3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transcription
molecule keywords Response regulator protein
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
1A6IA 3GBGA 4OTZA 5JNUA 2FQXA 4B4CA 5E3JA 4S04A 2WB4A 4RK4A 4ETNA 4M3BA 1TWAJ 2HOSA 4Z4FA 1JYFA 2W48A 2R0QC 3W9SA 1IG7A 1NXSA 3GBVA 5KC9A 3HVRA 3MVPA 1IIBA 1NXVA 3BG5A 5CNJA 5TPWB 4C3IJ 1E6LA 4P1ZA 3Q0WA 2NS8A 1XHEA 1UMQA 3KYIB 2TMYA 5IOZA 1ETKA 5B3JA 4JOQA 5JLXA 3BR3A 4WT7A 4EYQA 2Y0SN 5C5CA 3LSRA 1JKPC 2ZWMA 4JYKA 4D5CA 3C3MA 1MIHA 4JAVC 1AKHB 4DYRA 2JA6J 2OF7A 2WJWA 1H88C 1SXHA 4MQEA 1WGXA 1POGA 2FXIA 1TWGJ 2IDMA 4F11A 1NXOA 5C4JJ 1A2OA 3ILHA 1GV2A 3RVQA 4KQ9A 1MH3A 3Q7TA 2FVYA 4M3GA 1T34A 4PYRA 3M4OJ 3B2NA 1LFUP 3QELA 1PNTA 4F12A 2ZB9A 1GCAA 2L7FP 5FWYA 4WUTA 4IMIB 5FLVA 5HM6A 3QLVA 5TQ0B 3LKBA 5IBQA 3OSFA 3JRAA 4QTRA 1JT6A 4RKQA 2RGYA 2O20A 3N53A 1MSFC 2COBA 1ZQ3P 1ZHHA 2HXIA 2K9NA 2E2IJ 3BTJA 4D5FA 4XICA 4M3EA 1D5WA 3FIWA 2GWRA 2FEKA 1IUFA 2QVGA 1Z15A 2JA7J 1BW5A 2PE5A 3H5TA 1CEYA 1NTRA 1APLC 4MR7B 2XSDC 2CHFA 3QLUA 5B3JC 1QP0A 3BT9A 3JPWA 1IDYA 3RVPA 2ECCA 3I4NJ 5IUKC 3CCYA 3FFTA 1RXEA 3T8YA 1XG1A 1K61A 1GLGA 4O1IA 3QLTA 3EDCA 1XC5A 3C97A 3IPCA 4QIWN 3HOWJ 1ISSA 2GX6A 3R0JA 4MLCA 3JRFA 2HSGA 4YO7A 1QP7A 1Z18A 1ISRA 1B72A 1I6HJ 4S05A 5IEJA 1GVDA 3ZQCA 3TW6A 2HYJA 3C3WA 4WXEA 2QF7A 1RNLA 2FQWA 5GPCA 1J56A 5E3LA 2CQQA 1RKWA 1JF8A 2A9RA 2GBPA 1T33A 1D2AA 2IBDA 1LE8B 2R93J 1ZR4A 4A3CJ 2JJ7A 1JKOC 3BR1A 3OMWA 1JJ8C 2PUBA 2PLNA 3A01A 4ZMRA 1JTYA 1RETA 1MBGA 3SM9A 3O75A 3BTCA 3E61A 4Q6BA 4M88A 2JBAB 1JUMA 2HJ9A 3ZQFA 5J1YA 3S1RJ 2PUEA 1P6QA 4F3TA 4N03A 4RK5A 4A3MJ 1D5YA 1GDTA 3RVJA 4EVQA 6ABPA 3UKGA 3HOUJ 4L85A 1MAVA 2LIVA 1P7JA 5EZGA 4EVRA 1DRKA 1D4ZA 3S2HJ 2XPUA 1RESA 4HNVA 3LUHA 3JPYA 5JNSA 1QQAA 3A03A 4B1RA 3Q41A 2FN9A 3S1QJ 2LUOA 4ZJPA 4LE2A 1Z0XA 3TW7A 4A3FJ 3QPLA 3CG4A 2L19A 4MS3A 4UUSA 5FKLA 2FX0A 4IF4A 3Q7SA 1LFBA 1WH5A 4EEFG 1IRZA 4JX5A 3K9CA 3S1NJ 3HXMA 3KSMA 1IJWC 2TRTA 4XFKA 2IPMA 3CHYA 4MR8B 2IKSA 2X48A 1TWCJ 4EUKA 2R7ZJ 4JB0A 3G1MA 3OQOA 2CU7A 3N0XA 2ME6A 5EYRA 4LRQA 1NXWA 3HOVJ 2L7ZA 1PEAA 4L5EA 4UUTA 2GBYA 4S0HB 3KJXA 3ROFA 1Y1WJ 2TCTA 1IC8A 1YK0A 3L49A 2NT4A 3GTOJ 1C0EA 1ZN2A 4MR9B 1BDIA 3LUKA 1OCTC 2B1JA 4C3JJ 4XRSG 2QVCA 2MGQA 4MRMA 1HOMA 3OQNA 1EF4A 3NARA 4MRMB 2P9HA 3A10A 1DU0A 1TMYA 5F08A 3F6CA 3OSGA 3CKMA 1FJLA 1ZR2A 1HLVA 2E4ZA 5IP9J 3CG0A 2X7XA 4ZPJA 3WHCA 4MR8A 3LUAA 2LK2A 3PO3J 1MVOA 1QQBA 1S7EA 4RK0A 3NHZA 4B09A 1MB0A 4KK4A 1X2MA 4Z4HA 2DN0A 5BRJA 1BL0A 3N0WA 3OM1A 3QEMB 3FK6A 2EZLA 5KC8A 5EZHA 4IILA 1SXGA 2LBPA 3HDGA 1Z13A 4MR9A 2MW8A 3KTOA 4Z99A 1PEYA 1PHRA 1H89C 2K9QA 4E7PA 3RQIA 1M5UA 1F43A 1BA5A 1TLFA 1P6UA 3IH4A 1EAYA 1JDPA 2X9DA 3F6PA 1QNLA 4HNSA 5EEAA 5IYCJ 3C6QA 4RXMA 3VNAA 4Z4EA 3T6KA 3H1FA 2WY2D 2MYUA 4DYCA 2LLKA 1MBFA 3GT7A 4MS1B 5KWSA 4ABZA 3H6GA 1ETVA 3IV5A 3MM4A 1APBA 3ZQHA 1ENHA 4DZPA 3S1MJ 3H5IA 3KCNA 2JCGA 2HQ5A 2X6OA 4JP0A 4KQCA 5E3OA 2N9UA 4G0YA 2XGDA 3ZQIA 3LSPA 1VPWA 5F0FA 3ILYA 1R8JA 3TO5A 3H3VK 2MYPA 4A3DJ 2E4UA 2WV1A 1W25A 4RK6A 3FISA 1JFVA 2JVJA 2RJNA 1WH7A 4G86A 1OCPA 2M9HA 2NUBA 4OATA 4W5OA 1O4XA 2LY9A 3L6UA 1VKRA 4HYEA 1ZK8A 4DW6A 4NQRA 3Q9SA 3MA0A 2VKEA 2FMHA 1A0OA 2Y2ZA 1SXIA 2JK1A 1JT0A 4IEJA 2FJ1A 2O9LA 3S16J 2RAEA 3EGCA 1A04A 4MS4A 1SRRA 5T3YA 5TPWA 1C4WA 4N0PA 5DKFA 3OO0A 2H8RA 3GL9A 4DYQA 5JLWA 4IHXA 3EQZA 3T38A 1KGSA 1VF9A 2FLWA 4TMYA 2AYXA 3SAJA 3RVMA 1ETOA 5FWYB 1RZRD 1QP4A 1LJUA 4RK7A 5M5XJ 5TQ2A 4N76A 4A3GJ 2GI4A 2ID7A 1FTTA 5CNKA 3HEBA 4YGXB 2R5ZB 1DJMA 1WETA 4XIDA 5JS2A 4D6XA 1WPKA 1GCGA 3TX6A 3ZQLA 2NVYJ 2W42A 1JKQC 2PKXA 1TJYA 5IULC 2PUCA 2EQRA 5F04A 3Q3SA 3SY8A 4YS6A 3HV2A 3O8HA 5CNMA 2L2QA 1QRYA 5HQJA 1W0TA 4AUXA 3HSYA 1Z2EA 4QPJC 2DA5A 3LSJA 4CYCB 1JH9A 3L1PA 4V2FA 5E3MA 3JRHA 2F8SA 3S15J 1DCKA 4A3EJ 3CDLA 1B8IA 3FKIJ 1MBKA 3D02A 5M3MJ 3DZDA 3QLVC 1KRXA 1DCMA 3SG0A 4M6VA 2DTZA 3IH2A 1ZH2A 1VNDA 4KNYA 1U9OA 3BBLA 1OXKB 1MSEC 1HDPA 3OLZA 3B6CA 4DZJA 4KMRA 2DA7A 1ETXA 2HOAA 3O2QB 3IP6A 3OM0A 1LBHA 1ZH4A 3IP9A 2DA3A 3A02A 1GUDA 5JNWA 4BBRJ 2CD7A 2DMUA 3I45A 5DTDA 3O1IC 1X58A 3F7NA 1NTCA 1ZTRA 3LNQA 1NXXA 2LKXA 4EY3A 5TPZD 3BR6A 4W5RA 3H1GA 2GM4A 3BREA 2FLKA 1U2PA 1U8BA 2VK2A 3DGFC 2PMZN 3CS3A 3EAFA 3IH3A 3Q15C 4FB4A 4KV7A 4O5AA 2LVSA 2HQOA 4IGAA 4ML3A 2ID9A 3H6HA 3LUDA 1VI0A 2OQRA 1Z25A 4C3HJ 2NZVG 4D7MA 1VRVA 5ED4A 3QK7A 1JLKA 3I5AA 5IUJC 2LPMA 1U2QA 4M3DA 5F0HA 4N47A 2R5YA 2XGCA 4RZSA 2A9PA 3IP5A 2N8GA 1CYEA 2E2HJ 4MIMA 3S99A 3G1WA 2LP0A 1OJLA 2KYRA 3FGZA 3KYJB 5J3LA 4MFDA 1YTUA 3O1HB 3O1JC 3K4HA 2FSPA 3KG2A 2ME0A 5IP7J 2IPAB 4RU1A 2HI3A 2PL9A 1AHDP 2Y9YA 3N6VA 3FK7A 9ANTA 4RS3A 3D1NI 3LFTA 4RXUA 4WZZA 3LUFA 3ZQGA 1QO0A 1IDZA 3KKEA 5EGOA 1AKHA 5F1JA 1ETWA 3GYBA 3S14J 2FQ4A 4IHVA 5EG0A 1JTXA 4D6YA 1FSPA 3MF4A 2WAQN 2B4AA 3P9YA 2D5VA 4JP1A 4UHJA 2A9OA 1JWLA 2M8GX 5DS9A 5BQ3A 1M2EA 4JX6A 1JX6A 3HDDA 1EFAA 3NNNA 1GT0C 1ZAYA 1AB5A 2WRZA 4XRSA 1B72B 1DU6A 2QXYA 4RWEA 2DA6A 3NBMA 5FWXB 1WI3A 2R25B 4OG2A 1Z26A 4PE5B 4A69C 4MFEA 3C3KA 1B8IB 1AB6A 3S17J 1K68A 5K7HA 5M5YJ 3BQZA 4QYMA 4EYOA 3LUJA 4G0QA 1PUFA 3EODA 3LMKA 1P7IA 3KHTA 5TQ0A 2R4QA 3H1EA 2CJJA 1P2FA 4FTHA 2XB5A 2PMCA 4A3BJ 4MAAA 3I42A 5FBKA 1QVTA 1JKRC 4WWHA 1UG2A 1EHCA 1ETYA 3IDOA 5FKMA 3JRBA 4G12A 2ELKA 3S2DJ 1EWKA 2M34A 2VYCA 4P98A 4DN6A 1L5YA 1F4VA 1FIAA 3KLOA 3HBLA 2E19A 2DMTA 2NZUG 5KI6A 1CQTA 5IYBJ 5IC5A 1I50J 1BAPA 5EWJB 2R47A 2A9QA 5C5EA 2NOGA 4KVFA 4Y52J 4QICA 3BR0A 2P4UA 4Y7NJ 1NK3P 3CRNA 2L9RA 1U9NA 4RKRA 2OPTA 2LD5A 5IYDJ 5IP6A 3RVNA 5BNGA 2E1OA 1OXBB 1AU7A 4Z4CA 4IHYA 5FJ8J 1XWWA 2JBAA 3G1OA 1YK1A 3MQ4A 4L4UA 4FE7A 2JMWA 3O8GA 4HNQA 3GTQJ 2CRGA 5D2CA 3HOZJ 5M5WJ 3HDVA 3RZDJ 2PAFA 1HDDC 5DGCA 3OIOA 1YMUA 4KREA 4XLTA 2MSYA 1JL3A 2IEKA 3BR2A 1DCFA 1KRWA 1IV6A 1A5JA 1FIPA 4A3KJ 2FMFA 4PZ0A 2R48A 2E2JJ 3TD9A 1MBHA 1YVUA 5FKOA 2IAIA 3GTGJ 2GKGA 4BY1J 4AC0A 3GRCA 3LOCA 3SFIA 3RH0A 3O2SB 2DA2A 2ZAYA 2M0CA 4GNRA 2H0AA 7ABPA 2PL1A 1FQWA 4PEVA 3UUGA 3EJWA 2J48A 3BTLA 2KT0A 3LTEA 4I6ZA 1HF0A 2K9SA 1LE8A 1CHNA 4OLBA 1TWFJ 5I4CA 2R5ZA 4LE0A 4H3KB 4X1EA 3GTJJ 3I09A 1P8AA 2NVTJ 5F27A 1DBPA 1E2BA 3JRGA 4BY7J 1I3CA 3CZCA 2JRLA 3HUTA 2Y9ZA 3KLNA 2HQRA 3UK0A 3QX8A 1MB3A 4F06A 4PICA 3A3KA 4NV3A 4HNRA 4G0ZA 3ZOBA 1HEYA 4G0XA 5F64A 2CHEA 5IX8A 3BG3A 4EVSA 3DBIA 1RKTA 1U04A 3Q0VA 3DCFA 3N75A 3LSGA 1DP4A 3CZ5A 3BQYA 2VPRA 4E7OA 1Z17A 1UDRA 1D1QA 1USKA 1JFSA 4AYBN 4YCSA 3MYYA 3RZOJ 3BILA 3DGEC 1R9TJ 2KDZA 1W0UA 5EGOB 3SJMA 3JRCA 1JGGA 2FMKA 3JR9A 4G0MA 4Z4IA 4A93J 4MQFB 2GLOA 3OLYA 4QSHA 4UHKA 2JVIA 5HSGA 3DLBA 4MQFA 1T56A 1ZKGA 3GTLJ 2FMIA 2RJOA 3RVLA 5KQLA 1JBEA 3QEKA 1NK2P 1VLZA 4TLMB 4W1UA 3B6AA 3EULA 4W5QA 2WB1N 3MMNA 3G1LA 3ROTA 2DJNA 4RSMA 1U78A 1B00A 1K66A 1U8TA 1W9HA 4D74A 3Q0UA 2AYZA 5PNTA 2QR3A 1RPWA 3NHMA 2QSJA 4W5NA 1JFTA 4A3LJ 5IEBA 3TMYA 1EWVA 6CHYA 5FKNA 1RXIA 2VUMJ 1FFSA 2L0KA 2HDDA 1URPA 3I4MJ 5J1RA 4H3HB 2FW0A 1UHSA 3TP0A 3RKQA 1YMVA 3OOUA 1NATA 5JNVA 2IPLA 4EYKA 3HM9A 1IGNA 4MLDA 1XS9A 3LKVA 3HCWA 3CMYA 2JN6A 4CYCA 1S8NA 4G0OA 1JUSA 2L18A 3RVRA 2QCOA 2AO9A 1E3OC 2XPWA 4G0PA 3N0RA 2K40A 3JY6A 2E4XA 2DMPA 3TB6A 5KQMA 3M9WA 3IPAA 3GTKJ 4MS1A 2NVQJ 1ZITA 2MYNA 4XASA 4J19A 4JA2A 1ABFA 2M2EA 2YHAA 1I3QJ 5K7FA 2G0EA 4Z9AA 4G97A 1BDJA 2CUEA 4EGSA 3MN2A 4NCBA 3HOYJ 1USIA 4D7NA 3CTPA 1QKKA 3SDGA 2FEPA 2JA5J 3HO1A 4JASB 2PJUA 3GTMJ 4CBVA 3CFYA 3NNDA 4X6AJ 2MG4A 1GUUA 2DA1A 3PO2J 2V0NA 1K83J 3QQAA 2Y30A 2HPHA 1X2NA 3FFWA 3BRSA 4MYRA 4JB2A 3VNBA 1GV5A 4MS4B 3CQZJ 4MS3B 1BJZA 2O8KA 4O1HA 3KS9A 3C2BA 2ID3A 2YS9A 2JWTA 4RY8A 1JJ6C 5EF6A 4I76A 1Z2DA 5GP9A 2HQBA 3JVDA 4WXMA 5T7BA 4A3JJ 4F8JA 2RDMA 3HK2A 4EYGA 4RV5A 5IOYA 1FEXA 1MBJA 4Z0NA 2MSKA 5FWXA 2YHBA 5C44J 3BR5A 1ETQA 5M3FJ 3OO1A 2IOYA 1MBEA 4YP9A 2LR8A 2PUFA 2PUGA 3JS5A 1YS7A 3SQNA 1RZRA 3MKLA 1QPZA 1NY5A 5FKKA 1DC8A 3HGYA 4XAQA 3H5WA 1WCMJ 5KQGA 3QLUC 3JRDA 1Z77A 2EZKA 2FD5A 5TQ2B 3OQMA 3OLWA 1JDNA 2FKAA 1JHZA 8ABPA 1ORKA 3QPSA 3CU5A 4GFBA 3OMXA 4Z4GA 2YU9J 1D1PA 1MNMC 3H5OA 5KQPA 4BXXJ 4XXHA 2FTKE 5EWJA 3OLXA 5DCLA 1JUPA 2MSLA 3OLVA 4KZKA 5DLEA 2R92J 1E6MA 3NNSA 1DC7A 4KRFA 3H5LA 1KMIY 5EDNA 4ETMA 3W6VA 2NT3A 4DADA 1SANA 1OFCX 3A01B 4DQDA 5C3EJ 3CLKA 4ZYLA 5CNIA 4KFCA 3M6MD 1BA2A 2CUFA 2VUIB 2CQXA 3QELB 1RR7A 4C2MJ 2ECBA 2NVXJ 4LOCA 2R5YB 5EWLB 5K7ZA 1M5TA 4BBSJ 1SFOJ 3JREA 4LX8A 3PM1A 1RPJA 3URMA 2XDYA 1YIOA 5BRAA 4W97A 3Q7RA 2XB0X 4TN5A 1SD5A 5JNTA 4RY0A 2QV0A 3JVIA 2AHQA 4IMJB 4KPYA 2O7OA 3QEMA 5TE9A 2WJAA 3G85A 4RK1A 4LE1A 1LJLA 1ZY2A 1YRNA 3FMVA 3TEDA 3FDFA 3BG9A 4A3IJ 5HKOA 5DTEA 3HKZN 3HB9A 1TM2A 1DBWA 1F51E 4YWHA 4QYWA 1PUFB 2EZIA 1NXPA 2JA8J 2DMNA 4Q6WA 3NAUA 4FISA 2H1KA 1U0SY 4MR7A 2QU7A 3GBPA 1ZESA 1F36A 3E7LA 2Y31A 2VKVA 3E3MA 5GPAA 3F73A 2L17A 3WHBA 1QPIA 5JNRA 2DA4A 3MIZA 1ZGWA 5FBHA 4OLAA 5CHYA 2Q5CA 2IPNA 1NXTA 1EWTA 1FTZA 3HGGA 1Z16A 5JS1A 2XPVA 1Y1LA 4LZLA 2WWVD 5EWLA 3D8UA 3HM5A 4FE4A 2DMQA 4MO7A 4Q7EA 1FFGA 5ABPA 3M3YJ 5EWMA 1DBQA 3BRQA 2EBIA 2E4WA 4MPTA 1YRNB 2B63J 3JRIA 4TLLB 4FCYA 1FFWA 2BGGA 1ZGZA 2P81A 3CNBA 3QX9A 3RVSA 3O21A 1TVMA 2LTPA 2CWDA 4MGEA 3O74A 2PUDA 2I10A 2QZJA 1USGA 4MLOA 3RVOA 4RBOA 3LUCA 5EG0B 1LBIA 1BVHA 1DZ3A 1ZVVA 1JYEA 1TWHJ 1Y1VJ 5IUNC 2QW1A 3HOXJ 3H75A 3JTEA 1QO0D 2M1ZA 3EQ2A 1MH4A 2EH3A 5IPAA 3GV0A 2XRLA 4GPAA 4OBBA 4NICA 4KK3A 4XRMA 1E6KA 4YRZA 2ID6A 1Z12A 4H60A 4UUSB 3FFXA 2HOTA 5C4XJ 3HZHA 2FEWB 3GWGA 1HCRA 3HJFA 3H0GJ 4YV7A 1PNRA 1PUXA 1Q1VA 1ITYA 3K2AA 4XARA 2M98A 3GTPJ 3DEWA 4W5TA 4V2GA 1GUBA 5GOTA 4M3FA 2YUSA 4LDZA 2FQYA 4YR7A 5HODA 2JVKA 1G2HA 1XHFA 2EZHA 3LUGA 5F0CA 2MSWA 2WMYA 3HS3A 4BKXA 3UKJA 3SNKA 3O2JA 3T95A 4JX4A 1VFCA 2MYTA 4Z9BA 2F8TA 4B3AA 1ZDMA 3HUUA 4MQEB 1H9CA 1DRJA 4NCAA 4RY9A 3A0UA 3N8IA 3HEFA 2LP4Y 1BDHA 2PUAA 5FLMJ 2VUHB 1ZGGA 2IYNA 2L7MP 1L5ZA 2H3HA 1YS6A 3LOPA 3TP3A 4ZMSA 9ABPA 5BR1A 1DG9A 1LK0A 2NS7A 4N0QA 5E3NA 1M2FA 2FN8A 4NDLA 1ABEA 4YLEA 4IHWA 2LFBA 4RXTA 5TPZA 5GQSA 4LDAA 3VPRA 5J1UA 3K7AJ 2JK3A 2DRIA 4N41A 3RVKA 5TQJA 4ETIA 3DLHA 2JB9A 3A0RB 3H5VA 2HXOA 4XK4A 4IRXA 2I6FA 2E4VA 3M9XA 3IP7A 2VI6A 3F0CA 1QVUA 2OENG 2XGEA 1BW6A 3GA5A 3BTIA 2E4YA 1H8AC 1TC3C 1QMPA 5EWMB 4Y9TA 4RDCA 4RDUA
chains in the Genus database with same CATH superfamily
1TVKA 1TJPB 1BQ4A 4ISBA 4EZBA 2GD1O 5EKUA 4BJ1A 4JI1B 1II0A 3EASA 4F7ZA 1F2TB 3M49A 4FMDB 1HQCA 1SC3A 1SQGA 3NWSA 3GARA 4FQ8A 4IJQA 1TL7C 2BGJA 3R20A 5ENZA 3PVSA 1PJTA 5GONA 4S04A 1TJNA 1GKYA 2B2NA 1Z4IA 4MI6A 4YXWA 3A1EA 4KU4A 2V9PA 1Y9ZA 4MV7A 3PT5A 1ECLA 1AKYA 1N3LA 1TWAJ 1T1SA 1Q74A 1AGYA 2A4MA 4WK8F 4HVLA 1N3BA 3AEXA 5J58A 4UHCA 1D0ZA 1S5LC 1XRSB 1WRBA 4TYPA 4Q9JA 1N9GA 1NX6A 3PQDA 3BL6A 4ER5A 4YRNA 5L3QA 4TN5A 1UDBA 2FY8A 3LWZA 3M34A 3S2EA 121PA 3IUMA 3ZV4A 4RIGA 3IDFA 3FOZA 1QPGA 2DB3A 2HNHA 2H59A 5FF9A 3ZDFA 5AW7A 5LNK6 3MMSA 4ZEVA 3OU7A 2ECKA 1E5LA 1HW2A 3DUFA 2FUG6 3U1DA 4HR7A 1O6ZA 2ID8A 4ZVKA 2BSQA 3MVPA 3WGIA 2O2HA 4ZQGA 3RB8A 3I6ZA 4CN8A 3X2FA 5MN6A 2AHOA 3WKDA 5C7IO 1IIBA 3M81A 1NXVA 1T4MA 2KHZA 4CCMA 4W99A 4Y2HA 2P4SA 2PGXA 2OQGA 4Q02A 4PJNA 4F4UA 1FDWA 2M1XA 2W4SA 3AK4A 4TL6A 4W7IA 4TWAA 5IP5A 3W8EA 1OLTA 2E5LB 2G9WA 4P1ZA 1MT3A 1YRLA 5CA0B 3AFHA 1ZS9A 1U5AA 2EJBA 2JW5A 2V59A 3VYWA 3K5PA 3AB3A 3SC4A 5IOZA 3CZMA 1N2XA 3FR7A 5B3JA 1WE2A 1A9PA 1MD9A 1QRRA 2B36A 3DJFA 3D6HA 2VZ8A 3PQ3A 2IXBA 2F6RA 4JOQA 1KONA 2KP6A 5JLXA 3OF3A 1DC5A 4JD5A 3EW7A 3WGVA 3TUZC 1FMCA 2HM7A 1RD4A 3PQ4A 4BXFA 1E1DA 3PNPA 5LRSA 1DUXC 3E81A 1R1VA 3SLGA 3U31A 2ZWMA 3P2EA 1O9BA 4IUCS 4JYKA 1DAHA 3F9KA 3CUVA 4GVLA 1GDDA 1WKCA 3OL4A 2W6PA 2IV3A 1EP9A 4DNQA 3CUQA 1B1AA 4JC5A 4KE9A 4JAVC 4KXFB 2QN6A 1OI3A 1PK7A 2LCIA 3BB4A 1B41A 5FCDA 4Y2YA 5ALTA 2HDCA 2JA6J 3UH0A 1R00A 3OX3A 1S2IA 2WTMA 4NPCA 5BYJA 2CF6A 1H88C 3F46A 3N2YA 4IZ6A 2QAIA 1KEEB 1QGUA 2AXPA 2JGIA 3Q12A 2ES4A 5JDIC 1MMNA 3K0BA 1UHWA 1Z22A 3MWLA 4K86A 3VH3A 4JLBA 2PUHA 4DWWA 1ZM9A 3B2QA 1LLFA 1NXOA 4LWQA 3FIUA 1RI4A 1RS0A 4S1PA 1X1TA 4II2A 4LRYA 5IC6A 3EC2A 3SXJA 1QF7A 3TAXA 4JOCA 3WDSA 5C4JJ 3B73A 1PL8A 1IVYA 2FQ1A 3L79A 4XLCA 2ECOA 3ZN2A 2QSGX 4IX7A 4BO6A 2QAGB 4FFLA 3MUOA 1TQMA 2F4IA 3I34X 1JG3A 4ON0A 4ZD6A 3U1BA 2MA3A 3RIRA 4NE7A 1Y6GA 2E1MB 4MW0A 4NOKA 3D4NA 1Z75A 1ZI6A 3G1UA 2C84A 2PM8A 2GRJA 2H2GA 3GT3A 4PX3A 2AOTB 3Q7TA 3RPEA 2PO5A 5A5EA 1GM5A 2WP0A 2KKOA 4I5GA 1CT9A 1F60A 3EN0A 3N76A 4OHZA 4M55A 5L7YA 4YIKA 5JZMA 4DBLC 1Y5NA 1ZK0A 5E4FA 4PYRA 3M4OJ 1XSEA 2JLCA 5LU8A 2ZSBA 2B7LA 4U2GA 1LFUP 3QELA 4V0LA 4BX3A 4NB5A 2JFWA 3ZQJA 1Z37A 2JJ2A 1WL8A 5BR7A 4EG1A 4BEBA 1SFEA 3O9MA 3FXMA 2GKSA 2O8DB 3K6RA 4I8IA 4LXIA 5HF5A 3VH2A 3IEMA 2R97A 2Y4OA 3K2ZA 1F2DA 4C4YA 1SU8A 2K7ZA 3PQ6A 4RZ2A 5FLVA 1V11B 4NQWB 5HM6A 2FPUA 5KO2A 1NF2A 2J5XA 2XYRA 2XYGA 3H97A 1SCDA 3S7ZA 3HDGA 1DARA 4EG6A 2R6CA 5GAJA 1CUCA 2HL6A 1W47A 2NSYA 1YI2I 2WT8A 4HLYA 1JT6A 4RKQA 4JVMA 4IY1A 5JVTA 3K30A 3RT9A 1DHRA 1I3OA 4P83A 4JXXA 1BSVA 2B94A 2NZXA 4EY6A 4DMRA 5K03A 2I4MA 2RGYA 4M6WB 4LYAA 3AHDA 4CNQA 1EUQA 3KE2A 2P6RA 2EV6A 1SBCA 3JATA 2P2DA 2VTBB 1D4OA 4IFIA 1DWOA 4KAJA 5JO0A 2EARA 2R44A 2M6KA 2COBA 2NO0A 1V55H 3LT0A 3WODF 2P5VA 1RWQA 4JBLA 4L75A 2GEDA 3N2LA 1ZREA 3SBDA 3WGJA 1BOOA 1PJBA 3CRMA 1MDBA 2JLVA 3LTNC 1Z6GA 1NLYA 4R3UC 4CL3A 4O33A 3DEIA 4EB0A 1NTOA 2R7VA 1T8WA 1GXSB 1SVKA 3VHXB 4BL5A 1MEJA 2X40A 3MBOA 4I19A 1B8PA 2JS7A 2ZVDA 3LBFA 3GLFE 4M3EA 2PGJA 5AVXA 3FMRA 3R4KA 4KLCA 1NBEA 1D5WA 1B6AA 1QZUA 4B3XA 2A30A 3ORSA 4DMHA 5JVGF 2X6TA 1C9YA 1JBKA 1E89A 1QGED 4YRIA 3T9EA 4OMYA 2FEKA 1IJBA 4JLAA 5HW0A 2QQEA 4LW8A 2VH1A 5JQGA 5JTUA 2JA7J 3PEWA 4YMHA 3NDRA 3L2RA 4Q3AA 4OO3A 3TCXB 3H5TA 4MW2A 1CEYA 3TECE 5CEFA 1QIFA 2EX4A 3PDCA 3TTSA 1FBTA 3GVHA 2OXIA 1T0HB 4MR7B 3ZBQA 2CHFA 2PKCA 3KWJA 1QRSA 3DQVC 3FYUA 3NYRA 3WLFA 4MO9A 4ARUA 4OM8A 5K3OA 5LJIA 4CUGA 3ZR8X 2QRPA 3NOOA 1JQ3A 4O4HB 2KRFA 3F90A 3TQHA 2XXJA 1FNMA 3ILSA 2ACWA 3ADKA 2CFOA 1YDFA 5AJWA 2PXCA 1P0CA 4NE2A 3DE3X 5DWVA 1YDHA 4J7AA 3ZE2B 5EWJB 3WE7A 5IUKC 1MO5A 4FN4A 3TE7A 5KVVA 3CCYA 1T3ZA 3FFTA 4UM5A 2Y6UA 3J81A 3SYMA 2D2IA 2F43A 4RKEA 4B3GA 4X93A 4ND4A 1NHWA 1AD2A 1T8SA 2GH1A 5C5IA 1G42A 2OV7A 4EATA 3T06B 1F6WA 2JJ1A 2HVSA 1TAGA 1V6AA 3IMGA 4YCBA 4UQLA 2ZB4A 3DBHA 1G8HA 4ZT3A 3HOWJ 1LDJA 3B6JA 3ESYA 5BW5A 3KZVA 3WJAA 1ZCAA 1WSWA 2YIVX 2E1PA 2PT5A 4YO7A 1GP2A 2CEKA 2IOFK 2C4WA 4PLZA 4Z0TA 1A9XA 1R5NA 1LDEA 4GKBA 1EH6A 4KJXA 4WLNA 2FV8A 3L7JA 1ZISA 2G7MC 5IEJA 2WB2A 1THGA 5TV2A 1VCIA 1XJ5A 4OAOA 3TW6A 1GCOA 2HYJA 5FUWA 1KZ4A 2X4DA 3K16A 3JATB 1GGEA 5LFAA 3UK6A 4ZCIA 1FMVA 1AJEA 1EFLA 3FH0A 3IMFA 1ORIA 2XQIA 4WVLA 4CIBA 3VR6A 3WNQA 4BZZA 2GBFA 4K2AA 4S2UA 1RWMA 2HSEA 5FUXA 2FQWA 1LPNA 1Q11A 2DCUA 3FTDA 1F0PA 4B44A 1MOZA 3U4DA 2X1EA 4MXDA 4JLSA 4A26A 5E3LA 3HJTA 4GBED 5KWIA 3KBBA 3R6GA 1FP4B 3F78A 2CQQA 2W8BB 1SXJB 4RCYA 4PHFA 1RQLA 1J23A 1TNTA 2R7SA 1PT8A 2W6MA 3GJ6A 5F76A 5BYBA 3NWJA 3RUEA 3W5AA 2Q46A 3RTEA 3EZXA 1Z0IA 1T8TA 3C5CA 3KUXA 3GBSA 4RFLA 1PCXA 4LHYA 4BQFA 2OD5A 1BXGB 2MCFA 5JV5A 4ZTUB 2B0CA 3QSGA 1R6RA 4JA0A 5DGXA 1ZR4A 5D3MA 5EIEA 1KFCB 3GFBA 2YINC 2FHPA 4LTDA 3VC2A 5MGBA 3BR1A 3ET5A 3X2QH 1R71A 1QBKC 2B5VA 3DV8A 1ZVQA 4ID9A 3RD5A 3UYLA 4D9KA 4OSPA 3IC5A 3TGWA 5LZ2A 3GCGA 2ONZA 3PFWO 5KINB 4ENTA 1WW3A 3F74A 1XK7A 3FUUA 1RETA 3GEPA 1K88A 1E3LA 2AJ8A 5FUVA 4MVJI 3R9IA 3VR4D 2IY9A 4HZIA 1LA2A 4EPRA 5KYNA 2LOOA 1T6NA 2C5LA 2VJYA 2ZI6A 3F8WA 3O75A 4FIDA 4LG1A 5DLPA 3RC2A 3E61A 3QUCA 3HRKA 4WXRA 1N77A 4M88A 5JXJA 1MNEA 5FO5A 5GZ6A 4X8MA 1JUMA 3EEYA 3QMVA 4PANA 4Q9HA 3ZQFA 3DEFA 4A92A 4ZYWA 3MOIA 3S1RJ 2PUEA 3QNUA 5JG7A 3PHHA 4C5AA 1JU9A 2DYKA 4KLRA 4YRMA 4MUBA 4F4FA 5D8KB 4OHYA 1WEKA 1ZZGA 2R8PA 4A3MJ 3VB2A 2X6RA 3EVFA 3BFPA 1GDTA 1IXKA 4DZRA 3ELKA 2H0QA 4JZYA 3HOUJ 3FCXA 1MAVA 4L85A 4AJPA 4H0FA 3L2VA 4EG7A 4DDVA 1YULA 3OZBA 5A7FA 5ALFA 3BCRA 4NATA 2QY9A 1G7CA 4J1QA 4TV9B 3LA6A 2GVNA 3LT1A 4AZ0B 1FTNA 1DRKA 4TMTA 4AS3A 4DDHA 1UBGA 1IDN1 4BMOB 1D4ZA 3O8CA 2XE6A 4UNNA 4HNVA 1FQOA 3BEOA 2RNGA 5IBRA 3GB9A 5JNSA 1N6KA 3DUWA 3AOEA 1QQAA 1AA9A 1ZZEA 3HUGA 1LCIA 2G82A 3B82A 4R6XA 4EJVA 1FC0A 1X70A 3UHFA 1RI2A 4GQBA 2NPOA 2ACVA 3NHFA 3JRNA 4CQLB 3ID6C 4AJOA 4GF5A 2E34A 3GAMA 4JNKA 4N3AA 2WWYA 1JIUA 3QKSA 1E3PA 3ZXXA 1J8MF 4JI0B 2EG9A 5LIRA 3IT1A 3OKPA 2Y1XA 3F6RA 1OR7A 4YJ2F 5EP3A 4G2NA 1Q2UA 4GKVA 3NHBA 1CGPA 1NA5A 4HX8A 4MKRA 4R8SA 4I3HA 3WBKA 2JT1A 1U0GA 3JQCA 2VJJA 1XQ1A 4CJXA 2P65A 3AF1A 3R0XA 4JCOA 2NAPA 3D3QA 3NT2A 3RIEA 1PYOA 2GTIA 1SEPA 3PC3A 3A9VA 5FKLA 4HF0A 2I62A 1LFBA 1G21B 1N57A 1WDWB 2VAPA 5EOVA 3OESA 4R9UC 5D8LB 1X8JA 3K9CA 4CCSA 5LLTA 4WLEA 3KSMA 2M87A 3OOSA 2TRTA 1TCCA 4XFKA 3CHYA 1R1UA 1GYQA 1YUNA 2VTEA 2CVOA 4CKEA 1T1RA 2X4GA 2IKSA 5JECA 1H2AS 2P2CA 1KHTA 1TWCJ 5HDNA 2Q5QA 3GRKA 9LDBA 1RPZA 2WOOA 2COEA 2IU6A 4NG4A 2O2YA 5AW1A 3H9QA 4JB0A 3EEIA 1RADA 2CMHA 3ADPA 4IH4A 1UC9A 2E37A 4MYUA 5CEJA 1KO5A 3I8XA 1PQ4A 3HJAA 2JRTA 3FXKA 1FJXA 2EG5A 3WU2C 5EYRA 5J2TB 2GXAA 1VG0B 4I5IA 1A4RA 2M9MA 5EXTA 2VUTA 1CZKA 4ES6A 2R96A 2FBIA 1AX9A 3T61A 1ISJA 4IG4A 5LQCA 1TM4E 3HTXA 3NMUF 4OY3A 2GOYA 4UUTA 4KTTE 5JD4A 1TM1E 4RO0A 1Y1WJ 1SQ6A 3FSJX 3HP7A 3PJFA 1W7PA 2BFWA 4QIHA 5K3FA 1E17A 5A1JA 5BNIA 1H1LA 2NT4A 1Q0SA 2R7XA 1FLAA 2UXXA 1ZN2A 3LMMA 2SCUA 5AVTA 3BJIC 4OV6B 4D96A 2HBRA 2W83A 3I9OA 2ZCVA 3ICPA 1G3WA 1XUOA 4BMYA 1K97A 1WMSA 2HPIA 3MWDA 4Y6OA 5FADA 3ZWNA 4C3JJ 2QG4A 1Z5PA 5F2EA 2JEOA 2OR3A 2JFYA 1RYMA 2M5WA 1H93A 4NFLA 5C7YA 3A0HC 4OFBA 4QOFA 1QGAA 4MRMA 5T5QA 1UKAA 2Z9CA 2DZDA 1HOMA 2MLKA 1Y8AA 5K9ZA 1YQAA 2CFTA 1V3QE 1ZO8A 4CA0A 1MNDA 2NAZA 4KNWA 3NARA 4XYGA 3DE4X 2ZSHA 4X90A 3A10A 5KB3A 3OC0A 1FFYA 3K6JA 1UKVY 2D5BA 3I3SR 4OGLA 4X85A 2CMGA 5FV7A 4DJTA 3TG8A 2HT1A 4H1WA 1SK9A 2R7LA 1P4AA 1VBKA 3EAQA 4G5OA 4PK4A 3SKXA 2IYRA 1TMYA 4UBJA 3B20A 1KQPA 4P92A 4X5OA 3T94A 3ZW8A 4DOMA 2XUJA 3JWIA 3NHJA 4JR0A 1F5SA 3UJHA 2O8CA 3GZ6A 1JA9A 2BBTA 3E15A 5IDYA 2H52A 2OFPA 4WLOA 4BAZA 2G36A 1GA1A 3NDIA 2NYUA 3CKMA 1KY4A 4LRSB 4ECEA 1ZR2A 5E20A 4XPZA 2P1ZA 3D8RA 4AYXA 5E3HA 1YQQA 4D8TA 1HSZA 5ADHA 2F6CA 3UAWA 4MV1A 5F9MA 2QX6A 3K0FB 2GSDA 1XV5A 2ZRMA 3LUAA 5JXGA 1PI3A 4GX2A 2XBUA 4KGVA 3VYVA 4F60A 1KFKB 3X2SA 1BOAA 1KSFX 2VAXA 1A8UA 1UHMA 1GKIA 5AUPB 1S7EA 4ZHQB 3SN6A 2V6GA 5HNKA 1LTQA 1SD1A 1SZPA 3PSHA 3PQ5A 4FX2A 3AGQA 2UZ1B 4O08A 3O3KA 4X3CA 3RU2A 1P1IA 2G9RA 2DN0A 1OCEA 2R1TB 1WQ2A 3KPYA 4CL8A 3QX3A 1D0VA 1Y8QB 4HDCA 4GYIA 4UEOA 4D56A 1I4DD 4ZH4F 1BL0A 1TIKA 3GZNB 3HQ4O 1K86A 1GV0A 2VP5A 3HPHA 1NIPA 1NHAA 1LGYA 1ZQ1A 3GNQA 4TRNA 3U13A 4B4OA 5IK2D 1CZOA 2DWPA 4QZVA 1AN9A 4G8JA 3R5KA 2R3SA 3CZPA 2ATIA 2IP4A 1LRJA 3D1LA 4JN6B 1V3VA 2I80A 1OKKA 1QG6A 3OUUA 5KKNB 1NQWA 1GGFA 1I14A 1ZKDA 5HCUA 2C4VA 1BCRA 4B76A 4CQLA 4MV8A 5EJEA 4RTPA 2AHRA 2B8EA 4UE6A 2I4NA 1NW8A 5JATA 1AO3A 1VBMA 1Y8ZA 5DEOA 3HACA 1F0YA 4RL4A 4CM7A 2XRYA 4C4XA 2OTJI 3GPBA 4KW7A 1VKNA 2FNAA 3AQIA 1H2FA 4MPJA 2GZ3A 5I9BA 5LB4A 2JLUA 1XAGA 2NG1A 2XWQA 2D3TA 2V55B 3C8MA 4J90A 4IIEA 1VYTA 1L4EA 4TOIA 5DBOA 2WYHA 5C37A 1DFGA 2PL5A 3FY4A 5KX5A 1JVNA 1PUEE 3HP4A 3MD2A 4QUEA 2HZTA 1S6YA 1WCV1 2BMJA 2O3RA 2VTDA 1R36A 2XDAA 1H2EA 1AKWA 2YVKA 2JIRA 3AIIA 3GDFA 3CJRB 3KKKA 3K69A 3KQPA 3QP9A 5CCDA 3V4OA 3R9XB 4A0XA 1MJAA 3K0AA 1BA5A 1NN5A 5JFRA 1U9IA 2I03A 3A9TA 3IH4A 1JDPA 3V6MA 4GOOD 2X9DA 4QBGB 2ZK7A 1MQ9A 2V79A 3ROKA 1G9SA 3QMWA 4YRTA 2V3VA 1PR4A 1NW9B 5A0TA 3LYAA 3C6QA 4R1LA 2IW3A 3I9LA 2JFZA 3P45A 2X5JO 2FF5A 3ABQB 3D1JA 4DRZA 3Q6MA 1NBMA 4MQ9F 3UZUA 3WE2A 4ZEOA 1R6DA 3UGTA 2O5RA 2H4HA 1Z0JA 2VXYA 2POQX 3QWFA 4R2LA 3UXMA 4DEVA 4ZGBA 1YYVA 3N7UA 4TYYA 4CM4A 2LLKA 3IJRA 1MO2A 4X91A 2RH4A 3G9UA 2VWQA 1GPKA 4BFCA 1Y3CE 3IHWA 4XX0A 5KWSA 3ZUPA 3B7PA 4ONEA 5ELMA 3H6GA 4BNWA 4MGIR 3OM8A 1Y6JA 2ZDQA 3BJRA 3MWDB 3ZQHA 1BIFA 3JQFA 1L3IA 2YXPX 1ZUNB 4D0RA 4F7WA 2VJIA 4AY5A 1AO0A 4OIMA 5HK9A 2HQ5A 5CDSA 3EUHA 1CNFA 1Z2PX 2IK8A 1BC7C 1ADBA 1W44A 2N9UA 3MTAA 3NONA 4LY6A 1ZXLA 4NV1A 3KETA 1U5TB 3LSPA 3KDPA 4YFYA 1U0BB 4U6QA 3PNVA 1O94D 1U2DA 5EWMA 1FBQA 4NONA 2QUKA 3ILYA 4WZBA 2R8XA 1R8JA 3WYDA 4YRSA 4Z6KA 4YMLA 1Z06A 2BE7A 4Q4AB 2IS2A 4E6KG 3R7FA 3KHUA 4EGFA 3CN9A 4RPKA 4UFPA 2ZCWA 1B3BA 1KQ9A 2OXRA 1P62B 2IKQA 3EMKA 4KDCA 3UCFA 4Q9AA 4ZYTA 1PDVA 3JYQA 2PFBA 3PL1A 3H3VK 3OE7D 1ZICA 2G9NA 5BNTA 5CR9A 5CFPA 1UINA 2EERA 1JA0A 1N2OA 3KTAA 3BH0A 1YW9A 3K9QO 2DDAA 3OFKA 1U4NA 1MBZA 4Z1MD 5FUYA 5F98A 5J8CA 2J5BA 1OIWA 1PZMA 4FNMA 4X92A 4CFZA 5IJZA 3KXKA 4EPWA 1P1BA 1DJOA 3AI1A 2PZAA 2FDCA 5H5JA 3E0QA 1Y80A 3N3BC 2X1CA 1AURA 2J0EA 5LP6F 3RYCA 3FPLA 3C5WP 2WV1A 1W25A 3PRJA 3OKAA 2QRMA 3ENWA 2PT6A 3IJ5A 2FA5A 4Q24A 5HKKD 3HXPA 1QHHB 4PFOA 3OQJA 2JGLA 3CTMA 1D9ZA 3EG5A 3PKZA 1IY1A 4LV8B 1AOYA 4GMKA 4KUHA 2FSWA 1ESCA 1S02A 4OK6A 4URWR 3RKRA 5B1BH 1K6EA 1NJ5A 1BVYF 1YMQA 2EIHA 3FGOA 3WGOA 3ZVLA 1GFWA 1E1CB 4CMHA 3PUHA 3BB3A 4G86A 1MXHA 3N4MA 3OWXA 2KRCA 2DERA 4P84A 3A6JA 2JFGA 1OCPA 1JECA 3HYLA 4JLNA 5ICGA 4TLAA 5DIZA 4OATA 2DDBA 4IXDA 4W5OA 2KW5A 1MRSA 2PRYA 1WOYA 3BQMB 3OWOA 2XMBA 4I5FA 2B9VA 4MYSA 3S55A 1CUIA 3RF7A 3QBTA 1W4MA 3DV2A 4UOZA 3MGAA 4QVIA 1TJ5A 3V8RA 3IRUA 3OIFA 5MGNA 4QFBA 3K2BA 1XPUA 5LEKA 5GMOA 2AOUA 4IO0A 3Q9SA 2WZQA 1SD4A 4FIZA 4KE7A 5L40A 4TVBA 5FOXA 3KT0A 2DFHA 2I7TA 5LQDA 3KPHA 4KE8A 1KYTA 1Y0UA 4UVHA 1ICIA 2C7OA 3A9WA 2VKEA 3O31A 4DBRA 4GGGA 1Z9BA 1KEKA 3W2IA 1EUDA 5JCZA 5E7MA 2BCGY 1TQDA 3BCBA 3DV0B 3GJSA 4DRYA 3AAFA 4BDZA 1BE1A 4X1IB 2BM8A 5BORA 2AQEA 2ERYA 5I3ZA 1E64A 2PMWB 5LLDA 2GXUA 3ESDA 4MPRA 3E3VA 2HY7A 5IVDA 1XQ6A 2HMTA 1XRMA 4B1FA 2PR7A 5C80A 5H20A 1CUBA 5K5QA 2DPXA 2CLEB 2ZATA 1SRRA 5CGZA 3MW8A 4ZVSA 3SDSA 1RKVA 1L8LA 4E32A 4YLYA 3RS2A 5IAAA 5E8RA 5DYYA 4HNTA 1TU0A 4N0BA 3HKCA 3VSCA 2APJA 2PO7A 2X3FA 3O8BA 3OYBA 3UKDA 3ZY3A 1A9YA 5ESDA 1E3DA 1VCMA 3F4LA 1XZEA 3PR2B 4XIJA 3OO0A 2H8RA 4JVOA 2L0XA 4PWZA 1RYYA 4DIFA 3OY7A 4XYMA 2WM8A 3OCJA 1NF9A 1JJFA 3SOZA 4IWXA 5K05A 4CFSA 3WIEA 1M10A 2DH5A 1TJ4A 1YS9A 2BKUA 2PV0A 2QXTA 2XVCA 3ORQA 3O47A 4EJFA 2LMDA 3BWYA 3PEEA 4AT1A 5IS2A 4MWSA 5HCIA 1UZNA 2C4NA 2XGGA 2YIMA 3EEFA 3RJZA 4TL9A 4ZHQA 5DBGA 5SYAA 1G2QA 2CJWB 4PWYA 2AEJA 3FNFA 5CDYA 5JAUA 5J2UA 2FLWA 4EUFA 1FU4A 4BIMA 4WJLA 3KQUA 1JHYA 3GRUA 4LITA 4GKAA 4GU5A 4N9IA 3P4UA 3SSAA 1NPTO 2JH9A 1QYVA 2CXNA 1V9CA 3HG7A 1DJQA 1FFEA 3O3CA 4RK7A 5M5XJ 1P61B 1QUEA 3CW8X 2A35A 3AG6A 3OPMA 3QZUA 4QGGA 5CG1A 3AY0A 1M6NA 2WU4A 3F72A 2Q5OA 5J47A 1YHQI 3EOZA 2DQLA 5AVKA 4WOKA 4DTIA 4N76A 3KJHA 1KJYA 4O6VA 4EL5A 2GA2A 1E7MA 1M33A 5EPOA 5CB4A 3HRMA 3AEUB 1H8HA 3ENQA 3GA7A 2ZE5A 5BWBA 3SFZA 2QE7D 4HK4A 3T4EA 5JS2A 1ZELA 1FLIA 1R5GA 5MN5A 1UAAA 4J0QA 3MCUA 3WBBA 4PJLA 2GD6A 3IDQA 5JC1A 5JAOA 1VC2A 2BVLA 2GJAA 2NVYJ 4KN6A 3L05A 3UMSA 1U7HA 1MX5A 2VYNA 5SY4A 3BFVA 2PKXA 3HI6A 4RENA 2XAAA 3RJTA 3Q0EA 3DR5A 2G88A 4JQOA 1Y98A 4KC0A 2B0LA 2R60A 4P4SB 1IRXA 2I9PA 3RG8A 1NSYA 1ZD1A 3AL2A 2EQRA 4MVXA 2RH8A 1S0UA 3Q3SA 2O2IA 3AG4H 1C4XA 2GF0A 4P4UA 2NO6A 4IHTA 1CDEA 3MBIA 1RVDA 3SDZA 4C22A 1AKNA 3U4GA 1DC3A 3KEOA 2AXTC 3ESZA 4P3PA 3M8KA 1YFKA 4UB6C 1KE1A 5EEGA 1DGQA 1Z2OX 2I8DA 3ECSA 5B5EC 4IIJB 1EV7A 1QFMA 1OUMA 3S2GA 1A35A 1UBLS 3BIFA 2G1KA 2W7NA 2AQKA 2RDPA 4CDGA 1HTWA 2C4KA 1Q0PA 1CUUA 2RHOA 2JLQA 4HGRA 4XD2A 3VVMA 2EVWX 2VHQA 3T1YB 3ABLH 2C82A 5EJ8A 1WO8A 1FVXA 4O59O 3V8KA 4R9SA 3Q72A 1MVLA 2DKNA 2FWBA 2DA5A 4Y33A 4CYCB 2QNIA 3B52X 3KKQA 4FYXA 4D8WA 2DOFA 3S15J 1DCKA 1XFDA 2WHEA 4LHVA 4IOCF 2R7FA 1YR2A 3HUGB 2ESNA 1TM7E 2WILA 4FBMA 2IELA 1B8IA 4B3HA 4UTNA 3LWDA 4JGGA 3V1TC 4DREA 2FG5A 4BMVA 5KTTA 4RDHA 1MBKA 1CQXA 2OLKA 3DW3X 3TLJA 2JIZD 2CJWA 2PKEA 1PS9A 1KETA 1DCMA 4N1AA 4PNHA 3M1CA 1F20A 1C7RA 2LGJA 4RA6A 1I8TA 3AZQA 3HHEA 3CCCA 1XCVA 3ZN0A 1S1MA 1SOMA 2DTZA 3IH2A 3OR1C 4Z2YA 3NLLA 2Y9PB 3UATA 1QP8A 4F91B 3GROA 4QGHA 1VE5A 2HBZA 1QYXA 1TYAE 4PJMA 2BFCB 3W0LB 3H05A 1VNDA 4A8HA 2ZVQX 2EFDB 3DB1A 1KL7A 4MUNA 3CNOA 5HF6A 2AZDA 3RYFA 4N9WA 4E6PA 1JNYA 5JVDF 2QTLA 5CVIA 1E94E 1M66A 1L7PA 1QOPB 2VEOA 3GFFA 3JZAA 4D1YA 3JQ7A 2F3RA 1ETXA 4M7WA 4TWRA 2XD4A 3AU8A 1ZYRF 1TQ2A 3SYKA 1XMJA 4QL3A 1RCFA 4ZO6A 4C78A 2IT0A 3RTCA 1T8PA 3I05A 3H92A 5AIQA 3IP9A 1YITI 1ELOA 2Z2KA 4J16A 3A02A 5BURA 5DM1A 3BDIA 3DP7A 4P34A 4CMAA 5HJEA 4BBRJ 3EDPA 5FLXZ 3PUYA 4IQ8A 1NFQA 3NYQA 4NECA 4QOGA 1YJXA 3HIFA 2Y71A 4XDZA 2H31A 4RTQA 3RG2A 3O1IC 3PVZA 1R27A 1C4OA 3HCPA 4O2AA 3KZCA 3PQ2A 4FFVA 4P4GA 1SVIA 2X3YA 3OTWA 1JR3E 3GIWA 4RD6A 4MITA 2JDID 4UBNA 4BX8A 4EY3A 1NM5A 4V39A 5EE9A 2P5YA 4OF4A 4TQ9A 4GE3A 4LYEA 5B64A 2AQHA 1KTIA 3H1GA 1GQQA 3H9BA 3TDMA 3QFSA 2CW5A 4KN5A 4MP3A 2GAUA 2GLTA 4EHAA 2EEPA 3KZOA 3NWOA 1G20E 1IATA 4WQMA 4HNAB 3CLUD 1DUSA 3CS3A 4OH7A 4BUPA 1PQWA 3BE5A 3OZVA 3W6UA 2FI1A 3AJEA 4DV0B 1M2GA 1K08A 3E9YA 4LZJA 3ORRA 1NPDA 1P19A 1XQ9A 4OXKA 4PG4A 4MAFA 1Q15A 2FUG1 4Y1RA 3ZMZA 1PYGA 4U6NA 1A2BA 2ZITA 4CT5A 4DYVA 2WKQA 4I02A 1R0KA 821PA 3G82C 4C43A 1HT2E 2NO9A 4Q5IA 5LDGA 2HQOA 4F7DA 3K1AB 4YFNF 2AC2A 2BGLA 2IVZA 3JQ6A 2EBHX 1LQ1A 1I3NA 2NU8A 1DMRA 3K9GA 1P33A 5FQNA 1Y4SA 4RB2C 3KWLA 4TQAA 4WESA 2ZUVA 3A9SA 4E70A 4KDFA 1OFHA 3PI6A 1Z25A 4DPKA 2QBYB 1SZDA 4C3HJ 4D7MA 1NJSA 1RIIA 2ECFA 2H2WA 3BGWA 3AW8A 5EUQB 1I0LA 1PR5A 4R8HA 4FXPA 3WLMA 2C7GA 4ZAFA 3O8QA 5AD1A 4H7DA 5E3IA 2IHNA 1LS6A 4GXQA 1NNI1 1NI4B 4RKFA 1SOWA 2IS4A 3OIUA 4I9GA 1QAOA 4LQLA 2H1SA 1R1DA 5F0HA 3PL5A 4PLFA 3DOIA 3LLUA 3LA2A 2HA6A 4G85A 4HFMA 3GNLA 4IYJA 4NMWA 3CJRA 3C7CB 3GRFA 1NR5A 3IUPA 3OECA 4W6QA 1WDLA 4I8DA 5CXXA 4OXQA 4ARZA 1A5TA 1S2LA 4RZSA 3AU9A 1C1XA 1E2QA 3C87A 3MJEA 5AXAA 3W9YA 3K05A 3PGVA 3IP5A 2HXYA 4HDKA 4MIMA 4U0VA 1B8OA 4NKRA 4O02B 1DKMA 1DOZA 1VQLI 1I5EA 4BHBA 2ECPA 2XUAA 3FGZA 4MAMA 2A05A 4QPOA 3K4KA 4H15A 1CJBA 3UWDA 3LQYA 5J3LA 4Q9KA 3T3OA 1T9KA 5AM0A 4OU0A 1LB1B 3K4HA 1TZMA 5F7XA 1BOFA 3SZPA 1TF2A 2NVWA 5EQFA 3U6KA 5ALQA 1WD5A 5IP7J 1YRYE 5CTAA 5CA0A 2IPAB 1WUIS 2XE8A 4LOHA 1J0CA 3N2EA 1GEGA 3SR3A 4BAYA 1WJCA 2QTVB 1EUYA 1L1QA 2PL9A 1AHDP 4M7PA 3NUQA 3ZU2A 5C1BA 5BO5A 4HX7A 3RABA 3EUWA 3EFOB 1Z8DA 2PGDA 4RS3A 5CYOA 1RXVA 4FCWA 4X9XA 1C9KA 2XX3A 1BVRA 1PNQA 1ZIXA 2A3RA 3IKTA 1AK1A 2I7XA 2J3DA 2O1WA 2XCUA 3D7NA 4UJ3A 4WZZA 2YWDA 1H22A 5K6AA 2NYVA 1PVDA 2NO7A 2XQGA 1QO0A 4ZICA 3P5SA 2D1TA 1UPTA 5BYKA 3OHPA 4IDHA 1IDZA 2DBVO 2WFZA 4ZP1A 4DDWA 4ZHQF 1J8DA 4HEHA 5EGOA 1P4JA 1AKHA 3FETA 4G6ZA 2UUZA 1P9QC 4QOIA 2ETHA 5F1JA 2CVHA 3DAOA 3TOAA 1ZJ4A 4UEKA 4CWAA 2OQIA 5AUQA 5L3SB 1EIWA 2FQ4A 4IHVA 3EZ6A 4ZEMA 4G5GA 4I4NA 2R1ZA 3TGLA 4ARVA 2OXTA 4D6YA 2ZQYA 3DMDA 4FYPA 3ISPA 3KJGA 3V1YA 4D9IA 5D5VB 3GLFB 1VQ5I 2WAAA 5D5HA 4FOPA 1NG6A 2D0IA 2VHTA 4JP1A 2C1EA 2X8JA 1JWLA 1IG0A 3BMXA 1KI1A 3EBPA 4RVDA 5BQ3A 1Q6ZA 2GEVA 4K9NA 4QYSA 4F6RB 4INOA 1C3XA 3PWZA 3CF5F 1I6MA 4GYJA 1H4VB 5KDOA 3E1SA 1G3RA 3QPHA 2QQGA 4FEGA 4BVFA 1QU3A 2XF7A 1L4BA 1Z6QA 4RTRA 4HDMB 3VPAA 3NASA 3ONQA 4P32A 3WOHA 4EHJA 4QM6A 4HA8A 1GT0C 1KERA 3A1DA 3K0CC 3L9XA 2QZ9A 1OI4A 3KNZA 1DG3A 3E8XA 5I7WA 2WRZA 4NTZA 1B9MA 1AF7A 1COWA 3JV7A 4RWEA 4WACA 5SYMA 1K7CA 2OO3A 3M1LA 3RFUA 1QK4A 3GRYA 2K86A 3IUJA 2H2AA 1W59A 2XNSA 2WG2A 3IVCA 3OJLA 4P3KA 4RVUA 4DA8A 4EX7A 5EJ4A 1BIAA 1SD7A 1X7WA 3KQWA 3VAAA 3RAEC 2Q0QA 3F8MA 2QRNA 2BR4A 2WPNA 1IK6A 5E18F 1J42A 3BJMA 5DIFA 1BS1A 3TINA 3CTAA 2Q07A 3W2TA 3F5QA 3OEHA 1MJHA 4O4JF 2JHFA 2VOOA 4A69C 2OBPA 3B3QA 2Q5HA 4C3UA 2DTDA 3W6JB 2V4UA 5JD6A 3QPDA 4O4HF 1J0AA 4Z0HO 3KP2A 1RYFA 1W96A 5K7HA 3EUAA 3IQIX 5D7NA 5L3RA 1LBSA 4PPYA 3V4GA 4PJ0C 2QX4A 4BFWA 1EDEA 2GSWA 2WSLA 2L9VA 3OCCA 2WJIA 2W2PA 5ETJA 2ONJA 3OJXA 3RSQA 1UJNA 1IH8A 3EODA 3LMKA 3KHTA 2Z30A 3QA9A 4E22A 3BFKA 4KYVA 4AK9A 5KSWB 1RR6A 4B81A 3CGGA 3KRTA 2ASVA 4JR1A 1LNSA 1PFQA 4YWJA 2ZRQA 1K7SN 2G08A 4HI0E 1KK3A 1E98A 3AJ8A 3WSTA 5CB4F 5E2IA 4CM9A 2IBMA 2CJJA 3BIWA 5A0FA 2JVHA 2Q27A 2X8AA 5F78A 4A3BJ 4LBVA 3QKTA 4MAAA 1R4ZA 1CFZA 2QPOA 2ZR8A 3QKIA 3P0HA 5A7GA 1GRVA 3S2WA 1UG2A 2FPXA 3IOBA 1G7TA 5DN9A 2IYYA 4L0QA 5FA6A 5JLAA 2VJDA 3OQPA 5FKMA 3QU6A 1GA4A 4P36A 4ALKA 3JRBA 3VX3A 4G12A 3S2DJ 2HOQA 2WAMA 1D1AA 4XJXA 5IN5A 3CH6A 2Z3VA 3S68A 3PHGA 1P74A 2P4WA 4WADA 4BTLA 3TZCA 2WD8A 3FLAA 3RKSA 2LF8A 1ZOLA 2NTJA 5LSAA 2XKKA 3O0DA 1DTSA 2BY1A 2NZJA 5IJ0B 3DEAA 5EZSA 4ZTJA 3HBLA 1ZRDA 3KR0A 4BNXA 1X3SA 4D4GA 5L45A 5IAOA 4I4LA 2BHZA 2VP4A 3OEHD 4ZJYA 2ENUA 2CJFA 2ZT6A 3MBKA 1WZEA 1ZOIA 3E8MA 4UTPA 2DMTA 2ZWAA 1PKEA 3CKKA 4HDRB 1RRFA 3MYRA 2QL7A 4ABYA 3KKPA 1P92A 4DA4A 3P94A 5MN4A 5IYBJ 1XDDA 1L5FA 1Z3IX 5IC5A 3T35A 5C5EA 2A9QA 2X86A 2V98A 4Y52J 5JLJA 4BDTA 4XLZA 4D41A 3CVUA 2VA8A 2XUQA 4QICA 3I53A 4B6PA 3LSYA 4Q4LA 4QAJA 2VKHA 1EDOA 1WVGA 2E2WA 2FOLA 2PWPA 2L9RA 1WV0A 4YEDA 4D9BA 4J16C 1RXCA 2RK6A 3ZYZA 4FMBB 5BV1A 4BKQA 4RKYA 3LK6A 2WF6A 2W6CX 2FWIA 1JXQA 3V4ZA 3WRWA 2JJ1D 421PA 5B3KA 2ADFA 1Y3AA 3L7AA 3U39A 1ONSA 3EZ2A 5T4HA 3KZZA 1D2MA 4UZSA 1EA7A 3CRQA 2WHYA 4JGBA 3ZMVA 3C48A 3IMCA 4GE0A 3C3CA 3MPOA 3H86A 4QBIA 3T5TA 1ZJYA 4X6LA 3VUEA 4A5MA 3HUDA 2Z8YA 4CMCA 1AU7A 2CLHB 3IAXA 1WU7A 5TF0A 5AW0A 4D9FA 5IT9K 1KBQA 1GZUA 1U99A 4TMXA 5FR1A 1YC2A 1HDGO 1XWWA 1KBZA 3W7VA 1L4UA 5EEHA 4M1ZA 2P5KA 4DIMA 4F45A 4WI1A 5IHXA 4KQIA 4A0QA 1JPVA 1EFTA 3MQ4A 2PX8A 3U60B 4HT3B 1ECJA 4N0EA 3PGLA 1XDWA 3I8OA 5FROA 1YXMA 4AD9A 2P5LC 3LYHA 3NH6A 3VR6D 3WLRA 2JMWA 1BU8A 2WK1A 1QFSA 3GTQJ 4HNQA 5D2CA 3OZCA 2YYAA 1FSFA 2PAFA 3TO7A 1G20A 1XKQA 3H0DA 3AMVA 3KUDA 4LHEA 3WL6A 3R5FA 1OBFO 4BQEA 1KU2A 2XD9A 3NHUA 1IWOA 1PR2A 4TKUA 4CTJA 3FVWA 3OFVA 1JR6A 1YMUA 3BM5A 2MSYA 4Y3UA 2IEKA 1IV6A 1A5JA 3KYCB 1NUTA 1KQ8A 1E92A 1OHHD 1RXSA 4YCDA 2ZSDA 5D3MB 2FX3A 4Q18A 4COOA 4JMPA 1WTAA 4BEHB 1VHJA 2IF0A 3GP5A 1F1ZA 3H6KA 3H7IA 1Z4KA 3KFLA 2WVAA 4LIVA 2ORED 3OIWA 3UPTA 5FHRA 5EIXA 4QQFA 5BWLA 4MA5A 4D6PA 5IM4F 2XMQA 3TGNA 1ZN9A 3LHIA 4MVCA 1A5SB 5LZ8A 1MMSA 1C9DB 4LMAA 4PZ0A 3QPBA 2FSVA 4EX6A 2VS1A 5KOHB 4LJ6A 3C6XA 1M8KA 3KD2A 4OLHA 3TD9A 5AW8A 4HUQA 2QMOA 4N40A 3TFWA 5B1EA 2XUOA 2CMFA 1ADFA 1TD1A 3GTGJ 2J08A 3C8ZA 3PFCA 4JS0A 3BG7A 3FCAA 4AC0A 2VC1A 1RC0A 1SA0A 2VOJA 1M1YE 1DIRA 4ODIA 2BEKA 3KAQA 2Y0EA 3QIVA 2DQZA 4AX4A 2ZAYA 4RZXA 4RTSA 5C18A 5LOVB 3M1YA 2C96A 3GEEA 2IUUA 2IGOA 4NK5A 2PL1A 4PYOA 1TRKA 5GAGJ 1EESA 1B73A 1Z29A 4FI3C 1MMGA 2NNNA 4HZFA 1E18A 2UUPA 3O91A 4XQ0A 4B8ZA 3SZRA 2PG4A 3UUGA 3EJWA 2PFSA 3PXUA 4PTZA 1K9VF 4OIQF 2FFJA 3HGTA 2XW6A 3PFNA 1YE5A 3PSAA 2A33A 2LKPA 4KQ6A 2BUCA 2O3FA 1RAFA 2LY1A 4NCJA 3VSDA 2ZI4A 1Q7GA 4UHHA 2WAYA 3AL0B 3PT9A 4MVJA 1W36C 4QPNA 1E0DA 5J2TF 5CD9A 3KFVA 3R9XA 1MJ9A 2DPMA 2F3SA 4P0TA 2E1RA 4LF9B 3ZUGA 1NVVR 3WAJA 1AH2A 2CXSA 2RHRA 2K9SA 1CQZA 1E3TA 1FS5A 5T6BA 4FHTA 1FMJA 1ZPDA 3S40A 1JSRA 4D43A 3H1AA 1NNEA 3WIDA 4MWTA 3PLAE 1LQ2A 8ADHA 1BYIA 2O1XA 2VDWB 3L5KA 4R1MA 5UKDA 4YJ2A 2Q2OA 2Z08A 1EJ6A 4Z0PA 5KWJA 4LE0A 3N74A 3CUKA 3V7YA 1IJKA 4YI3A 1W1WA 5BXQC 1GU7A 1O5IA 1MF7A 1WNTA 2CNKA 3JZIA 1TYBE 4FJ1A 4JIMA 3RT1A 3IVMA 1P8AA 2FW7A 5F27A 3NKFA 4OQLA 2O2ZA 2RGRA 1E2BA 1RHKA 3R8CA 1ZLKA 1XLTA 2R7NA 3OZRA 5E9QA 4LCEA 4BY7J 3MTGA 2V7QD 4RADA 3R7DA 4ZOAA 4BGIA 1HR0B 2NTVA 4J0HA 3AUJB 4PYQA 3KLNA 3QNMA 5ICMA 4FVTA 1XTJA 3E53A 3VRHA 1KFJB 2A9KA 4IRHA 4YAFA 1AU9A 4YXWD 2F00A 4XWAA 3P5BA 5ES3A 1G38A 2B25A 3OLCX 3QUBA 4FINA 4MQLA 2I76A 4ZCTA 2X9NA 3R5TA 1M9NA 5ESRA 1ADCA 3EUKL 3RVDA 1I3KA 4D3YA 4NXMB 5JIBA 3SJZA 4YH1A 1L1RA 2EWVA 3H19A 1HEYA 4KTVE 3ZDCA 3O94A 4G0XA 2Q1SA 4MARA 5AW4A 3A4MA 3Q8WA 4MPPA 3RS3A 5KDLA 3VR2A 4RTLA 1GD1O 2KIUA 3FYDA 4CMGA 2FN7A 1QDUA 4CPDA 4NG5A 5G3ZA 3KOZA 5C7OO 3IT2A 4HB2A 1S72I 1AA7A 1YQEA 2YC2C 3K0CA 3KO8A 1VZ0A 3Q0VA 1HXHA 1UKCA 4WUVA 4YQZA 5ES4B 3DTKA 3GLSA 3OIDA 1EKXA 5IT9Z 2HC9A 4DXDA 3OKFA 1KJQA 1YRAA 2G4LA 1Z0DA 8GPBA 1NDQA 4M1MA 3F8BA 3KD3A 3UN1A 4EQQA 1DP4A 1GGKA 4EQ6A 1RRMA 1NF8A 3BH7A 3CZ5A 3PNKA 3BQYA 2COMA 1XTBA 2Q3JA 2Z2IA 2G83A 1ORRA 4EG8A 1IM2A 4TXJA 1Z17A 2KX7A 1Z2CA 4QFMA 3A3NA 4EM0B 2CWWA 3SR0A 4L3OA 4MGZR 3A6GA 3MTDA 3KUUA 3CR3C 1TM5E 1I7NA 4ZO7A 1D1QA 5DXJA 1JFSA 5ALZA 1I0IA 1NGSA 4GAEA 4B84A 4CU5A 2VQFB 3MYYA 1WPRA 1ZRFA 4HEJA 2YKGA 4LV5B 5GTIC 2BFAA 2MSCB 1E7QA 1F7UA 4BEJA 3VKHA 1W87A 3L6OO 4EB8A 1I7QB 2OYCA 4PY2A 4QQKA 2B37A 5JMWA 3DTNA 1OCOH 3GPDG 2J59A 1OPCA 4RV4A 1VYUA 4Y30A 1W0JD 4EELA 1E8MA 1JGGA 2W98A 3P27A 4D4MA 2FMKA 3JR9A 4G0MA 4Z4IA 1OX6A 1Q6YA 2W6ID 1HDZA 1MP0A 1II9A 3L04A 4YDHB 2DTRA 2HMYB 4IGIA 5KNCA 1JI0A 1GQRA 1EB8A 1GPAA 1VJDA 2G0NA 4KR9A 4DY4A 5A3JA 3TL4X 1Z07A 4KX5A 3L0ZA 1KMCA 1KPIA 1N2CB 1A27A 2Q4OA 1AZSC 5JMTA 4UHKA 5HSGA 2WAOA 4MQFA 5BN4B 2YIJA 5D1NA 4QNNA 3GQBA 3TLZA 3NBQA 4Z4QA 3ZMTA 1EVKA 3I9NA 1L5WA 2FF7A 1ZMXA 2IYWA 2XQJA 3DFZA 5EKSA 2VLAA 2QYTA 4IKFA 2CXTA 3BB1A 1YQDA 1UJ5A 1TLTA 5K5RA 1Y6RA 4W8OA 4LSGA 4MW4A 1IEVA 1N8NA 1OH6A 1O0BA 1BNCA 4IDOA 1WU8A 4ZYZA 4BLRA 1SBQA 1O87A 4MTCA 3CF2A 5DPMA 2OPHA 1VPVA 1YU6A 3RS8A 3PEUA 2A57A 3DAGA 4UDOA 3E05A 2XZDA 1GKLA 3RIHA 4CLDA 3J81Z 3ITDA 4O6JA 1GHCA 1ND5A 1S8AA 1TZCA 1TW3A 4YJ3A 4J2HA 3HDYA 4N7RA 2D62A 4NCNA 5K7SA 2WP8J 5LP6B 1VLZA 2JGRA 4PW0A 4Q4DA 5LQNA 2GYVA 2RHJA 4W1UA 1HSJA 1DZIA 1SPBS 3B36A 3OTIA 2NXJA 4PZDA 1DBSA 3R7SA 4AO8A 2BIFA 3KKOA 2YVUA 1PV1A 1NW7A 3DYIA 3SS8A 3VJLA 2AFHE 1QTIA 4R6WA 4L74A 5EJ2A 3HXQA 4IDFA 3ROTA 5B2FA 4AJEA 2AE1A 1ZW1A 3R7AA 3W6ZA 4EEKA 3LUBA 5A4JA 3LQ1A 2PWBA 3KJZA 4M49A 1K66A 5CU7A 4RVFA 1N7HA 4BTEA 4JI6B 4NJEB 5G3YA 3UC5A 4FFMA 2AN4A 4GLFA 1PJAA 4BVJA 2ZJ5A 4YT8A 3E5NA 3Q0UA 1EM6A 2AYZA 2G77B 2J5QA 3L7KA 2MWMA 4ETSA 1VYHA 3G79A 2HXGA 2BPOA 1JHOA 1QKJA 5PNTA 1XHLA 1Z47A 2C5AA 3LAPA 1E20A 2XDWA 5ESWA 4CDMA 1XZAA 3H2KA 3PDIB 3QEAZ 3ACDA 2Y66A 4DIDA 2D6FA 2P9ZA 1KU3A 2DPDA 3FVTA 3HB5X 2HR1A 1E4YA 3NHMA 3KZIC 1J9EA 2QSJA 4HAUA 5FR2A 1T9GS 1YBVA 2FF4A 4UVIA 2HDHA 4XX0B 2QD3A 3UICA 2GMWA 1Q16A 3EHDA 1G4AE 1YJCA 4UULA 4Y6GB 4FDTA 2FXVA 1E9VA 2FR8A 3EOBI 3TMYA 1EWVA 5HQTA 1NDHA 1VBFA 4E5DA 1R88A 3H9JA 4KICA 2FUKA 6CHYA 1N6OA 5FKNA 4LRXA 2IBSA 2F3TA 4FMCF 4HN4B 4BP8A 3KQLA 3ILXA 1JIJA 4MQBA 4KITB 3UYKA 2B9EA 2XUDA 1LF5A 4WX2B 1CWUA 4LPKA 3WJ2A 3I3OA 3ROMA 1QH8A 3SHOA 2HDDA 3FWEA 1JZTA 5EPEA 5IYZA 4YP7A 1NL3A 5FD8A 4WX9A 4DV3B 3B1VA 3PUXA 5IVPA 2HXSA 2ATCA 3W2VA 4GOXA 4HSEA 3DXJF 3O2PE 3RKQA 3VZCA 4DMGA 3THWB 2EHJA 2IJLA 4ZQBA 1NATA 4LECA 5JNVA 2IPLA 2DHEA 2P2YA 4L1KA 2V7VA 5IASA 1J0EA 1J9ZA 3X1JA 3HCWA 1EXWA 1BGXT 2C07A 2C00A 2VUUA 4G5SA 2V7BA 2ZPTX 4AN4A 1U7UA 2C0CA 2O6HA 3OA2A 1WKBA 4FYYA 4IR7A 1Z0FA 1CJVC 2IA5A 4XNFA 3HNOA 1A69A 4PRYA 4KPGA 1W36B 2SNIE 3TZLA 1X1QA 4S0XA 2Y93A 2J9FA 3WGZA 4J6FA 2BJHA 3A27A 1LNWA 3ZX4A 4JQFA 4NNPA 1KKMA 4RH1A 2WNIA 3PENA 3N0RA 1V8FA 4RPHA 2XCIA 5I01A 5KQMA 4JP8A 3M9WA 3IPAA 4CQJA 2PX3A 1O3TA 4G4SO 4DV5B 1GPWB 2ERXA 4C6TB 1TEZA 1R5ID 3R3UA 5EJAA 4CM6A 5F3RA 4NPAA 4QU0A 3Q6IA 1U7PA 2ODWA 1TPYA 1YNOA 4JYBA 4RHYA 4XASA 1RXWA 5DXFA 1F3LA 4GOKA 2JI7A 1QYDA 2JG3A 2BTEA 5JJIA 4JA2A 3AKYA 3TB4A 5GADJ 3STUA 2O0MA 1DTWA 3R3JA 1GV1A 2FZGA 3GOQA 1BR2A 1B8VA 3IIJA 4YP6A 4B87A 1N2IA 3OCXA 4Z9AA 5KCZA 2WHXA 4F3QA 1BDJA 2FSIA 5K1YA 1RT9A 3RYHB 3VC7A 1EEHA 1I1SA 1L6IA 1YQGA 2IZ6A 4K9RA 4EPVA 4KXVA 4V0KA 3PTLA 4B34A 4DWJA 1W49A 5M29A 1T5TA 4NCBA 2OO7A 2JCYA 3WISA 1SFXA 2AMJA 2DK5A 1FTSA 1M83A 4OJNA 3KALA 3HN7A 4QU8A 2A0FA 3I2KA 3T1TA 1AQYA 3V2HA 5BXYA 4V19K 2PZGA 2V6FA 2O2EA 3C1TA 3BMCA 3LWNA 4L08A 3T4PA 3TQNA 3T9AA 1G17A 4NYJQ 4U02A 4D3XA 2JA5J 3N2NA 1GSHA 1G55A 1WMDA 2BL4A 3QW4B 3WK9A 2I8AA 4JBHA 5EINA 4E11A 5LHGA 1ZJZA 3LL7A 2OHOA 4LVOA 3F5FA 1IXSB 1B26A 3MMPA 3NJRA 4UHEA 4HYQA 2D7JA 3AYXB 4OLJA 1PT9A 4PG7A 4Y6PA 2JAWA 3TW8B 2XQVA 1E2MA 1P9RA 1R49A 3DNPA 5B2EA 4QJ4A 3VKUA 1PW5A 2OUKA 4A2CA 1FQKA 2P5TB 3E7PA 2H0RA 5KVAA 1KC1A 1ORDA 1GUUA 3ZGZA 4PX9A 1M1ZA 1UXJA 2FEOA 3IO5A 3QV2A 2DA1A 4Q21A 4LLGF 3FXUA 5AM3A 3HOTA 8OHMA 2Y30A 1EK5A 2JIDA 2LKDA 1T25A 1A97A 1X2NA 1UELB 3LFUA 3CLRC 4KQWA 5ALWA 4CMKA 3D31A 4QYIA 4DM3A 4DQVA 3BRSA 4A8TA 4DLLA 3EXFB 2BKLA 4XW2A 5CB8A 2Y1CA 3TMKA 4AKHA 1MJBA 3U2QA 4Q34A 3SSNA 4UVBA 5AVWA 1XKLA 3VO8A 5EJ6A 3I5MA 2Y1EA 2XRZA 4XL9A 3DDSA 4XWOA 1BJZA 2QGUA 1IHPA 5F5XA 2RIRA 3G2KA 5CVJA 4J0DA 1LDKB 1YCHA 5E9WA 3SZOA 2JANA 3WGTA 4KWIA 3MCVA 3H11B 4O1HA 2QD1A 4M9QA 1XDBA 3VPCA 2WAQA 2P11A 4R16A 3CEMA 2ZKZA 1J5PA 4CKCB 4XDYA 1EQAA 3ZCPA 2BXYA 3OQ1A 5HKLA 4HG2A 1BRTA 1G6OA 2EL7A 2Z3ZA 1CUSA 1QVZA 2E18A 4JXJA 1G18A 3GYHX 4YFXF 4R71A 3FYUB 1K3UB 3P1JA 5IKOA 5BUZA 1R6BX 3ZK9A 1JJ6C 2CUKA 4LXXA 2IEAA 1H94A 4HLDA 1USTA 4TROA 2N42A 2PHZA 2IL1A 2WWHA 5EIOA 2EA2A 2FYTA 3M89A 1Z2DA 4KVAA 3WQQA 1O57A 2FZCA 3RKUA 2HQBA 1SHJA 1OX5A 4HDSB 4YY3B 4IDGA 1XN7A 1WDMA 1G4HA 4QULA 4WXMA 2BKEA 4ZOQI 2RHMA 3FMOB 5T7BA 3AILA 2V0GA 2BFDB 4EYGA 4XEUA 3HK2A 2PD4A 3U09A 1GFZA 5IJ0A 4OK3A 5KYGA 5BP7A 1XYVA 2XCLA 2CNOA 3O73A 4NENB 2Q6KA 4KLAA 2PKWA 4CV1A 1Z4LA 2IGBA 4ZQFA 2BV6A 1L4HA 4HQNA 2A07F 1AG9A 3R6DA 2LWIA 4TL7A 3BR5A 1IUYA 3B3GA 5BPFA 4GXTA 3MNFA 4L28A 4MIYA 5KNCD 2QVOA 1P7PA 1MBEA 2AW3A 2CXOA 2IOYA 4YP9A 3NVAA 3TYXA 2QYSA 2QQ5A 2YV3A 3KJQA 4OJYA 4KDRA 1B4DA 2PLFA 2PUFA 2V7GA 1KFBB 3U2RA 1NRJB 3SQNA 1NBWB 1W36D 2IHBA 1O6GA 2Z56A 4AZSA 1ACLA 3GFOA 1BEZA 3OUTA 1QPZA 3KIPA 5FKKA 1DC8A 1XZBA 4NU0A 2EPFA 2YJTD 5IT4A 2R66A 4AG6A 3HGYA 4XAQA 2RHBA 4FHZA 3LQRA 3GH1A 1PEDA 1A9ZA 5HUQA 1HL7A 2PSJA 5L4NA 2I6SA 2VP2A 1I80A 2YY5A 1W2WB 1XK6A 3PL8A 1Y37A 1OQAA 3BD6A 2RHWA 3L4BA 1SUEA 2Q9UA 4FWIB 2OGSA 1C7IA 4B5LA 3QKUA 5JJKA 3TTUA 1L6RA 2FD5A 3PR1A 1Q7CA 5GZ1A 2QN1A 3QVWA 1CZUA 2RJ3A 3EHEA 3OJFA 3COSA 4BHCA 3D8BA 4TTIA 2DPUA 4UCXA 1QS0B 3G4SI 2ZTLA 1KOGA 2Q9CA 4YUVA 1IAVA 3U21A 1XVAA 1QH0A 4YVFA 1F8GA 2JLSA 3TWOA 4GFBA 3ADBA 4WF2A 1SCUB 3CJTA 5LA6B 4ZK6A 2H54A 3UMBA 1QIDA 5BMVB 1LNQA 2P9GA 2XNCA 3L1JA 4K26A 2ELHA 4JBWA 3N97A 3I0MA 2FWPA 3A4CA 2M30A 2PZLA 2IT1A 2XOEA 5IYZB 1IW7F 4IWYA 2GCNA 2CDRA 5FL7D 4CKCA 5KQPA 3J7YJ 3GJXC 1R5OA 4MJLA 3RKYA 4KLZA 3H4VA 4RE5A 4UEJA 3EYWA 3SLKA 2RGAA 4EHNA 5EWJA 2VLBA 1WV1A 4QXOA 3BFXA 5HIMA 3T8TA 1RE0A 1HMPA 1U0HC 3B6EA 3FPSA 3OLXA 3HU3A 4KRYA 2W2KA 1KWGA 3WTXC 4MGRA 2P5UA 1T95A 2LDBA 4ND8A 5HBRA 7REQA 2QM8A 3QQ5A 4J3NA 4O1MA 2R92J 3WB2A 5JS7A 1N2SA 2I0FA 1O3RA 3A9UA 3OE1A 3S70A 1IU9A 1Q0HA 3RSFA 5KAPA 2OHHA 1VIDA 2OY0A 3Q3JB 1DKPA 2KBFA 4G09A 5CT6A 1DC7A 1IZ1A 3ND9A 3GH3A 1S8FA 1YSCA 5CCXA 4DV7B 5EDNA 3IVAA 1AGXA 1XRQA 4ND2A 2OESA 3GNSA 4LJSA 4ETMA 2WVGA 1XJWA 4MVJH 4QBTA 2H57A 2DLCX 2KMUA 1UOQA 1TCUA 1XEAA 2H4XA 1ZRMA 2QUAA 3P9IA 4UNSA 3A01B 1PV2A 1Y42X 3TSCA 1SIOA 1ZU4A 3GFPA 5ECWA 4IHJB 4DQDA 3C5EA 2I3DA 2YV4A 1KP3A 4KFCA 3CLKA 3LHDA 4RTJA 3AIMA 1O7LA 3M6MD 2H1OA 4DCNA 3AG1H 5E6SB 3M6IA 2OCPA 2ZB8A 3TXYA 4MUEA 4ZIRB 3L1UA 3NAQA 3HN6A 3NI2A 4I55B 3Q7QA 1FNSA 2OBLA 1RR7A 4C2MJ 3DFKA 3LT5A 2X9GA 3DT9A 3FM3A 3RGGA 3B51X 4QELA 4WA8A 5DMHA 1QFZA 1REPC 2AQ8A 5LPNA 1R4NA 5BMOA 3AUXA 4O4HA 2YICA 4BKPA 3NYIA 4BBSJ 3V7WA 3MMXA 4C2TA 3AF4A 3T9CA 3ZHYA 4O4IF 4QATA 5B1AH 5L9AA 4WKCA 1KY5A 1NNSA 2KRHA 1XZDA 2GHTA 2NTNA 2XDYA 3LA7A 3ICCA 1YIOA 4BVGA 5BRAA 3DKRA 5AM4A 4DG9A 4EI2A 4OP2A 3R60A 5GAHJ 2VL7A 4MYDA 3W2GA 1L5HB 4ZXPA 5BSMA 3S3OA 2EV5A 4BMZA 1H0MA 3BRWD 3RUCA 4RD3A 4TLCA 5HIJA 5JNTA 2IA2A 3WLIA 1DGWY 3OYIA 2H7VA 4HX2A 5EQJB 4L76A 1T6ZA 1MDMA 1MRZA 4XGRA 2PZJA 4CUZA 2PBRA 4TYQA 4MVJM 4HYTA 1QHHA 3G3EA 5AOCA 1AKRA 3ECCA 1WTCA 3KR2A 3ZNPA 5JDIA 2VT2A 4R41A 2R6R1 1GL9B 5A4DA 2YJ4A 1VSQA 2Q8PA 3TUIC 4WEQA 2XY4A 3NIFB 1XYYA 3PFFA 3HL2A 3RANA 1QGUB 1R5JA 1KEEA 3SEZA 1EHIA 2XCSB 3TQSA 4Q9DA 1YR9A 2W2VA 4E08A 1YJAA 3BS4A 3K09A 3U62A 1H42A 1X1PA 3ZS9A 4OBXA 5AJXA 4WK2B 5LDHA 2AUNA 4MEJA 1WP4A 1AMUA 3THYA 2ENWA 4YRRA 3E82A 1UM9B 2XDQA 3EEOA 3M6FA 1GGHA 3FPAA 1DBWA 3HVHA 2R7TA 4IXWA 2PXXA 5BUCA 1DAFA 2A3SA 3CY6A 4F5DA 3P7NA 2EGGA 5DHAA 1ITZA 3LP8A 1ODKA 1RLUA 3EB9A 1UOPA 1UB9A 4H6VA 5JD5A 1CC1S 2IRFG 1S7CA 1R7JA 1XR3A 4JYAB 1TQ4A 1RZ3A 3L6BA 2DH6A 4COKA 2DMNA 1FP4A 2VBXA 3NAUA 2RFLA 3QEOA 1POXA 4BEVA 5IJ9B 3JD0A 1E1KA 3QWAA 2CWEA 5DTQA 1Z3XA 5SV2A 3RH0A 4Z7JA 2ORYA 4MROA 4N3BA 5HJ7A 2WFAA 1EZ1A 5CM2Z 4EDHA 4WN3A 5C8VA 1ZBQA 2ERCA 3KL4A 1JFLA 2R8YA 4UCWA 3SQMA 3WRVA 1BRMA 5JU6A 4B71A 1WP9A 1UADA 2QU7A 3WTVC 3QVOA 3VH1A 1K7FB 2ZTUA 1EFDN 3KVVA 5L3EA 2O1EA 4B6FA 3ETEA 4BUCA 2XA1A 2BEWB 4UHBA 4UVGA 1F36A 3E7LA 4ZYAA 1MGOA 2DFVA 4KYWA 1MJFA 2Y31A 2GO1A 3D3WA 1N6IA 1SHUX 3A0BC 2D45A 2DHDA 3E3MA 1N2CA 1UBTS 4ILEA 4LX0A 4J1TA 4R5HA 3ZI4A 2L17A 4BVEA 4F46A 4MUFA 4DFDA 1QPIA 2WM3A 5DTIA 3K4MA 4KQEA 4BLPA 5KSPA 5B7NA 1WY7A 1F5TA 3STHA 2E1MC 4AIHA 3DCNA 4KFRA 1E3EA 1SUBA 4OLAA 5JS8A 2VQDA 3FTCA 3TMOA 1ZNWA 4MUMA 2WJ3A 5DM0A 2AMLA 3SWWA 4Q47A 4E7HA 1I4LD 2IPNA 1A7UA 1ZRSA 3HDVA 4IJ6A 4RGSA 1P2TA 1QZXA 3DJYA 3DKIA 5DBIA 5FBQB 3AHEA 2O4CA 3O3MB 5KOIA 4LVUA 4MMYB 3QKRA 3HGGA 4FN5A 4ON9A 5KOJB 2JBWA 4ZVPA 1Z16A 3IC7A 4B48A 1GTMA 3G0C