3RQIA

Crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
169
Chain Sequence
DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator protein
publication title Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transcription
total genus 59
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rqiA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rqiA01
1ZHHA 3RVKA 1QPIA 2FQ4A 2E19A 2M0CA 2H8RA 4MAAA 2CWDA 3Q0WA 1NTCA 1MBEA 4D7MA 3G1MA 1QNLA 3SQNA 2DMQA 2EZKA 1DRJA 5FLVA 3H6GA 4KREA 2NOGA 2E1OA 4Z9BA 2XB0X 5IUNC 1S8NA 2VK2A 4QIWN 4EGSA 2LKXA 2DRIA 4CYCA 4KRFA 1K61A 3GTOJ 2LP0A 2MYPA 3EAFA 4H60A 1IUFA 4IGAA 4KPYA 1JKRC 3O2QB 4RWEA 4DYCA 3OLXA 4IEJA 3BR1A 2IKSA 5IP9J 2MSKA 5IPAA 4XRMA 4RK7A 4NCBA 1S7EA 2HXOA 3H1EA 5DS9A 1DRKA 1Z15A 4O1IA 2TCTA 1JDNA 3A3KA 4PYRA 3LUAA 5EWMA 3IH3A 5F04A 4YR7A 1BDHA 5IOZA 3CMYA 3I4NJ 5FBHA 3LOPA 3G1LA 3JS5A 2M34A 3NBMA 4QPJC 2GI4A 2JMWA 2O9LA 5EG0A 3DCFA 3H1FA 2Y2ZA 1FTTA 4MQEA 2FMKA 4V2GA 2HJ9A 3QLVC 5GP9A 4V2FA 4NCAA 4JX5A 3O74A 2M2EA 4OLBA 3HVRA 5F0HA 2WV1A 1QKKA 1AKHA 2GM4A 2DA2A 3PM1A 1MIHA 3G1WA 4G0ZA 4TN5A 3BR3A 1GCAA 4A3IJ 2L0KA 3EULA 1RZRA 2LUOA 1HCRA 1UG2A 1E6LA 3QLTA 4Z9AA 1OFCX 3IP5A 2I10A 4JB0A 2NT4A 3QEMB 4A69C 4JASB 2PUGA 5C4XJ 1RETA 3CLKA 4YS6A 3CHYA 2ID7A 2PLNA 2QXYA 5TQ0B 4Z99A 3N0XA 2K40A 5DLEA 1LFBA 3URMA 2DTZA 4UUSB 3WHCA 5JNTA 1JFTA 3DLBA 1B72B 1RZRD 5JLWA 4W1UA 5IX8A 4N76A 1BDJA 3SNKA 4N47A 1LK0A 3OO0A 2J48A 3H75A 3GYBA 4LX8A 3JREA 1PNRA 5BRJA 2ME6A 4RDUA 3S1QJ 1LBIA 3O1HB 2PUCA 1WH7A 3Q7TA 2ID9A 3EODA 1JFVA 2PUBA 1SRRA 5ED4A 1Z2EA 5TE9A 7ABPA 1JKPC 2GWRA 1VF9A 2NVXJ 2VKVA 2WAQN 4S04A 3JTEA 3QLUC 2G0EA 1TWAJ 2XPUA 1SXHA 3JRIA 1WH5A 3GL9A 1ENHA 2VYCA 3HO1A 3SG0A 5J3LA 5M5YJ 2L9RA 5KI6A 3NAUA 2EBIA 2NZVG 2JA5J 1FQWA 1EWTA 2MG4A 2CQQA 3FISA 4M3DA 2JB9A 1VKRA 2HYJA 2E4ZA 2Y9YA 8ABPA 5TQ0A 3Q3SA 4AC0A 4LDAA 1FSPA 2NVYJ 4MPTA 2LD5A 3MN2A 2FKAA 4Z4IA 3BREA 4C3IJ 3VPRA 2EZIA 2R7ZJ 1B72A 4A3LJ 4F3TA 3ZQFA 5DCLA 1PNTA 1ZN2A 3E7LA 1MBJA 3ZQCA 2DA6A 1QMPA 2IPMA 3RVSA 3HM5A 1TWGJ 3RKQA 3RVRA 2EH3A 2IYNA 4G97A 2XGCA 2PKXA 4DYQA 2HDDA 3OM1A 4J19A 1ZH2A 3N6VA 1MVOA 1ZR4A 1YS6A 1YVUA 3QQAA 3ILYA 3OLVA 3I45A 1ETXA 3M6MD 4IILA 3Q7RA 4YRZA 1JBEA 1MH3A 2R92J 4JP1A 3QELB 3LKBA 4Z4CA 3BRSA 2IDMA 2MGQA 1ZDMA 4OLAA 5CNKA 1WCMJ 1U8TA 2E4VA 4KK3A 1QP0A 5K7ZA 3NNDA 3SAJA 3GTGJ 2W48A 1JUMA 2R47A 3TP0A 3HB9A 3KJXA 4RK0A 3BQZA 4Z4GA 2MYUA 2N9UA 2FMFA 1HDPA 2FMIA 3T38A 1VFCA 3QLUA 4IHXA 3BR6A 1XG1A 2VUIB 4XASA 5FKOA 2MSLA 4D6YA 2CJJA 4W5QA 2X7XA 3H0GJ 1H8AC 2NS7A 1FFSA 3DGFC 1BW5A 2QSJA 3CKMA 2HOAA 3KCNA 2BGGA 1P7IA 3LUGA 3JPWA 2R0QC 1E6KA 4HNVA 1MSFC 4MO7A 1C4WA 1W9HA 3S1MJ 5B3JC 1TWFJ 1YIOA 4MS3A 4MQFB 2FQYA 4YGXB 1RXIA 3GTMJ 3OIOA 2HPHA 4BY1J 4XRSA 1X58A 2JA6J 2EZHA 5TPWA 1B8IB 5KQMA 3QELA 2DN0A 3BR0A 1UHSA 5EZHA 4LRQA 1HF0A 1JJ6C 3F7NA 3LUFA 1FIPA 5IYDJ 3GTPJ 2WB4A 2FSPA 3QX9A 3TX6A 3IP9A 5EEAA 3VNAA 4ABZA 4E7OA 3FFXA 1M2EA 1I3QJ 3Q41A 4HNQA 3HJFA 2ZAYA 1VI0A 3JRAA 4ZMSA 5C4JJ 3TD9A 2FXIA 1DJMA 4IHYA 4FE7A 2QU7A 3EDCA 1QVTA 2Y9ZA 3HOXJ 1DP4A 5KC8A 1Y1LA 3BTLA 4LE1A 3LUJA 1USGA 1ZVVA 2DMTA 4WUTA 2LPMA 3N75A 4EEFG 4DZPA 1MBKA 1WGXA 4G86A 2RGYA 3T6KA 2A9QA 1TMYA 5FBKA 5F64A 4D7NA 1ZY2A 3LUCA 2ME0A 5TQ2B 4W97A 3DGEC 1DC8A 2FEKA 1EFAA 3D8UA 4MQFA 1SD5A 5JNUA 5TQJA 1MBFA 3DBIA 3RVLA 3BG9A 3HUUA 1D1QA 1Z13A 1B8IA 4DYRA 4MYRA 2CHEA 2R48A 2L17A 2DJNA 5DTEA 3S14J 4EUKA 3RVJA 3HS3A 4F8JA 4MLCA 2PAFA 3NHMA 4MR7B 5IYBJ 3SJMA 1QO0A 4Y7NJ 3GBVA 1NXVA 2LBPA 1K83J 2FN9A 1SXIA 3TP3A 3A01A 5B3JA 4KK4A 4Z4FA 1BL0A 3HOWJ 3C97A 1LE8A 3RQIA 5EWLB 1GT0C 4OBBA 2YHAA 4MR8B 4UHKA 2FQXA 3ILHA 3GA5A 1MAVA 3QPLA 1OXKB 1DC7A 3S17J 3F6CA 2ZB9A 3HK2A 1QO0D 1NXPA 3TEDA 1ZTRA 1PUFB 6CHYA 3L6UA 1BDIA 3O2JA 1VRVA 4B1RA 3UUGA 1JUPA 1U78A 4L4UA 4RK6A 4OATA 5GOTA 4A3BJ 1QP7A 4L85A 2QV0A 1EAYA 2OF7A 1IRZA 4AYBN 4DN6A 1I6HJ 3GV0A 5JS1A 3QPSA 2A9PA 3MKLA 4M3EA 2FN8A 3SY8A 4D6XA 3FFWA 4S0HB 4GPAA 2PL9A 1QP4A 1L5ZA 1ETQA 1AU7A 3R0JA 2CU7A 1DCFA 4RXTA 5PNTA 2ECBA 4QTRA 4MS1B 1VNDA 2JBAB 4MRMB 3ZQGA 2L19A 3CZCA 1TJYA 3HEFA 4QSHA 5C3EJ 1E3OC 5J1RA 4A3GJ 4BXXJ 1USKA 4JAVC 4XARA 2RJNA 1U9NA 2MYTA 4KFCA 2NZUG 2HOTA 4XRSG 1YTUA 1P7JA 2F8TA 1MNMC 1P6QA 2H1KA 3KLNA 1P2FA 1ETYA 4EYKA 1Z0XA 5EYRA 5IOYA 5BR1A 3O1JC 5F1JA 4TLMB 2X48A 3KTOA 4G0QA 2IPAB 4ZPJA 4ETIA 3FK6A 2E4WA 3OLYA 2HSGA 4D5FA 1F36A 5F0FA 1AHDP 3C3MA 2PUEA 4M3GA 1WPKA 1ORKA 2R25B 1PUFA 4WT7A 3FIWA 3ROTA 4M88A 2E4YA 3FGZA 4A3JJ 1GDTA 2IAIA 2QR3A 4QICA 3TW7A 1ETKA 5IUKC 2P81A 2L7ZA 5GPCA 4KNYA 1QRYA 3B6CA 1ZGZA 3RZDJ 4RU1A 2ID6A 3OSFA 5T3YA 4Z0NA 3DEWA 3JVDA 5FWXB 2E2IJ 1QQAA 4P1ZA 4A93J 2XSDC 2LVSA 1ABEA 4B09A 3A03A 5EWJB 1EWVA 3EGCA 1GUDA 4IHVA 3WHBA 2NUBA 2IOYA 2WWVD 2JBAA 4F12A 2CQXA 1TC3C 3HSYA 4G0MA 1W0UA 3EJWA 4FB4A 1JL3A 2KYRA 1OCTC 1BJZA 3H5VA 1GUUA 1DU6A 1U0SY 3CZ5A 1CQTA 2WJAA 4RV5A 3Q7SA 3F0CA 3FKIJ 1RNLA 2B4AA 1JYFA 4Y9TA 4EVRA 3KG2A 4A3CJ 2FJ1A 4G0PA 4IF4A 5FLMJ 3K9CA 5K7HA 3QEKA 3CG0A 1BVHA 1XS9A 1NK2P 3OQNA 3QEMA 1TWCJ 3MIZA 1G2HA 4KZKA 3N53A 3JY6A 6ABPA 4C3JJ 2PE5A 1XWWA 4MS4B 1QVUA 2XDYA 5C5CA 1AB5A 5KWSA 3RH0A 1DG9A 3MQ4A 1SFOJ 1GCGA 4MGEA 2E2JJ 3HOYJ 2PUDA 4W5TA 3O75A 4UUSA 4NV3A 2R93J 3G1OA 1Q1VA 3JRHA 5E3JA 1URPA 2AYZA 1RXEA 5CHYA 3CNBA 4M3BA 4ZYLA 4ZJPA 3T95A 1X2MA 2NT3A 3LOCA 5HODA 3KHTA 2O8KA 2LLKA 3CU5A 2MYNA 4FISA 5KQGA 3BR5A 1IV6A 2A9OA 3BRQA 4KVFA 3SM9A 4RK4A 2HXIA 5ABPA 4Q6BA 4HYEA 4C3HJ 2H0AA 2O20A 3OLWA 2FEPA 2PMCA 2VPRA 4DQDA 5EGOB 1A6IA 4PEVA 2GX6A 2JRLA 1RKWA 2XPWA 1T33A 3HDDA 4W5NA 5FKNA 3LNQA 5E3LA 4E7PA 1YS7A 1Z26A 4BY7J 1H89C 3BBLA 3IV5A 3I5AA 5IP6A 2FQWA 5CNJA 3H5WA 3I42A 2RAEA 5IEBA 2VUHB 3OMWA 1DU0A 3HUTA 2HI3A 3H5IA 2LFBA 4LE0A 1R9TJ 3H6HA 1F4VA 1ZH4A 2FLKA 1ITYA 1FTZA 4RKRA 1APLC 4MLDA 3OQMA 4N03A 1JT6A 2L18A 3S1NJ 2AO9A 4HNSA 1X2NA 3NNNA 3LSPA 1JHZA 1D5YA 3OM0A 3RZOJ 5DGCA 1ETVA 2CRGA 4I6ZA 1F43A 2IPLA 1JH9A 4EYGA 2LTPA 4BKXA 4MFEA 5GQSA 1ZKGA 2L7MP 4S05A 4O5AA 2FX0A 1ZGWA 5BQ3A 2OENG 5HM6A 1UDRA 2CUFA 1MBGA 1LJUA 4MLOA 3GRCA 4A3DJ 2RJOA 1YMVA 3Q0VA 1DBQA 3IH2A 3L1PA 2JVIA 4H3HB 1MB3A 5EZGA 4Z4EA 3HXMA 1E2BA 2WY2D 2XPVA 2DA7A 3HBLA 2HQRA 3C6QA 2WMYA 1JT0A 3TMYA 5K7FA 2HOSA 3GTKJ 4BBRJ 5IC5A 4B4CA 1NK3P 1YK1A 3CFYA 3LUDA 3GT7A 3GWGA 1R8JA 4D74A 4KQCA 2XB5A 2KDZA 3LUKA 3OQOA 2FVYA 1M2FA 3SDGA 3IDOA 4Z4HA 1Z77A 1ZK8A 1Y1WJ 1CEYA 1JF8A 3SFIA 1PHRA 3EQZA 2E2HJ 4W5OA 1OXBB 3CRNA 4X1EA 2FEWB 4KQ9A 5FWYB 4M6VA 4YCSA 3UKJA 1IGNA 1NXXA 2MSWA 3KYJB 3JRGA 1D4ZA 4HNRA 5HSGA 1M5TA 3A02A 3MVPA 3N0RA 4FTHA 2GBYA 2WRZA 1PEYA 2Y0SN 2QVGA 4DW6A 3ZOBA 1HLVA 1GV2A 3A0RB 1FJLA 3FMVA 3CDLA 1GUBA 2JVKA 5D2CA 1CHNA 1MB0A 4F06A 5JNWA 5C44J 4JP0A 5JLXA 1Z12A 1USIA 3HKZN 2WB1N 3BR2A 1O4XA 4P98A 2LR8A 2A9RA 2QW1A 5EWMB 2VI6A 3O8HA 1LBHA 3IPAA 2E4UA 5IYCJ 5FJ8J 3LFTA 4XAQA 3MF4A 1YRNB 2TMYA 3O2SB 4RDCA 1ZQ3P 4MQEB 2AHQA 2HQBA 3HZHA 4JYKA 1ETWA 1IC8A 1H9CA 3ZQIA 3S1RJ 2VUMJ 3C2BA 2PL1A 3C3WA 5TQ2A 4A3FJ 4XXHA 4M3FA 2X6OA 5FWYA 9ANTA 5M5WJ 4UUTA 4Y52J 1IG7A 1D5WA 1KRXA 4JB2A 5FKMA 5JNRA 3Q15C 1GV5A 3W9SA 1D2AA 1BA5A 4RXMA 1F51E 4YP9A 1JJ8C 3MA0A 1DZ3A 4IMJB 2DA4A 4N0QA 1B00A 1XHEA 4Q7EA 1GLGA 1Z17A 1RPJA 4IHWA 1PUXA 5T7BA 2V0NA 1A0OA 5M5XJ 4MFDA 1K68A 4MR7A 3CG4A 3K2AA 3O21A 3F6PA 5IEJA 2JK1A 4F11A 4WXMA 1U04A 3BT9A 1KMIY 3GBPA 5EWLA 2QF7A 1JUSA 4GFBA 1WI3A 3JRFA 4MR8A 3A10A 2NVTJ 4RS3A 1NXOA 1YRNA 1JTXA 4O1HA 3RVQA 1IDZA 2YUSA 2D5VA 3H3VK 3Q0UA 5CNIA 1RESA 2YU9J 3LSGA 5FKKA 1IIBA 1M5UA 3T8YA 1XC5A 3H5LA 1BW6A 3KS9A 4QYMA 5KQLA 4JX6A 3LMKA 3NARA 3HDVA 1PEAA 1L5YA 2IPNA 3IP6A 4LZLA 2KT0A 4RY8A 1APBA 1FFGA 2MW8A 4GNRA 2L7FP 2CHFA 3UK0A 2EQRA 1VPWA 2JA8J 3F73A 3JPYA 5IULC 2R5ZB 1YMUA 2ID3A 2JJ7A 2I6FA 2DMUA 1EHCA 3FDFA 2N8GA 1JYEA 3IPCA 4EVSA 4MS1A 4MRMA 2K9SA 4XFKA 1H88C 5KC9A 3QX8A 4W5RA 3HOVJ 3S16J 2K9NA 1A5JA 4PE5B 4WWHA 1NXSA 1I50J 4RY9A 2F8SA 2R5YB 4IRXA 3VNBA 3CCYA 1GVDA 3LSRA 5E3OA 4RZSA 3OSGA 3NHZA 3JR9A 4EYQA 2YS9A 3O8GA 4ML3A 4N41A 1QPZA 4PICA 2JVJA 1P8AA 2LIVA 3OOUA 4QYWA 4YV7A 4EY3A 2B1JA 2H3HA 1Z25A 1DBWA 2FD5A 3RVNA 2GLOA 4G0YA 4LE2A 3O1IC 2VKEA 1WETA 1T34A 1D1PA 2TRTA 1BAPA 1RKTA 3I4MJ 4N0PA 4A3KJ 2K9QA 1Z16A 4JX4A 1DBPA 3D02A 2OPTA 3TB6A 1IJWC 1YK0A 1IDYA 3DLHA 3H1GA 1ISRA 2E4XA 3M9WA 5HQJA 3H5OA 3BG5A 2AYXA 4BBSJ 1J56A 2GBPA 4L5EA 1A04A 3ZQLA 3E61A 1I3CA 1UMQA 3P9YA 1JGGA 1ISSA 5F27A 1P6UA 2R5ZA 3HGGA 2L2QA 2RDMA 3N0WA 5FWXA 3G85A 2Y31A 4NICA 4G12A 4JA2A 2XGEA 3RVPA 2DMNA 4FCYA 4D5CA 3RVMA 5EWJA 3M3YJ 2PUFA 3LSJA 3MMNA 3QLVA 2JA7J 2ELKA 1JFSA 3HM9A 5DKFA 1NXTA 3S15J 2M9HA 4CBVA 1ABFA 4FE4A 4ZMRA 1TWHJ 4AUXA 2QVCA 1XHFA 1JTYA 3N8IA 1NY5A 3D1NI 2R5YA 3HV2A 3KYIB 2WJWA 3BQYA 5KQPA 3KKEA 1KGSA 3BG3A 4G0XA 1POGA 4PZ0A 3M4OJ 1FEXA 4H3KB 5E3MA 4EVQA 5F0CA 3NNSA 1HDDC 4A3EJ 4MS3B 5JNSA 2MSYA 1U8BA 1FFWA 4XK4A 3KSMA 1LJLA 5IP7J 2X9DA 1EWKA 3PO2J 5TPWB 3GTQJ 3DZDA 5IBQA 2PJUA 2JK3A 2DA1A 1TVMA 2Y30A 4A3MJ 1QQBA 1FIAA 2LK2A 2COBA 2HQOA 3MM4A 1TM2A 4MS4A 3HOZJ 1DCKA 1CYEA 2ECCA 3CTPA 4XLTA 5E3NA 1W0TA 4YLEA 4RY0A 5I4CA 1ZGGA 3S2DJ 2FMHA 3LKVA 4UHJA 2LY9A 3BTJA 3K4HA 1ZR2A 3GBGA 2IEKA 4ETMA 5HKOA 1RPWA 2XRLA 1SANA 3Q9SA 4TLLB 4RK5A 4XICA 3B6AA 4WZZA 2ZWMA 1Y1VJ 1HOMA 2IBDA 5TPZA 1NTRA 1JKQC 1Z18A 4RBOA 2GKGA 3IP7A 3FK7A 9ABPA 3CQZJ 5EGOA 1W25A 4LDZA 2NVQJ 4MR9B 4WXEA 3JRBA 2PMZN 5TPZD 4IMIB 1SXGA 4OG2A 1A2OA 2FTKE 1TLFA 2FLWA 3HOUJ 1DCMA 3E3MA 1KRWA 4XIDA 1JLKA 1NATA 2M8GX 1ZESA 3FFTA 3ZQHA 1JX6A 1U2PA 4TMYA 2JCGA 4NQRA 3JVIA 1MH4A 4G0OA 4Q6WA 3PO3J 5IUJC 3OMXA 3JRDA 3L49A 3A01B 4OTZA 4B3AA 5C5EA 1OJLA 1JDPA 3LTEA 1LE8B 1HEYA 2JWTA 2R4QA 5J1UA 4MIMA 4KV7A 5CNMA 2PUAA 1JWLA 5DTDA 4NDLA 2OQRA 3TO5A 3ROFA 1U2QA 3A0UA 3EQ2A 3H5TA 4KMRA 4RKQA 4RSMA 3KLOA 3K7AJ 2CUEA 2P4UA 1E6MA 5M3FJ 2QZJA 4X6AJ 5BNGA 1MSEC 3I09A 1OCPA 2P9HA 4LOCA 4EYOA 3OLZA 1ETOA 5J1YA 1NXWA 2HQ5A 3BTCA 2NS8A 2M1ZA 4DZJA 4C2MJ 5EDNA 1BA2A 2YHBA 3UKGA 3TW6A 2O7OA 4RK1A 5F08A 1LFUP 4CYCB 2B63J 1ZAYA 1ZITA 2W42A 4DADA 3C3KA 4MR9A 3GTLJ 3IH4A 2DMPA 4I76A 2XGDA 2CD7A 1MBHA 1T56A 2DA5A 3S2HJ 3CS3A 5M3MJ 2QCOA 3MYYA 1VLZA 3B2NA 3BTIA 4YO7A 1JKOC 2DA3A 3HGYA 5BRAA 1Z2DA 5GPAA 5FKLA 3LUHA 2JN6A 1AB6A 3HCWA 5EF6A 3GTJJ 5EG0B 1EF4A 3OO1A 3HEBA 4YWHA 3S99A 2EZLA 1C0EA 5JNVA 3BILA 2Q5CA 4JOQA 5JS2A 3RVOA 4ETNA 1K66A 3W6VA 1U9OA 3QK7A 2LP4Y 4RXUA 3M9XA 2FW0A 1AKHB 1RR7A 3JRCA 2M98A 3HDGA
chains in the Genus database with same CATH superfamily
2P4HX 2ADMA 2I8LA 3CVWA 3FUCA 4O5OA 1GCUA 2RV8A 2EKPA 3TB4A 2IXDA 3ZWVA 2WNIA 1PJRA 1G3RA 1V0JA 2XB9A 1I6MA 4QIWN 4MGKR 3TG8A 5SY9A 1Z5ZA 3MGGA 4JYBA 3GJ0A 3T4PA 4NMXB 3AU8A 1KYZA 1ZRNA 2ZBGA 3DO8A 4K6FA 4PFKA 1B59A 4HMPA 5IPAA 3R9WA 4E3WA 5JCPA 5KWIA 3CEJA 3MD9A 1Z15A 2MC3A 3L2WA 3DTVB 3NASA 3JRXA 4PYRA 5EWMA 1Q0UA 5DCMA 2CBGA 3Q8WA 2YPRA 2JGIA 3ZR4B 1MGTA 4U7FA 2JFQA 4H7EA 3N74A 3ZE1B 2VJLA 2A1IA 5BPIA 3T7AA 3T5XA 4UPDA 3EDRA 4TMXA 4J1TC 3RTRA 3O74A 2AJCA 3AUYA 4R2LA 1LDEA 1Z47A 3HBMA 3ZBQA 4I0BA 1DKPA 2W2KA 2EFYA 4RPHA 4IUBS 1ACLA 1A9PA 2GN8A 4A0GA 4C6TB 3EMVA 1RPNA 4HQOA 3I8SA 4HWPA 3U7IA 2ZMEC 3CXRA 4NU6A 4IXMA 1V3FA 3DZKA 3HBJA 1A36A 3N0XA 3CBQA 5LIRA 4DV1B 5C52B 1I2MA 5AQ1A 5JNTA 1QJ4A 2HA4A 3DLBA 3MRXA 3EMDA 3BK2A 2IX3A 3LRTA 3HFGA 2VLAA 4W1UA 2GCNA 4QRDA 4JP3A 2HZ7A 3VKGA 3NFYA 2OTCA 4MO2A 2XQGA 1T6SA 3KYLA 3ESRA 4WZBB 1AA6A 2PT6A 1JBKA 2LTAA 2Z8XA 1GZ5A 4AO7A 3SR3A 4A2WA 4UHCA 4AC9A 4RAQA 3K4LA 1F12A 2VQEB 3U81A 3H36A 3O4HA 5D3ZA 1I5OA 3A6DA 4QLBA 2G63A 1K79A 3AIMA 3LY9A 3JRIA 2O2GA 1U5TC 4XJVA 2Q28A 2MINA 5J3LA 1RWQA 4IOAF 4L02A 3CE9A 3CR8A 3D7MA 3B8EA 4BNWA 5FL3A 3PQ2A 2JB9A 4ENQA 4P84A 1KR2A 4FC7A 1GSHA 4JUFA 4H6VA 4RX1A 1V8ZA 2K7ZA 2HHCA 4C3IJ 3R60A 3KEFA 2ZTVA 4BQOA 1TDJA 2XF5A 1WKVA 2BMJA 1IG0A 3GLFB 2YFYA 3A6EA 4G94A 1PE0A 2YXNA 3RVRA 4TGLA 3NIFB 4YN3A 1U8ZA 4HFJA 2PKXA 2MSCB 2Z6VA 4AY2A 1PN3A 4CIXA 1A9ZA 2GOMA 2IE8A 1PSWA 1NP6A 5D8KB 5HKKA 4IILA 4YRZA 3DVQX 1V3VA 3Q1KA 2A5JA 3ZK8A 5HKAA 5IH7A 3UEOA 1T3HA 4ESBA 3G9ZA 3HYNA 3QZUA 1CZHA 1M73E 4D0GA 1V35A 1HFJA 4P54A 3K0HA 3DCNA 1EGQA 2Q2QA 4XN3A 1NW4A 3E5HA 1XMOB 3TDKA 5CLQA 2XE6A 3PFNA 4LGVA 4X93A 1A9TA 3MMZA 3TX2A 4MX8A 1Y3AA 3M3HA 4HGZA 1HDPA 5B57C 2HLHA 4IHXA 4NFHA 5JFGA 3UT5A 3DXJF 4LLLA 2C7GA 4N0MA 3R5KA 4O2AA 2QP9X 2HOAA 3WDKA 3LBHA 3S5JA 3K6SB 2I7XA 2PNJA 2JK0A 1W9HA 1XJQA 3TKLA 4HQRA 5IMBA 1CUXA 2FQYA 2J3KA 3QPCA 5EIWA 1N2CE 4OX9B 4XRSA 3NOXA 2DBVO 5TPWA 4FILA 3L0CA 4DEVA 2EF0A 3G2NA 4L73A 2RHGB 2BF7A 3TLCA 3RKRA 3PK0A 1V25A 1G4HA 4UNOA 2QTZA 1LRLA 3GTPJ 4TS4A 3HU5A 4BUCA 2H4XA 1YBFA 2WWFA 3VOAA 3HJFA 4KIFA 4GM0A 2C7BA 1BW9B 3TD9A 3IKMB 4Q05A 3RQSA 3RS7A 3OT5A 4U2CA 1A95A 5KC8A 5K5EA 3CZPA 2JIOA 4OJYA 1FNCA 4FCCA 1WO8A 1Z2OX 3O6BB 3KYDB 1SZJG 1JMVA 1L1EA 3MS2A 2R8BA 4P53A 1MD0A 4FBMA 2V5VA 3I05A 2XVZA 2VDLB 5LB4A 4Y13A 2R4GA 1T36A 4ND8B 2I91A 1RDFA 1CJBA 5C51B 4N0DA 1RIOH 1V3TA 2G67A 1DJLA 2GHIA 2PX4A 5JLAA 2PMZA 2HV9A 1Y1RA 3EQ9A 1J7KA 4K6HA 2LGJA 2XHEA 1U0JA 4KXVA 3VX3A 3H8VA 1PV1A 1JXAA 4PG6A 3VH4A 1Q0ZA 3C6MA 4F0JA 3A01A 3I0TA 2OD5A 2ZUVA 4DHWA 3ABRB 2R4UA 2UZKA 4KIJA 5EJMA 3WYAA 1VPTA 3GA5A 3ZE8A 3KDSE 4FUTA 2YWEA 2MSNA 1EH5A 3QPLA 5BURA 1WDMA 1QPBA 4GOMD 4UAUA 1ZEJA 1DBIA 5CDYA 1ESEA 4QJ3A 3SHVA 1K7FB 2IXGA 2QL6A 2WP0A 1OY1A 1DL5A 2X1CA 5BW6B 4OATA 4JJ8A 2J5XA 2WTMA 3NTRA 3MKWB 1UBTS 3PIIA 1CY7A 1TTYA 1RRJA 3ORYA 5CK4A 1E6UA 2CUJA 2D0OB 1F2TB 2R7XA 5HFJA 5JWHA 2HRRA 1GV1A 3K32A 1CV2A 3MTJA 1J2RA 1ZREA 4ARUA 4MVJH 2D4AA 4MRMB 3CZCA 4MNTA 4D0RA 2KMLA 5B37A 4BXXJ 2Z3YA 1O3SA 4XARA 1C4OA 4F9FA 4W9NA 4B44A 4LISA 5EHXA 4KFCA 2VOJA 3CJTB 2HR3A 1RBMA 5AMXA 1NQXA 5REQA 1HE8B 5A03A 2YMMA 4HS9A 1EP9A 3KTOA 2XVMA 4N1AA 3EIOA 3K1NA 4GLLA 5JS6A 2G06A 4INPA 3DT6A 3WQRA 2CW7A 2P7IA 4J4TA 4YUZA 1RWBA 3Q6IA 2VNSA 2NU6A 1YZTA 1ATZA 2ID6A 2RK6A 3J7AY 4Z0NA 4YRJA 1MEJA 1Q3KA 3JQAA 3O3OB 1J0CA 1XD2A 3KZZA 2XJ9A 2LVSA 4BXOA 4DM7A 4TYQA 2ZANA 1NUHA 3AJDA 3EGCA 2WWVD 2JBAA 4HRYA 1O0SA 4G0MA 1RJGA 5E6RB 3V8PA 3PC8C 2QSUA 4NZOA 3IAM2 1JHHA 4DR5B 1L5VA 1HDYA 4V1CB 1QWOA 4XWOA 5KCZA 4MICA 1IQPA 3KE9A 4FHFA 4Q4HB 1QCDA 1SXQA 1JJVA 1S2OA 4D0NA 5TB5A 1JEYA 4PJMA 3OQ1A 1JYFA 4MEBA 5I7AA 3OCVA 4EMBA 3ADCA 4DDTA 5EE3A 3JQFC 2LBFB 1KU9A 5FLXZ 3OHSX 1IHDA 1WIWA 5D86A 1NX9A 4ZZ2A 4YJDA 1YE9A 1JKMA 5J47A 5BW5A 3GBSA 5EYPB 1LSOA 2YJ3A 3EUHC 1HNNA 2J09A 2PRKA 2YH2A 3NLLA 3PWSA 5J8FA 2DQLA 3HOYJ 3C43A 1XMSA 4UUSA 4RZXA 3GFLA 4D9FA 1WHSA 3U7RA 3EXIA 3MT0A 3EFOA 3WWEA 4Y2HA 1KU0A 1Q19A 4A0RA 1T9KA 5DW0A 3L7WA 3EG5A 4N5MA 1T1EA 2LLKA 5LWHA 4LITA 1ERDA 2H1RA 1IV6A 1K98A 3RPUA 3AG3H 4RK4A 3KUXA 1E1CB 5D6OA 2BR3A 2OBFA 2GCGA 3OLWA 1T6BY 4J9UE 2JANA 1TQ4A 3ZQQA 3LO5A 2I6XA 4Y9RA 4BEBA 1YJ9I 3C3YA 3H1BA 2DUWA 4IVQA 4NL4H 4KRYA 3GW2A 2C3UA 3HDDA 2WQZA 4CE6A 5FKNA 3IHUA 4PN7A 4E7PA 4KLCA 4HNTA 1BEUB 1S96A 3D5SC 1MX3A 3LDGA 1PEDA 1DUVG 3CJQA 4M0DA 3GXBA 3RBXA 1XMIA 2DUJA 5AI4A 3SZLA 4L8FA 5C4IA 3M1YA 5JSKA 2O6GE 1YDEA 5CKTA 4IUYA 2E5LB 3M8KA 4C5AA 2R97A 3ZG6A 5FUMA 1X19A 1EXWA 3V6MA 3O83A 1X2NA 4MV4A 1JDTA 3LGAA 3T9FA 3LP5A 2FOWA 1Y8ZA 1I0LA 1KI3A 5DPMA 2IPLA 1QP8A 1SCBA 3DC7A 4NBKA 2OAZA 4EHHA 4D5GA 1T10A 4CL3A 3B3FA 4I9NA 4H7JA 2WABA 3M81A 4NOKA 3BE5A 4GC5A 4U0JA 2JJ1A 3GRCA 4MB6A 3IH2A 1R8YA 2JJQA 1W6UA 5AIAA 5JS8A 2G08A 3NMUF 3RFUA 4I01A 2YY7A 5BY2A 2F5VA 4FGKA 3L4BA 4IUCS 1O58A 1ZSYA 1G8SA 2DFHA 4CM8B 5JMOA 1OB5A 4LMRA 2PWAA 1J25A 3G2PA 4IXWA 3GRZA 3VVMA 2CDCA 5A6VA 5FROA 1NK3P 4UD6A 1UEXC 1SHJA 1A5ZA 4MW0A 1JH8A 1WCV1 1TIKA 1G7CA 3U40A 4O4JB 5KUTA 1VM6A 1CEYA 3VHLB 1BHO1 4Y6SA 3V7YA 1I7NA 3ZCXA 1ZM3A 2W8BB 4LF8B 3QQPA 4TVKA 4YRBA 2Q9BA 3AR9A 5J8CA 3R6LA 1GG8A 2A6TA 4L8VA 4C4YA 1ZJ6A 2IDZA 4AT1A 2HWXA 1JFFA 3MT7A 4PNZA 2MSWA 3CPSA 1GUAA 4YUVA 3JVUA 4I7HA 3GIWA 4LOJA 4DW6A 4P7GA 1RWMA 1GV2A 4PJNA 4FFDA 4AXXA 1HW1A 4V38A 2H1SA 4J7CA 1XD7A 5JNWA 5JFRA 1GZ6A 1UDBA 4UBMA 3DUFA 1Q1AA 2XUQA 5TT1A 1KVSA 3CTMA 2XYGA 4P98A 2FVXA 2VI6A 4IDCA 4V0KA 1CD5A 4ZO6A 2E4UA 1DTEA 5IYCJ 4B2YA 5IJZA 4L7QA 5FJ8J 3LT5A 1P0IA 1QV9A 3NWBA 3K73O 3BD7A 3PC7A 5T6MA 5LNK6 3QBVA 1OLSB 4EITA 4MQEB 1I30A 4UHTA 3EEOA 3WLOA 1H9CA 2XSZA 3NXSA 4GPTA 2JJ8A 4KITB 5A4MS 4AY4A 5BXQC 4GT1A 3JQ7A 3IQEA 2UZ0A 1R5NA 2FPIB 2WTNA 1PZEA 1QU2A 4XXHA 2FX2A 2G71A 5K0SA 5HIAA 5IF9A 1N78A 5JO0A 1GV5A 4NQWA 4M1KA 1WUYA 3VOTA 2XT0A 2KBEA 1JR3A 2CNBA 4UAJA 4TUYF 2GXQA 1NVUQ 3CLQA 4WNYA 3MA0A 5JG7A 4KN7X 3IUMA 3DLIA 3DF9A 1ZARA 4PHFA 1G0NA 4MR7A 4JQCA 4PXAA 1V41E 2ZVQX 4XVHA 3M6XA 1NJ2A 3MCAA 4B32A 1KJNA 4NSNA 3EFBA 5AIQA 4DLBA 1YO6A 3M2PA 2AFIB 1D0ZA 5H0IA 2WAYA 3V2GA 3PFGA 1CZNA 1UMCB 2IYAA 5DHQA 3A6HA 1SG9A 4IX1A 3OT1B 1LX7A 1S29A 5LLSA 3UKOA 4F2GA 4MRNA 3ACBA 1XX5A 3AM3A 4GFDA 4UMEA 1VQPI 4ZVKA 4D4LA 2RARA 4LMAA 2DFIA 1FMWA 1Z3XA 3OYJA 3L0BA 1DC6A 4OHOA 1IZ9A 2GSDA 4CDRA 3AESA 3B1XA 4YAGA 4ZYVA 1BTOA 4MUEA 3W4IA 1AIPA 4HGNA 3DL2A 4HNAB 5LQUA 5CX4A 2B83A 3CKYA 1P1CA 4YJ3F 1LX6A 3B6IA 2QQEA 1N0UA 3DV9A 2QENA 3N87A 2GK7A 3RRNA 2BGIA 1W6RA 1R4MB 4GXNA 1XTZA 2R5YB 3VNBA 1DO0A 4UEWA 5E3OA 3E5MA 3AF1A 3K2IA 4D7AA 3MG9A 4EJSB 2F2EA 3RU2A 3W7BA 4D45A 2QYSA 1VHTA 2HQAA 3MUNA 3WNDA 3GELA 4FR0A 5DI3A 2WFZA 1Q57A 4R68A 3IBSA 2IXTA 4C9YA 3K8YA 5JE8A 5JRDS 4BO0A 2BRUA 3DH0A 2DU9A 4GBJA 4FFNA 4JX4A 2R8RA 1YQXA 2NV2B 1YK0A 2VRWA 2HLNA 2I33A 1PVEA 1Y3IA 5HR5A 1BNCA 4NZNA 2VPPA 3BG5A 5E8GA 3T1NA 2C03A 4BBSJ 1PYGA 2QUHA 3EK2A 1IZ7A 1KJJA 3D31A 1ZSNA 4DEXA 5HQ3A 3GP8A 1JSZA 1IULA 1QZZA 2NVBA 2A07F 4BB9A 2A6HF 3RJTA 4LJKA 4DM4A 4FT8A 2DOKA 3OM8A 3STYA 1JPUA 1A4RA 3MJSA 3HTSB 1Z82A 1CERA 1T13A 4BNDB 3MINA 3ZYCA 2IA0A 3ONWA 3C3AA 1B42A 4L75A 1ACJA 3MTGA 1Y5NA 1HYGA 3TUJC 4DANA 3LHKA 1Z5GA 3FYUC 4N12A 4L1KA 3D3WB 1K63A 2FWIA 5CLGA 3UAXA 2I99A 3IOMA 4X6XA 4PLCA 4C22A 2JIPA 5LB2A 1LJLA 5DLDA 3A6LA 2MWMA 2IRFG 4G36A 4Q4AB 1M1YA 2QAGB 2WF5A 1M54A 3AB3A 1ZZGA 1RCFA 1Y6ZA 1QTNA 5A4DA 1YQEA 1BFKA 4NC6A 3OKPA 5AVJA 3I4CA 3I52A 2B25A 3V7FA 3ZUPA 3BTJA 5EXEA 221PA 4L8LA 2J1LA 4KOEC 2VBWA 3CD6I 3KYBA 5M7EA 2E7WA 5A9SB 4BC0A 5HE9A 1JT2A 2BFCA 4BMZA 5A62A 3UCEA 1KK0A 2DTRA 5CP8A 3DEAA 4RBOA 1JPNA 3OU7A 4QUAA 3V1TC 4DAEA 4WEOA 4ESFA 2Y1CA 1XQ1A 2A59A 1XZCA 4PGFA 3CXUA 2FGJA 3SC4A 4F5WA 4UC0A 4Q3BA 1XLTA 3QFSA 5A5EA 1PGOA 1X3SA 3UJAA 2PMZN 2LKPA 2AWOA 1L3CA 2AOTB 5IZ4A 3HOUJ 2P90A 3ORSA 5AONA 3DMYA 4MRVA 5FI0B 4OMUA 3D4NA 3ZQHA 1MXHA 3WWCA 4ZKDA 3QW4B 3FDXA 2DYKA 1DRWA 1CYDA 1KBOA 3WP1B 4PN3A 5EKTA 4WFKA 4HV4A 1K6IA 4RD1A 3PFIA 4N49A 2R4QA 4Z3OA 1JWLA 5LMUB 2WPNA 2QZ4A 4HTFA 2OQRA 5AI6A 3A0UA 4BBPA 1EK1A 2MD0A 5CTJA 3PWTA 4QOGA 4RTKA 3BE6A 1R50A 1PR5A 1M7BA 2NNNA 1Y7TA 4ZI5A 1DIBA 1IHOA 2XQJA 1MO3A 1EXMA 1SIWA 1L7VC 5FXMA 5JJIA 3KR0A 3QOYA 4NZPA 5C8YB 4D8WA 4FLEA 4U0KA 3ZVNA 1W5FA 3TNLA 4F6LA 3KD2A 3OCCA 3ED5A 5L3SA 4ZVUA 4U2DA 4R7ZA 3SKYA 3HN6A 4BV2A 3DOIA 5C7IO 1D9XA 1KH1A 5G4KB 2ZJRF 2JAHA 4NYIQ 4EY7A 2FBHA 5KSZA 3NHKA 1Q3HA 3LUHA 3PGMA 4EG1A 1QVAA 2L54A 3SZTA 1II8B 3HU3A 3MTEA 5EZSA 4KCGA 1LVHA 4V2IA 3HBFA 5JXIA 1AM4D 3QWBA 2EA2A 4ANJA 1R88A 1BXKA 1U3EM 1RR7A 2VQDA 4DCSA 3W8FA 4DGSA 5JD3A 2PQ8A 3CJNA 1RAAA 3VHQA 1QHNA 1XEXB 3S2GA 2DMQA 1VMKA 4X1YA 3DAGA 2CLHB 3SZ3A 2C9ZA 3EMBA 4XGKA 1ECCA 3N8KA 2IY7A 5KYUB 1Z6XA 5K51A 2YS7A 5CTAA 2ZOSA 4KQXA 3VR4H 4ZYGA 3OPXA 1X4PA 4WX9A 3BJRA 3NO4A 3QUTA 3C1UA 3O2QB 3D7NA 4P32A 4RWEA 2DX7A 1S4QA 3WG7H 1S7EA 4AIIA 1X38A 1G20B 3IH3A 3Q7QA 5DYWA 3I4NJ 5FBHA 5F21A 2FOLA 2O0MA 5KYYB 3NBMA 5JRZA 3RAEC 2O9LA 1XVAA 2C4NA 4C4OA 4D42A 1LF5A 3MWDA 3R0QA 2Z4RA 4CF7A 4A91A 3ASOH 1B6GA 4G09A 4CLOB 4V2FA 5HKLA 5IM4A 3RC7A 4KAAA 4HWRA 3SE0A 4OLBA 2FUCA 4X6LA 5ICMA 3BOSA 1LKZA 3BDAA 3MTAA 4LFBB 2NXEA 4WOKA 5ECWA 2H31A 4ABYA 4U87A 5DP2A 1NKTA 1ISJA 1B73A 3NBUA 3A36A 1R36A 4HX7A 4H9GA 4H7FA 4A8JA 3HDYA 2VAMA 1Z9BA 1MMDA 5BSUA 1FJ2A 4BEHB 5D5VB 4A6DA 1JDSA 2OP1A 2HREA 1P5JA 3OX1A 5DTRA 3PP8A 3IPRA 3PDIA 3DZBA 2ESNA 1NLMA 4IXAA 2O8CB 1LK0A 3O8BA 3P0HA 1JJIA 4LX8A 1E66A 4XYGA 3FRJA 3VSDA 3FR8A 4RDUA 1KKUA 3TDMA 2RC4A 4Q1EA 4DBQA 5LJLA 3K7EA 1XYYA 3GR6A 3LCRA 3KWLA 3DMGA 5TE9A 1VQOI 3TQFA 1UBCA 3V9AA 1C7RA 2NYXA 2FPGA 2FZLA 1FFBA 4S04A 2QIOA 2RMKA 1TWAJ 5BYBA 1QU3A 4OXRA 1JDZA 2WV0A 4RSRA 3OFVA 4M7OA 3QJ5A 2QYTA 1I7QB 2AI3A 5BV7A 2M9MA 3G1TA 5KBYA 3BDIA 4KR2A 5M2QA 1SC3A 1V9SA 1W4BA 1MH1A 4G5SA 5JCOC 3KQUA 3WRXA 2X1HA 1M8FA 1PNTA 3FOCA 4E12A 4F2DA 3AHDA 2DFTA 3G8BA 1UQTA 4OUKX 3HM5A 3NHLA 2QTCA 4C0AC 1QIJA 3HJEA 1XKLA 3OTWA 2QZ9A 3EXAA 1WM1A 3OM9A 2ESHA 1NF3A 4H59A 4OSOA 3R44A 4BKUA 3IUBA 5AJZA 1ZLXA 2QYOA 2IIQA 1ZR4A 5CR9A 3Q3HA 1W1UA 2BGTA 4CIAA 4A82A 3ILYA 3N97A 4LSWA 2UZ1A 4OP1A 2ZIXB 1Z4PX 3U3XA 5CDHA 2NZ8A 1XCOA 2GOYA 3E2IA 1SVUA 3BGOS 2J9FA 3F8MA 3BGDA 5IKXA 3HSSA 2G7HA 3ELWA 1O9GA 5H81A 1QIIA 1DFIA 5TRTA 2C4TA 4M7WA 4R1HA 3GGSA 3CEPB 2A94A 1E1QA 3QPVA 2VDVE 3JATA 2Q2OA 1GXPA 3BMOB 3QLUA 4QXAA 1HRDA 4NU5A 1K0UA 3N8NA 2HRDA 4E2XA 1PL0A 4LCJA 3QVLA 4UFOA 3P27A 2HNBA 5IK2A 4QLAA 1SU4A 4UBIA 3R20A 4QVIA 4MVJP 4YRMA 1U8FO 2WSMA 3S6JA 5JPIA 2NUAB 4QUHA 3OIOA 5I6DA 3E0QA 3JWGA 1UC5B 1X58A 5F6FA 4XGRA 1BR1A 3CUQA 4PFQA 2WM3A 2ABWA 4Q01A 2P1ZA 1A8UA 2GEFA 4NZYA 1U0RA 1UQUA 4MB0A 5FP0A 4OBWA 3P0JA 1NY6A 1OI7A 3MJTA 3RUFA 5LXTF 4MMYB 2AJDA 5HJEA 3V4PB 3CUVA 1Z8DA 4CEIB 2DHEA 3HGQA 4BFXA 5KYXB 121PA 1FUKA 1RAEA 3O6VA 4QLCU 5FTLA 1Y6JA 4IGIA 1F17A 1VXOA 2SKEA 4C07A 2JLQA 3O47A 3J80K 4DZPA 3Q6MA 2NUPB 1CUSA 4HVAA 3T6KA 1EZ4A 4XFDA 1IIRA 3GJSA 2QNBA 4TKVB 3FCCA 1GKUB 1XZPA 3UHAA 2Z08A 1EKXA 3BSYA 4J0GA 2F3QA 1EK6A 4DUPA 1WL8A 4JBHA 1EFAA 3UWOA 3TAXA 3N2NA 2FPMA 5CT9A 4R6WA 3ULQB 2P2LA 3BG9A 1V1JA 3LGXA 4EJOA 2WWXA 1L5LA 1Z36A 3OYAA 2EKDA 1U0OC 4K8RB 1FYKA 4TZ6A 1UT6A 3VVLA 1GM5A 1I36A 2UYOA 2WFAA 4FWBA 3ZJVA 2CFRA 1VL1A 4XW2A 5ALDA 4D4GA 2O6HA 4JXZA 3DEJA 1LSUA 4XEUA 1K83J 3OY9A 1Z3IX 2QW8A 1X0XA 4Z7QB 1P74A 5B3JA 2UKDA 4HEA1 1LE8A 4LHZA 3LA7A 2R6GA 3LSKA 2HQ1A 2YHAA 4MQBA 4MR8B 3P94A 1TQ6A 2FQXA 1D2CA 4DIQA 1RXVA 1YS1X 2PGOA 3TPZA 3WGVA 4LOHA 4RESA 3ASVA 1I1HA 3BD8A 4JJZA 2ZB9A 3VC3A 5C8ZA 2BEOA 1S0UA 4MV1A 4GX5A 1N0VC 3OT4A 1S7CA 1X9GA 3E9NA 4B1RA 1T6XA 5HOEA 4YP6A 1XE3A 3ONVA 4BO6A 5J4LA 1SD6A 3MKLA 2OCDA 3Q88A 1CQPA 1C9NA 4KICA 3I64A 1ESDA 1RZVA 2LDXA 3F3YA 5F33A 4HL6A 4QBKA 1G42A 3BXFA 4ASUA 4KAFA 3ANYB 1PFYA 3ZQGA 3IT1A 3QG5A 4FPXA 4DCOA 4UATA 1E3OC 3FCYA 3Q5EA 3K72B 2OD9A 2FSHA 5ADHA 1UPBA 4UFNA 1PWHA 2VZ8A 4L15A 2NZUG 4N3AA 1Z8FA 3P7MA 1V43A 3DXXA 4BGIA 3PYXA 4S2EA 3LZCA 1ZRDA 4MQMA 2VJ4A 5CRIA 4PYMA 3H4IA 1OLTA 2M3AA 3LHSA 4P35A 5HZMA 3TUZC 2P9CA 2X48A 1Z6ZA 2C9DA 1NLYA 3TWOA 2GFQA 1PUFA 1RC8A 4FVTA 3T3DA 4UZFA 5L3QA 1QIDA 1O03A 5TT0A 2QR3A 3K20A 1E9FA 3QYBA 2X0IA 5IXJA 3BFJA 3ELBA 1WXDA 2YINC 2B35A 3ZWQA 3H04A 1RJDA 1J21A 5IN4A 1M1EB 1E9SA 1TEZA 3GDWA 1T25A 2TMGA 3SBEA 2Q8PA 2XQFA 5AP9A 4EUHA 2B7BA 2NUBA 4FTWA 4M1WA 3VU1A 3UJHA 1KYWA 2BSQA 1W0UA 3Q4GA 3KZVA 3ZH9B 1CETA 1F6WA 3GJ3A 2W90A 3OYDA 1WCWA 4LC0A 2GNAA 1E9VA 4XUCA 3ZGVA 5I47A 1YVDA 2H7VA 1E79D 1GPYA 2BUCA 3M9LA 3FCAA 5LKRA 4YAOA 1UBLS 5E8RA 3P19A 3LQRA 4RCVA 2G40A 1I6WA 3K9CA 4TTPA 4UEQA 2WHYA 3CG0A 1DQYA 5H1YA 1NK2P 1U5AA 2C82A 1XWWA 3W5CA 2ZSAA 4HGPA 4L8WB 1N5LA 5I5GA 4E3ZA 3KD3A 3EMKA 2WSIA 3E7WA 3CH7A 2QL7A 1TGVA 4D9HA 3B3QA 2VS1A 2YV2A 1VJGA 3TNFA 2EIMH 2ZIAA 3O93A 3AVOA 4QECA 1QGOA 4PPFA 3CNBA 1JTFA 3BXHA 2ZB2A 3WJAA 5EC8A 4Y30A 3DMNA 4FETA 4EG5A 1BQ4A 2AFHA 2AC4A 3HXTA 5KQGA 3KVYA 4TV8F 5MGBA 4JFRA 1KEVA 1E5DA 1XGSA 4B3IA 3B1YA 2HF7A 4U63A 1D8AA 2O20A 3TE7A 2C2WA 1GU1A 1TNTA 4GECA 3S29A 3AKCA 3N0TA 2JZCA 5J4KA 2O2ZA 3DM9B 4ZT5A 4DQDA 2ZAIA 4AF8A 4C7BA 1P0CA 4I2NA 4RH0A 4DLAA 2MTBA 4UCXA 5EJFA 2A3NA 3CMMA 1EUDB 2PO7A 2AD1A 2A5YB 4PTYA 5L3CA 3ENNA 2VP4A 3PQ4A 3QFCA 1DU0A 3MC1A 2HI3A 1X1SA 3R40A 2A0UA 2IYYA 1ITYA 4RMHA 2Y1WA 3K1PA 2VYVD 1CJVC 1ZN8A 5A3QA 4DEYA 3DF8A 2IW3A 4NH0A 2PWYA 3LSPA 1JHZA 1ZK3A 5L45A 3T4UA 1T5HX 3JZMA 3MJEA 1M7GA 4NESA 1SUPA 2WC1A 3KELA 3GFFA 4I6ZA 4U0YA 3A70A 2H16A 3ELDA 4XMYA 3WX0A 4CIYA 3AP2A 2L7MP 2O2HA 4MYSA 2E36A 3V34A 4O5AA 2JCXA 1ZGWA 4BQNA 3HLTA 5E6UA 4C88A 2A5GA 1UDRA 1H3FA 4BZWA 3K71B 1H0SA 3FF5A 1NBHA 3G8DA 3G0HA 1M34B 2GKOA 1YXMA 3L1PA 4Z4EA 3QWLA 1E2BA 3TSCA 4GPZA 4LYGA 2XTZA 1I3MA 2E9SA 2HQRA 5D3MB 2FR8A 3C6QA 2K4JA 2H52A 4B3BA 4L5AA 4IVNA 2GB4A 3BGSA 2XOEA 1QPMA 3FPHA 1ORVA 4HSRA 1QDUA 3U48A 1T9DA 1PFWA 2VAPA 1AUOA 4IMPA 2QVYX 4Y2YA 5B3AA 1CQJA 2MSEB 4DNQA 4W7SA 3OTQA 3ME5A 3X2QH 5ERIA 3WG9A 5JSHA 2NXWA 1O6BA 3RT7A 1TRHA 1JF8A 5B1BH 3SFIA 3EQZA 4Q9KA 3CRNA 4RELA 3NOVA 3ONEA 4TWBA 2OCCH 4IOCF 4FOOA 9GPBA 4RVDA 5FORA 4QYSA 1CE8B 4K8OA 4XOIA 3RABA 3JX9A 3ZGNA 5AUNB 4HNRA 3PENA 1JTVA 5DGDA 2AB0A 3PUIA 3A02A 4Z5XA 3R0IA 5TDHA 2R6JA 5CCXA 1DJNA 3ELYA 3BHJA 2ZBDA 3AHCA 1YH3A 1JQDA 3JQ8B 3EVDA 4KG7A 3OJXA 4WRRA 2WB1N 4YMUA 1YQUA 1X92A 2X2FA 2EA4A 3KOUA 1VSBA 2M6LA 2WLTA 3EX7C 3RRZA 3PNKA 4MJXA 1MPXA 2ENWA 3RS8A 5DOVA 3MF4A 2TMYA 2XRYA 5FUVA 1EBBA 3ENVA 3RIHA 5CDFE 2XUHA 3HZHA 1RADA 2QTMA 5K20A 3HDQA 1W93A 1J9EA 5E7JA 4RVCA 2QUBA 4QELA 2FB9A 2EARA 1JW9B 3DE4X 1SY7A 4MUHA 1M1NB 1T15A 2HF9A 3AFMA 2Q2WA 2F1HA 3X1KA 1GPMA 2C7QA 1AKNA 1N5OX 3SZOA 1N1GA 3KQKA 5BW8A 3CCMI 4OF4A 3PD1A 4RXMA 4FFBB 2K2WA 2OV1A 1R15A 3D7LA 1RYDA 1MOSA 4KFTA 3ZDZB 2GCOB 3W7AA 1VDZA 3QBJA 1DIHA 2OUKA 1V4BA 1PJTA 5KJ1A 3LT4A 4F11A 3CVXA 1U04A 4AYTA 4FZ3A 2G1KA 4RHUA 4WWCA 5AXDA 4YPVA 3GDHA 2QUZA 3LBIA 5H5JA 2VEDA 4FMBB 2A0FA 4DA7A 4DV6B 2P4QA 4F71A 3T1VA 5HNFA 1HE5A 1IRXA 1DEXA 1Q83A 3MKYB 1DG1G 3AKYA 2OHGA 1IIBA 3U9LA 1OAOC 4MKGA 4LZAA 4UCFA 3Q7IA 1OI3A 2EJVA 2D5BA 4WGGA 3T1YB 3FXQA 2WR8A 5K3EA 3AUJB 3UPUA 4WLVA 4JQSA 1APBA 2XAGA 5EHGA 4K2AA 2ZW9A 4PC2A 1Q22A 1MORA 3G6EI 2EWVA 3L7JA 5FWAA 3RODA 4L9TA 3MWYW 4BFYA 3WMRA 4OD0A 1SK8A 2VHYA 5ANRB 1ZK0A 2EZ9A 2ZJOA 4KR9A 2DAOA 4UE6A 4RY9A 5JXHA 2EG9A 1BD3A 2M4KA 4CM1A 3JR9A 1DG3A 1JIIA 4L3VA 2Y1KA 4PICA 2PLWA 4L74A 2BFPA 5LPNA 2XRZA 1V71A 3DPSA 1AKVA 4N3NA 4X66B 1FLDA 1WB6A 1O87A 2ATXA 1VZ3A 1NI5A 1YTLA 4I4IA 2VKEA 1OA0A 4IF6A 1XNJA 2L4MA 3D02A 1E60A 2LF7A 1TB4A 1FY7A 4NBTA 5HIIA 2XIQA 4ABTA 4D0LB 3H5OA 2W24A 5CB4A 4CDNA 2V59A 4GC9A 1ZXBA 3GCMA 1N5IA 4B80A 4UNNA 1TFRA 1I3CA 5JH7A 3HBAA 1LPAB 2I9KA 7ADHA 1T1JA 5F73A 2LW7A 1T8IA 1QIEA 1NW6A 4AJ2A 4FCYA 5HVQC 5FI5A 3BX1A 2OXIA 1KP3A 3ZWOA 3NHBA 2UZIR 1U0EA 5LA6B 1FFEA 3KP6A 4LJRA 1GXSA 2Z57A 4DLYA 1W88B 4A8PA 3N1UA 2QVCA 3RW9A 3Q8KA 1D4FA 2FP4A 3DMTC 4I02A 2XZDA 2WYIA 4JXXA 4NJMA 5JW6A 3KKEA 1IUYA 3GRUA 2WOOA 4U6SA 4XEHA 4MVJI 4DLTA 1S9DA 1Z07A 3THRA 5JYCA 1WQ4A 3I0MA 2OHOA 1MLDA 1UC8A 3PC3A 2DT7B 1DDNA 4ZIRA 1YDFA 1EJ9A 3EWIA 1ZM4A 1G5HA 2PJUA 3MBOA 5D4RA 5LWQA 1EA5A 2VDPB 1YR6A 4PONA 5IM5A 3JQ6A 1JHAA 1TJ4A 1ORTA 2VL8A 5ALIA 3PNOA 1SBZA 2YN4A 4QWQA 5HJ2A 3H9EO 2FMHA 1KK3A 5IZCC 3Q8XB 2CJWB 3P20A 1YV9A 1JVBA 4URXR 2IEKA 1XDWA 4ZAVA 4YASA 3DP9A 4LS3A 3EXHB 4Q3CA 4US0R 2XUJA 1BMDA 4F7ZA 5AXAA 2CUNA 1JLHA 2PSEA 2IBDA 2ZATA 4NULA 3G9UA 2O61A 1XTUA 2ZVPX 2ZP1A 2P3OA 4C1BA 4MDFA 1V1MB 1VCOA 1N0HA 2QRUA 4MNUA 3CO5A 4K0KB 2HA0A 4PK4A 1O95A 2H4JA 1Z63A 2XKPA 4JY7A 2P9BA 4IMIB 4OG2A 4OQZA 4E6EA 2Q2NA 1O97D 1WV1A 3NANA 1XTKA 5EUQB 4ZREA 2QVLA 1RYHA 3IJRA 1ZUD1 3R5FA 3B51X 4BUPA 4HD8A 1ANKA 5IDVA 3PA6A 1MHPA 3JVIA 1P5FA 4Q6WA 5IKEA 2IOFK 1YKFA 1UC4B 3JRDA 1GZSA 4B3AA 3AXSA 4MVJG 2C3MA 3UPTA 4TS9A 2XUAA 1TT5A 1CK4A 2XOXA 2UZ4A 1WHTA 4RKQA 3ZLVA 2VXOA 2ID8A 1TUBA 2GZWA 5FL7A 3HVUA 1IB0A 4MAFA 3UH1A 3LK6A 3ORFA 4IPAA 4L72A 2NS8A 2H9AA 4Z0TA 2M1ZA 5E8IA 3FWKA 4W7HA 1G5FA 1AGNA 4OJTA 5HDQA 2ILVA 2Q3CA 5KNLA 2XF2A 2Q9AA 2XCSB 2C07A 2GDJA 2RH5A 4ZQIA 4CKCA 1E3WA 5K3DA 2XWBF 4YCAA 2VG8A 3ICVA 1FMVA 3KB2A 1F06A 3N2LA 4OQPA 3OQ6A 3I9OA 2HDCA 3WGMA 2IA1A 5F5NA 3MHTA 1KZYC 4RF3A 3BWVA 5J40A 1QIFA 1UDWA 4MW2A 5JADA 1L0OC 1KHHA 1XTRA 3G7SA 1WEKA 1KZ9A 2BGKA 1J7JA 4MKRA 2ECKA 3SFTA 3AGPA 5DISB 3CESA 4C43A 5CLJA 3M4XA 1I7LA 3RF6A 4X94A 2CB9A 2E6UX 4UDYX 3REQB 2CWDA 4BFLA 2AE1A 1QNLA 4DT1B 4XCXA 4G01B 2LRHA 5EGNA 4XFJA 3CF5F 5IPFA 3ETGA 1Z4LA 4F38A 4DBZA 2O3JA 1SKMA 3GTOJ 1QRDA 2P5KA 2I62A 2JASA 4P4SB 4RJ2A 2ZCJA 3VA7A 3JWEA 4OI2A 5A06A 4HW0A 1VLJA 1UK7A 2V74B 4NCBA 2AN3A 4XWAA 3TTVA 5I9TA 4ZOLB 2K5CA 5HZGA 5F5LA 2R751 3OY7A 3UG7A 2GI4A 4PC1A 3Q7EA 1L8XA 5JTUA 2Y2ZA 1KBZA 2VBYA 5HRCA 1XALA 4G84A 3E7FA 2L2OA 2C2BA 5ICCA 3FVVA 4E5KA 1LS6A 3EYYA 5FBWB 5F0HA 2GM4A 1V1RB 3ZDYB 2VP0A 1MIHA 1QV7A 3I04A 3G1WA 3C8ZA 4IRMA 3OPVA 2BYVE 3IAFA 4PZUA 3CC7I 4F6RB 1Q0SA 4FJ2A 1SBNE 4RB0A 2GYUA 4KI7A 4OYLA 2E1NA 2I8DA 3NVKI 4I1YA 2ZSIA 3R6GA 3I6QA 1OR7C 1NFFA 1SBYA 3BY6A 1VLLA 4TL8A 5EI5A 3LXUX 3I30X 4YJFB 2X0KA 1OPCA 1O08A 4C7MA 3ZDFA 2Q6OA 4ZV9A 5DDIP 4HDNB 3RUDA 4HSEA 2ME6A 1SZDA 5C8XA 2TECE 1LBIA 2PUCA 1QB7A 2JIQA 4AXBA 2DT5A 5LEJA 3DTNA 3DBHA 2R84A 3K09A 3LQFA 4YHHB 1OIXA 1QGAA 1UADA 2GWRA 3SJUA 5EJ9A 4YAKA 4R2XA 1EUCA 2ZROA 4XL9A 3SZPA 4C3UA 2XLCA 3MMPA 3UAWA 2XPUA 1LEAA 3F5DA 2G77B 2VNHA 5BNZA 4E15A 2VC2B 4GUDA 2YKGA 4FYIA 2HMYB 2X41A 3LX8A 1QONA 5JMTA 1YZUA 5CBPB 3EUFA 4FD2A 5JZBA 1TAQA 2OHXA 1CQXA 3CLTD 4LK2A 3ZD7A 4ZK2A 2PZ8A 1ODFA 1KEEB 3F6VA 1USSA 2QN1A 2H1WA 1Q44A 4FYKA 2JJ2A 1K5PA 3LY8A 2FKAA 3TUIC 3FYHA 5HCUA 1YR7A 2FOXA 2RGCA 4H0CA 3FTDA 3A1WA 3HUGB 1W0JD 1L4FA 3GLFE 1BMQA 2Z5VA 1P9WA 3SE7A 3MUOA 2A0WA 2RG1A 1TCVA 1ORWA 3Q87B 5GGYA 5JLJA 3JALB 5FRMA 4YO8A 3I9MA 1OX4A 3IELA 5D3QA 2IBMA 1T0UA 2VSFA 8ATCA 4G6TB 3N6VA 4BLQA 4LYDA 3CGWA 2C4MA 2EV9A 2HU8A 1Z88A 3B7WA 5IYZF 2X1DA 3GWZA 3QELB 4MIEA 4HATA 3LKBA 3HL4A 3LCJA 4YELA 4OLAA 4AZVA 3E5NA 4HVCA 4QU9A 1ADGA 1A7JA 3WYEA 3IHLA 3NNDA 3W2VA 5T6BA 2WP8J 3T7TA 4LCBA 1E4YA 5E1XA 2XYHA 2OO7A 4UM8B 3FBIB 2XX3A 3AX6A 2KIFA 3NEAA 3L7AA 3A1FA 3ETCA 2AQ8A 1MJNA 3RTGA 5KNCD 4BO5A 5A2QK 3T9AA 4B3JA 2O3SA 1WRJA 1ZVJA 3CVYA 4X0EA 2IEDA 2B4TO 3IE1A 1VC2A 5DNCA 4ZZ0A 4YBZA 1AG9A 3FXAA 1QGUB 2W4SA 4I6JA 1E6KA 1E0EA 4HT3B 2I55A 4CEHA 3KWMA 4K9MA 2LY2A 2WT9A 4QVKA 1P44A 4CHGA 2L9VA 1H0KA 4KLAA 2NXJA 3JAMZ 1TKCA 3CW9A 3LNCA 3U4MA 3JW8A 1W36C 2QUFA 2AJBA 5DBEX 4X3PA 2W57A 1E2DA 2FPKA 2W6ID 2P6NA 3OX4A 3TK1A 5EHQA 1YL7A 5BPFA 4U9IS 4Q1VA 3VNAA 3SJCA 3VYSB 3LAJA 3QGMA 3Q41A 1QIHA 3R3VA 2IF0A 2FXIA 1LEBA 4Q7KA 3ESWB 2K6GA 5JYEA 1DGWY 3TZKA 2VJKA 1JG7A 3M5PA 1AQIA 2ACWA 4BU0A 4DLXA 3B78A 3D6HA 5LOVB 4GKBA 3CVJA 3ADBA 2NTEA 1HFKA 1VSUA 1MNEA 1Y8RA 2A9JA 3PGA1 1UJ5A 3N2GA 1RWVA 4XLPF 3K0FA 1KFEB 2OMEA 5LQKA 3UGKA 3MCVA 4GVLA 3LHDA 4HGYA 2H06A 4W97A 1SD5A 1HT2E 4N4NB 1VJDA 2PUHA 4B6SA 2WZDA 2GGSA 5KNDD 4A12A 2QTVA 3ZHRA 2JFBA 2K9MA 1G5QA 4GG1A 4IV5A 5BMVA 2RNJA 2PMBA 3KUDA 2R48A 4RF5A 3PFKA 4UZEA 2ZKZA 3EVCA 3LD9A 2XMZA 1GARA 1DAHA 3DM5A 2EBWA 1HDOA 5B1EA 2R8XA 3QUQA 1QO0A 4G0WA 2V03A 1U1DA 4IEFB 2RIRA 3L0SA 5JAUA 1P3DA 3UHOA 4NC8A 1RC9A 2AEEA 3GZNA 2FA5A 2BY2A 1NUTA 1FU4A 4X0GA 3OYMA 3OBIA 3PF8A 3AAFA 1FLVA 3EXEA 2UV1A 1KXZA 2ZS7A 4MGHA 4AI6A 2IYVA 1YQWA 2CV1A 1RWNA 1ZLJA 3F74A 1BBYA 2A3SA 3E5RA 2SKCA 2DT8A 4JL6A 3PUXA 3B3GA 4XUDA 3UK7A 5IVPA 4A3BJ 4MQ9F 3TI7A 1KAHA 1H9TA 1YJBA 2IYUA 4EJUA 2A9PA 2Q3FA 2E1MB 2Y2UA 4RVFA 4WNAB 2Y0SA 3WLTA 4BFWA 5CBKA 3N2ZB 3LC7O 4Q7LA 1F1BA 2HPVA 2WADA 1QFJA 4GP6A 3PIPF 4XX0A 2DF8A 4ON9A 4RJKA 1ZHOA 3JQRA 2ECBA 5CEFA 5A4KA 3WTUC 3KDAA 2PV7A 5IS2A 4FDMA 4I8XA 1TJYA 3PQDA 3WGTA 1AHHA 3WAKA 1H2FA 2V55B 1OLXB 1OKRA 3QOXA 2RJNA 3A4TA 2VDWB 2XB6A 3S3OA 5LVAA 3TVYA 1JU4A 2Q1UA 1Z74A 3IMCA 3C8MA 1L4KA 1TW3A 1I80A 4KAJA 4U7GA 3TGLA 5C37A 4LV8B 3JSOA 3DVAB 4DTIA 4IJVA 1YUMA 5SICE 5IANA 4HWGA 2VWHA 4B3SB 3BGVA 4BDSA 2Y76A 3HXPA 4GNKA 1DQSA 4R8RA 3A4VA 4XGNA 5C9ZA 4QUJA 3K70D 1X7XB 4DY6A 5C8YF 1ZGZA 4HGQA 5L4LA 1CDDA 1OUMA 1JI0A 2E2IJ 4RQUA 1SQSA 1SU8A 1OWOA 3SYNA 4OX9Y 4IHVA 1H6BA 3W79A 5LKAA 2WHEA 2FH5B 4AZ3A 5DNEA 4M9QA 2HMVA 4FCWA 3QWIA 5FA5A 2Q4BA 2GEKA 2IHKA 1T2DA 1TJPB 4IKOA 4QUEA 4F4JA 1BKYA 5IFKA 1BJZA 2FRXA 1M72A 5D1HA 4BB5A 5BNTA 3R5TA 1T1GA 2EFCB 3ZE6A 3BJZA 3CZ5A 4IH4A 1E69A 3CUEF 2ONJA 5FPTA 3T52A 3M1AA 4KQEA 3S7ZA 3N3BC 1P2UA 3U3JA 3RBVA 5HIMA 4CT0A 3PQCA 5KPDA 1XO1A 5K7HA 1OVGA 5EIOA 1E3TA 3CLUD 4DGQA 1G2HA 4KZKA 2ACVA 4UNIA 1Y80A 1AB5A 3ZWBA 1U1GA 3B7GA 3FKSD 2ET6A 1J2EA 3VUFA 3PWKA 2E2JJ 4LXYA 2ATVA 3B12A 1RIFA 3Q10A 2DOFA 3G1UA 2OORA 1P3Y1 5ALEA 4NCJA 2O0LA 3I83A 4IG9A 5BN5A 2XRNA 3LRXA 1YO5C 2YXEA 4ZGGA 2C5GA 1DAKA 2ZB4A 1Z2AA 3BOQA 1QXSA 1Q2XA 4ZYLA 3OZAA 1IO2A 1Z7EA 1OTYA 1WJDA 2MYNA 1JBQA 2RHDA 1F8FA 2J5RA 4YIKA 4H31A 4R9SA 3RUPA 4UAVA 1JNXX 1RQNA 5KS2A 1HDCA 3HOTA 3OZUA 3GJRA 3NP9A 3HN2A 3EYAA 4J91A 2NZ2A 1SD7A 1R49A 3W9BA 3TLAA 3IAUA 1VLHA 2ZJPF 3AVWA 1RKWA 5L3GA 1YBAA 5AW4A 4CEJB 1YS7A 1TUGA 3VR2A 3KKKA 3DKXA 4F93B 2IQIA 1BS1A 1WP9A 2Q0HA 3X2FA 3MK31 4I5GA 1ZD1A 2FETA 3OYGA 3NT2A 1TCBA 3C5WP 3PFYA 2ZZNA 1PL7A 3JRNA 4PAOA 2HCTA 1BCSB 3X0DA 1AZTA 1ZH4A 2HSZA 4BN5A 2ICAA 3A2LA 1ZL0A 5H68A 3UW3A 1CY0A 4EKNB 3VYTB 2BFWA 1R8QA 4L0CA 4QWWA 2FFRA 3OTGA 5H9WA 1LQ2A 4M9CA 3RYFB 4OAZA 4QUBA 4EHAA 4FDAA 1K78B 8LDHA 2GILA 3MGCA 4FKZA 3EC2A 1ZKGA 3ZDRA 4XM3A 5AW6A 3FSJX 1PT9A 1MC5A 4CNQA 2RGNC 2OENG 3O8DA 3VJMA 3QYEA 3UENA 4KN5A 9MHTA 1YACA 5FBZA 4PGMA 4AJEA 1TO6A 3P9KA 1TFUA 3H7IA 2VSOA 1MB3A 3LE8A 5EZGA 2COKA 1MG0A 1IZ0A 2G07A 2MOKA 1P72A 4QPQA 4P4UA 1NMSA 1HR0B 4DJEC 1Y1PA 1OKKA 4ZZ1A 3RC9A 3EPRA 1X2BA 3ZLUA 2FHSA 3E9YA 4YBRA 5LZ8A 3CE6A 3ZQUA 2ORYA 1R8JA 4D0SA 5D87A 4KT6A 3A1TA 4JH0A 4YUXA 2KDZA 4XM2A 3KLMX 2V4MA 3BCUA 3TINA 1ZK8A 4H77A 4TWZA 3GLVA 4G85A 3DE1X 2G25A 2LREA 4UUBA 1RJWA 1RYEA 3M49A 4Y1FA 5FWYB 5JCXA 5B4UA 2SNIE 1NXXA 1YBMA 5EMMA 3AK4A 2J5BA 1M5TA 4PJLA 3EVNA 3QWAA 1FJLA 3FMVA 2A5LA 2GMWA 4KLRA 1GZ4A 2JATA 2EIKH 1UK8A 4BV8A 4NR0A 2D7JA 2QX4A 4E11A 4FB5A 5KWEA 5DHFA 2DKOA 1QFSA 1T0FA 1ENZA 4CJXA 3KVNA 4BXFA 2VOPA 2IYEA 1ONNA 3ND5A 3FM9A 1V5GA 4NZMA 1ECBA 1VQMI 4LRTB 3UA4A 4BAGA 5CXQA 2CLSA 2I1QA 3C16C 4L0MA 1TJ5A 2DBYA 4TZ0A 2JHGA 5CCEA 4AJ4A 1YE5A 3HP1A 1PR0A 3ZQJA 2QM8A 3NDPA 4HAVA 2HDOA 5FKMA 4UW9A 2O52A 3WIDA 3PGXA 4M9SA 1SQ6A 2GFHA 2QK4A 2CW8A 2XUPA 1YNSA 1KR5A 3R7BA 3FMIA 3I9V2 1BZYA 1PYOA 1JDBC 2TYSB 3DQQA 2HRBA 4P38A 3STUA 4MUIA 1RJEA 4KB5A 3D0RA 4KVAA 1GXQA 2QD5A 4X1OA 3IOYA 1Q1QA 4PRLA 1W4CA 4IYRA 3FF1A 3FZYA 4DREA 1WQ2A 2O7RA 4BNGA 5BVGB 1MD9A 3AR7A 1RP1A 1XF9A 1YRNA 1YDMA 1T98A 4F4CA 3RVQA 3Q3CA 3L2CA 4KN6A 4WJKB 5EL0A 2I22A 3TL2A 5IHXA 4QHYA 4TXHA 3T7SA 4G3XA 3JQEA 4ZCSA 3I0NA 1HTTA 4IDNA 4JX6A 4XB6B 1IN7A 3NI2A 4ALJA 4AX4A 5DU2A 3Q2OA 3FKJA 2CDAA 1B93A 2CNWD 3AWDA 4NYMR 2MW8A 2KHZA 4IZOA 2L7FP 2CHFA 4RHFA 2AC2A 2EQRA 1QZEA 5JAQA 2ID3A 2I4NA 2PS1A 2WSSA 2FWJA 3PQEA 2PJPA 5KVRA 1XC7A 2FV8A 3RUAA 1VQKI 4DIOA 1WOYA 2WMDA 3FLBA 1TF5A 4YAEA 2O5EA 1P2VA 3VC2A 5D5WB 4MOWA 3INTA 2YJ5A 2D2VA 1JB9A 5HLTA 4RJTA 2YS9A 3MRSA 5A3SA 2Q5LA 1D0IA 4B3GA 5BT9A 3QMMA 1WD7A 1XN4A 4JI0B 4QYWA 3FUVA 2BGCA 2Y66A 4ZC8A 4GLOA 4AKTA 1BRTA 4UBLA 2BI8A 3THWB 3M0EA 1KIAA 3O1IC 1N0IA 1DPGA 2GXUA 3WGZA 1JHRA 2V6GA 4Y9UA 4DA8A 1DAOA 1NONA 4U6QA 3H1GA 2H57A 4EHNA 3T94A 4KO2S 3LU1A 2IQ5A 1FXSA 4XQCA 2VBCA 4L5EA 5TQVA 4ER0A 1IWOA 1EDBA 4N9HA 1LBSA 2BXZA 5H6QA 1R8SA 4RH3A 5HZHA 3BMXA 4MVJD 3VPFA 3IT3A 1F4KA 2WIDA 2AHOA 4JA2A 3RVPA 3TZCA 4X9XA 3KBBA 3QLVA 4M87A 2VTVA 2Q6IA 1WKBA 3A6KA 1K27A 2M9HA 4YMIA 2AKYA 2ZUCA 4TZKA 2BGUA 2O1WA 1JTYA 3ZRGA 1RAGA 3W6JB 4KN8A 1CDZA 2MLGA 5HFAA 4EF6A 3AW9A 3T5BA 3RYCB 1U7ZA 2FR1A 2FPUA 3QP9A 3L7IA 4Q47A 5F0CA 5IABA 1BIAA 4YCMA 3UMFA 2ZR8A 2WD7B 3S28A 4OFXA 3O82A 3I39X 1FXWA 1H65A 3WMEA 4XWKA 4PO8A 3A11A 3DZDA 4HUTA 4CG0A 4JELA 4AIHA 1AQUA 3PXDA 2LK2A 2BSXA 1CFZA 2HQOA 2VPWA 2XA1A 2BHTA 2ETXA 2ECCA 2CMPA 5FB3A 4CTKA 3ZQ7A 3NYQA 3S2DJ 3TO9A 1UCRA 4M54A 4U7BA 3VR5H 1N0WA 3FLEA 3TSAA 2X0RA 3S8MA 1OFUX 2P11A 1HOMA 4PQFA 4N5HX 2C58A 4OINF 2AL7A 3ZLJA 2ZRDA 4V03A 4N39A 4OHVA 1RZ3A 2IYWA 3D43A 2QN2A 2P5YA 2Y1GA 2J8ZA 1FMTA 1J22A 2ZS9A 2PEXA 1SCDA 1J0AA 4IDGA 1RZ4A 4WXEA 4Q9LA 2I0FA 4ZZIA 4D8TA 3SR0A 2BFBA 1YDWA 1HDZA 4I9GA 5HTOA 4NJOA 4LSGA 4IOLA 4C01A 2X3YA 2DHDA 4BPRA 2OV3A 4OKNA 1NIJA 5TXGA 3DFIA 3CN9A 5J2UB 3I2GA 3SMQA 2FE1A 4G0OA 3JAWA 2H9YA 2Q2EB 2XBUA 2IS4A 4MUXA 4ENUA 4OTZA 1K4KA 5C5EA 2RNGA 1YX5A 3QIAA 4C3ZA 1THMA 2PUAA 1RD4A 1T08B 3MGAA 4B45A 2IBSA 3HXKA 2Z33A 3KR2A 3OI7A 3I1FA 2IYOA 2NO6A 3OMYA 3BRWA 1AUVA 4GXOA 1UFRA 5AH0A 5L51A 2VHXA 1NXWA 2H5IA 4ZO4A 3O5AA 5J9FA 3OZCA 1GTL1 1HG0A 5JSUA 2JNWA 4RHXA 3VR5A 2DHRA 1G1AA 3B52X 3OYCA 4B2LA 4NAUA 5EE9A 1CQIB 1SA0B 2DMPA 3U56A 3W3CA 1R9GA 2L4AA 3S8PA 3SXYA 5ECDA 3S3TA 2IS2A 1Q7CA 3JARB 4BQRA 1Z35A 2W4QA 1VLZA 4IINA 1KA9H 2I4LA 5ELXA 2W6CX 5BNIA 2CSXA 1VL0A 3U26A 5I9MA 3V7RA 1ZU4A 5EF6A 2QNIA 4UEOA 4OK5A 1RW4A 2AXPA 5DNUA 3FM5A 1O3RA 5AHRA 1U9OA 1WLYA 2VIXA 2JFPA 2DFDA 2VVTA 2LP4Y 2FN3A 1F6DA 1SUSA 2YWBA 1NN5A 1B26A 3ZY3A 2R5WA 4HO1X 1JVSA 2XRMA 1Z6TA 4YIIA 3G1MA 6Q21A 3IUOA 3SQNA 4RIIA 2CVPA 4OL0A 1JEJA 4RV9A 4CLRA 1EUYA 5IUNC 2XB0X 4FT4A 2M1XA 3IQIX 4EGSA 3L7LA 2Z98A 2P6TA 4KW7A 4HK4A 4PR0A 5TNXA 2XF6A 1K61A 3YASA 2WM2A 1NLFA 3TYXA 3GP3A 3FPEA 2C7OA 2J5QA 4MVCA 5K6AA 1SEPA 4I6EA 2YW2A 4ZMBA 3JSAA 4NB5A 1OFTA 2XXAA 5DM1A 2RH8A 4A1FA 4P3YA 2TCTA 1JDNA 4F4UA 4WI1A 4EA7A 4UBNA 4YECA 4TXMA 4HEQA 2HX1A 2XQVA 3E15A 1WMAA 3V6LA 2LZ0A 3GFVA 5HILA 5EJCA 1T4DA 1FA9A 3C1AA 3BCAA 3DE6X 3ZV6A 1Z0SA 5KREA 3QWFA 3IVMA 4C2BA 2O2JA 2IDJA 1DARA 4BS9A 3SDZA 2E71A 4PRKA 4ZVVA 1GG5A 3KNZA 3TL4X 3PM1A 1S2MA 2QD3A 2GZRA 2ZJFA 2LUOA 1HCRA 3OC0A 3QLTA 2PXAA 3SOPA 3OL4A 1I3AA 3FR7A 4A69C 4IKFA 4K9PA 2PUGA 3ZMSA 3P26A 3E3OA 4DWJA 3H4MA 1Q95A 3RSOA 2ID7A 4QOHA 3UHPA 4JKOA 4WFQA 3GY0A 4FIZA 2WWHA 1FNDA 4OXNA 1RZRD 4JLNA 3AI7A 4LZPA 3IAM1 5ARDA 2JCSA 4YHBA 3RLIA 2OM6A 4PZYA 1FJHA 3JWJA 4KFSA 3NUGA 1VA5A 4R81A 3VDRA 1VL5A 2QD1A 5CIWA 3MSCA 1TZLA 3L8HA 3ZN0A 4JLBA 4BASA 3LL4A 5H2FC 3PEWA 4KXNA 3ZU6A 4LYJA 1HGXA 1F8GA 3COYA 2WJJA 4YQEA 1U02A 4NQZA 1BXGA 3A28A 1MRZA 5LZ2A 3KOXA 1AGRA 1YFZA 1OV4A 1RAFA 1Q50A 5ALTA 4BVEA 1AZSC 1IXCA 1Y7HA 4HVLA 3K0LA 2HRQA 3H2YA 5CGQB 3AQ4A 1ZNXA 2UXDB 5CM8B 3USES 4CM4A 5F51A 1MXFA 4EKEA 3WWOA 2HYJA 5E6SA 3CEHA 1ULTA 8ABPA 1NSTA 1QDEA 3HL0A 1MNAA 3BH6A 3UTCA 2PWZA 1AK2A 2W2PA 2NP6A 2HK7A 1CLEA 5G0WA 4DMCA 4JXKA 4HRIA 3NHRA 3ZQFA 1G17A 2LNDA 4P4GA 5FNVA 3VZQA 3I04M 3WXBA 3JQQA 1WFXA 2WILA 4JXJA 4J0IA 1MW9X 5GP1A 4EELA 5KYWA 1NWCA 2W2LA 1YZKA 2QNRA 4BZPA 1OILA 3KKZA 1MVOA 1UBGA 1N3IA 4G0NA 1M74A 4BVGA 2ZFWA 1SMTA 4BNMA 1GL7A 1XTSA 1MH3A 5H59A 3AG6A 3O26A 1SWWA 2PZJA 1OOEA 4EMUA 2OECA 4DLNA 3FMOB 4C78A 1NNI1 2JIRA 1ZUNA 2LDUA 3I9NA 1RAIA 3SYKA 3D2CA 4EKGA 3J7AC 1ONBA 1ESNA 3QKRB 3K6GA 3QX3A 1NJGA 1H0MA 3SAJA 3QOWA 2V45A 3TP0A 2BMVA 5K4AA 2B34A 2N9UA 1UJ6A 2ZS8A 3E22A 1L1RA 2W82A 5TRDA 2XIJA 4DSNA 5FKOA 1S2IA 1P9NA 4BRSA 1YRLA 3SIRA 4DQ0A 3SVZA 3CX8A 1RHUA 3CPJB 1HMPA 1RLJA 2ZKIA 4BVFA 1FFSA 1W5AA 3HPGA 3DGFC 4YLGA 1MSFC 4TRJA 1SC1A 3C24A 1E7RA 5K5OA 1ZVQA 1PSDA 2D5AA 4AJJA 2QSFX 2BW3B 2ZM6B 3BRCA 2PT9A 3EH1A 2HPHA 1I5ZA 2JC3A 2QTBA 1AQNA 3SSAA 5JMPA 1WJ5A 2V54A 3H0DA 4RLFA 1Z2PX 4PAMA 1HF3A 3SFZA 3L7KA 1UHSA 1ZOLA 3A4MA 3FHJA 4WK6A 4KT5C 2AC7A 3ZXYA 4CPDA 2E49A 4C6HA 4XORA 4MWCA 5CW1A 1TLHB 4AJ9A 3GEPA 3UJNA 4E7OA 2QAJA 1CFJA 2ZAYA 2HLDA 2V5UA 1HX7A 1CJMA 4EB3A 4GU5A 4RPKA 1J24A 3C8UA 1KTVA 3B6ZA 5BSEA 1XAIA 1USGA 3ZOZA 2BDUA 4X00A 2DUMA 1MEOA 5LA6F 2PD6A 1H5UA 2FQ1A 4G86A 3IP8A 1D2GA 4JIMA 2IHYA 3KKLA 2R1ZA 3L6RA 2F55A 3G5TA 2P1RA 5CD9A 1KZ7B 5FBKA 5KHOC 2GEVA 4II7A 1WJGA 2X76A 3G9QA 1DC8A 2PUVA 1ST2A 4MQFA 2IA5A 1JEQA 1RBZA 3QU5A 3AUSA 4XD7D 1NQ5A 5JAIA 2Q6LA 5FLKA 4HH4A 4K3VA 1DZIA 4FQ7A 2ZI3A 3TSZA 1ZK2A 4Y3UA 1RTTA 2WIFA 3KT0A 2BFFB 2DERA 5CD1A 1W0KA 2GBGA 2XKKA 2OHHA 3SJMA 4LB6B 4YQFA 3E6CC 2D1QA 3GEDA 3L3BA 4OLFA 4B82A 3VHXB 4Z4FA 1OCRH 4ZO8A 5EQDA 4GW3A 4OIRF 3RKXA 3STXA 1VCIA 2C3PA 1BIFA 4YXFA 3V8EA 1E89A 2CE2X 2GN6A 4RTNA 3OJCA 4FYVA 2NZYA 3OHMA 1RQ7A 1H2YA 2H3EA 2BBWA 1TTQB 1PF7E 3EC1A 4ZAZA 1HV8A 2QBYB 4WY5A 1J0XO 5K8UA 3UJBA 3SVTA 3OV8A 4ZEVA 3TBFA 4JJKA 3ECAA 1T5OA 5FI1B 4OP2A 3RBAA 1YZHA 1ULUA 3I56I 2ZT7A 4JEMA 2HQSA 3WOHA 4JUCA 1GG2A 5TF0A 3ZI4A 4MRPA 1WXEA 1M2NA 1QH9A 4AZWA 1F1JA 3L6OO 1V55H 3BWBA 1WD5A 1Z73A 3LDHA 1E0KA 1TEHA 1RRCA 3O2PE 1GGMA 2CFCA 4MWTA 1VJTA 4IYJA 3U9GA 3RC8A 3V1YA 3L1KA 2DPGA 1OHHD 2WNHA 5EPUA 4XRSG 1SXJA 4Z6YA 1PUIA 1P6QA 3OJ0A 3MAGA 4EYKA 4YV1A 1IXKA 2WK1A 2KLBA 1QYCA 1ZCJA 4BJ6C 3LA3A 1U7PA 4DJJA 4TSFD 4JUDX 1AHDP 1Q6YA 2JD2A 1ORKA 4ZEXA 1KU3A 5JZOA 1DLIA 4XYMA 1U2ZA 1H2AS 5IUKC 2ISQA 3WA7A 1FJGB 3KEYA 2VC1A 3K4NA 5T3YA 1LPOA 4FX5A 2BSAA 1PRYA 2ZRPA 4MIYA 4ZRMA 4EGQA 1RHMA 2JCBA 4PY2A 4DIBA 3V00A 2CLDX 4K9RA 4DLLA 5BW4A 1GUDA 1HE4A 6ADHA 4A36A 3NETA 4DR4B 2NZWA 2V8BA 4CCWA 4XVRA 3GRFA 4E22A 1PU2A 3GW8A 1SD2A 5ITWA 2AZMA 4Q9DA 1QGDA 3BSFA 1MUUA 1PQYA 2FG6C 3PGLA 5ADVA 2PMHA 5CMLA 3DVSX 5KOIA 3K4PA 3C2GA 4PZDA 1CQTA 4PPYA 4TSRA 1H22A 1MNDA 3HA3A 4X1IB 2QQ9A 1K5HA 3AVTA 4PYOA 5F7XA 2FJ1A 1XRQA 2Q3HA 3C3BA 4HAIA 1WB5A 4B48A 1XS9A