3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transcription
molecule keywords Response regulator protein
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
2QU7A 2B1JA 2NVQJ 1GUBA 4RKQA 4OG2A 3D02A 3BRSA 3H1EA 5HSGA 1Z16A 3HGGA 3CZ5A 4M3DA 1ETYA 1H8AC 3HOVJ 2M2EA 3F7NA 3G1WA 1BVHA 2CU7A 1EWVA 1LFBA 4D6XA 4ETNA 1TWCJ 2LTPA 2QSJA 4MAAA 3F6CA 4LDZA 3Q0WA 2CHEA 1JUSA 1P2FA 3O8GA 1QO0D 2OF7A 3SQNA 3OLZA 2MSWA 3B6CA 4XLTA 1F4VA 3QEMB 3DCFA 2NVTJ 3PO3J 2I10A 4UHJA 4BXXJ 3KYJB 2O8KA 3IP9A 2XDYA 3TD9A 2E4XA 4YCSA 2DA1A 4RS3A 3MIZA 2WWVD 2ID7A 3NNNA 1GCGA 2WB1N 5EWJB 1NXXA 2E4UA 3K9CA 3HM9A 4MO7A 3BG9A 4W5OA 4ETMA 4RY0A 4MS3A 3BTLA 4O5AA 4MQFB 4QYWA 3CCYA 4CYCA 3H75A 4LZLA 1E6KA 1JLKA 4MLDA 2NT3A 4WZZA 2E4WA 2Q5CA 1JT0A 3GBPA 1MSEC 1GT0C 3M3YJ 1JFVA 3EDCA 3N8IA 2DMQA 1QQAA 3Q41A 1T34A 4B1RA 4JP0A 5CHYA 4KK3A 2CJJA 3FIWA 5FBHA 3RVLA 1GUDA 3QPSA 4XRSG 1IUFA 1K61A 3HKZN 1B00A 4WXEA 5TPWB 3PO2J 2OENG 3LUGA 4G12A 1EF4A 3GT7A 3E3MA 5ED4A 2M0CA 3N6VA 1RNLA 1YTUA 4IEJA 3LUAA 3DGEC 5DTEA 1KMIY 5BRJA 1JFSA 5EDNA 1TWGJ 1EAYA 5E3OA 3JRIA 3I09A 2EZKA 1XG1A 1ETKA 1ZGZA 4KMRA 4F12A 3Q0UA 5D2CA 2WB4A 2R5YB 3JRCA 3EQ2A 1A2OA 1NXPA 2FQWA 3OM1A 2Y9ZA 3O1JC 3HK2A 2B4AA 1LFUP 2LIVA 3JRAA 1MH3A 3BTJA 5EF6A 2L17A 2PUAA 3LSGA 3W9SA 5FWXB 5IUKC 3S99A 2CUFA 1MBHA 2TMYA 2XPVA 2TCTA 4OLAA 5E3LA 3F6PA 1JL3A 3TP0A 5M5WJ 1D1QA 1DCMA 1SFOJ 3P9YA 3A03A 5F64A 4ZMRA 4H60A 3T8YA 1ENHA 3HDDA 4RK5A 5B3JA 1HF0A 1SANA 4N0QA 4JOQA 4D5FA 3GWGA 2O20A 3HOZJ 3DGFC 1WGXA 3JRGA 4MR7B 4Z4FA 3QX9A 4RK0A 4DW6A 3O74A 3ZOBA 3BG5A 2XSDC 3I42A 1P7IA 1ABFA 2IDMA 5KQGA 5IOZA 1PUFA 5K7HA 1U0SY 2DRIA 2HYJA 4MR7A 3O2SB 2K9QA 1YRNA 5EEAA 3QLUC 1YS7A 2DA2A 2E2IJ 2VUIB 2L18A 1DRKA 5EWMB 2GBPA 1SXGA 5TPWA 2MGQA 2AYXA 4YO7A 3JRBA 1QKKA 4MLCA 2FW0A 4W5NA 4YR7A 5DLEA 3JY6A 5C44J 4JP1A 3MMNA 1MNMC 1JKPC 3OOUA 3GA5A 5DS9A 1U8BA 3NNDA 2MYNA 2LR8A 4J19A 6CHYA 4DZJA 5TPZA 1MH4A 1F36A 5FJ8J 2JBAB 1NY5A 4IMJB 2ECCA 4Q7EA 1BA2A 1YMUA 2HXIA 2DMPA 5ABPA 2IKSA 3A0UA 5JLXA 3LSJA 3OLYA 1GVDA 1UG2A 2JA7J 1A04A 3HCWA 3OMWA 3VNAA 3QEMA 1MIHA 3SG0A 3ROFA 1KRXA 1LJLA 3TP3A 4M6VA 1DJMA 3TB6A 4JB0A 4A69C 5TE9A 2R7ZJ 5FBKA 3HOWJ 1QMPA 3S16J 2VPRA 2FEPA 2B63J 4N47A 4W5RA 1Z2EA 4BY1J 4G0MA 2JB9A 5KC9A 1RKTA 1M2FA 2PUDA 2MSYA 2G0EA 3HEBA 3H6HA 4A3CJ 1Z2DA 1JUPA 3KTOA 3NHMA 4YWHA 4ZYLA 1WPKA 1OJLA 1TWHJ 2LD5A 1BW5A 3G1MA 1NXVA 3CNBA 1BDIA 1YK1A 3RVRA 4FE4A 3CKMA 3HBLA 3TMYA 4MIMA 5CNMA 3ILHA 5JLWA 4MFEA 1APBA 5DCLA 2DA3A 1Y1WJ 4LE2A 3CG4A 2R25B 1USIA 5IYDJ 3CFYA 1L5ZA 3CZCA 3K2AA 4FISA 1YK0A 2J48A 2LFBA 1IJWC 2BGGA 1M2EA 1WI3A 1D2AA 2K40A 2HJ9A 4RK6A 3OMXA 3RZOJ 2GX6A 4RU1A 4V2GA 1EWTA 3SJMA 3QPLA 2FX0A 2WAQN 1XS9A 3GTOJ 3LTEA 4LX8A 4Z9AA 3QEKA 3Q3SA 5E3NA 4W97A 7ABPA 1JKOC 2VUMJ 1P7JA 4JX4A 1ZAYA 1JH9A 3IPAA 1FQWA 4D6YA 4ZJPA 3GBGA 1JFTA 4IF4A 3BRQA 5EGOA 2EZIA 3MM4A 3FMVA 3MVPA 4Y9TA 3O21A 4FTHA 5EG0A 2LPMA 1X2MA 4LE0A 4Q6WA 4FCYA 5JNTA 1XHEA 1DP4A 2H0AA 5IX8A 4N41A 1A0OA 4JX6A 1DBPA 1JX6A 1QVUA 3IV5A 3LKBA 1U8TA 3OSFA 1Y1VJ 4YGXB 3IPCA 3F73A 4V2FA 3FK7A 1ITYA 4E7PA 3H1FA 4G0XA 4QPJC 1OFCX 5CNJA 4IHVA 4YP9A 2D5VA 3NNSA 2FLKA 3H5LA 1APLC 3H5WA 1ZK8A 2VI6A 4MRMB 1JDNA 2R4QA 4OBBA 4XFKA 4A3KJ 4DADA 2ID9A 3QLUA 5IYBJ 4RK4A 5M5YJ 1I3QJ 2L9RA 4BBSJ 4M88A 5FLMJ 4JX5A 3G1LA 3JR9A 1Y1LA 1M5TA 5IUJC 2VKVA 5IEJA 3B2NA 2R5ZB 1MB0A 1NXWA 5JS1A 3OM0A 1K68A 5FKOA 5JNVA 4G86A 3BTIA 5C5EA 2DMNA 3TO5A 3Q0VA 1MBEA 2X9DA 1QP0A 2YUSA 2YHAA 2PUEA 3S1MJ 1Q1VA 3EULA 2DMUA 3BREA 3OQOA 2XB0X 4C2MJ 3N0XA 4UUSB 4XXHA 5F04A 2FMIA 3HS3A 2MYTA 3JRHA 1JDPA 5M3MJ 4NV3A 4KPYA 4DN6A 3TX6A 1JT6A 2R5YA 3K4HA 4RY8A 1I6HJ 2KT0A 4RKRA 3ZQLA 3BR5A 1DZ3A 1LE8A 4IRXA 2ID3A 2P81A 1M5UA 1ZGGA 2QR3A 2QV0A 3SM9A 4FE7A 1YMVA 3C3WA 4B09A 2ZB9A 1PHRA 5TQ0B 3RQIA 3RVJA 1EHCA 3SFIA 4JAVC 1DCKA 1S8NA 3C6QA 5FKKA 5IP9J 2M9HA 4YLEA 1YRNB 3S1RJ 1NK3P 2LVSA 2ZWMA 1MB3A 3LUCA 2NVXJ 2LP4Y 3QLVC 1BAPA 1RXEA 1ZHHA 1IRZA 2R92J 1DG9A 1BJZA 3C3KA 2P4UA 1W0UA 2CWDA 1JTYA 4XK4A 5F0FA 2LY9A 5IYCJ 2FN9A 1X58A 3NAUA 1GLGA 3DEWA 4QIWN 1T33A 4G0PA 4PE5B 3OLWA 2IAIA 3DZDA 4D7NA 1IC8A 1BDJA 1U78A 3BR1A 3JS5A 2E2HJ 3H5OA 1AKHB 3BQYA 3N0WA 4KRFA 2PLNA 3HOUJ 5C5CA 1KRWA 2N8GA 4O1HA 3KS9A 5FKLA 3BBLA 3HOYJ 3I45A 1HDPA 5K7FA 4JASB 5DGCA 2Y2ZA 2HI3A 4XICA 1RZRA 4W5TA 1F51E 4AC0A 1TMYA 1D5YA 4GNRA 2H1KA 4KNYA 5EYRA 3HGYA 4BBRJ 3DBIA 2L7ZA 4N03A 5E3MA 5C4JJ 1MBFA 5IC5A 3S15J 3GTKJ 4S0HB 1VNDA 2JK1A 5J1RA 1NATA 4WUTA 1RETA 3HB9A 1QPIA 3O1HB 4NICA 1NXSA 4M3FA 1K83J 5GPAA 3T6KA 2R47A 2ID6A 1ETQA 2NS7A 3FKIJ 2COBA 2EBIA 1B72B 4FB4A 5HKOA 4EVQA 3WHCA 2FMFA 3LUFA 3VNBA 3IP6A 1NXOA 1QQBA 2ELKA 1ZY2A 5PNTA 1JBEA 2RDMA 2JBAA 1JJ6C 1WH7A 2JCGA 2CUEA 2A9QA 4MR9B 1AB6A 3LSRA 4E7OA 1B8IA 2IYNA 1JKRC 2L7MP 1Z77A 4C3IJ 3O1IC 1X2NA 2VUHB 3LFTA 4EYKA 1E6LA 2PE5A 3M4OJ 5IEBA 1F43A 2PJUA 4F3TA 1WH5A 3QK7A 4UUTA 2FJ1A 4W1UA 4NCBA 2L19A 1ETOA 3IP7A 3KLNA 3HUTA 1VLZA 3MA0A 4HNQA 1AU7A 5IBQA 3DLHA 5F0HA 5J3LA 4ETIA 3GTPJ 3TW7A 1IGNA 1NTCA 5GOTA 2H3HA 4RZSA 4MR8B 3W6VA 4PZ0A 1DBQA 1OXKB 5T7BA 3LMKA 2R48A 2R0QC 1ORKA 4RK1A 2A9RA 2F8SA 1ZN2A 1A5JA 2QF7A 2JRLA 2PL1A 3Q7RA 2ZAYA 3HV2A 2IBDA 5GQSA 3HM5A 2F8TA 2E1OA 3HO1A 2HOTA 4CYCB 3E7LA 1JTXA 3CS3A 5EZHA 2MSLA 2NZVG 1BDHA 1UDRA 3SDGA 2X7XA 3IP5A 3CLKA 2L2QA 2FQXA 4MQFA 4OLBA 2E2JJ 5HQJA 3HDGA 5KC8A 3JPYA 4TMYA 4IHXA 2M98A 4DYRA 4N76A 1YS6A 3HZHA 4RY9A 2IOYA 4WXMA 1G2HA 3RVSA 1USGA 1Z17A 2QW1A 2ECBA 2L7FP 2VKEA 3FISA 4L85A 3MQ4A 3RH0A 3H5TA 2FMHA 3H5IA 4HNRA 1XC5A 4A3BJ 1GV2A 1U9NA 3LOCA 3KSMA 3BR0A 1H89C 1SXHA 4PICA 1R8JA 2AHQA 1I50J 4A3LJ 4Z0NA 3S1QJ 4DYQA 1S7EA 4MS4A 2PL9A 4IGAA 4GFBA 2E4ZA 2P9HA 2IPNA 5KQMA 1Z18A 1P6QA 1A6IA 1HDDC 5JNRA 2A9OA 5IOYA 4TLMB 1SD5A 3UKGA 1Z25A 1CQTA 2DTZA 2M1ZA 3LUJA 2X48A 3ZQHA 1ISSA 4H3KB 1PNRA 1Z15A 1LBHA 2O9LA 3S1NJ 4M3GA 1K66A 2JA8J 4XRSA 3S14J 1HOMA 5K7ZA 4P1ZA 3JREA 4M3BA 5DTDA 4Z4GA 2HXOA 4AUXA 3B6AA 2XGCA 4A3JJ 1VRVA 3O2JA 3RVKA 1GCAA 3C97A 4A3MJ 1D1PA 3CQZJ 1I3CA 1RXIA 2CD7A 1J56A 4I76A 4ZMSA 2PUCA 1GUUA 2FD5A 5CNIA 5T3YA 3HXMA 1U04A 3OSGA 4Z4EA 2Y9YA 4M3EA 3G1OA 1ZR4A 3FFTA 2JN6A 2AYZA 5BR1A 1W25A 2FSPA 4RDUA 3RVMA 1IIBA 2QCOA 3HDVA 2NS8A 3ROTA 3GTQJ 5IULC 3ZQIA 2JMWA 3QLTA 1YIOA 1CYEA 3R0JA 3IH3A 1U9OA 4NDLA 4G0ZA 4Z4HA 2FLWA 2HQBA 5M5XJ 3S2HJ 2YHBA 1MAVA 3Q15C 4P98A 3A0RB 1IDZA 2N9UA 2CRGA 4X6AJ 2EQRA 1XHFA 3URMA 5I4CA 3OQMA 2O7OA 2L0KA 3L1PA 3RKQA 2RJNA 4KFCA 5EWJA 3RVOA 5EZGA 1WETA 3E61A 4KQ9A 2FKAA 3EAFA 3KG2A 4D74A 1E6MA 3QLVA 4JYKA 3GL9A 3NHZA 4MYRA 3CHYA 3WHBA 4QYMA 4D7MA 3JTEA 3DLBA 2HPHA 4YRZA 2GKGA 1FIAA 1HLVA 1CHNA 4JB2A 2XRLA 5BQ3A 3JVDA 4A93J 2E4VA 1RR7A 3A10A 3JVIA 1JHZA 1E2BA 3BR2A 3KLOA 1YVUA 4BY7J 3H3VK 3H1GA 2E19A 2QZJA 4IMIB 2NT4A 2DMTA 4A3EJ 1CEYA 1E3OC 1W0TA 2R93J 4L4UA 4MR8A 2LP0A 4IILA 2HOAA 4LOCA 2H8RA 3T95A 1ABEA 1USKA 1EWKA 4EUKA 2E4YA 3HUUA 3ILYA 2EZLA 5J1YA 4XARA 1LK0A 1PEAA 1L5YA 2Y31A 2CQQA 3FFXA 4RDCA 3GTJJ 3N53A 1PUXA 4RWEA 3GTMJ 1VPWA 1C4WA 1NTRA 1BL0A 2JVJA 1TVMA 1ZITA 1O4XA 2FN8A 3T38A 3GBVA 1H88C 5GPCA 2FQYA 3CG0A 1DRJA 3MF4A 2K9SA 4EYOA 1RZRD 4DZPA 3BT9A 1JUMA 4Q6BA 1HCRA 4G0QA 4ZPJA 1BA5A 1VF9A 2V0NA 2WMYA 3UUGA 1RESA 4RBOA 1LBIA 4MS3B 3M9XA 3FK6A 3IH4A 1FSPA 3CTPA 1ZDMA 4Z4IA 4LRQA 2FEWB 2LBPA 4PYRA 4RSMA 1PEYA 5JNUA 3QQAA 3RVPA 3D8UA 4N0PA 3MYYA 2DN0A 1OXBB 3S2DJ 1TLFA 1QP4A 4DQDA 1DU6A 2DA4A 3ZQGA 4PEVA 1JKQC 3A01B 4TN5A 1DC8A 1RPJA 4A3FJ 1XWWA 5FLVA 2MW8A 5EGOB 2W48A 2IPAB 1H9CA 5TPZD 1RKWA 1OCPA 1D5WA 3A02A 1Z12A 5IP7J 1MBKA 3GTGJ 3IH2A 2RJOA 5TQ2B 3N0RA 2OPTA 3LUDA 4ABZA 1EFAA 3A01A 2IPLA 3BQZA 1HEYA 4XIDA 3CMYA 2WJAA 3OIOA 4HNSA 4MQEA 3O8HA 2Y0SN 5KQPA 3D1NI 3CDLA 1FEXA 2QVCA 1ETXA 3S17J 1VFCA 2LLKA 3K7AJ 1FTTA 4KVFA 3FFWA 3TW6A 3LUHA 2HQRA 4A3GJ 5FKMA 4F8JA 4NCAA 3N75A 2WY2D 4LDAA 5BNGA 1OCTC 4Y7NJ 3RZDJ 4YV7A 1TM2A 1URPA 2MG4A 1FTZA 5HM6A 3KHTA 3RVNA 2X6OA 2WJWA 4WWHA 3HEFA 5J1UA 4CBVA 2FMKA 2I6FA 4YS6A 1GV5A 5BRAA 5FWYB 4Z99A 3MKLA 5KI6A 2VK2A 1ZKGA 3LSPA 2FTKE 3MN2A 4RXTA 2RGYA 4EEFG 1ZR2A 1U2QA 1UHSA 4A3IJ 3L49A 1TC3C 1NXTA 4Z9BA 3L6UA 2FQ4A 4OTZA 1TJYA 4EY3A 2M34A 2NOGA 5JNSA 2ME6A 2DA6A 1W9HA 2XGDA 2DJNA 2XGEA 1RPWA 1B8IB 2AO9A 5TQ0A 4W5QA 3FGZA 2NVYJ 1ZGWA 3HJFA 1Z0XA 3QELA 4F06A 4HNVA 1U2PA 4NQRA 4MFDA 1AB5A 3BR6A 1SXIA 2RAEA 4MLOA 1DBWA 3LOPA 5C4XJ 3KKEA 4QSHA 2PUGA 1KGSA 4QTRA 1JYEA 4UHKA 1MBGA 1ZESA 2JVKA 3JPWA 4MS1A 2JWTA 3BILA 2XPWA 3FDFA 3G85A 3OLVA 2HQ5A 2JK3A 4JA2A 1LE8B 1DU0A 2DA7A 2IPMA 3M9WA 5KWSA 1IV6A 4MQEB 3JRDA 4OATA 4KK4A 4EVSA 2EZHA 5TQJA 3HVRA 3GTLJ 3HOXJ 1GDTA 1QNLA 4IHWA 9ANTA 4MS1B 3A3KA 3Q9SA 4I6ZA 3HSYA 1VI0A 2QXYA 1PNTA 3GV0A 2PUBA 4MR9A 2DA5A 3H5VA 2HQOA 4G0OA 4G97A 4H3HB 3ZQFA 2GI4A 1ISRA 5EWLB 2KYRA 4EVRA 4B4CA 2NZUG 1TWAJ 1POGA 4KZKA 8ABPA 1D4ZA 1JF8A 1AKHA 3PM1A 4O1IA 2HOSA 2YS9A 1MBJA 4B3AA 5E3JA 5GP9A 1B72A 4XAQA 6ABPA 4UUSA 1ZH2A 3OQNA 2JA6J 4X1EA 2XB5A 2W42A 3UKJA 3CRNA 1QP7A 1C0EA 1JYFA 1ZQ3P 3I4NJ 2MYUA 4IHYA 4D5CA 2JJ7A 4BKXA 2JA5J 5EWLA 5FWYA 2OQRA 2YU9J 3O75A 9ABPA 2CQXA 5F08A 2M8GX 1MSFC 5EG0B 4Z4CA 4EYGA 5FKNA 4A3DJ 3EQZA 3NARA 4MS4B 2IEKA 2R5ZA 1Z13A 3QX8A 3M6MD 1IDYA 4XASA 4C3HJ 4G0YA 1ETWA 3F0CA 4MPTA 2LK2A 1PUFB 3IDOA 5KQLA 1T56A 4S04A 1P8AA 5IP6A 1FFSA 1DC7A 2GM4A 5DKFA 2NUBA 4AYBN 4RK7A 5B3JC 3QELB 1FIPA 5F1JA 1WCMJ 2PUFA 1ZTRA 2ME0A 1JJ8C 3LKVA 2FEKA 2GWRA 5EWMA 2EH3A 1QO0A 3I5AA 4GPAA 1ETVA 1UMQA 1ZVVA 4WT7A 1SRRA 4Y52J 4KREA 2JVIA 3GYBA 5CNKA 1FFGA 4L5EA 1BW6A 5C3EJ 3O2QB 2TRTA 4ML3A 3BG3A 3KYIB 4EGSA 3OLXA 3H0GJ 5JS2A 5F0CA 1QPZA 1ZH4A 1QVTA 3SAJA 1DCFA 3Q7SA 5IPAA 2LUOA 3BR3A 2WRZA 2VYCA 3C3MA 1FFWA 3SNKA 5M3FJ 1FJLA 4KQCA 1JWLA 2PMCA 1NK2P 3LNQA 4MGEA 3I4MJ 2GBYA 3OO1A 2FXIA 4EYQA 1AHDP 2PAFA 1LJUA 3OO0A 1IG7A 2HDDA 2QVGA 1VKRA 3GRCA 3LUKA 1MVOA 3Q7TA 3C2BA 4RV5A 3CU5A 3EODA 2WV1A 4DYCA 2A9PA 1Z26A 4C3JJ 2XPUA 2LKXA 2KDZA 2GLOA 1TWFJ 2FVYA 3EJWA 1R9TJ 3UK0A 3RVQA 3KCNA 1P6UA 3EGCA 3VPRA 3NBMA 4RXUA 2MSKA 2CHFA 3BTCA 5FWXA 4MRMA 4S05A 3ZQCA 4RXMA 3KJXA 3TEDA 4LE1A 5TQ2A 4F11A 1QRYA 4KV7A 1JGGA 3JRFA 2Y30A 4TLLB 5JNWA 2PKXA 3SY8A 5IUNC 4QICA 2HSGA 5F27A 4XRMA 2MYPA 3H6GA 2PMZN 5HODA 4HYEA 2K9NA
chains in the Genus database with same CATH superfamily
3ZCQA 5FWNA 2ZJ6A 2B1JA 3II6X 1XSDA 1TYAE 1GUBA 2R60A 2SECE 3B6ZA 4A10A 1O97D 1OA0A 4DCCA 5KMGB 4G56A 1U8EA 2VDNB 2LH9A 2CLDX 4DJDC 3D02A 2X3FA 2B98A 3K15A 1JXOA 1QFYA 4UU8A 5IP5A 3TEFA 3WIBA 2VC1A 1XEAA 3R5TA 2Q1TA 5A9SB 2W37A 2QE7A 3ETJA 1PSDA 4IDAA 4KO4S 1UFOA 2O1XA 3CZ5A 4MVJM 1UXGA 4M3DA 2P8SA 4EHBA 5LWQA 4X65B 4BOYA 3QBJA 4V19K 1A82A 1RI4A 3I1FA 1IHXA 3MVEA 3FLMA 4MVWA 4GLBA 3ETHA 3F7NA 3G1WA 4QTXA 4XFJA 4XD7D 1EWVA 2K5UA 2HDCA 3AZQA 1LFBA 2RGVA 2YXBA 1GNPA 3AP3A 3DCYA 1V8DA 3RQSA 3WHKA 3PHJA 4R6WA 4ETNA 3FXUA 2VAWA 4F97A 4BNDB 4COKA 1EUDB 1AO3A 1DX4A 1GA1A 1U1EA 1VCIA 2VIXA 1NNLA 1WCIB 2ONKA 1KEEB 2UUOA 2IPXA 4BE0A 4RMNA 1VQ4I 1V7ZA 2UYQA 3OYDA 1VXOA 4RH0A 5H70A 1QH9A 1ZCBA 3CT6A 4N40A 3VPHA 3WDMA 3WWEA 4OO3A 2AMFA 4MUAA 4I0AA 3T1YB 3AF4A 4BBPA 4BQRA 5CEEA 5TISC 4NSNA 1FP6A 2R7TA 4P2BA 3OLZA 4Y17A 3TO7A 2EA4A 1NMZA 5DM60 2MSWA 1CE8B 4RSRA 2EBHX 3UAXA 1DFHA 1FU4A 2LKSA 3Q85A 2PIDA 4NE7A 4XLTA 2NU9A 1ECLA 2QAJA 3JQDA 4DUPA 2NV2B 5HS8A 1F4VA 4B47A 1GAJA 3UENA 4KQIA 4DILA 1AUPA 3JTHA 1JMKC 2Q0OA 2HFKA 1NW7A 3WI7A 2HC9A 4BO4A 1D03A 2FUG2 3PQ7A 3SC4A 4Q1DA 1XL1A 4GGGA 4M60A 2J4DA 4BXXJ 2VYVD 3IRVA 4U2CA 2YJGA 5BWBA 1JDBC 4YIHA 4FKMA 4ZDOA 5ALMA 1M6VA 1SUSA 1UXHA 1ZGJA 2VZEA 1QE0A 2IELA 3ZQ6A 2XNDD 3AILA 5T4FA 4F45A 2XDYA 4KH0A 3ELWA 3BCRA 4XJTA 4POOA 4INOA 4FBLA 1X0VA 4H4EA 1DTEA 2PYIA 1X3UA 2AXLA 3H36A 4C76A 3VX3A 3ESBA 4YCBA 1PT7A 3K2ZA 1HQDA 3H9EO 4ZZ0A 2XX3A 2C97A 4ZVVA 3ONEA 2EFEB 4OMZA 3MBOA 4FD3A 1MJAA 4CTNA 5BW5A 1E5DA 5IVHA 3DG9A 2WB1N 1YOVB 4AJ4A 1QHEA 2IGNA 4MVYA 2F5CA 2ZAIA 3I55I 1E7RA 5AJHA 1T08B 5A6SA 3AEQB 4D41A 3ITEA 3T5BA 4L5BA 1S2DA 1ZD1A 3REOA 2BFOA 4JBHA 5FOXA 4UTXA 1S01A 3HG9A 2WAYA 1UOQA 4BNKA 5B1BH 3BG9A 1JQ3A 5DISB 1DKPA 1CF7B 3CLVA 3KQUA 4X7BA 2CN1A 3P52A 4S2EA 5EY5B 5TDHA 4B31A 4CEIA 5B6JA 2VQSA 5DEOA 4BJ3A 1T0FC 1ML3A 3G0CA 2JI8A 4Z2YA 3I37X 4B6OA 4GYYA 4MQFB 4XMYA 3LC2O 2NSJA 3B6IA 3E53A 3QPUA 1Q0UA 4JDUA 5DX0A 3WQSB 5JY6A 2GH1A 3PU6A 4J3NA 3O7WA 3LDHA 3PQ6A 4LZLA 5IN5A 4EECA 1FEZA 1JLKA 2ECQA 2CO5A 3JYQA 3QYAA 3R6WA 4MLDA 3V1KA 2NW6A 3PTAA 3TOAA 2NT3A 2ZLBA 4U39A 3SGLA 3ZY3A 3FZQA 2RI0A 5E6SA 2E4WA 2J45A 4DDHA 3NBZC 5BN3A 3F1LA 5DI9A 1SMYF 3I5UA 1IWOA 1X8XA 3NETA 4O4LB 1HG0A 4MV6A 5DT2A 2JH8A 3ZWCA 4X94A 4FYMA 3SQWA 4WV3A 5BV8A 2RCNA 3OCVA 2HCBA 3GBPA 5JWOA 2UXDB 1T4CA 4YT8A 3Q5FA 2OWDA 3O92A 1Z7BA 1U5CA 4FZ5A 3VOBA 3KIPA 4PQYA 1CF7A 3L82B 4QQNA 4AG3A 2XRZA 2HRCA 2FPXA 3LT2A 4QBTA 1C8BA 4ZCMA 4F72A 5AUPB 4IMPA 4BEHA 3IKMB 5LQAA 1PDOA 1B7GO 1XZEA 8GPBA 2OLEA 3OZIA 4NU8X 4UDYX 4KK3A 5EKSA 2QYSA 5B3KA 1CR2A 2VJBA 3SQLA 1U8RA 4MRMB 4MRAA 4BL5A 3ECAA 4UFOA 2Y1GA 3HXTA 1MU0A 1J1ZA 1OLUA 3OQPA 3AWIA 2QVYX 4X61A 5JNLA 2DECA 5JHGB 3AXSA 5IT3A 5J43A 2AA3A 3EGOA 2PMDA 1L4BA 3QEBZ 4NPCA 1JHXA 5HRAA 4QPQA 4JGBA 3WIDA 1OPRA 3HKZN 3GVHA 1T15A 3ACDA 3JXEA 4NJOA 4QNNA 3QVWA 4WOJA 1E20A 2MJLA 4CFYA 3U4QA 1PNVA 1H5UA 3OWOA 3PDHA 4UE6A 5BQOA 1RCUA 4G12A 1EF4A 3NONA 3UWDA 4UEWA 2Y1EA 5BUZA 3DUWA 4URHA 5AM3A 5IK2D 1H4QA 1UT8A 3RU3A 1BU5A 4UHDA 5EKDA 4G8JA 1SXJC 5HJ7A 1RNLA 2NS0A 1XJWA 4LJZF 2FH5B 3HL4A 1IN1A 2W6ZA 3UF0A 2I7CA 1SIBE 3IOMA 2UKDA 3PGXA 4X91A 4HL6A 1X4PA 3SKVA 3K0FB 7AT1A 2JJQA 3K0FA 3UGJA 1JHDA 1JW9B 1UDAA 4BNYA 1JFSA 3HDHA 1EAYA 3KTFA 2PLRA 5CGQB 1XIVA 4ABTA 4DLKA 5E3OA 3JRIA 1ERDA 1BMTA 2PU7A 2DE0X 1LVAA 4BE4A 2WWRA 1YJXA 1STZA 1GL6A 1NBHA 2FMUA 3H3FA 3OPYA 1GGVA 2AN5A 3L6DA 4K9DA 4KMRA 5EJ8A 4IKPA 4UTVA 3B1VA 3Q0UA 1Q20A 1J5YA 4WN9B 2GZMA 5FI0B 4BFLA 4DIBA 5KMGA 1GLNA 1HNWB 4GBMA 3PEEA 3PI6A 2EFJA 1ZSVA 2WB4A 5D01A 2V6FA 2VDWA 1FNSA 1LC3A 1T4DA 5JISA 1M2KA 2GA8A 4Q1VA 3ZHSA 2ZT6A 2PQMA 3LDAA 3LKZA 4LMRA 5K4HA 2FMTA 3NTVA 3SX4A 5FNZA 3EQ2A 4YIIA 1C9JA 3IT3A 4RHTA 5BY2A 1NXPA 3WIUA 3AHGA 4U87A 3OM1A 3UMJA 3IIEA 4CA0A 1TIBA 1G3YA 4I19A 2Y9ZA 4LDPA 5JVDA 5F76A 4AY2A 1YDEA 2WHXA 3O1JC 1FSHA 1RAHA 1LFUP 1AY0A 2B4AA 3GELA 4ND8A 4EDHA 4YCMA 2LIVA 3SICE 3AV0B 5TGDA 3QSYA 4ZAGA 3NT2A 2PUFA 1OI4A 2HCTA 3OM9A 2ECPA 4HWPA 1JQAA 3FB4A 4B3FX 4E08A 2L17A 2PUAA 4Q3DA 1ZNWA 4WNAA 2YYSA 4WNAB 1LB1B 3RABA 1K79A 2VKHA 4XDYA 3ZXSA 3MWEB 4UUNA 5E1WA 3W9SA 3S81A 4N9IA 4X6XA 2DJIA 1D4AA 1GQFA 1CUWA 4N6OA 3S1AB 1R6RA 1QPBA 1YQXA 4CLEA 2NTYC 1YFLA 4YCNA 3IODA 1E61A 2DPGA 2GPYA 4QHSA 5JD4A 4JDPA 4TKLA 4KLZA 4R9RA 3E0JB 3RPEA 1M2JA 3AT1A 2TMYA 3FCXA 2BJWA 4TKUA 3KD3A 1MT3A 4Z8XA 4DC1A 5E3LA 1Q7RA 3DL4A 2ZQZA 2Q6KA 3TP0A 1JAZA 4UB6C 2L42A 2PEYA 2KSQA 3I12A 1B6GA 1ZWKA 4AJPA 2VHCA 3ONWA 4Q5IA 3RBVA 2NZYA 3CX8A 2ZTSA 3R77A 5CVVA 1QHHB 4O25A 1O5IA 2VSXA 1LD3A 3UC9A 4KOEC 2AW3A 2Q2WA 4XOUA 5F64A 4ISCA 3FCSB 4ZYZA 1JU9A 1Z6PA 3QPAA 2CMGA 5CITA 4F4HA 5JZBA 3LK7A 1ENHA 4I0BA 2ZYUX 4O4JB 3R7LA 4HA8A 2WOJA 3J7AO 2X6TA 4A0HA 3HUDA 1RJDA 2C77A 2GHIA 4HC4A 1NTOA 3JVEA 1NOJA 2BHZA 1H0MA 5MGNA 4QGSA 2BJHA 3L9WA 1AQIA 1KH3A 4UTRA 5C53B 2X0KA 2BDTA 2ZRQA 4JMPA 5BNFA 5C18A 2JRMA 3E6DA 1P81A 2XIGA 1RLUA 2VTVA 2O50A 3QPDA 2O20A 1PQUA 5CIYA 4RSGA 2XB6A 4XWGA 2QQFA 4NIMA 2PKRA 1YA4A 1KNXA 3DE4X 3GGGA 1WSUA 1FBUA 1CUHA 1RJGA 3PQ4A 3HUGB 2OCYC 2XD4A 4MR7B 5EC8A 3DFZA 5F7ZA 3T1NA 3V4VB 4I14A 1IN4A 1XTSA 1CUSA 1V9SA 2G70A 2I2XB 3ZPXA 4LQCA 1T5SA 2W4MA 1PNOA 2GF2A 4E21A 3LA8A 3NHFA 3P1JA 3JYHA 1V5FA 1BHJA 3L43A 4X95A 4UB8C 3RYHA 1I94B 1G8PA 2QTAA 4D3DA 5EESA 1BDBA 5INTA 3TCXB 1QVZA 1Y6GA 4OHBA 1FRZA 2WJZB 3VISA 3S6JA 5IABA 2HRBA 3O8QB 4MA5A 1T2AA 4W7SA 2O2HA 3EGXB 1DFIA 2IDMA 4KE6A 2IZOA 3RIMA 3DMTA 1ZRHA 4FD2A 5KQGA 3PHCA 3TRHA 2QQ0A 1SGWA 4D46A 2O4UX 4WNCA 3MCTA 3H6KA 2OCEA 2OHVA 2XQVA 2A69F 3RJ5A 2Q1ZB 4DUGA 3FXRA 4UBLA 1QIEA 4EM6A 1P3JA 3HKBA 1KOLA 4W7HA 4ZT4A 5K7HA 1U0SY 2IHVA 2V98A 2BLLA 2DRIA 3DOUA 4ENPA 4GGOA 2EQBA 5DD4A 4RZ2A 1W52X 3DHWC 1Q0RA 4MYDA 4WLNA 5J4VA 1T4CB 2WIBA 3IULA 3G9TA 1O96B 4NY1A 1SQGA 4FUTA 2I99A 1AXEA 2LREA 1YRNA 4L74A 4P35A 5J63A 4YRSA 5LN1A 2Z8YA 3ZJTA 2LDUA 4D99A 3TZQA 2IITA 3FWHA 3ESXA 1N1DA 1IM8A 2CXPA 1YS7A 2JJYA 3PPVA 2IWRA 4MTEA 5B1HA 1CRWG 1HFKA 1BFUA 1SOVA 1WZEA 1XDDA 2G9RA 2Z2KA 4FYPA 3H9JA 4LQLA 1JECA 2IEZA 1ZINA 3RC9A 2AQIA 3UHPA 4FI3F 4GC5A 4IEEA 1MDMA 2Y66A 2V1DA 4A6EA 4P5PA 5EWMB 1E4EB 1AS3A 4BC1A 1UBJS 4A2UA 2O05A 2YV4A 3ULKA 1BXRB 3OSZA 4CG1A 2CL6X 3TM4A 2XMGA 4F60A 5A9SA 1PFQA 1WXGA 1C7FA 4JB3A 1WJCA 4A9AA 4LXTA 2V5AA 2VXBA 1KQGA 2FYTA 3A9UA 4K9QA 2BEUA 2OXRA 4GT1A 2AYXA 2GIZA 1LU9A 3DFMA 4KH1A 4LHVA 1N9KA 5C3UA 3JRBA 2W11A 3IBCA 1QKKA 4RS8A 1FTWA 4F4CA 3I5YA 1SHZA 2B0LA 4FHZA 4W8HA 4F2WA 3GPIA 5ES4B 1QTQA 4DLRA 1WQ4A 4XLAA 3GYGA 4TVOA 2VH1A 5EG5A 1XD2B 2WHEA 8OHMA 4ON0A 2FZWA 1SXJA 2C8LA 2HX1A 3BMCA 2J3KA 1DPRA 1CJMA 3M1CA 3KXLA 4E2WA 1MNMC 1E0SA 2H1VA 1MEOA 1QVRA 2QXTA 2XRFA 1I6MA 3QPCA 3UH0A 1E2IA 1C30A 1MAAA 3OE5A 3OFVA 5K3FB 5DE3A 2L3DA 1LPNA 1NQUA 3E7XA 4DZRA 1X9IA 1PAUA 3GA5A 3ADCA 3I6MA 4EWLA 2WM3A 1GG9A 2WMOB 3QHQA 4CKBB 5C51B 1K0FA 2SKEA 4G89A 3ST7A 5EJGA 3CW2A 2EF1A 1DAFA 1ULTA 3T0YA 3EYIA 4DZJA 1BWQA 3EB9A 1B8PA 2GTPA 2PKCA 5TPZA 3U3ZA 1SVNA 3OZFA 1BC7C 1Z5OA 4DQLA 3G17A 2WIFA 2PK3A 1E2DA 1NY6A 3U0VA 1CERA 3FF5A 1HC7A 1HXHA 4BU2A 4QUGA 3RSLA 1M34A 2C9YA 4LJ4A 3PQ5A 3WU1B 2NAFA 2W2NA 3OLCX 4IMJB 1FUEA 2ECCA 4Q7EA 1P6XA 1Q17A 2K87A 4L9AA 5IAAA 2LIPA 3WK4A 5LB4A 1WJFA 4C7OA 4D26A 4ITVA 2IPOA 5GP1A 4RELA 1D2CA 3E81A 4O2RA 5KPDA 5FUBA 5A0VA 1HX7A 2F4NA 4XOPA 2IKSA 1F8GA 2CLEB 3A0UA 1A9ZA 3W6OA 3HDTA 4WD3A 3S8YA 3HFGA 3X44A 3NHWA 1N8TA 2UXBB 4XKBA 2QUIA 3L02A 3OLYA 3BXZA 3C8MA 3E48A 1QHXA 1WQ2A 1WQ1R 1GVDA 2OO5C 4L9RA 1P19A 2VTBB 3B3JA 1O97C 3G0OA 4QVGA 1PP7U 2WG2A 1XGSA 4EW6A 3HCWA 3GP8A 4ZC3A 1XB2A 3NWSA 3QOYA 3VNAA 4NBUA 5A2GA 2H5JA 1XZDA 1NJSA 1PI3A 4HNHA 4KIFA 4B4WA 3ZDRA 1FC3A 2GRJA 5HR5A 3LTNC 2OUKA 1I2MA 4R9VA 3AVVA 3ZD7A 1EP3B 4H77A 1JEAA 2NYXA 3DTIA 4I4TF 4U6NA 2IBTA 1R6BX 3U4HA 3MD2A 3IIJA 4GI5A 4OXNA 4MPPA 3TP3A 1SKMA 2WJYA 4C4PA 2X51A 2CXUA 4GMDA 3V8EA 4GZ3A 3AB7A 5TE9A 3I9JA 4J75A 4DKXA 1CFJA 4DA7A 2PDAA 4MV5A 1OWMA 3OZTA 1N2ZA 1CZUA 1RXYA 1RWXA 1YQWA 3QVLA 5THKA 4ZYXA 4A1FA 4HDNA 2VQFB 4CI0B 1I39A 1EH5A 4E11A 3UMRA 3IUQA 4AD9A 2UYCA 2VQCA 2WWHA 2ZJAA 1JHHA 2VPRA 4JC8A 3AM4A 1LKZA 5ENVA 3U16A 4NXMB 1TZLA 1WVGA 1UB9A 3DWLE 3TGNA 2B63J 1K08A 3BZBA 3P97A 1VL1A 3RF7A 3K0KA 4KO3S 3OTOB 1DGWY 1KSHA 3UJ8A 3IESA 4MARA 3GMDA 4HADA 3T5MA 3T7IA 3BHNA 3W5HA 1ZARA 5FORA 5KC9A 5JDIA 3ZZMA 1QK5A 1QQ6A 3FTNA 4KG7A 3ZLTA 4JEUA 1HE2A 1E8MA 1M2FA 4JJIA 3KSUA 3FW1A 2ZZKA 4CLXA 3OYKA 3FZYA 4BZZA 1E5QA 2VHZA 1W34A 2YWJA 2O8EA 1LDBA 4X7PA 3HEBA 2E71A 4WZ6A 4A3CJ 1P45A 5EFZA 3TXYA 1N7GA 4OOFA 2OV8A 1S3SA 1VKOA 3AY7A 4JITA 4GQAA 1K6EA 3NZEA 2H9IA 3CLOA 1B14A 5HOEA 4V1CA 4A12A 3GI1A 4EL5A 1BW5A 2WU0A 5K45A 3G1MA 1NXVA 4AUMA 3R9XA 3A06A 2EATA 4G9GA 4OX9B 1BDIA 3T7EA 1A5BB 1SUBA 1ZIXA 2I1QA 2XGOA 3CKMA 2X85A 1TPYA 1V5IA 3INRA 3CLSD 3WNBA 3S3TA 3LQQA 5KNCH 2J6HA 3IQXA 5J2UB 2YY5A 4MW9A 4D98A 4ITUA 1O0SA 4PSAA 1WJAA 4KXNA 4CKYA 4IHTA 3IB3A 2C03A 1ZMRA 1SQSA 5J3JA 4EGFA 1EKEA 2R6ZA 1UMBB 3O3CA 4QDOA 2JAHA 4LSWA 3W05A 3CVOA 1Y89A 5HW0A 3V8KA 5I9IA 4P53A 2XPCA 3PNYA 3CB4A 4RD2A 2LNBA 3VZDA 4LE2A 1OYOA 2F5DA 1SXJD 4ZT5A 3V7NA 1FZTA 2JIOA 4HEQA 4NB5A 2QLZA 1USIA 2Z5GA 4ZAWA 3CFYA 4XGQA 3C70A 3WQQA 1ML4A 1XE3A 2J07A 5HYVA 1MW9X 1R88A 2VZ9A 2BW3B 2RB5A 3UBMA 1HE5A 2BONA 1IN8A 2R6JA 3WGIA 3Q8KA 3G73A 5GJBA 5AMXA 2AH5A 1RACA 4GYIA 4KDCA 2AXQA 3PL8A 1IJWC 4Q4LA 1XTAA 3VHXB 2HYIC 1AH2A 1SBNE 1NU8A 4YJGA 5L3BA 3KXDA 4CODB 5HS4A 5JXGA 1QZZA 2K40A 2M5WA 2HJ9A 4RK6A 5C5IA 4G3XA 4EO4A 5ITZB 1JKXA 4W9MC 2ZRHA 2A57A 2HEGA 1AZLA 3KM0A 2CW8A 4FJ2A 5E2AA 4FBMA 1G7CA 1Y4UA 4AXXA 3C3AA 3FYUB 5HFNA 1S96A 5F23A 3HHHA 1TX4B 1R0SA 3HBFA 1SUAA 4TXNA 4M36A 4DLTA 3NOVA 1X7YB 2J0UB 4FMDB 1XRSB 4LNUA 1W1IA 1S8OA 4NYMR 4UNIA 1S02A 3X1XA 1NQXA 3HR4A 4FIDA 4Y1RB 1P4SA 2WAQN 3GTOJ 4CMHA 1KI6A 2H00A 4F3YA 4FN5A 3QEKA 3P9IA 4LB5A 4LX8A 3Q3SA 3NBUA 4NJEA 4Z9AA 3KYDB 4DSNA 3IA2A 4QO8A 3OQBA 7ABPA 1JKOC 1XZMA 4JJGA 5KJCA 5P21A 2VUMJ 2VLBA 2HQ1A 4BRZA 3MS7A 1PCXA 1U9YA 1A7UA 5HOOA 3H2YA 2GZAA 1T9DA 3CH7A 4QJBA 4P9NA 3LS2A 4Q4AB 5G4KA 1HSJA 4FDUA 5JDCC 4BFTA 1DELA 1PL7A 1X8KA 2IYSA 4DCVA 4ZZ2A 2JSCA 1FQWA 1MAUA 2GFQA 4DMFA 3SXPA 3FXOA 3QHPA 5TJ9A 4D6YA 1SG9A 3EQ9A 2QS9A 4P5OA 4QLCU 3AJDA 5HFAA 3UAGA 7YASA 3LH5A 3JWGA 2QRMA 1NF3A 3BRQA 3KEOA 3MKZA 1KKUA 4WXYB 3G2HA 1H4TA 1SVLA 2O0LA 1J75A 2PXXA 3OZCA 2KZVA 4PFOA 2HZBA 1X42A 1W5FA 4WWCA 2ELJA 3FMVA 3GCMA 3WTWC 3OT1B 4NLLA 5I8WA 1J4AA 3BRCA 1WP9A 1ZQ1A 1J8DA 2IHTA 2IUEA 2R8PA 3WTCA 2Z9CA 4WECA 2ECKA 5IRCD 3BB1A 4H6WA 3B8EA 1N1MA 2Q5HA 2YWFA 1SOAA 3H86A 3C1DA 3OOWA 4WXDA 5CVIA 3FPBA 3JVVA 2WQZA 4OAQA 4U7HA 2WJVA 3W77A 4CNQA 4K6GA 4S12A 1KHTA 3AO0B 3AR8A 1MRSA 1Z0AA 1X2BA 1Z6QA 4DRXA 3AL3A 1JAYA 4F1KA 5IX8A 4MIEA 1KAQA 4PVCA 5ADWA 3ADPA 3SEZA 4B43A 1DE0A 4L16A 3WRXC 3W78A 1ELOA 3DM5A 3ZV4A 4KQWA 1T6XA 4CV1A 3EEOA 3D9QX 1MTOA 3O3MB 2AG6A 1EFDN 2I0FA 4JX6A 1YVPA 2Y1KA 1K6MA 1YONA 2YVQA 4TQAA 2DPYA 3VYVA 5DNCA 1JX6A 4W5JA 5KO2A 1QVUA 3M6WA 4WZBA 4CTKA 3EVZA 1KK1A 3U60B 2X76A 3GJXC 2FU4A 3OSFA 1FFYA 2P9QA 3ABOB 2BP7B 4BUZA 2DJ5A 2PLYA 2AG5A 2EFDB 2WAFA 3G2IA 4L8WB 4HUJA 4E4TA 1ATIA 3MTAA 4V2FA 3FK7A 1HKHA 2GZ1A 3MELA 3OESA 5FQNA 5K01A 1J39A 4I5IA 1Q1ZA 4L5IA 3OCJA 4QUEA 3KSRA 3VOSA 2MH9A 5LBUA 4ZDJA 5KJ6A 3N5CA 2MMCA 1GY8A 2WICA 1J20A 2COKA 2JNWA 1ACIA 1EGMB 1WTCA 2C2HA 1T4MA 2HXSA 3GNSA 2C5FA 3GB9A 1FJ2A 3L18A 5CCDA 3SZ3A 1K5GA 3K4CA 3W3CA 1XTRA 2DFEA 2B6HA 2FLKA 2X0IA 3NBKA 3NNSA 4L5YA 4MGHA 6GPBA 4FHDA 5GJCA 3VB2A 1DU4A 4XFKA 5EZYB 2ETHA 3DC2A 4W1RA 2VDUE 1YQQA 3M07A 4MQMA 1ATZA 1E5TA 1B6AA 2FJ0A 1NASA 1VE6A 4ND2A 2G1JA 2WA2A 1G3SA 4PLYA 3SDSA 2AJTA 4B7XA 4PHTA 4DADA 4P0QB 3S44A 1UOOA 3QLUA 3Q2IA 2ZNYA 1JQDA 5JQWA 2P77A 4C3OB 1W73A 3O38A 5CFPA 2ZPUA 3TFWA 5EXTA 2BP7A 4ZCTA 1AO0A 3QFFA 3QFCA 3A11A 2BKUA 1YRBA 2XRNA 2QP9X 5ALQA 3A6JA 5M5YJ 4MROA 2GEDA 4PJMA 4KEAA 4MDHA 2VTKA 3HB0A 4IXMA 4QOEA 2IXSA 3I9KA 4BBSJ 2R7DA 3VFZA 1S8FA 1BRTA 3BSSA 4JX5A 3NHSA 4Y6QA 4Y2VA 3JQBA 3JR9A 1P44A 1VYTA 1EDZA 1ZW1A 3DH0A 3LWZA 3TO9A 2Q3LA 2O8NA 2ZR7A 5AICA 2VKVA 5AK0A 1ZUHA 3JRWA 5IYZB 3CVYA 3ILVA 5BVHA 2R5ZB 5AHWA 1NXWA 3IX7A 4QDZA 3ER8A 2R3SA 4O1MA 1MD0A 4MKGA 3G3EA 1U31A 3DLIA 4E5UA 3DD5A 1YS4A 3KR0A 3JAKB 4GGPA 3PJGA 4TS1A 1K68A 3ZWPA 5ALFA 4WX9A 2GOMA 4EQZA 4PS1A 5JTUA 3DZBA 3OKAA 4DV1B 4DPMA 1C2YA 1YE3A 2Y1FA 2NP7A 2VNJA 3N2KB 1MDMB 3DF7A 5C5EA 3UCFA 1YQEA 2ZYTX 4KFRA 2AN9A 3E8MA 3RRXA 4DRYA 2QY9A 2IW3A 3PA8A 4AMUA 1EUQA 3K9QO 3O4JA 5GVSA 4YV1A 1SXQA 2GRAA 4Z4FA 1H2EA 2J9FA 3TSWA 3RSHA 5HQ3B 2JFVA 1WUKS 3GFGA 2XT6A 2PUEA 2B83A 5KJ1A 4UMDA 5FUVA 1YIAA 5E6UA 1S3JA 4L0CA 3AERA 2IP4A 4JI8B 1Q1VA 4PPFA 2R7XA 1T9BA 2DMUA 1K06A 4PSDA 3FROA 3F7OA 3CWZA 4PGAA 3K72B 4EAQA 4ZDIA 1FTGA 2YJTD 1Y1PA 5AVTA 1WMEA 4FOPA 1M1UA 4WAUA 1QV7A 4C03A 2FMIA 1ORHA 2ZRDA 1E3EA 4ZV7A 3DVQX 2BVNA 4EV0A 1COWD 4ZEMA 1FWZA 1RPZA 5IDXA 1QRUA 1EQ2A 2DFNA 5C8ZA 4M6YA 3N2KA 2UV8A 2EGUA 3LT1A 2WKWA 1T6YA 1VLQA 1SN7A 3TJMA 2YYZA 1A8IA 4CDRA 2X1VA 3L8DA 1N9GA 1PS8A 3TR5A 2ZAMA 5GTDA 4KPYA 4GF5A 1JKJB 1YA8A 5K20A 1YL5A 2G72A 1WI9A 4DN6A 5B55A 4BXOA 4ID3A 3TX6A 2YZNA 3WO0A 2B2NA 3BGVA 1IBSA 5K6TA 5E6UB 2YXPX 3SEFA 5I4KA 4RTMA 4R6XA 2P0WA 2X9QA 3ZY6A 3UJBA 3W9YA 4HFRA 3DEAA 1ENOA 2QZ8A 4EHIA 1GZDA 4ESBA 3G9UA 1A35A 1I6LA 4HGOA 3HCEA 3MXTA 4AJIA 3GRPA 5JANA 4BX2A 2Q4OA 4WRRA 1NVMB 3S8PA 3NEAA 2ZGVA 1E2FA 1E63A 2CH0A 4RAZA 3AI7A 3ZQLA 5CYFA 3WOHA 3PRHA 1YX3A 4CZCA 1VFPA 1FMTA 2Q3JA 2UUZA 1ESNA 3HB7A 3W6JB 4JVMA 4NENB 1EA7A 4CCOA 1WKVA 4GMHA 1L4YA 2JI9A 2J9ZB 1Z75A 1CJUC 3CMEI 1M5UA 4GE3A 4RSHA 5ELMA 2QV0A 1JRLA 4TXHA 4RW0A 4F7WA 1M3SA 5AR1A 4Q5SF 3EYYA 1UPXA 5FPKA 2EV9A 3SM9A 1M7BA 4YCJA 2NU6B 4XYLA 4LOKA 1DLJA 3C3WA 1YMVA 2N47A 2VRNA 3C43A 3LG2A 4RM2A 3ZHUA 4BP8A 3FLBA 3PFWO 1SHUX 3KP3A 2GPNA 1PT9A 4EOGA 2IEAA 2OECA 3RQIA 1KR5A 2K85A 1EHCA 2BCEA 2P68A 3BIXA 3CEJA 1P72A 5HIIA 5HUJA 1DCKA 1QPMA 4JOMA 1AGNA 1YQTA 1S8NA 1TC2A 4AF7A 1R4AA 4P22A 4LIUA 3SC2B 2DT5A 5FKKA 4IX1A 4YFKF 5F2NA 3MTGA 4HZUB 4R51A 5KYVA 4IH1A 4I6GA 1J23A 3TIIA 3UICA 3I4CA 1NAIA 2G1PA 4GOND 3S1RJ 1Z0KA 2XNCA 3K35A 5HIKA 1U3UA 3RI4A 1OI2A 1MB3A 3KSAC 4YMSA 2NVXJ 2LP4Y 4K2EA 2FUG6 4M22A 4QUDA 4YP1A 1Z3IX 3SEAA 2AWOA 1EJ0A 4ENNA 5IJXA 3FTDA 1V1MA 4QA9A 2HSWA 2MOKA 2FSWA 2Z4SA 2IV3A 4F12A 2JGEA 3F5DA 1S2GA 4JJ8A 3GMEA 2Z6UA 4ZCLA 3AW8A 2P5SA 3N4MA 4P3PA 4NBTA 3KX2A 3K69A 3DT6A 4OHOA 4A91A 3JQBC 2EWVA 4AYXA 2VT3A 2AMLA 2F17A 1XRMA 2OC4A 3C3KA 2WHRA 2P4UA 3EZ2A 2WPNA 3GD5A 1QP8A 3PXDA 4UU0A 2BYTA 4PX3A 1ZIOA 3QEAZ 1HSOA 2CFRA 2CWDA 3L1VA 5BORA 2D8AA 4R1QA 3ZBUA 2VH2A 3D0QA 4JL6A 4R31A 5AWFC 4M76B 4DARA 1WBDA 1MX3A 3B02A 3ABUA 2HIHA 3LPDA 3H4TA 1I1SA 4KQXA 3LC1O 3E6BA 3FG9A 1SUFA 3MSCA 3QPWA 1G6KA 1UPBA 1GKUB 1CZNA 2Q27A 5JCOA 1I5EA 3T4PA 1DVRA 4B4UA 5IMSA 1T5OA 1WJBA 2FN9A 3UJ3X 1S4QA 5CLHA 1J2RA 3OWHA 3DPIA 2YC2C 4QHTA 5LOVA 2P2DA 3K2BA 3QKRA 2A88A 3KEMA 1IJKA 1D2GA 1JR3D 2CY0A 4XVUA 5CFQA 5GIPE 3DZDA 2WG1A 1ZN7A 2OZVA 4RD1A 1BDJA 4X20B 5KQSA 4UTOA 5IT4A 2QL9A 1W36C 4RA2A 3IUEA 3TL3A 3UO8B 5IF3A 3JS5A 3MEXA 2DBVO 3AEQA 1CJVC 1XHLA 1Y4ZA 3CLTC 1FDTA 3GX4X 4UHEA 1QV6A 5DHAA 1Y56A 3GRVA 2BZ0A 1A8SA 2GUGA 4MRRA 3IXQA 4ECEA 1Z2OX 1BJTA 3HM2A 4IOKA 3HOUJ 5CB0A 2Q9CA 1DEOA 2N8GA 1ZRSA 1WCWA 3KS9A 3MJDA 4FHGA 4GYWA 4JFAA 4BCDA 4D9KA 3TJRA 4C0HA 5AVXA 1P5ZB 1IN5A 4G81A 5JCPA 3CCFA 4PW0A 1W36D 5YASA 3I45A 2Z5FA 1QHYA 4AUKA 4C6SA 1BOAA 4B7AA 5E0OA 3A70A 3LXXA 5BQXA 2GCEA 5I7AA 1RM4A 2B99A 4PO9A 5K7FA 5BV7A 4G5HA 2JLYA 5CM2Z 2NXCA 3WRXA 1OCCH 1JZSA 1CF9A 2VNIA 3IS3A 5HX7A 3AG2H 5EIWA 4N4OB 3ITNA 3KOXA 5DGCA 1ZSNA 3WA6A 3ZCPA 4EW1A 2X4GA 1TAHA 2PU5A 2YVUA 3EVNA 4MEJA 4PHGA 5TV2A 5FRDA 3QU5A 3AR7A 1RZRA 1FB5A 2XZDA 4LVCA 1OFUA 4PJJA 2DAOA 2XKAA 1TQ8A 4GEKA 4Y2UA 5KSPA 3T3HA 3WHIA 4EABA 2OK8A 1RRKA 1I2DA 3BH7A 1WMAA 1U7OA 3IBFA 3WX0A 2H1KA 4C07A 4J0HA 5EYRA 3RS7A 3DSRA 1GPLA 1ZGHA 1ZK0A 3ZWBA 4UUVA 5JAUA 4AM3A 3OE4A 4HQKA 2BELA 4AJNA 3D1LA 1M2NA 3D8TA 4IOLA 4DDWA 5BSGA 4YG2F 2WYOA 3JZAA 3FMIA 3OBBA 1GPJA 2IA0A 4GPTA 4J0GA 4IKFA 5BSKA 1MBFA 2EBUA 2PLAA 1NI4A 3QUBA 3S15J 1JHMA 4UJ3A 3GVPA 5AO9A 2ID8A 1FPMA 1QAMA 3NOOA 1BSVA 1AN9A 4S0HB 1CNEA 2X4LA 3T7RA 3WGYA 3MMYB 3KP6A 4FDMA 4YJGB 4BZXA 1VNDA 1Y0BA 3AIOA 2JK1A 3F71A 5LIRA 4KGZA 4Y9RA 1DI0A 2VDQB 4LPSA 3ONVA 3BWMA 4OHRA 2I4TA 3TLYA 2Y1WA 3NC1C 3KSBC 3FMRA 4I9UA 5EJ2A 4K9RA 4A8PA 4HYTA 3JRNA 4WUTA 3RF6A 2Y1LA 4JKOA 3RASA 4YFNF 1QPIA 1LNZA 1XCLA 1ZM4A 3AW9A 3B3QA 2ZUSA 3LOUA 3O1HB 5LGUA 5FUXA 3ZTWA 2XE8A 3DA8A 4MJXA 4NK4A 2ZQ5A 4Y18A 3H3JA 2VDPB 2CXOA 4M6XA 3E4DA 4NOLA 1C0IA 1LX6A 2AC4A 3M9AA 5IK2A 4A2QA 1LKXA 2M6LA 5GPAA 5HTOA 2H2IA 1YZYA 2JFXA 3EUWA 3T6KA 2EHDA 2P5VA 2ORWA 1NVWQ 4G2TA 4DMCA 5KYTA 4IIVA 3KJNA 3A1VA 3QOEA 1RFGE 1JA0A 1YGYA 2A9KA 2Q8NA 5JZSA 1P75A 3BS4A 2HHAA 2CQKA 1X3SA 2ODWA 2QLJA 3TDKA 4UV9A 1ADJA 2IYTA 3WGOA 2OHOA 1G8AA 1C7JA 1ID8A 2D54A 1GAQA 3KZNA 2M6KA 2IHNA 3QBVA 3IP6A 1YFKA 3ONQA 2X1MA 2ELKA 3D3EA 1ZY2A 4AULA 5EEHA 4QXPA 4OCZA 1V5WA 1JBEA 1RPAA 3T06B 4ZO6A 3GMTA 4AIKA 4L5AA 1I1QB 3DBHB 1U8UA 3I3LA 2VNKA 4HY3A 4MVJF 4R0VA 3ZWVA 4CM4A 1C9KA 1T0IA 1UQTA 2FN3A 4MJ7A 5JWRA 1Z2PX 1JI3A 3G79A 3LSRA 4RTSA 5TT0A 2UU9B 4F2HA 2IYNA 3BSFA 2DTDA 2W70A 4EY8A 1JKRC 4JBGA 1DCTA 3R44A 2L7MP 5ICFA 3H99A 1YJQA 2XMQA 5JQGA 1UPCA 2YDYA 2YWGA 3GF4A 4L9JA 3R24A 1BBYA 2QGUA 1LK7A 1MO2A 4QFMA 3L8MA 2CMKA 2UZ1A 3CF4A 4MKHA 4OI1A 1B2LA 3E2IA 3M2PA 3O3OB 1MIOB 2CLMB 2RFLA 4NAVA 3AU9A 4NH4A 4URUR 2VUHB 5IAEA 3TRFA 1RQNA 2QQEA 4Y3UA 5GVRA 4EYKA 1S2NA 3MINB 5C7IO 3TOSA 1CK4A 1Z35A 1U6IA 1A9YA 3K1JA 1P2GA 3V4FA 2VJ4A 3M4OJ 3L7BA 2PRZA 1VP3A 2ZVDA 3EVGA 3LC0A 3U13A 3W2HA 1V3UA 3ROKA 1Q6ZA 1CX9B 2FPIB 3GAZA 2XDQA 4XR6A 4TLAA 4KX3A 3QK7A 3RV4A 5K3DA 3W5UA 4IDDA 4NCBA 3RHTA 4CEJB 2BT4A 2L19A 2VDRB 3KWMA 3NIDB 4BZPA 3I59B 3VOEA 3OTIA 2G9NA 5DGXA 5FHRA 4YFXF 2F3QA 1ETOA 1EXNA 3ASUA 3R7SA 4XOTA 1ISHA 4HATA 1E7QA 3KBBA 2O0YA 1AUOA 2EP8A 3IILA 2UVPA 1N2XA 4L9VA 2PSSA 2Q2QA 3AONB 3L84A 2VWHA 3M5WA 4P4NA 1NMQA 3AIKA 1JXSA 3K4PA 1VLZA 3W3AD 4MSUA 1KEWA 1C0KA 4EPRA 1X8JA 3DE0X 3KB1A 1Y3BE 3AHFA 1KIMA 5F0HA 4I46A 3DLHA 5J3LA 1WW3A 1WXEA 3DUFB 3AJEA 4ETIA 3EXHB 3GTPJ 3TW7A 3GQBA 2M0MA 1Z83A 5LOVF 3LQKA 3UT0A 1P6RA 1NJ1A 1A9XB 2DPHA 2PANA 2V74B 3A9CA 3K7EA 3D7MA 5GOTA 4F9GA 1F0KA 1BQ3A 2PXHA 3UHFA 4AWAA 5L3VA 4CCJA 1B43A 4MTCA 3W6VA 1I2CA 2EVWX 5F7JA 5J5AA 3SE0A 2QD1A 1DBQA 3E8SA 4FYIA 4Q19A 5KDLA 3RK1A 3UCXA 1D8KA 4CZ2A 4PIPA 1LS6A 3VKVA 4ZGBA 1EFKA 2Z2IA 2JIDA 3ANTA 4BX3A 2POQX 1A9PA 3DP7A 4CUGA 5JR3A 3L8CA 1KIFA 4UHTA 2E3JA 3IAHA 4P7FA 4RK1A 3OZ7A 5EIEA 3ZU5A 1ZN2A 4GL4A 2ZC2A 4B1FA 4MWSA 4M38A 4RLSA 5IDYA 3KR9A 3IC7A 4ZQCB 3X1MA 1ZUD1 2JRLA 1DO8A 1G4UR 3OYHA 3B7GA 1C4XA 2BUBA 5LBQA 1T39A 1DSSG 3HM5A 5LGTA 1QRAA 2FX3A 4M87A 4XQEA 4B3IA 5F7OA 2F8TA 2HOTA 1FDOA 1ESDA 4ILEA 3A6EA 5ESRA 5NULA 4AO6A 2OZEA 2F6CA 1ZXLA 4LX0A 4YQZA 1XQ6A 2LC2A 1MHTA 1F0YA 1TL7C 1UKBA 3WC4A 1QGED 3SU8A 4C4XA 5THQA 5EZHA 2NZVG 3KQHA 4P4LA 1BDHA 1DKNA 4KDPA 3DQQA 4BV8A 1UDRA 2O8DA 2Q1UA 2LF8A 3DOCA 3VKUA 3KJZA 4HLNA 3FX3A 1NSTA 1U3VA 4KQ2A 1U81A 2CBGA 3IB6A 4GM0A 4JLMA 3SJAA 2WAAA 4FLFA 4XFDA 1DAKA 1LVHA 4M53A 5A71A 5ILVA 4QDKA 2WU4A 2GVZC 3DWGA 4CLRB 1YC5A 2NG1A 2R6HA 3KYLA 2CV1A 2PFKA 4FFMA 3U3KA 2L2QA 3K1YA 4K8RB 1NW9B 3PJFA 3LIIA 2J1LA 4G84A 1MH9A 1C80A 3HDGA 3T1TA 1PBNA 1IBCA 1YF3A 2O48X 1JLSA 5BR4A 2ZJOA 4IHXA 4TMYA 2PT7A 1UBNA 5LPNA 4X0EA 4PG6A 2OR3A 5KVAA 1HZZC 4DIMA 4RY9A 4JI1B 3EARA 4AECA 3WDKA 3FPKA 2QT9A 4WKGA 4WXMA 3PCTA 1PDNC 3BF8A 2ZRBA 4LITA 3RVSA 4BVKA 4CTMA 2QRJA 5FTMA 3FUWA 2P5KA 4Z3OA 2L7FP 3I9FA 5FNVF 1XTPA 1I4TD 2C0CA 2GD2A 3MQ4A 3PIDA 4U2GA 2E7WA 3LJKA 3H5IA 2K3PA 3VR2A 4A36A 1M34B 1X19A 3FKSD 3ETNA 1WJDA 2R8EA 1D1TA 4A3BJ 4M1MA 3QPBA 4YA6A 5ESXA 1YB7A 4R7GA 1P2DA 1G6HA 1QYCA 1WB9A 1FLIA 4R7TA 4L4RA 3L09A 1PTJA 2GPTA 2XT0A 2AG8A 2GZRA 1SFRA 3IOEA 3L01A 3VKFA 1RAAA 2QJFA 4PICA 1GTSA 3JAWA 3J80Z 1EQAA 1R8JA 2ZDQA 3CR8A 4HB2A 3W6UA 3R3SA 1K9SA 1LY1A 3LLSA 3E9NA 2JVGA 1E62A 4INJA 2E2WA 5AI8A 4YUXA 4V03A 2JLSA 5KNLA 4A3LJ 1WV0A 3DFKA 5BXQC 3H65A 3V34A 2NUAB 2AFVA 2G4VA 4Z0NA 3G02A 4DYQA 1S7EA 2Z99A 2AE1A 3FXAA 2X86A 2Y1CA 3DKPA 4UJ5A 4XWTA 2P9FA 1EX7A 4K8OA 4MKRA 1FJGB 3UNXA 4GFBA 2P9HA 4Y2PA 3NHRA 3L4EA 1P0PA 1NG6A 3EUAA 3OJWA 2V96A 3OZUA 2Q8PA 4YEJA 2YINC 2GYYA 3ASZA 3OFJA 3UGKA 4ARSA 4B6FA 4LMAA 4DG5A 3D6TB 1P6QA 3VR1A 1A6IA 4UDOA 2KX7A 1EK0A 1SHJA 4C3UA 5JD6A 5K8TA 1CUXA 1OXVA 1Y9DA 2M7BA 4EJWA 4E7LA 1E92A 1LPQA 2VBWA 1QM5A 1Z29A 3NAZA 3RG8A 2WZQA 2H1LA 3K6RA 4IOJA 2LKDA 5HE8A 4AKEA 1GNSA 4P3OA 4AF6A 4D8WA 1RYEA 3F23A 2G0TA 4TLMB 4QBFA 1UJCA 3TSYA 1W9MA 1ZOPA 5CFRA 1KH2A 2VRWA 3WQRA 1Z25A 3BK2A 4GZ5A 2P6UA 5CIQA 4PLWA 4CXMA 4P0PB 3PDIA 4D9CA 2CNDA 2O3SA 4AZ0B 3HYIA 1IJFA 1F5SA 4CNBA 4GC9A 3GVCA 3KUCA 3C5EA 3VJRA 5AW3A 5BOSA 2UYHA 3I3SR 3KDPA 5EL0A 4L2IA 1PNRA 2GA1A 1KQ0A 1JHPA 3MWEA 3I6YA 2JA8J 1KZHA 3S14J 2PPLA 4PTLA 1HOMA 1XKLA 3DOHA 3B1KA 1ZI6A 5BQPA 2C88A 1MORA 4P1ZA 4DUGD 5BN1A 1PR5A 1VYHA 3G2MA 2CSUA 5I9NA 3EJ6A 4M3BA 1K86A 2IV2X 5DTDA 4CFSA 2WSIA 1RHMA 4Z4GA 2QLNA 3KEYA 2XBLA 1R00A 1I2BA 2QUJA 4AUXA 1YW8A 1QPGA 1TRHA 2JIMA 4Q66C 5ES3A 1UCRA 5FFNA 4EHNA 2P6TA 4A3JJ 1C7EA 3WLPA 2X0LA 5K5OA 1LV7A 2JI6A 2Y2UA 3M3DA 3ESWB 3O2JA 5B3AA 5K6RA 1AHPA 4URWR 4CIVA 4ZZDA 1CY4A 5JAMA 2DB3A 5L3CA 2CEKA 2H52A 3C97A 5FL3A 1I3CA 5EHXA 5KYYB 1FXWA 2CCKA 2G0NA 4UARA 3URKA 2VJDA 3S5UA 3CJTB 1VSTA 2ZUVA 4WX2B 4YQEA 1IB0A 4B33A 3PNVA 1M9NA 2JGMA 4M73A 2PQ6A 4IZ6A 1TUIA 5CM9C 1J56A 2NYAA 2NNLD 3EGVA 2PUCA 3D6MA 4QUBA 1Y7IA 1XF1A 4LIPD 4U2FA 1U04A 2GCIA 3K73O 5ARCA 4Z4EA 2ZTHA 3ERMA 5BYKA 1LBQA 1CQIA 1YQAA 1V6SA 2WQ6A 4J7CA 1Q57A 3FFTA 5T6BA 2YMMA 2ZIVB 4WLOA 4DLBA 5C7LO 1Z0IA 3LX8A 1BW9B 1XRLA 4Q9JA 5K3OA 4N7MA 2FSPA 4XORA 2J7KA 1UPUA 3DM9B 4RDUA 4NWIA 3FJ1A 1BYUA 3FMGA 4PCQA 3HUFA 5FLEX 4DR6B 4D4JA 3HKDB 2NS8A 2F4MB 2VBIA 4ASUA 1HA8A 3OMYA 1N6KA 4BO9A 3GLUA 2XI4A 2ILTA 4H08A 2LR0A 1CYEA 2XKPA 3PD0A 1R0BA 4KDFA 2PT9A 3PFYA 1ODCA 1UKAA 1E6UA 2HCFA 2QP3A 2VQDA 4NBKA 3TN7A 4G0ZA 2ZBUA 5IH7A 3QMPA 4AICA 3MS2A 4D0GA 4FMPA 2Q3EA 2EKBA 4Z4HA 2FLWA 3F9IA 4A7PA 3ZGNA 4JUDX 4YASA 2ZXJA 1T9GS 3MN1A 5CD9A 2A0UA 1SM4A 2HRRA 1CS0B 4MLZA 3TCNA 9GPBA 3GFTA 1U8CB 1VL8A 4NMXB 3QF4B 1U7ZA 1IDOA 1NOIA 1X7XA 5DNVA 3H2JA 5ISMA 1FJXA 3ABIA 3URMA 5JE8A 3G5AA 3CXUA 4KJZA 4LDRA 3LWBA 4EP1A 1OU4A 2QTGA 1H3FA 3HY6A 4LDQA 1GL9B 5I4CA 3EPKA 1OAOC 1CF4A 3L1PA 4KCGA 3UFXA 1RI5A 4BFSA 3N05A 3AZPA 3FPFA 5DASA 1FL9A 5D8LB 4DPLA 3JYOA 2OOKA 6REQA 1T3HA 2INGX 2WUEA 4NG5A 1P0QA 4JODA 5EZGA 5G3ZA 1WETA 1ND5A 3VX4A 5CCBA 1VMIA 5JYDA 5EERA 2E5FA 4FHTA 3ISVA 4J8PA 1GXPA 4HP8A 1OUMA 1FFHA 1E6MA 1QGYA 2IEYA 2QVZX 3E9EA 3IVGA 3K1TA 3ERED 1PHPA 1ZQ9A 2DG2A 4OAPA 1T2UA 2JZYA 3CNEA 4QLOA 3TKLA 4A0XA 1AMUA 3EGDB 1CUZA 2R11A 1USSA 2Y75A 2R6FA 1GU1A 3LCVB 4HRAA 4JBLA 4PYLA 3ZG6A 1W1WE 4DAEA 5K3CA 3WHBA 2IA2A 3N8GA 3QP9A 1WTAA 2JJ8A 1OLUB 3OFND 5GGXA 2X14A 2J5KA 4IV0A 3EH1A 5ITSA 3WL3A 3WMGA 3S40A 4DSOA 1UZAA 3AL2A 2VWQA 4NK5A 4UVGA 1HDIA 1TZJA 2WT9A 2B5OA 3OC0A 1SBQA 4JLAA 1RM5A 3AY0A 4KWCA 3JATB 4HYYA 3J81A 3QZUA 4G0NA 2HA7A 2BMVA 4RL4A 4WK2B 4PIMA 2VBYA 3BCHA 3DV9A 3P7MA 4A93J 1AWCA 1H2WA 2O3QA 2XLCA 3FCEA 4EGJA 1CUYA 1JHFA 4PXAA 4LVUA 4LY9A 4WK4B 4BWVA 2JJ1D 4RGUA 3HACA 3V2UA 4XUGB 2BR5A 3DNFA 3JVIA 2UZ3A 1ST3A 4YQFA 2F9MA 2AQHA 5DVZA 1OJ7A 2HLDD 2I03A 5HJ2A 4G8DA 3VMMA 3H3VK 1K89A 2FBHA 1ISPA 4K87A 1SHTX 3CLRD 3U9GA 4U0VA 2JAUA 3L5KA 4BQQA 1AT1A 4IMIB 4AJHA 2NT4A 4ZZIA 4QFBA 2DMTA 3RPUA 1PN3A 5ER9A 3TIGA 2AF3C 2R93J 4P54A 1GTMA 3IKJA 4KO8A 1IZ1A 3H8JA 1G20E 1E1CB 4L5CA 3R09A 3PZRA 2HOAA 5AJTA 2XF8A 5SZKB 3ZHOA 4LOCA 2AXTC 1G1MA 2GD1O 4C5AA 2BKAA 2JFQA 3N2LA 3PG5A 4Y2JA 1K27A 3LV8A 2C2GA 4FP9A 3MK31 1K7XB 1ABEA 1EWKA 2FP4B 4X00A 3PT9A 1THGA 1U8XX 5T8KC 3C8HA 4HFJA 4RD3A 4N3AA 4XKJA 1QGDA 4PZCA 2EZLA 4TYQA 3KP5A 4DLNA 1P2UA 4DDUA 5HKBA 5JD3A 3E84A 4YAUA 4X0GA 3CNHA 5JZ9A 5J1YA 2ZUCA 1SB8A 2C78A 3FCYA 3JYPA 2XC7A 2HUNA 3FOCA 3O4HA 1OWNA 2REBA 2ZUFA 1UWLA 3DBLA 3QTBA 4Q24A 4DE5A 2AOXA 4TSFA 2VHJA 2EK5A 3KKOA 1VMEA 4R1OA 1IBKB 3JQ7A 3UUEA 4RDCA 5DTQA 3RG2A 1PFWA 2FCRA 2FR8C 1X4OA 3VH3A 1YG2A 5C1PA 4HLUA 1KDVA 2WT4A 3WYCA 3UUGA 2KB0A 2X6WA 4QYIA 4EVIA 1KF0A 1Y1KE 1KYVA 1UT6A 1D1AA 4ENMA 1AX9A 1HFWA 1BL0A 1YKFA 2JVJA 1OLSB 2P0AA 4C2BA 2GZ3A 1BWPA 3QTLA 5DX1A 2I6TA 3T38A 3U3RA 4EFNA 3KHSA 5CVUA 4NZPA 4J07A 4UPDA 3SLRA 3HR7A 2WIAA 1BRMA 1LLQA 2ZSBA 1QHGA 2X0FA 4G6ZA 3BT9A 4LDJA 4BNTA 1LA2A 2F64A 1HCRA 1MJ9A 2WSSD 3FBNB 1XLTA 1HKSA 1LDMA 1PJBA 2YH2A 4L72A 4XLNF 1NURA 2QRZA 3DDWA 3EVTA 3MB5A 4ZPJA 5JALA 3AVWA 3I32A 1FFXA 3T5AA 1MB2A 4FX2A 1K78B 2V0NA 1JQKA 3JQFC 2CXNA 1WKBA 2GAUA 4RD4A 3HOTA 2A9FA 1RESA 2J7PD 2PH5A 1ZVJA 3QYPA 5FJJA 4AQ7A 1UZCA 1ULSA 2J59A 3LU1A 3ICEA 4NZOA 5LZ8A 2X8JA 1QONA 2FPGB 1L4FA 1EWQA 3Q88A 3TOVA 3E58A 1UP4A 2FSUA 1PTKA 1XZGA 1BS1A 1E79D 1S0UA 1XCPA 3BKWA 5REQB 4AY3A 5DTIA 1W5CC 1V4BA 4RPHA 3BRWA 1DQNA 3AI3A 1NJ2A 4KQFA 3TW8B 2PX5A 1XU7A 1O7JA 1DAHA 1YUMA 1IY2A 2QT0A 4I8XA 2JRCA 4GW3A 4QTTB 3PUFA 4F7DA 1DQSA 2A0XA 3S2GA 1V16A 2F2EA 2A8YA 3QQAA 4XN0A 4M99A 4U7FA 4D79A 4EEKA 2PN6A 5H80A 2BTOA 4ESHA 2L02A 1W1WA 1XQXA 1Y6RA 3QXJA 4YP5A 5E9JA 3BKXA 3UH1A 2AJBA 4EJ6A 3SE7A 3S2DJ 4ENUA 3MFKA 4ZARA 2NM0A 2JFGA 3O0TA 1CRPA 3E97A 4DQDA 2ACKA 2DA4A 1DJOA 1KDYA 2XGXA 2F43B 4X63A 1PWHA 1OXSC 4TN5A 5K0FA 3MCUA 5E8RA 1RPJA 4Z9YA 2M30A 4YRIA 4YCAA 1DUIA 2W58A 4EPTA 2VH5R 2NTNA 3N7AA 4HDCA 4MTLA 1IC6A 5EGOB 4N49A 1SVOA 2OO3A 4JYZA 3EAGA 5K7SA 3L7YA 2AX4A 4C6TA 1UEJA 3F6SA 3OI7A 4YFYA 5THXA 5GV8A 1UMDA 3HXPA 4LYFA 4PX5A 1DEAA 2YIMA 3RHFA 4PLTA 2YWRA 4EUFA 5LNK1 5ELXA 2CVZA 4ZTZB 1SCUA 1XMSA 2HVSA 3N0VA 3D4OA 2QROA 2EFNA 5IP7J 1MBKA 1A7AA 1KY3A 3V55A 1EB9A 2WV7A 3WGMA 4RZXA 1JSLA 5JVGF 4ZOLF 1XVAA 3QJGA 3GTGJ 4RJKA 5JLAA 3STUA 3JARB 1MJGA 5ILOA 1YHZA 2PR7A 4HV6A 4NJEB 4Q15A 4Q82A 5TQ2B 3D2AA 3L7CA 2WF5A 4HJXA 2WFLB 3ORHA 2O57A 4MHOA 2OPTA 1NP3A 1ZKDA 1NUAA 1RRVA 3FVQA 4ABZA 3HSSA 2IXGA 1N5RA 4L9SA 2RI1A 4X60A 2RGRA 2BHLA 1Q21A 4KE9A 5IJ9A 1WCIA 4RHUA 1EFAA 3RJMA 2KIMA 4M9UA 1CRQA 2XTJA 5K8IA 2AQKA 4I6EA 3FPLA 2A07F 3OHPA 4M46A 1O77A 3WLMA 5TS2A 1GG8A 5IWAB 1SH7A 5A0TA 3D31A 3OIOA 2L9NA 2ZI4A 3GEHA 4HNSA 3KFVA 4J0QA 4QPNA 3PA6A 3ZNQA 4EAAA 4WLFA 3V4RA 5HCUA 3COZA 3JV7A 5KJEA 4IIEA 1BC5A 3D1NI 1FTYA 4U6SA 3FSGA 5AW9A 2DR2A 3F5MA 4W99A 2VQLA 1NUHA 1TC1A 2I7DA 3M82A 1ZICA 4XI9A 4J1TC 3TPCA 4B4DA 2XE4A 2LXNA 4DABA 5IHXA 3UK2A 3KZIC 2CYYA 1ZRCA 1E32A 3ZD6A 2YFQA 4HF0A 1VFCA 2LLKA 3EZFA 4P8RA 3K7AJ 4XTRA 3DO6A 4QOHA 2H1HA 1FTTA 3V42A 1V7CA 3FFWA 3MT9A 4RCVA 2BE7A 1NQOA 4XYEA 3MWKA 3V2GA 3VO9A 4RGXA 3ELYA 1E6CA 5F1KA 2QL5A 4UVAA 1P4GA 4DANA 2FV8A 1FNMA 1ORVA 3O2NA 3ZZUA 2F3SA 1J07A 4O4IA 4PS0A 3OJLA 2YUIA 3GHYA 3GLRA 1SO8A 2J85A 3DXFA 1S7GA 3FCAA 1KU2A 3KE2A 2M87A 1MGOA 1PLJA 4WBXC 2VP2A 4F8JA 3C18A 5JCZA 4Q3KA 1NWHA 4RIGA 3QAHA 4AZSA 4NCAA 2FFQA 2HTFA 3GFOA 1XR3A 4EKNB 4YB8A 4TXMA 4P1WA 1A8UA 3C41J 4XSZF 3QUCA 4I1SA 3IPYA 3F6BX 1M1YE 2FNAA 2B8NA 1DP3A 4YUWA 5ADUS 4CL0A 1YW7A 3DTVB 2OAGA 5BNGA 1U63A 1JR3E 4RKWA 4EYEA 5FPPA 4F5EA 5A4KA 4CEHB 5FNVB 3E0XA 4LXHA 3KUXA 4K88A 5FIUA 3R0ZA 3OVMA 1YRLA 3FOAA 4F5YA 1NW3A 4ODIA 4BMCA 2BEWA 4X3OA 5AIPA 2KE5A 3WTSC 2CXSA 1TM2A 1GPUA 1KZ1A 2JKVA 5EXXA 1YRAA 4JJ7A 3O47A 4UPVA 1OR7C 4R54A 3CZMA 5IS2A 3BA6A 1BXGB 5EKXA 2MG4A 3PUYA 1NT4A 2IXBA 2O2XA 3ANYB 4Q4DA 5JFRA 1WZUA 3B5EA 3C2HA 1JHAA 3RVNA 4DHEA 2YJ4A 1LPMA 2PMWB 1C3OB 3KXPA 4AAYA 4EFKA 1XRQA 3A4MA 3C6MA 3L1JA 4IJUA 4RO0A 5E6RA 1E3SA 2BGUA 2P5TB 3WGNA 1GXQA 3TLXA 4AQYB 4S35A 4C0JA 1E2MA 1PYOA 1GV5A 4YS6A 3BWCA 2IYAA 1GG2A 1YJ9I 4DCGA 3IEMA 5HLIA 4NS4A 3UGTA 3T3MB 4LK2A 2H0RA 3WOVA 1U0OC 1KEPA 4BKQA 4EB0A 2DVMA 3LLCA 1AS0A 3ER6A 4PG4A 3ESZA 3O9ZA 3LZ6A 3P5BA 1YNOA 5AVJA 2BFCB 2ZJ0A 2ZSDA 3QU2A 2BY2A 1YW9A 4XE5A 1YWGO 5KTSA 1H3EA 3FR7A 3LSPA 1H85A 2UVPB 2FTKE 4JIGA 5ALOA 3MN2A 1SVSA 2PL3A 2XWJI 5D3ZA 4NL4H 3MBIA 4FW8A 4XWYA 1PKXA 2AUTA 1KNQA 2RGYA 4ZEVA 4YAOA 5AVQA 2OXIA 4QJ5A 1D3YA 4EEFG 1H8ED 5LL6P 1FSZA 2IP2A 2VHQA 3BGWA 2C7RA 3DKXA 4V0MA 2BM9A 5KOHA 4LWPA 2GJSA 1J70A 1AKWA 1YZ3A 1NXTA 2EFHB 5K3AA 1P33A 1M7HA 5LQCA 4YFVA 5H1YA 4XX0A 4A73A 4DGQA 1Q84A 2VAXA 4GI7A 1TJYA 5JYBA 2F4OB 1CYDA 5DLPA 1Q1BA 3LNCA 3E5UA 3E6CC 1H2YA 5CX1A 1JS1X 4M0MA 1EIZA 1WF6A 2NP6A 4B6QA 4II3A 3C6XA 1M0TA 1R0LA 1ONNA 3ZDDA 1J5PA 2V97A 3D0RA 1UFMA 1W46A 4EY5A 2I80A 4PGGA 1WXDA 2EDAA 5HDBB 4E7KA 1B8IB 2BFFA 2XY4A 3E3LA 2QRGA 2YWCA 3EGIA 5TQ0A 4F04A 2AJ8A 3GPLA 3HJFA 4ACAA 3ND7A 1DRVA 1I0ZA 1P31A 4N12A 4US0R 5D5QA 1C7IA 4F06A 2I3BA 3O4VA 5C2JB 4CCMA 4RDXA 1N1EA 3TB4A 5JYEA 2MA3A 2P2CA 2R1VB 2MTBA 3GJYA 1I4DD 1XZAA 3HZZA 3P9XA 4FQ7A 4IJMA 4BO6A 4D4HA 3SQDA 3EG9B 1E5VA 2ES4A 1WUTA 2KP6A 1YTLA 4MWTA 4V1CI 1A96A 2C8KA 5F35A 1IOVA 4PJ0C 4CHGA 1TZMA 3HNRA 1XA3A 2A0YA 4V02A 3NU1A 1POWA 1T3LA 4QGBA 2FX2A 1OBFO 1YU9A 3LBAA 3T34A 4EEZA 2Q8QA 4PZPA 1X1EA 4MO9A 4WOPA 2W8BB 1TQ4A 3G6KA 4LMBA 3CC4I 4IIDA 1KGSA 1FDWA 2Y9MB 4QTRA 2A61A 5JC1A 2B5VA 2F3RA 3EMDA 4RGRA 1LWNA 3EQ8A 3KPJA 2ZBDA 1MBGA 1YI2I 3B82A 3O4GA 2PZ8A 2R5NA 1LLUA 3R6GA 3N2ZB 1WJGA 2JVKA 4LUCA 4TTPA 5D3QA 4YP7A 4UQPA 1QQ7A 2Z2YA 1VLHA 4M9SA 1DV2A 4RF2A 5AVYA 1HYGA 1GCUA 3BEDA 1GYQA 1KAOA 1OOEA 1U7UA 3LBIA 3M5CA 3WB2A 5LCXA 3W04A 2VDMB 3PLAE 1P1KA 2NNNA 2CVQA 3LHDA 3PPYA 4PAQA 4PCAA 4DBRA 3K20A 2ZYRA 1U2DA 1IY1A 5SZHB 2RHDA 1U2RA 1MMAA 1VECA 1GT91 3IJ5A 6PAXA 4QUKA 3TSOA 4A0QA 3NAGA 4KN7X 1LE8B 1NH3A 1UMCB 5K3BA 5ITZA 5KU1A 2IPMA 1W4LA 3HN2A 3L0DA 1VSVA 3OYFA 2CB0A 1AUQA 3ZP5A 1BI3A 1IV6A 1YJ8A 4PC7A 4Q9DA 4XYBA 3JRDA 5B1DA 1HSTA 3DYIA 2E48A 3RIRA 1L5WA 2EZHA 1A27A 3C4QA 3L05A 4Y6LA 4NDNE 2G40A 3A6LA 4OQYA 3FGPA 5KHLB 3IMEA 3OF5A 4E2FA 3L8FA 3MJVA 1PZNA 5EUQB 2XA1A 2P67A 2FSVC 3A6DA 3PFGA 4MO2A 4N8SA 4ZALA 1MJBA 4H17A 1BX3A 1D0IA 5F52A 1RW4A 3F67A 4FR2A 1KI6B 4M0EA 4ZAXA 3ZD8A 4UM9B 2IOQA 1Y1TA 1L1FA 1UEXC 4I6ZA 4L18B 5AKGA 3BD6A 4D8XA 1WY7A 5IDWA 1ZAOA 4G8BA 3DOOA 2O9JA 3STYA 3M7GA 5E6RB 1MX5A 1PEDA 3QP6A 2FEMA 2HV9A 3N2NA 1CCWA 4C30A 4NHJA 1OAOA 4JWKA 5CVCA 3UC5A 4BMPB 3AEXA 5KSYA 2UV1A 1E5LA 1WDKA 1P1RA 4ZC8A 4MWOA 3WJ1A 3IVXA 2PUBA 3RBXA 1YFZA 4WDQA 4WL0A 1JMYA 2B3TA 2Y77A 2VQ6A 4OBXA 5E1ZB 1YACA 2HQOA 2GA2A 2HSD