJ4A 3W04A 2HK7A 1QHXA 4TV8F 2VK1A 2KRCA 1JA9A 5A03A 2B6NA 2AI2A 2Y0CA 4MTEA 1NW6A 2PVPA 3TW8A 3DDSA 3GMSA 2R2GA 1CIJA 4DMKA 1XZ8A 4L08A 1LRLA 4UB8C 3KZMA 1I4WA 2Z2JA 2VAXA 3FXMA 1QH8B 2VBZA 3LWZA 4FYXA 2V6BA 4DCMA 3AF2A 1W46A 2O8CB 3G5UA 2PFKA 3R5FA 3R61A 2JUCA 4QE3A 3I56I 5A6SA 1V5GA 1W8IA 2X85A 3T3HA 3LYLA 1EHIA 2APJA 4QFDA 3KLMX 3KZCA 4ALLA 3HVIA 1HE3A 3BBLA 2G0TA 4FOLA 3EVZA 3WU1B 2NMVA 4GU5A 2QN3A 3IWZA 3KXIA 1EPUA 4ZVQA 3ESYA 1PLKA 1WXWA 4R5HA 1NJ1A 1R10A 2MLKA 1YZYA 4BZXA 1YS4A 4BKMA 3ZXXA 5JYCA 2YVAA 4BLVA 3EWAA 2VZ9A 4ND5A 4H4DA 1BYUA 3A1DA 1WLSA 4MVJD 2L0KA 4O4IB 3E61A 3I58A 2CVZA 2I8AA 1GXQA 2NU7B 4TZTA 1QH1B 4R68A 2JJQA 2WPNA 2L7MP 1UODA 2W70A 5LR6A 1QAMA 4LAFA 1Y1WJ 1UBFA 3LZDA 3KLBA 3O8LA 4YV7A 3H1GA 3MQ4A 1RCUA 3E9EA 2YRXA 4U2FA 5AVVA 4BS9A 1GPBA 1DU6A 2VJIA 5IAEA 2P2SA 3V4SA 4QBKA 1WUIS 3L0ZA 3IUBA 4WFKA 5GAJA 1JG6A 2ZMEB 3U4QB 2A5JA 1CQIB 1KDPA 2VSNA 1J56A 2D62A 2RG7A 1P7PA 5J4VA 5IKOA 4UHJA 4EGJA 3VH4A 1D1AA 2I9KA 1LTQA 4B4UA 3EIUA 2DTRA 5EKSA 1TW3A 4GPAA 1G4UR 3MEXA 4M8SA 1RI1A 3NBMA 1EB8A 3U3DA 4KO4S 3QWLA 3DMNA 2IGNA 1R6DA 4RHEA 5EMLA 2EGGA 3E1GA 2C9OA 5DNVA 4TQ9A 1XCBA 5D5QA 5JRJA 3DE0X 2FZ4A 3GFTA 3AHHA 4BOYA 1H2FA 3LRTA 3LXRA 1M1NB 4EFNA 5HPYB 1TXGA 4GKJB 1MO5A 2J5BA 1MDMB 1SU8A 3UGJA 4LV6A 2ZUBA 2MTBA 1HG1A 5BN1A 3KLNA 2JVIA 3PBKA 4RM3A 3IRUA 1EDZA 2G8NA 2P7VB 4A03A 5I9IA 3IQGX 4LQLA 1EM8A 4UAJA 4YP5A 5TS3A 1HKQA 4HDKA 2KI5A 2P2LA 2CLFB 1Z8DA 4U6SA 3VGJA 2DKFA 3DPSA 1YO6A 4UUSB 1AQIA 3WLMA 4PNHA 1EKEA 4ZDLA 4RU1A 4Z99A 4P54A 1URPA 3AGPA 5C8DA 4I2VA 1YDWA 5CH3A 2O1XA 4PGHA 1ULUA 4W5RA 2DULA 1E79D 3HIFA 4GOLD 3VA7A 5ALVA 1H88C 2NT4A 2LCQA 4ZT3A 3V1LA 1I39A 2ZT5A 3DBRB 2J3MA 1KQ8A 1QVAA 2GN8A 2DERA 1JUSA 2VRCA 5AHWA 1WB9A 3ZDYB 1M1ZA 1FTNA 3LECA 1Z39A 3PC8A 4H6XA 2D5VA 1P44A 1VCMA 3JXEA 2BE7A 2BGIA 4H7EA 3K32A 3SIRA 4ZRDA 1I0ZA 4P9UA 1IIRA 5FJJA 4GE0A 1T3GA 2P1DA 4XORA 1GZUA 2D4HA 3AJAA 1YNOA 3VPBA 3AEZA 4JBXA 1X7YA 3N87A 3THOA 4IIJA 2YNMA 3AEXA 2UYGA 2R6FA 1N5IA 4RZ2A 4YUAA 3M6LA 5EPEA 4ZXFA 1HFKA 1B6AA 1I1QB 2D0IA 4QPOA 1DT5A 4UNIA 5ERXA 1CVRA 5G53C 1PP7U 3O8DA 2MINA 2EG5A 3OQHA 4GPIB 1W6UA 5ICCA 2IYUA 4KDFA 1N6PA 1SCIA 4HNSA 3KQOA 4D9FA 2A57A 2YFHA 2CV0A 4C0JA 1YS7A 3CUQC 3RUCA 3G7UA 4QTTB 2I6XA 3KZZA 1KFCB 3WB0A 4ZMSA 1U0TA 2P0AA 1TA9A 3IDZA 1ZH8A 5F0CA 1GTG1 3QPSA 3PC7A 1VG9B 2LUOA 2P9EA 3WNVA 1B6GA 1K7SN 2HU2A 1WMDA 2LH9A 1VJTA 2I4LA 1AA9A 4UMFA 1ILEA 5BPDA 3AG3H 2QI9F 2GM3A 2H2HA 1NBAA 3BRSA 5K5OA 2O0HA 5BWCA 3TNLA 3I6BA 3OTOB 3NUGA 3UWMA 5JATA 2PRIA 1HO3A 5J2UF 2QIPA 2PRYA 2OTJI 3MS2A 2E1RA 3BFKA