3RRFA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with atp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
b'MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrfA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrfA02
4JKUA 2RBCA 2HLZA 3QA2A 4O1GA 2HQQA 4LBXA 3UQEA 1TZ3A 4K93A 4KADA 3B3LA 3W4SA 4EN4A 3Q92A 4XDAA 5BYEA 2ABQA 2DDMA 3B1OA 3DRWA 4N09A 3RT9A 1JXHA 4X8FA 2I6AA 2ABSA 1EKKA 3RU2A 1V1BA 2V78A 4E8YA 1RFVA 3LHXA 4S1HA 3VAQA 1LIIA 3B1NA 3NBVA 5C40A 1C3QA 4KAHA 4S1IB 3CQDA 2AJPA 3HICA 2DG2A 3PZSA 4YWRA 3B1PA 3RPHA 4C5NA 4JJPA 3LOOA 2QHPA 4LCAA 3UMPA 3Q1YA 4YL5A 4E8WA 5F0ZA 1V19A 2Q5RA 3IKHA 1DGMA 3K9EA 3NC2A 4KBEA 3RSQA 4E69A 1RFTA 5C3YA 3NCAA 2C49A 3H49A 1UB0A 3D3KA 3LKIA 4WJMA 2JG5A 2HW1A 3NL6A 4K8PA 4U7XA 3RQ5A 1V1AA 3PL2A 1LHRA 3IBQA 2PKKA 3GBUA 3QAIA 4K8CA 4EUMA 2F02A 3UQ9A 2AB8A 4N08A 3RNOA 3RRFA 3H74A 3NL5A 2VARA 3KTNA 1GQTA 3RREA 3UBOA 3IE7A 3RU3A 1TYYA 3B1RA 4E8ZA 1YGKA 3IH0A 2AX3A 3RQ8A 2PKFA 2C4EA 2FV7A 2R3BA 1BX4A 4XF7A 1RFUA 3ROEA 3ZS7A 4EBUA 3RY7A 3RRJA 2DCNA 2NWHA 3KD6A 4K9IA 3RQ2A 4C5LA 3I3YA 4DU5A 2JGVA 4LC4A 3RQQA 4EOHA 3UQ6A 3BGKA 4UBEA 4K9CA 2I5BA 4GM6A 1YHJA 1JXIA 1V1SA 1LIKA 1TD2A 2I6BA 1U2XA 3IQ0A 3ROXA 2PKMA 2R3EA 3RQ6A 3RQXA 3N1CA 3RS8A 3RTDA 3OTXA 3RTEA 5EYNA 3NC9A 2YXUA 1LIJA 3RPZA 3ROZA 3D3JA 1TZ6A 3HPDA 4LBGA 2A9YA 2QCVA 3NL3A 5EY7A 3NM1A 2XTBA 3MBJA 3B1QA 5CGAA 2JG1A 1EKQA 3NL2A 3RO4A 1VM7A 4PVVA 4S1MA 3RT7A 3RQHA 2AA0A 4S1IA 5CGEA 3NM3A 1LHPA 2O8NA 4B8RA 2YXTA 3RSSA 2AFBA 3RS9A 4E3AA 4DC3A 4XF6A 3ROGA 3NBWA 3IN1A 4K8TA 3RRBA 4JKSA 1YGJA 3GO6A 3RM5A 2DDOA 3RTGA 3RSGA 3RSFA 2DDWA 3FHXA 4O1LA 3UQDA 5BYFA 2AJRA 5C41A 4C5JA 5TRWA 4B8SA 3EWMA 1WYEA 3RTCA 2F7KA 5C3ZA 5B6AA 1L2LA 1RKAA 1VK4A 1JZTA 4KALA 3DZVA 4KANA 1RKDA 3KZHA 2AWDA 1ESQA 3JULA 3RTBA 5F11A 2PKNA 1UA4A 4E84A 3HYOA 3FHYA 1LIOA 3RO7A 4K8KA 1RK2A 4XCKA 3VASA 1VI9A 3MBHA 5COJA 5BYCA 1GC5A 3K5WA 2A9ZA 3BF5A 1ESJA 3LJSA 5BYDA 1KYHA 3UMOA 3GO7A 1RKSA 4C5MA 5TQIA 5CM5A 4C5KA 3KEUA 3RTAA
chains in the Genus database with same CATH superfamily
2MT9A 4HAUA 2JGDA 1YGPA 5DN9A 4I3HA 2EHJA 4ARBA 3L7YA 4MH0R 1A69A 2IBSA 4JC4A 3UK6A 4AYXA 3H1EA 2KPOA 1NE2A 4E07A 4XDAA 4JR0A 2W90A 1RCUA 3B6KA 1GDDA 3KE8A 2Q4RA 2HV9A 1OYWA 5LBUA 1W4ZA 2IFTA 3A4NA 1HLFA 1BJTA 1Z6GA 4M8LA 4NARA 2AZXA 1Z5PA 3B3QA 4BVAA 1IN4A 2O6LA 2HCRA 1XO1A 2QSJA 3F46A 3QU2A 5HOEA 2B7BA 1RQXA 3GCDA 2EF0A 2VXCA 4E6PA 1F9AA 3QYAA 1H1LB 3VI3B 4HQ0A 5J2UA 1E32A 2OB2A 4YPFA 4DWJA 1YONA 5LXTB 2DQZA 2GLTA 1XF9A 5EHQA 2V5VA 2WF9A 3N0WA 5EKTA 4BQSA 4ZIRB 3VZRA 3OPXA 3I34X 1G8AA 1FS4A 3UMRA 5IC4A 4NMXB 2F90A 3PD1A 1KAQA 3T4PA 3RBAA 4M0FA 3VTFA 4DB4A 3T7IA 1YU6A 3DWGA 1KWKA 1FEZA 2R8ZA 1EP1B 1WZNA 3DKPA 1XYGA 5BWCA 2XDAA 4M76B 2RHDA 1ONOA 3ROMA 1X7XB 2JDID 2B37A 5HMMA 1BEUB 4HADA 1BYIA 4X71A 4CV3A 3LOUA 5JWHA 1F14A 1E4VA 1H5UA 2PKEA 3TF5A 3KQTA 3PU6A 1EVJA 1JE0A 2P9ZA 4MCJA 4TSKA 1F6DA 1FLVA 1ZI8A 5FPQA 1YS6A 4JR2A 1DAGA 1DG9A 4KGZA 1XNHA 1P1JA 3L7AA 4IFIA 1J1ZA 2YWRA 1QX3A 4G07A 4BFUA 4MVCA 1JJAA 4B5KA 1PQ4A 3Q7PA 4EG6A 3HKDA 4BJ5A 5CJJA 5E7QA 1X2EA 3RSCA 4N49A 4WV3A 3NTQA 1FLNA 2QE7A 1J24A 3LGAA 3SEZA 3LG2A 5F35A 2ZATA 4AM8A 5AW6A 4CEIA 4QL3A 1U90A 3ONEA 4Y2GA 3Q9SA 4CMEC 1GILA 3ZE0B 3N7AA 4BEWA 3M34A 2OOKA 4FMCB 4IO0A 3ROZA 4ISBA 2QTVB 3KB2A 1GAWA 2QCVA 1W29A 2H0QA 4PLHA 2X3UA 1HDXA 2ZSIA 3IOMA 3OP1A 1P2SA 1VBFA 1D7AA 4UVEA 4IL5A 3TOZA 1EB9A 4ODIA 2OA0A 1T0UA 2O2SA 4B3JA 4B4KA 5CMLA 1FU8A 1WCV1 2I29A 2Q5FA 2IDZA 1KEZA 2X0JA 3M6VA 2IIPA 3RPEA 4YGXB 4L73A 3URMA 1DKRA 1EPUA 4O4LA 3SYLA 1V7PC 2PGAA 3ICCA 3AP2A 4UOQA 3CVWA 1V1MA 1R9MA 3T3NA 5C41A 2HDWA 3P2MA 5KDDA 3EAFA 2YICA 4DV1B 4JI8B 3T4XA 1RRKA 1QGAA 3LUBA 2QQ0A 3ZM5A 2ZGVA 3IPXA 5L6MB 4RTPA 4U5XA 4UHKA 2A86A 2X1LA 3LWBA 3U4AA 1JS1X 4WCFB 4PZEA 4EJFA 1L4FA 2FQWA 3NRBA 5AVOA 1W5BA 2GS9A 1UOPA 3NDBB 3AHJA 3CEJA 1Z8HA 1LZKA 1RRGA 3NO4A 4E2YA 1XNRB 2XUGA 2QI9F 3R7NA 3AFHA 1KYHA 3I30X 3KJNA 4MI1A 2GM5A 4C0LA 1FUIA 5KCZA 1GQOA 3K5HA 1U0JA 3NHFA 1TMYA 4J2OA 5AHOA 1P1KA 2OFXA 3GBVA 3QU4A 4CKEA 3H11B 3KKNA 3NR2A 5JJCA 4NMHA 4UU7A 1R5OA 1LBEA 2EBFX 4QUAA 2VQSA 4GNRA 1YZUA 3OFJA 2JZNA 4ND6A 2ZDQA 3GJ8A 2XCTB 5J1SB 1W36B 1LNQA 3BRQA 5E3IA 1ONSA 2RJNA 3THWA 2W22A 1GUDA 1RC1A 5D3MA 3T9AA 5TR9A 5KQMA 3ZC3A 5EJ7A 5DHPA 5CAEB 3U80A 5FOWA 2GWHA 3TX6A 1W85B 5BW6B 5BSVA 4LVCA 2EXXA 3PDHA 2PVPA 5AJUA 4ALLA 3NAZA 4JROA 1ZGBA 4H59A 2OV6A 3L2OB 4EY8A 1DEOA 2K87A 2AVDA 2W2VA 4WY8A 3VV3A 5JJ5A 4M9CA 2OHHA 1AA9A 3U2QA 2EJWA 3EA4A 2O0JA 4GM1A 3J7AC 4LN1A 4L4XA 3ZPXA 4PLGA 4BZPA 1Y3IA 1ZEMA 3K2BA 1VRVA 3PPIA 4MUGA 4X3CA 3N1UA 3LQQA 4GX0A 2I7CA 5BOSB 2BH9A 2NZ8A 4XB2A 4OFWA 3SYTA 1ZNZA 5KTRA 4Y7CA 3OE7A 3WLAA 4H7PA 2GD2A 2GZHA 1ZAYA 1UJMA 4JP2A 5J3JA 2VAMA 2DKOA 3IP1A 1GQQA 2ES4A 4E51A 1RAHA 1Q14A 4ZCRA 1YI1A 1EHIA 1ZC3A 4GC9A 2H08A 4GZMA 4RACA 2GF9A 3BULA 1E8NA 3FPJA 4JKOA 3CPSA 3TMYA 1FRNA 2P1RA 3I0MA 3KHUA 4HLUC 1I6KA 4BRZA 2PUEA 2CNDA 3QKSB 3DD5A 3IOYA 3LD9A 2PUAA 5BUSA 2M98A 1AHPA 3TGWA 1Q1QA 1ZICA 1YHNA 1G6HA 2ZJ0A 1OX4A 1KKUA 1R2QA 1DBVO 2JLAA 4I08A 2QN7A 4P3YA 3C16C 5TQ2A 3T6KA 1W73A 4BMXA 1KP2A 3FUUA 3NKFA 2BKVA 2VP9A 3WLNA 5I7VA 3AY6A 5JBQA 3W2FA 2H2FA 2BR3A 4CF5A 1SZPA 821PA 4DQVA 2XMGA 1E62A 2HHCA 3P97A 4A27A 2VDWB 2YZNA 1X7YB 2QN2A 1JLHA 3AOEC 4XQGA 1AQUA 1SKYB 1ZCBA 2WWHA 2HMVA 2OG1A 2ODNA 1N6KA 3EXHC 1HE3A 1SC4A 1TRHA 3DEYX 5GOTA 4G23A 2IBTA 3X1JA 2CSXA 4LF5B 2I4TA 1NF3A 3AG6A 1MORA 1AKMA 3FGNA 3OZBA 2XUAA 3OKAA 3A1UA 3C7TA 3MTJA 5KNCD 1K4MA 4K9RA 3RUIA 4QQRA 4PGGA 3SQDA 2AZMA 1RZUA 5JASA 1SXQA 1C2YA 3ET5A 4KALA 3F7OA 2AN4A 2PFGA 1NUTA 1CDEA 3OTWA 4JJFA 4KWHA 2OQVA 3HB1A 2FWMX 4BJHB 4ER7A 4HQFA 3U3MA 4G9BA 1M2OB 2QPLA 5J23A 1JEQA 4ANFA 4HVAA 4GHWA 3RO7A 1M5TA 2CLIB 5JS8A 4LC0A 3EPJA 1EIZA 5EIHA 3WGVA 4BKMA 1ESJA 3W5CA 1E5QA 3LP5A 2HIGA 1TYAE 3GMIA 2NUTB 1Y7TA 1VA5A 4J0EA 4ER0A 1DBRA 1T6XA 2G17A 3ZVNA 2ILVA 3RG2A 4OB7A 1MOSA 3IQEA 2C7OA 2ODWA 4EHLA 1PTJC 2OD2A 4Q12A 1WVMA 2BC9A 1NY5A 1PYOA 2FPUA 5DM1A 4N8SA 4UFNA 1CQXA 5B7NA 2ZJBA 4HL6A 3J81k 1ZAKA 2J07A 2P4QA 3ASUA 1YB1A 3IV9A 3WK5A 5JY1A 2HR1A 4MTCA 4G0VA 4CT4B 1E3WA 3I5MA 3TLKA 4W5NA 4BMNA 4R1SA 2ARKA 2Z30A 3IKVA 3PGXA 4HLCA 5HDQA 3IKTA 1U0BB 1UJ6A 2PL5A 1FXWF 1P81A 3H97A 2Q7DA 2AM2A 1GPH1 4QLAA 3ANYB 1DJQA 4ZYYA 5KOJB 3EIXA 2M6LA 5DHUA 4FHCA 2EEPA 3H9CA 1EM6A 2BCEA 4RPHA 1ZUNB 4Z99A 4B9AA 3NNDA 1FFBA 3G9QA 4XW2A 4WSOA 1V19A 3F5FA 5M29A 1S3GA 4QDXA 3ZHSA 2EYQA 2BUAA 1SA0B 3CEHA 2HU2A 2Y6UA 2VATA 1HKHA 4TXNA 5EY5B 1BJKA 1J2EA 1TT7A 5I7FA 1UK7A 3PL2A 1BOFA 4GSLA 4TN5A 5KYVA 2F55A 1KPGA 1V8FA 3JZAA 4A8HA 2POQX 5HF9A 1TIPA 2O0LA 4YN3A 3HADA 4HH3C 5BNFA 3F74A 1VIDA 4HDAA 2P69A 3WG9A 5KZMB 4ZVOA 3ZZNA 4XM1A 1GHTA 3WAGA 1XALA 2HA0A 2JJ1D 1M8GA 3VU9B 1UR5A 3R5XA 2HFKA 4D6YA 1N1GA 4YS6A 4MWCA 1CVLA 1D2GA 1PKEA 4HX5A 3DF9A 3WB1A 4FC7A 2BEWB 4Y1GA 3WIVA 1DPGA 3GVHA 2O1XA 1JSZA 4RTKA 5HIKA 2XD9A 2B78A 1EDOA 1GZUA 2FTKE 1WPGA 4MKFA 1TT5B 4QREA 4QBKA 4MGIR 1UQUA 4Z4GA 1YZKA 2AS0A 2P9GA 2IGTA 3L8HA 1ZH8A 4MNTA 4OGGA 3D3EA 2FKNA 2P79A 4XSVA 5ALLA 5LOVF 3PB3A 1UBHS 2HMSA 3VHLB 1ZDMA 3WR5A 2R87A 1Q17A 3NC1C 1SUPA 3AVQA 3NWEA 5D5QA 2JLCA 1ANKA 2XNKA 3OQHA 4O0LA 4U5QA 3L6UA 4UNQA 3RHSA 3VZCA 4PVVA 4C3ZA 5CLLA 2PKCA 4R81A 3R41A 4J91A 2XUPA 2C3MA 3AV3A 1GPUA 1FC0A 1ZJZA 4TTTS 1X8JA 4GBJA 4LOJA 2OCYC 2RGGA 3DBHA 1ADBA 4G2TA 3N2LA 4KC0A 5CEEA 1FYXA 2MR5A 3HXKA 1TA4A 2DMRA 1JYFA 4H6WA 5IVIA 1MBZA 1PCXA 3T3GA 3WGHA 2QGNA 2C9OA 4ONEA 4IEIA 3O21A 3CTMA 2F8LA 4HI0E 4MRMB 3THXA 2J7KA 1MT0A 3MWEB 1JI0A 1E3LA 3G0IA 1X13A 5HE8A 1UDRA 3NYQA 5C4GB 2GCBA 5K0GA 4XTCS 5JO9A 4MWDA 3K6SB 1NUQA 5KOIA 2XB2A 4ZQBA 3NRSA 4KVZA 5J5AA 1EWRA 1KNXA 2GRUA 2GT1A 2OEPA 4RK6A 3SQWA 3PNVA 7AT1A 1NLFA 1XEAA 1ICEA 3OETA 1NP3A 4CEJB 3I09A 2IVFA 4G41A 4Q3CA 1CU1A 2IKSA 4XVRA 2D1FA 4UQOA 4ARZA 2FF7A 1C8LA 1PKXA 2G4LA 2IS4A 3N8GA 2QTCA 1V16A 3BE6A 2AQKA 2NXWA 3OFSA 2VH1A 1C9EA 2CEAA 3TS1A 3MFQA 3AB7A 2AXNA 5T3UA 2TMGA 3N5KA 1TD9A 2FWIA 3QWAA 4FPXA 3UV7A 3V4PB 3ADPA 5SY9A 5IHPA 5C1IA 4MHOA 4GLFA 3CLTD 1U0TA 3DFFA 2W70A 1Y6FA 5CGAA 1NV8A 1E4OA 2A84A 2Q6LA 2WHRA 4K9PA 4WX2B 5CX1B 3BQ9A 4CLOA 3FVRA 3SJAA 1PFGA 3G9XA 4AS2A 4B7ZA 1QWSA 4I9FA 3P4XA 3ONVA 2VF4X 3HCWA 4DLKA 2G70A 5EIBC 2EZUA 3FDFA 3DPUA 1H66A 1QFZA 2J85A 3CWQA 2P6OA 2WIBA 3PWTA 3IB6A 1IPHA 4JGIA 2CDBA 2M9MA 4PY2A 1OAOA 4IZIA 2H9IA 4U6SA 2AIRA 3HXOA 2EOAA 1LPBB 1PTKA 1VMIA 5C7OO 3LVRE 2GESA 4IM7A 4EECA 4XJVA 1CQZA 3KLNA 3HY3A 2IEAA 4LBVA 1KKLA 5J1TB 1S2GA 3JWJA 3QLJA 2V6IA 4JXXA 2R7KA 4Y6OA 1I30A 3DCYA 4B3TB 2HEGA 1X1CA 3KVYA 3OZUA 1EZ4A 4EQ6B 5LP6A 2P9HA 1BX4A 1JALA 5C18A 1PQPA 1H94A 4L7VA 1M72A 4OXNA 4BFLA 3RRJA 3FFBA 5I8ZA 3VPDA 3C39A 5IN5A 3MRTA 1WHTA 2DFDA 4E5MA 5B7PA 3K8ZA 7MHTA 1SCQA 3K96A 4BLOA 4RXUA 4DDTA 2K2WA 4AG6A 3D7SA 2GZSA 2VOEA 5IH7A 2RCNA 4JUFA 1GVHA 1DT5A 2Q4OA 4YXFA 5CUQA 5L7WA 1GGHA 1II8B 1NLYA 1OE0A 4PHGA 3ONNA 5HKAA 4DARA 4NXMB 3SSMA 2J3DA 2NG1A 4O1IA 1SZCA 1YULA 2JC3A 1WB5A 2R6CA 4V0KA 5AI0A 3O6VA 3OQIB 5BW5A 4I1IA 5CFQA 3KZMA 2ZRQA 2Q2OA 2AF4C 3WGOA 3TGLA 2Z8YA 4UHBA 3ZBQA 4CTJA 2J3EA 3E1KA 3KZVA 3WA6A 1H3FA 1E79A 2O48X 2Z09A 4OLBA 2AMYA 3IKMB 1QZUA 3I9FA 5B6JA 4UU8A 5JDCA 3VDRA 3HJNA 3HXTA 1GA4A 2A94A 2G0TA 2HPAA 2QROA 3A6LA 1E9SA 4BEJA 1GV1A 3URKA 5LR6A 5C53B 5JJKA 4RMIA 4BP9A 4BQOA 4F4JA 3ZIAA 1GZHB 3WK9A 1HZJA 1HWYA 1SUBA 1TK2A 2HSWA 3ZWNA 1G9XA 2P77A 3HH8A 4RADA 1B7GO 1E1DA 2Q8NA 2WIFA 1WSAA 3UWKA 4ZICA 1IY8A 1BFDA 2I65A 1K4YA 4MYSA 1J0XO 3RTBA 2UXBB 1F6WA 1Z08A 4V0LA 1YI0A 5EMLA 3CVJA 2RGWA 9ATCA 2HYIC 2F6RA 3IAXA 1IYZA 5HJ7A 3RVDA 1FYFA 4CM9A 4ZYZA 4IQGA 1UIRA 4F9EA 3S1AA 4FMDB 3NIGB 2EFJA 3ZWMA 2GPAA 2XUQA 1FRQA 2ZRAA 2XAAA 4TV8A 1M6WA 1LH0A 1DI0A 1QGYA 4RE5A 4UCFA 4CCYA 4Z1OA 4Z7NB 3BZWA 3HU5A 5JRJA 1T8RA 1U2XA 4KXVA 5CJPA 3QA2A 2BFNA 4JT9A 1U2GA 2W8ZA 2FW8A 3M6MD 3O4IA 4HDNA 3HYLA 3DOUA 4OXRA 3VR3D 5HBGA 3PFHA 4CTMA 4F97A 1GGKA 2OORA 4A2WA 4RCYA 5A06A 4BNIA 3U4MA 1EDBA 4P83A 4DIDA 3DLHA 1O87A 4LXIA 1JL3A 3OPYA 3NBQA 3DDSA 4BNXA 2FU5C 3PGVA 2BMVA 2ORWA 1A71A 4QC2A 1KEUA 1YQEA 1KMHB 1C30B 2V9CA 1MNQA 2A9QA 1OWOA 4QTTB 3OPNA 2IP2A 4QQ8A 1V48A 1YBHA 3P9QA 1AN0A 1JFRA 2C3UA 3C3BA 3FCEA 3GGGA 3A2MA 2YINC 2C83A 3L07A 4CFZA 3QFHA 4N5NA 3EAQA 5DNYB 2H1OA 1JDJA 2HL6A 1Z0IA 5ITZB 2QTGA 3MWYW 4YAFA 4KLAA 3SSOA 5JMOA 2IIQA 5CM8B 1CJSA 4QEDA 2NVOA 3UAZA 1QGZA 1DRKA 5MF6A 1E6EA 1PQUA 4IIJA 5F7JA 1IHYA 1KNQA 4WKCA 3B3AA 4NENA 3VVLA 9ABPA 1I80A 1VPLA 5BORA 4I9GA 3AFNA 4KU4A 2PANA 3M4XA 3TVDA 2PKKA 3H5AA 1XZGA 2C4KA 3CM0A 3Q3VA 4M0UA 3ROKA 3RC3A 3PGKA 3F9RA 1F3LA 4X1KB 3R7WA 3LCCA 3JQCA 4ZOBA 1YGKA 2XWSA 1DQZA 1BW9B 4DQDA 1SJ9A 5E2BA 2W9XA 5LQAA 4TWJA 7GPBA 1CZKA 2YR0A 2QBYA 5JAMA 4K6OA 2Y6VA 1DQPA 3MOSA 4LQ4A 4LV8B 1ACMA 3A9UA 4FUTA 4NE9A 1V5FA 5CLJA 4LDPA 1LLCA 3KPYA 2XNCA 1HI9A 2P2YA 3QLUC 4AKSA 4ZDJA 4QM6A 1L0BA 16PKA 1AF4A 2GF2A 1QDUA 2GZAA 3U3OA 2NPFA 3UHAA 3IUMA 4UDYX 4MGKR 2GFQA 1ZK4A 2WNIA 3PG5A 3L0OA 5B53A 1NJ6A 2OHGA 3AV0B 1Z0JA 1VXRA 1WRBA 2J5XA 3UJ8A 3UT6A 3ZNOA 5LWQA 2QRLA 3HYCA 3PQFA 2ZAGA 2G40A 4I8DA 3IEUA 3FOZA 1RYBA 4HGYA 5IFLA 4QPPA 5EGSA 5AKKA 3VR1A 2CSUA 1KQOA 3P0HA 2J9FB 4YMIA 3D6HA 5YASA 5C0OE 1GTZA 3GAAA 3V80A 3ZY2A 1ZN2A 1DC6A 4P7FA 4DLNA 4A7PA 3ZY5A 3TUJC 3MD9A 3KYCA 1QVWA 2GCNA 3X2EA 2XTJA 1JMYA 1MUUA 2EQBA 3KKPA 2VPQA 4EEXA 3TW8B 1RPTA 1N1DA 2JIZD 2XTNA 4H77A 4WEOA 1XNJA 3HLYA 3DWFA 3NXSA 3TXYA 1JA0A 1FFDA 1Q7TA 2A14A 2W37A 3L18A 4LE0A 3SHTA 1O54A 3WOVA 2B4KA 1R5NA 1S2DA 3EOBI 3PXBA 3HCCA 4XARA 4ZVTA 4PQRA 2J7PD 3DDCA 3WMGA 3ZXSA 1QLJA 3GLQA 3R3WA 4F5EA 4QBGB 2Q1WA 3HFRA 4YMHA 3A6PC 1P7YA 2UXCB 3D1VA 5G3ZA 2PQMA 3M5DA 4PCAA 2GAAA 1DFIA 1RK2A 3CKYA 4R9NA 3EPKA 1T5HX 1QK4A 2UUAB 4EY6A 5BRJA 5ICFA 1YR3A 3EMBA 4ZU6X 1M9NA 4II2A 2WTZA 3QPBA 2V7UA 5CB4A 1Q19A 4BJ6A 5B6PA 2WMOB 2GUWA 2PWPA 1N75A 4X7BA 1UMCB 2XT0A 5I9IA 5BNTA 5DX1A 4BMOB 4WK0B 2OG2A 1SMKA 1ZXXA 3FBTA 1C8KA 5HOQA 2CLMB 4XYEA 4LF9B 4K2AA 4JI3B 4I4IA 4RLHA 1Q7CA 1J07A 4PX2A 4TV9A 3TSWA 5FNVA 3R7AA 3CB2A 4EUSA 3L1IA 4FFBB 4BJ3A 5EVJA 5G41A 3DHVA 3UHFA 4H6XA 2WM8A 4X5OA 4AX8A 3OZRA 1YS9A 2C7VA 4RVOA 3L0IB 4X97A 3FCYA 5JFOA 1YJCA 3QTLA 4LDJA 4XB6B 5E9QA 1QBGA 5KJEA 3ZJ4A 4Q1CA 5CYOA 1JLMA 4FSHA 2H1LA 1U0EA 1Z5VA 2FG7C 2I4IA 2PMWB 5EG5A 3TRDA 2XZLA 3ZDYB 1AMOA 1R4MB 3AY7A 3EH1A 5LSAA 2V74B 1HFWA 4IRMA 4DXHA 3S1SA 3BPSA 1SOMA 2PR2A 3MOGA 4MZXA 1VYVA 2I3DA 5CK5A 2XCOA 4JELA 3ANTA 3MTEA 3NV7A 2OL4A 3EGVA 1PYGA 1L5VA 2CVQA 2C7GA 1UK8A 3KWFA 2VNKA 4N8EA 4XLZA 4R1TA 2ZIWB 2CF6A 3VNVA 4L50A 3VPGA 2RARA 1SR8A 2POCA 2ZRKA 3WLKX 5FNZA 2FDRA 2VSXA 3ELWA 1FJ2A 1ZXLA 2DFNA 2IHUA 3HJBA 4R7ZA 2IYNA 3ZY3A 1VKOA 2OFWA 4EF4A 4TWRA 3DE7X 4GKJB 2G4CA 3N86A 4U7FA 4F06A 1GL9B 2O8EB 4RSRA 3K5PA 3RVPA 3B3FA 1P91A 4QXPA 1QONA 3MBIA 3O4HA 4PO9A 2G9NA 3P71T 3TFWA 4DEVA 4UBEA 2F3UA 5D1NA 5I4KA 5JAOA 4CMGA 3U7EB 4TZKA 2C94A 5A62A 1FVXA 3LM8A 3PXGA 3P2KA 2P40A 5AW0A 3QBJA 5KBYA 5G4KB 2H59A 3JAMA 1PFVA 2A5YB 4FCWA 4NQRA 4RJKA 5KVVA 1A50B 4DR3B 3JQ6A 4JFRA 4GR5A 5H81A 2A30A 1QCCA 2VHCA 2WSBA 1QOZA 3JSXA 4BBJA 2XYVA 3UK7A 3GJZA 4JU8A 1C4XA 2ZE5A 4AMBA 5D6OA 1RI4A 4H3VA 4DC9A 4ETMA 2ERYA 4B2LA 2AEFA 2EJUA 4LJ5A 1X7WB 4XDZA 4XIIA 3CF6R 3RS9A 5JCJD 2HHAA 3DKRA 5CFMA 3C97A 2D2EA 3HU3A 4OAPA 4MUYA 1HZZA 3ORHA 1P1RA 5MHTA 2VRNA 3C3WA 2VFAA 2FEOA 2H9AA 3L7JA 2HRRA 3LXXA 4CKCA 5KU1A 1EX7A 2W5UA 2GBGA 3AQ4A 5ER9A 1DJLA 1RPNA 2O7RA 3N6XA 4W82A 3OD5A 3AWIA 4CCAA 2W8BA 4DLRA 2ZAMA 1CY1A 5G4LA 2V7WA 2ZRCA 4X8HA 4J7AA 1ORRA 2BSAA 2I1LA 1MXHA 1QNLA 5C51B 4DCJA 1EU1A 3D4IA 2C8LA 121PA 5JPDA 5D2CA 4Q4AB 1L5KA 1JKFA 1XZQA 4U8HA 4BWYA 4C4RA 3GJTA 4C7VA 1G1AA 5BYDA 1JT9A 1SUFA 3BTOA 4OQPA 2CKMA 3F5DA 5TF0A 4QPDA 2I2WA 3JTEA 3BXZA 3QK7A 5LYJA 2ZQZA 4ZEOA 4I8XA 1YDFA 5IKOA 5DZSA 4BNGA 2HLZA 1KIFA 5DGTA 3CQ9A 3B1VA 2J45A 1D03A 4J0QA 3BXPA 3UPTA 1PJBA 5IMBA 1C7FA 2E4AA 4CM4B 1JIIA 1E7RA 3GF4A 4XX1A 3E35A 1I1QB 1YQWA 1Z2DA 2YH2A 1IHXA 2Z98A 1UPFA 4A1OA 5EWLA 5JSUA 2DU8A 2FDCA 1Y3AA 3D64A 4NMMA 4ZTUB 3OESA 2OYSA 3B1ZA 5GOZA 1R0KA 1YRBA 1JQKA 2F1OA 2I71A 3FKQA 3SZOA 3ZYZA 3IIJA 4LHEA 1TZBA 2OE2A 3JTMA 3NALA 4DPMA 1E3SA 3AF5A 3TSZA 3T1NA 2QP9X 3S8MA 1NQAO 4Q66C 2RMKA 1Y6ZA 4D80A 5ALMA 1S1CA 4F2GA 4EB0A 4FHDA 3CR3C 3ETEA 2GASA 1P7WA 4GYYA 5FEMA 4DWOA 4KXWA 2JVIA 2F3PA 4LI0A 3ZUGA 3L7KA 5H80A 2YTZA 3S4YA 4NYJQ 4B17A 2YVAA 4RVGA 1KAGA 1SHZA 2CC2A 3ZCUA 2IZ7A 2LIVA 3K9NA 1SURA 4K87A 3SZMA 4JX9A 3VAZA 4BLUA 4FFDA 4YMTA 2QM7A 4O4IB 2ZUEA 4M0KA 2NO1A 2KW5A 2H5EA 1P4GA 3IMGA 3SJCA 1XDZA 2LR0A 5FTNA 4BMSA 1WETA 3OFVA 8MHTA 3RG8A 3DKIA 1JFLA 1UUFA 4UHFA 1PN3A 1G55A 1HG0A 1W94A 2GD6A 4H1HA 4PONA 2IZOA 5B3LA 1KP3A 2FK8A 1RWBA 5DT9A 3H5WA 4YP0A 4TWBA 4DT1A 2FZGA 3GWZA 1U8EA 1QANA 1GAJA 1HNXB 4RPLA 1NN5A 2D13A 3KL4A 3BGKA 4K3UA 1NU6A 1ZD4A 4V38A 4K9CA 1XCOA 4I19A 5A1TA 3AVWA 5FNVF 2NNLD 3QNWA 3LRTA 2K2QB 1YQTA 2XWBF 1US8A 2WWIA 4BIMA 2Z3WA 2DHDA 4TTQA 3T9DA 4BGUA 3MQ4A 1BS9A 2EATA 2WWGA 3KQMA 1AKTA 3M6XA 1T4CB 2FKAA 2IH4A 1O08A 1CUXA 1J5PA 4IDQA 5HRAA 4R9VA 5HP4A 2LBPA 4WKOA 1QAMA 2QRUA 3PNKA 3U1BA 4RXTA 4HJXA 3B9BA 3GA5A 4AJLA 3VO9A 3RSSA 3QXJA 1JB1A 3H9UA 1SCNE 2VK4A 3WYNA 3O2QB 1A4RA 3OTOB 4DC3A 2VAWA 2OLKA 4B9EA 3LX8A 5E7MA 3V8PA 3VH3A 2QUHA 4ZMBA 4Z7OB 4NYMQ 4QU5A 3T1VA 5HM6A 1JR3E 5I7SA 2UAGA 1RW4A 1VI5A 2ZYHA 1ISMA 2J3LA 2H6EA 3OC6A 3GG9A 4Q4HB 5EXDA 2CNNA 4NPHA 1CJBA 2NNWB 3ABQB 5T6MA 3DDOA 1GAQA 4MR8B 4F1KA 3SC6A 1V4VA 3A06A 2E6KA 2WMYA 3NONA 2V55B 3NIWA 1O5ZA 2FX5A 2Z8YM 3NFYA 3K0CA 1T2DA 1RBZA 1U4OA 3ISJA 2JIBA 4PWYA 3E48A 4UE2A 2PHZA 4P92A 5TE9A 5KIAA 1FQJA 1M67A 1DCKA 1PLLA 1USUA 2PUBA 3PQDA 3MWDB 1R3UA 4O02B 3C41J 2PH3A 2VTEA 4Z9YA 1RLIA 3S2FA 1HFKA 3M82A 2PPVA 4H3HB 4MJLA 4U9UA 4Z86A 3UMFA 2WM3A 2CD7A 5EMNA 4CQMD 2R11A 2ZBQA 3W9SA 3P9KA 3RJTA 1LJ8A 5TLSA 1C4WA 2ADFA 1XVTA 1XZHA 3VR3A 4CN9A 1H0RA 1B1AA 2ZP1A 4TRJA 5I47A 3JQBC 1UXOA 3QF4B 1G5RA 1L4NA 4IILA 4BHTA 4EBBA 4N03A 5IK2A 1YUMA 2CFOA 4L95C 4UNRA 2VHJA 3AB3A 5DWDA 3TQOA 3WGUA 3OZVA 3CV3A 4U0JA 2VS1A 2WLTA 1E2IA 4XR9A 2I2FA 4MJ3A 4LDAA 4ACBA 4TUYA 3WQHA 3IVMA 1IULA 5K09A 1C3QA 1I6MA 1GZ3A 4O3FA 3EIUA 4R8VA 5BO5A 4C4XA 3IEVA 1COZA 1I2CA 2W4QA 3VR5H 1D1PA 2QV7A 4DY4A 4RHXA 3WL6A 5DBFA 4YDSA 3GFSA 3TXXA 3WDLA 1WUIS 3KTAA 3Q8KA 2B2XA 5CLHA 3A28A 1HOTA 4BVFA 2ZBFA 1DJNA 2V97A 5JYEA 1DGQA 2JIRA 1UBMS 3TZKA 1GU0A 5JSKA 4LYAA 4FQ5A 4BFWA 1AG9A 4ZVMA 1VQ1A 4US1R 1DC3A 5BN1A 1P8JA 4IRXA 3ZDZB 1T5SA 1QE3A 5HDBB 2AOUB 1VHLA 3HBLA 2FVXA 3ABOB 2QB5A 3IQGX 5EP4A 4JI6B 3YASA 3CNQS 4DV2B 2VARA 4HGOA 3HRHA 3T1HB 2HU8A 3LXMA 1LF0A 3OQPA 1AN9A 2CBGA 2JLZA 4L72A 5A5FA 3E3NA 3E84A 3SU8A 1NM5A 2R751 1K06A 1MO3A 1GCIA 3QUCA 2BEUB 1Q12A 3AHFA 1OFTA 4X54A 1RFUA 5PGMA 3OQNA 3FD8A 4DEXA 2XNSA 2XT9A 5ULLA 2BKLA 2I66A 3LYHA 5AW2A 1IUPA 4FHFA 4N54A 2IXGA 1DBQA 2HJWA 5CDYA 4PZ9A 4Y6LA 3WICA 2PKMA 3TZCA 1JEYB 3HA7A 1D8TA 3LFHA 3UT0A 4ID9A 3O1LA 2ZE6A 1EGAA 5F77A 4AURA 1QJ4A 3UFBA 4D99A 5JFTA 4BVEA 1J22A 4GSKA 3LBAA 1M7BA 4BNKA 3BCUA 2IV3A 1XVIA 5FQOA 4MI9A 3VYTB 2BGUA 2QY6A 3F7TA 2BGIA 1CJUC 2O8NA 1HDCA 1HQDA 2YFKA 3DT8A 3M1IA 1P2BA 2XUKA 1P6QA 2HNBA 3PI6A 4Q18A 3ZTWA 4I55A 3ROPA 1QIIA 4NZZA 3GP5A 5KNLA 4X60A 4L6AA 2NV6A 3TKLA 2BJVA 4KG7A 4W4TA 2PCJA 3H9JA 5T5QA 4Y2QA 1G17A 1E7SA 1KC3A 1D2EA 1E1CB 4YUAA 2CWWA 4IV0A 3S0JA 2GC5A 2HF2A 4LTMA 2BF7A 3V7WA 3WLQA 5GONF 1N33B 2B5WA 2N0SA 2ZUVA 4PF1A 3VSAA 1FFWA 1M1UA 2QZPA 4NV3A 2F00A 4MRVA 5DDIP 4C12A 3O95A 4ALIA 4C4OA 1XTVA 2XMBA 2Y4NA 3DL4A 1U1DA 3EJWA 3JYOA 1ZSNA 2X2EA 3UWOA 1G8HA 3UPUA 5BYAA 1VLLA 2TECE 2FR1A 4W9NA 1ZA1A 3IR5A 2H1FA 3UJ6A 4RPKA 1DKOA 1VIMA 1XLWA 1J5XA 2ZJ1A 3WYGA 3K5WA 1WOMA 1ZRSA 2ORVA 2Y68A 2YHUA 3BJIC 4K46A 5DOVA 4LMRA 2FUCA 1JT2A 5CYFA 5LC1A 1MB4A 3DEHA 1BWPA 2DHEA 3OMLA 1W78A 1IOZA 5B5SA 1KQNA 4DLBA 1M1XB 1WEKA 1Z38A 3H7IA 1HDGO 4RW0A 3MW8A 4LF7B 3PFWO 2X76A 1H6DA 1OFGA 2ZRGA 2FW9A 4GR9A 4N3BA 2VEOA 2EKQA 2IUSA 1EEHA 2B99A 3AF0A 3H65A 3D1LA 2GXUA 3OZFA 4I1RA 4BGDA 5GWXA 3QLVC 4QOIA 4ZOLB 5EZSA 2JFOA 3KELA 3OAAD 3CRZA 3G02A 5FXMA 2O07A 1CBUA 3UV3A 1U8CB 3FZGA 1KYXA 1E2PA 2E5LB 3RVRA 2JKVA 1IM2A 4CNBA 3NBVA 1IK4A 2JA1A 4WY5A 1HYHA 2ZROA 1YR2A 1JBEA 1U3DA 3R40A 4KQIA 3B1WA 3BN3A 1RJDA 3JVUA 2OK8A 2XRYA 1JR6A 4ALKA 2BBTA 3Q1YA 1MX3A 4CMIB 2FWPA 1QG6A 1RYEA 3NTXA 3WZMA 1ACLA 3H17A 4CMEA 5HX7A 4DIEA 3ENKA 4KIFA 2QAGB 4M9RA 1JEOA 4A03A 4PGHA 2DLNA 4E5KA 2DR2A 1AV6A 1Z0FA 2AR7A 1QRAA 4YIKA 4QHSA 1QM5A 3NIFB 2C88A 2OR3A 3N2IA 3AEYA 3GEIA 4EPYA 1CR4A 1GQTA 3NTLA 2Y9PB 3BTSA 3MGKA 1JNYA 4LQCA 3H05A 4NCJA 4GWGA 3KPWA 2H7XA 1Z4QA 4URHA 1GTJ1 3UWSA 1DV2A 2IEBA 5BV1A 5E8JA 1I32A 1SY7A 2YWHA 5TB5A 4H6VA 5KX5A 4CI0B 1DINA 1DJOA 1JAHA 2IP4A 2QG4A 2UKDA 2HF8A 1KWGA 1QPGA 4FNGA 1HR0B 1RCTE 3FVWA 4P8RA 2XITA 1MJFA 4G0XA 1U6JA 3VHXA 4AZ0A 3F4KA 4KFUA 3W4KA 4YT2A 3ZL8A 1TVKB 2WJIA 3G3EA 4COOA 1EUDB 5LFAA 1DU4A 3G23A 4HPJB 1QIDA 1TD1A 2ECOA 1XAIA 2FPIB 1U3CA 1JUDA 1T3HA 3BZBA 1E61A 3DNFA 3CUYA 3ZU5A 3Q8MA 5HA5A 4O4JF 1JAXA 3D4LA 3I28A 1ST2A 4B32A 5KDLA 1XU9A 4UULA 4RTMA 4DMFA 4KN5A 3BFVA 5DM2A 5GGYA 4XH9B 2V6MA 4YP5A 3FBWA 1R8XA 1NUUA 5F64A 3UB2A 4BATA 3KG2A 1VPDA 1GPLA 3DTVB 4NCHA 1U7DA 1TX4B 3EG9B 1EJ0A 1KARA 2P5TB 2B34A 3I2IA 2GEBA 1NPYA 2B5OA 1X3SA 2GFIA 3IVRA 4LYEA 4UFOA 5EJIA 3AXTA 4DNFA 3KSMA 5K9ZA 5KO2A 3KLPX 5L3RA 4DMLA 4U6NA 4C4YA 5LQKA 4F4IA 1X77A 4HDMB 4XSHA 2VRCD 3GRFA 1L2LA 3FYUB 4IZOA 3HCRA 3FKSA 4DIMA 5AJWA 1E4EA 3SBXA 1B41A 3LAWA 2PUCA 1SU6A 3CNEA 1KI6B 1B2LA 1D0SA 2QTFA 3ECCA 1EFDN 3TNJA 1B23P 3ZG6A 1KAMA 1XTZA 4LOAA 4WECA 3D02A 5DGCA 4HZUB 4LX0A 5EE5B 5KTPA 1WCIB 4C5MA 4OBEA 3WWCA 2BMEA 4RMJA 4DJAA 1NJ2A 2B82A 3QELA 4CQJA 4CJXA 1M8FA 3V8QA 3SEFA 5ALZA 1IEWA 1NKVA 5KTNA 2CWDA 2ZKLA 3WLPA 5AH0A 3B3LA 4J07A 1O3YA 3PFCA 2C04A 4L4YA 3TE6A 3K0HA 1ZI9A 1HV8A 5AVUA 5DXFA 3OU2A 4IVNA 1RS0A 1CQPA 2QE6A 1V1BA 2Q99A 3LRPA 4RGVA 3BA6A 4Z9AA 1TMOA 4HLUA 1BHO1 3RUAA 2YNMD 1Y5NA 4J2TA 1BA3A 1Y6QA 2RKOA 2PMEA 2AN9A 4PS1A 4X91A 4DV4B 4WACA 3E05A 1JJFA 1QVRA 4I99A 3K30A 1XLUA 2NXEA 1ODIA 2GCEA 2GB4A 3FRJA 2AMLA 3INGA 3PVZA 4JB8A 4PGAA 4I5IA 4D1YA 5CXQA 1DLIA 4PZ0A 2C96A 2QZJA 1RKXA 5IPFA 1UFVA 2FMTA 1XELA 3AUAA 3E7WA 2FV8A 2RB5A 3AHEA 4HH4A 3TDKA 3QKIA 1OBVA 3AOEA 5LQCA 2WWTA 1A5BB 3NDIA 3PE6A 3JQFC 1IZ7A 4BZXA 5IT9A 1TYEB 3EXHA 3NVDA 4MS3B 1KBZA 5CPFA 1J0CA 1MRZA 3CPHA 4PRYA 1C3XA 5DRYA 4QYXA 4B4WA 2HQ1A 2E1PA 3B2QA 1W46A 5LDGA 1VG0B 2DTDA 4K86A 4KIUA 4OL0A 5FJJA 4JBWA 2PGDA 5JZVA 4LJ9A 3LA8A 1EP3B 1Q1BA 2A67A 3HTXA 1R27A 1JDTA 2JIQA 1OBFO 1UBKS 2VZLA 4HBGA 4J94A 2ZWOA 1SN7A 2BFDB 3BD7A 2GJSA 3EMVA 4P0PB 2YQZA 3C70A 3PYZA 4UBJA 2COEA 4UXJA 1UFKA 1GTRA 4A5OA 5BSFA 2X6RA 2NYVA 3A1SA 2B0JA 3I9JA 5G0VA 1YR1A 4XYLA 3ANMA 1Y4DE 3KJXA 2ZB7A 3SXJA 3SNHA 2OVFA 4CLRB 1EM8A 2ECFA 1V1RB 1NX6A 2DVMA 4TKLA 3TKAA 1Z74A 3OTQA 1P2TA 3O7WA 4OQDA 5SZIA 2ZIXB 5ILQA 3QGMA 3OA0A 2P90A 4GPAA 3PDIA 2HRBA 3IBYA 4MB0A 1SKMA 1P7PA 1CG6A 2D3TA 2FUEA 3E81A 3MWGA 1U3FA 4WNYA 3WSWA 4BO9A 4E22A 3FCOA 3MIZA 2VT2A 3K0FB 1C1XA 2WYIA 4TTSA 4UDXX 1N3IA 3FLAA 2ANBA 2UYGA 5ALGA 5C3UA 3VR6H 5FA8A 5C52B 4O2AB 3RS4A 3V33A 1ZUWA 3QKRA 2EBHX 1PJRA 2F4NA 4RORA 1VCMA 1Z16A 2CUNA 4UTOA 3A3PA 4CHGA 4EHIA 5K4HA 4A6DA 5B12A 2GZRA 3BM5A 2F1KA 2IDMA 2OHOA 1X1QA 3O38A 4QXRA 2XAUA 4U39A 4AJKA 4U6QA 4D41A 4RFLA 5FH9A 5GJCA 4V0ME 1QS0B 1BMQA 3QY9A 2C77A 3CZRA 3RR2A 4ISCA 4LF6B 3K72B 4K6GA 4EKDA 4URVR 2YBDA 4OM8A 5CDFA 4RNCA 1X80A 5EJ5A 1QH0A 1FFXA 2FP3A 3BK2A 4DSOA 1V39A 4C6TB 1U2EA 4R1MA 4JKUA 1MB9A 4R69A 1IZ8A 2IHYA 3I37X 5JH7B 5E1DA 5BW4A 3UAOA 1GR1A 2DFVA 2BM1A 3KXIA 4A0SA 3JV7A 3QVOA 4GT1A 3ZVRA 3Q8LA 1J0EA 4EW1A 3I8XA 3ER8A 2JAPA 3LBHA 4KCGA 3RT9A 1ABEA 3K31A 1Z37A 4BS9A 1BRMA 3L1KA 2O5CA 3O75A 2B21A 4B3SB 2UZ1B 4OUKX 1PNOA 2IUFA 1X7ZA 3HYSA 1GNRA 2D1RA 1P4AA 5C8DA 1PVVA 3ITEA 3SF8B 5TMEA 3BS4A 2H92A 4HPXB 4MKGA 5I7EA 3CVVA 4A82A 2Y76A 2YIVX 5LQDA 3MWJA 4CKXA 4BWVA 3HICA 1QE5A 2AJTA 1N8NA 1RHQA 5BYJA 4A8JC 3MCVA 2X5XA 5LD2B 4UARA 3TJZA 1E6LA 3BEOA 4OQYA 1TEHA 3NHYA 4XB1A 2WYHA 2RK3A 3O03A 3FPFA 3BIJA 3AKCA 3GV0A 4PYIA 1B2RA 1MTZA 2HO5A 2NU9B 2VUIB 2IU0A 3UANA 3PJDA 5F1KA 3BIOA 5H8WA 4GI2A 4YCCA 2QP4A 6YASA 3RF7A 1P18A 1RHUA 1ULHA 3HCEA 1QO7A 2W6ZA 2WWXA 3T5CA 3WHIA 4IEFB 3P9ZA 3DHWC 3OF5A 3FUTA 1RR6A 4IFEA 4OUDB 5DI3A 2TMKA 2PAFA 2AB8A 1OQAA 1O8BA 1T9GS 1MABA 3I2FA 1DKPA 1T3SA 4D92A 2WR8A 3UQZA 2JLSA 1NI4B 3HK2A 4TLCA 4EMTA 4HUQA 3HJCA 3ZCPA 5C5IA 3PNSA 2ZSHA 3CH4B 4PAWA 4PBSA 3WHKA 3Q8XB 1OKKD 1I7SB 2JGRA 2DQSA 1G18A 4O2BF 5I4CA 2QVYX 1OU0A 1CIJA 1RT9A 2VZ9A 3ZXIA 5TT0A 2C2YA 3UQ6A 1G8YA 4M8IA 1QZ3A 1I3CA 3DQZA 3FTQA 4ZCPA 3PCTA 4QE3A 1HX7A 1MEEA 3QEJA 1XLTC 2WTAA 1V2HE 2ZS9A 2P0YA 3BWYA 3EXG2 1L5HA 4V1CI 2UYCA 1NXOA 3K5IA 3I9V6 2G28A 4OJNA 4J7XA 1CUUA 3W5SA 4KIWA 1K7SN 1KETA 1BZYA 2OZLA 2HQOA 3LL7A 3B5JA 1YOVB 3BCHA 1D9ZA 1JQDA 4WBNF 1DAKA 5ILGA 4D9FA 1TW3A 5AM5A 5CFRA 3QFTA 4A6XA 2FQYA 1N2EA 4WKNA 3V2HA 5K0BA 1LVUA 4KAXA 1XAGA 3FFAA 2C20A 3H6HA 5JNVA 1FMJA 1ND6A 1TEXA 1G0NA 2EBUA 4K26A 1XTRA 4JEHA 5EJGA 5FBZA 1PQYA 3E7DA 4PNZA 5KMGB 2CK3D 2ZI7A 1N8TA 2YWJA 2IZ5A 5FO0A 3V1YA 1XZEA 3O4GA 1T9AA 3WLOA 1IXYA 3DZVA 5F7ZA 2C3OA 2XDQA 4WLUA 2ZRMA 1RRFA 1W0KA 5KYNA 3PF9A 1T36B 3WAJA 3ZNNA 4HEQA 1ZSVA 3H42B 4YEDA 7REQA 1J0AA 4MQMA 4HQNA 3LJKA 5CFNA 4K9OA 2YJZA 1R0XA 2ADOA 2DTXA 4NRDA 4CM7A 4QYIA 2VSFA 4ZZ2A 1XD2A 3OIDA 4DYHA 3DOJA 4PHHA 3A14A 3I4CA 2WOOA 3T52A 1JZSA 3WLTA 5AJVB 2FR8C 4DMRA 3S81A 1Q0UA 1K7YA 4GL2A 1JBKA 1BIFA 1JG6A 2PYIA 3RS0A 1NR7A 1R6DA 1JQ3A 2Q50A 3L7DA 1G6OA 2ZJAA 3QJ5A 2EFCB 1JMVA 4F5ZA 1R4NA 1LFAA 3ITKA 4D8XA 2NGRA 4DA8A 4PO8A 3GJXC 2Y1GA 3KALA 1ULUA 3R0IA 4HO1X 3DO6A 1EKKA 3IPCA 4RA9A 2WEKA 5F3DA 1S4QA 2QUZA 2YJNA 3PT5A 1BH6A 5B2EA 2C03A 3Q7QA 1USIA 2W2LA 3FAKA 2FOXA 3QXHA 3STYA 5C46F 5L51A 1CQJA 5JE8A 4I9HA 3TAHA 2QTRA 4EFDA 5JECA 4RXMA 5L3VA 4E8WA 1UZAA 4Y9TA 4JV5B 4R8KA 3U6BA 2QT1A 5CK4A 3HWWA 3JWGA 2OYCA 3LKIA 1K68A 2WUDA 3DBLB 3FPEA 4TS9A 4G9GA 1SOAA 4CIVA 4YRBA 1XL1A 3C2QA 4M54A 3LQ4A 1P4JA 4EUMA 4XVUA 1SVOA 3ZNPA 1Z2AA 1OXBB 1P5JA 3AL3A 3HSYA 3PHJA 4G86A 2B4QA 1VL6A 3QPCA 3MCUA 4X8MA 4R9RA 2LE0A 4JB2A 4BVJA 4D0SA 3KQSA 3CA8A 1JR2A 1RLMA 4IUCS 2PKFA 4HDSA 4H7HA 4V0OA 1RI2A 1TM5E 5IAJA 4Z4QA 2XKBA 5LPNA 3E9QA 3NJ4A 3FPHA 1JXOA 2Z9CA 3PDJA 5FR1A 3SBOA 4CM1A 1SRQA 3NBMA 3RYTC 5BVHB 1H2ZA 3B78A 3IUBA 2FQQA 5DMHA 1GRRA 3V4SA 2QRGA 3TRJA 4BFCA 2J87A 4C4SA 3LWZA 4CF6A 4D3XA 3TVYA 1LBSA 4DDMA 4Y8VA 3S7TA 3UUEA 1UBOS 3DV2A 1E1KA 2PX4A 1ZU5A 1CY0A 2VK8A 8OHMA 4JI7B 3ZS9A 2HY7A 1CK4A 1MA0A 3DMTC 3P2OA 5B57C 1X1AA 5IC5A 1ND5A 3I6IA 1GCAA 1I3MA 4ZQEA 2YZKA 3O8QA 3H4MA 4CIDA 2QL7A 4LAFA 1Q7GA 1GEGA 3T7JA 3NL2A 4ENTA 2CF5A 2R8YA 4KSCA 4JXKA 3UCXA 3T7CA 1QP4A 1P33A 3GJQA 2RBEA 4KR2A 3PKJA 3O4RA 2OGWA 3B3GA 1BKYA 2EVWX 3IO5A 5CYPA 1E9DA 2YVLA 3D5TA 5LM3A 5IS2A 2GYYA 5AFSA 4ILEA 4DR6B 2A9JA 1H6AA 1Q0LA 2ZTLA 1BMFA 1PEKE 2X2FA 3CZAA 2ACWA 2OD7A 3VJRA 2IPLA 2ZWPA 1FJGB 2GXSA 2VQDA 2FPSA 3AF2A 4HLNA 5HK8A 4C78A 4GH5A 2GZDA 3WGIA 4FD2A 1RYNA 3W77A 5JVDF 2FN3A 4QUJA 3FWHA 3N28A 2D2XA 2KYRA 3FPKA 1ZHFA 2W48A 2G4VA 2Y0DA 3P9SA 4XOIA 3WLEA 4PG8A 5BQ3A 1E2KA 1YXMA 3LO8A 2LZ0A 3QEOA 2VNAA 5GTDA 3WV5A 3DMFA 1PFQA 3WK7A 3I23A 2VSQA 4YJFA 3RU7A 4I4TB 4KK4A 1LQ2A 2I2XB 2FEMA 3TZ6A 2ZITA 4Q4JA 5IAEA 2BGNA 4WFKA 5FUQA 2PX6A 4B83A 5DBOA 2ZM5A 3BB4A 1XZAA 3L84A 5JBIA 1AV7A 4Z9FA 2P4EA 5KU7A 4EN4A 4LC9A 1CUHA 3CN7A 3CVOA 3HYNA 1J39A 4MO2A 3K8QA 1C9DB 1CXZA 5J2UF 2WMDA 1KFBB 3HPQA 3I1FA 4RFSB 3AERA 5K4AA 3V48A 4DLWA 1ZVJA 4ZEMA 5LLTA 2ZOSA 3R4VA 4E8YA 1RYYA 1TK3A 2YNMA 1GFSA 1KEPA 1TA0A 1T0HB 2A5DA 2P7HA 3KYBA 3QLUA 3GRRA 4H4EA 4POAA 3HY6A 1JQLB 3MPOA 1HTWA 3EPRA 3ZI7A 4YRDA 4NI5A 1YR8A 1PV4A 4GX1A 2MMGA 2OO5C 2AG0A 1YZGA 4N5HX 1NG9A 1J2RA 3M1AA 5JEEA 4JUIA 1N9ZA 2O14A 4JIGA 1NPTO 2ZVDA 3HZHA 4R1NA 2HYDA 4EGCB 3W8EA 3HZZA 4DR2B 1GZ4A 1NASA 1GQYA 2VDLB 2ZXFA 4LZNA 3G68A 4N8DA 1R6TA 1SU7A 1TF5A 4G65A 3C3EA 5FJIA 1LLDA 2AMFA 2AGVA 3CC8A 4QXMA 3T95A 2VA9A 3TZBA 3HSKA 4MUMA 4ZAVA 3RREA 4YRLA 5DEOA 5KNDH 2NZYA 2Q7OE 3ZD6A 1ZIXA 2GKGA 2ALJA 5IN4A 3ACDA 4DN6A 3FTNA 1VE1A 2W6PA 4EQZA 5JYCA 5GJBA 2V8BA 4C7JA 1X3LA 1EGVB 1ZRNA 2EIHA 3TRIA 4JUDX 3COZA 3D4BA 4K9IA 1GYQA 2ET6A 2KJQA 2IYPA 1X15A 1UANA 4IG4A 3R3UA 4LCBA 2X0FA 3ORSA 2R1ZA 4WLOA 1JXIA 4LRXA 2CXSA 5K3DA 1D6JA 1M8JA 4CMBA 4ERXA 5HRCA 3LIIA 1DT3A 3ZIDA 2IEYA 1UQRA 3KZXA 1E99A 1FRFS 2XRZA 3OTXA 4BMPB 4YJ2A 1K86A 3RUDA 4ESVA 3P96A 1TZ6A 4LNUB 4RGYA 4CIXA 4EUEA 1Q0ZA 3R3JA 4E4TA 4RKRA 3EEIA 2CNOA 3OQMA 4EA7A 3IULA 1I01A 2QYTA 3ESQA 3I3OA 4O4LF 4UE6A 4UEKA 4CQLA 2G07A 2V5AA 1L1RA 3REFA 4BN5A 5EMKA 1QK3A 2BTQB 1JKXA 4Q9HA 2QMZA 2YYAA 3DTYA 3CEPB 4TMVA 3SFVA 4DV5B 3E1SA 3T94A 4FCTA 2WTEA 3C6YA 2FSHA 1U9CA 2QRPA 4V24A 1YHZA 3N2GB 2P2ZA 2SECE 4GGPA 3VO8A 4IOLA 2LUOA 4G67A 4YC7A 5DNAA 3TM5A 5EPUA 2GO1A 1UDBA 3GLVA 4GUDA 1R9JA 3NDJA 5TMPA 1WYEA 4RV5A 2CFIA 2QMYA 4LZJA 1TO6A 3CR7A 3PC2A 2AJDA 4M9XA 5FHRA 1OB5A 4MPTA 2FI1A 3C43A 1NVVQ 4OBWA 3GN1A 2H2IA 3A9SA 2WWWA 3CZ5A 3IEIA 4ZHQA 4MUBA 5A5GA 4QOFA 1UKVY 3UJ3X 2R6HA 3NAQA 4W5WA 1JXMA 1KAEA 2P2DA 3A9WA 1KL7A 4GDMA 2PMCA 3OCWA 2V65A 3IE0A 3L7LA 4OATA 4RUKA 2QPTA 4R8RA 2AD1A 1BEEA 2H51A 3SXPA 4GBGA 4JLOA 4BQRA 4MRRA 1QTNA 1Z4NA 3C7KA 2JCXA 3UWMA 1NNEA 1VC2A 1MOPA 5FULA 1L7OA 5A0FA 4GOMD 2EF1A 4J1TC 1LQTA 5E6SB 5KWEA 1R0CA 3DFIA 4H6PA 3ZQ6A 1Z7WA 5KYUB 3IIMA 3N3AC 1SEPA 5CXUA 3UW3A 4NMWA 1ZX1A 4ATNA 1HC7A 4FKMA 1WU8A 4LZLA 5B2ZA 3N0VA 1G3IA 4TXHA 1JHPA 2IPNA 2WZCA 1O89A 4MSUA 4BAUA 1HTTA 4X0EA 2CJPA 5KOHB 2QM0A 2R9VA 2UUOA 4K40A 3PITA 5JPCA 1H9AA 2G6BA 2OYRA 3FHJA 1Q3TA 1QIEA 4YL5A 4BO2A 5MN6A 4NYIQ 4AJPA 4O4JB 5FBHA 1OLUA 4LFCB 3DUFB 4E94A 3WLMA 1VL1A 3A7EA 1P1IA 3GLIE 3I9MA 1D4ZA 3F8WA 1L7MA 3JAWB 4WJMA 3I61A 4I1UA 5ERGB 1DDOA 1GUZA 1KORA 1PQWA 3ZGVA 3F8SA 2RGDA 2WM9B 4G8DA 5L53A 3S29A 4MR7B 1YQUA 4PR3A 4HDOB 1JDPA 2Y1EA 4YMLA 3NHJA 2O5RA 3V4ZA 4IP0A 4HMOA 4D74A 2PMFA 1CW2B 1OKKA 3FCUB 3UTCA 3QVWA 2EKZA 3ESRA 1IBCA 1JG3A 1IRIA 1LTKA 2PZGA 2QN8A 3A04A 3P32A 3VC2A 3WB9A 3ZUPA 4DMCA 5AK6A 2LCQA 3ZHBA 4MI3A 1M6EX 5J4KA 3KYJB 4E5UA 1KVUA 4EG1A 4OQMA 5E4TA 3VZBA 5AHKA 1QAQA 1SCDA 4ZQFA 5HQJA 2AN5A 1JIXA 2XECA 3CF2A 3GC6A 4BCDA 4QTZA 5B64A 3ZJTA 1OZAA 1Y5RA 3NX4A 4FUQA 5KYXB 3OT4A 1H0KA 1LI7A 1HURA 1PJSA 3DE1X 3JARA 4RPCA 2JJ2A 2IZ6A 1QBKC 4FGJA 4KXLA 5BMVB 3T7RA 5JZMA 3L6EA 4I2NA 4NX2A 5GJVC 2CFSA 4RVFA 1DPFA 5A6VA 4L76A 4MV0A 3PUYA 2XV1A 3GVPA 3I9V1 4C3OB 4KPFC 2CZGA 5D84A 2BEVB 2B3TA 3AFGA 5HS4A 3KEMA 2ODEA 4JJAA 4PFSA 3OPVA 5JQGA 2C1XA 4B82A 2F7KA 4BL5A 3CIOA 2VZEA 2H8KA 4OI1A 4CT5A 1GQFA 1OLSA 1EWYA 1M7HA 1XIVA 4I1OA 3FSJX 5CBPB 1KOGA 3I6ZA 2WJVA 4KN9S 3W8DA 5U1PA 4CKBB 4D3ZA 5AIBA 2DBRA 2YOGA 3I45A 5B1HA 1WEHA 1N2XA 3R1IA 1OXUA 2GCOB 5C3ZA 1JVBA 1NULA 4JY7A 3V55A 4NYMR 1Z33A 1G291 2ID9A 2OPBA 4IMPA 3CY6A 5HTKA 1OVMA 1PL6A 1ZS9A 2Y0PA 3GLHA 3IPLA 3OH8A 4Z0HO 4GQIA 3T7TA 3VR4A 1EH5A 1GN8A 3H16A 1YDMA 4KFCA 1E1LA 3IOEA 3OEEA 4M1KA 1LDEA 3LJSA 4MA4A 2BGMA 4PSDA 1WG8A 4M89A 1E8DA 2I2AA 3NNNA 4WCFC 3QFSA 5H0IA 1PJAA 1PGJA 2P6NA 3UCEA 4F3CA 1DIHA 5A3SA 3EZXA 5K3CA 2OBNA 3PSAA 3UT5B 3K16A 2LIPA 2LTAA 3BMNB 3KAPA 2QD2A 4H1VA 1K7EB 3QP9A 2M32A 4GI7A 3HJHA 1ZD5A 4X95A 4LGCA 1N6LA 4EGFA 5A5EA 3STXA 5KKNB 3G8DA 3VZSA 3VYRB 1Z8NA 4C30A 4AY6A 4MRSA 1N2CA 5EERA 3L4BA 4Y6GB 4N9QA 1ODJA 1YI8A 3ZGYA 4LUCA 3I01A 4FZRA 1OTYA 3KO8A 4TN1A 4DADA 2W71A 4IDFA 1OGYA 4H1TA 3IUNA 4R51A 1AQJA 4DVGA 1VE6A 1ORIA 1F06A 1W36C 2AFIE 2EFYA 1A98A 1MGOA 2HU5A 3EVEA 3I76A 1U1EA 2W93A 2V7TA 1G8JA 4RD6A 4UUNA 4L4SA 2O7QA 2BVNA 3U1TA 4CM5A 2J3QA 3AJDA 3SR4A 5HCIA 2Q21A 3MT8A 1RFTA 2EEZA 2XXJA 3PCRB 1HNZB 3QOXA 2GYUA 3UN1A 5E2IA 4IDPA 3U19A 5EFOA 3VYVA 2FGJA 2QIPA 5B7GA 3LSTA 4XRGA 3HN2A 1HE5A 1VHQA 1W5FA 3OCVA 2BZGA 3PX3A 1G20A 1USWA 2WJJA 1Q0SA 1VDZA 3DV0B 1E5DA 2D4HA 2V7EA 2WT4A 3C8ZA 9LDTA 1E9EA 4ZKDA 2ZRHA 1SVWA 4DUGA 1TAUA 2GC6A 1LI5A 2W00A 3LI2A 4CMHA 1KVSA 2H2WA 5K6AA 2GR9A 2VQ3A 3STHA 5A4KA 4YY3B 3DTNA 3K20A 4OHXA 2J5BA 1FOEB 1PBTA 4MO9A 4L2IA 3GY0A 3HJ6A 4FLEA 3KC2A 3BDAA 1H23A 1A2OA 4KREA 3M1YA 4MVYA 1BGXT 1U02A 4BX8A 1ZIYA 4D82A 4NDZA 3Q3IA 2WAAA 3EQ6A 4FKZA 1SXJD 4LBZA 3C4JA 3IDAA 1N78A 4GOJA 1XU4A 3PGLA 4BB5A 1W87A 1GPBA 1KQPA 1ODCA 3QKTA 3SEAA 1AXRA 1O2DA 3LZCA 3FF4A 4NHEA 1G3QA 3FM9A 5CVDA 3A1NA 1M2KA 3QW2A 1EHCA 1QIGA 2IVZA 2WIGA 2ZRLA 4ZVSA 3R0ZA 1R50A 3HB4X 4OVKA 3AVPA 3ZEAA 3BK1A 3G2NA 5BRNA 4RCVA 2AOTA 3MMPA 3RFFA 3P45A 4ER6A 2BL4A 5J5CA 3SC2B 4I50B 3LY7A 1KP9A 4RVHA 4WXYB 3JQBA 3UFXA 4CW7A 1O5OA 3ASVA 3VMMA 4N47A 2FF5A 3OZIA 1XJ0A 1BYUA 2QJOA 3ZE1B 3SSAA 4QFDA 1NTRA 3A9CA 4MWBA 4Z1MA 1C0EA 1DJPA 1N7HA 2LCIA 5THXA 3VR2D 2HIHA 2IELA 3OE4A 2OBBA 5K3SA 3CNLA 1KS2A 4A4DA 1D2RA 2QD1A 3PEFA 2WFLA 3NTOA 4XWGA 2X0EA 3O1JC 2FSUA 3AZQA 2Q5JA 1SUEA 4KQ9A 3KHTA 1CZRA 3P19A 2LRHA 4ZAXA 1E1RD 2I22A 3F6BX 1P73A 1O7JA 1ZMRA 4QVKA 5LIPA 2CKDA 1J33A 1RKBA 4GGMX 2IXAA 4OJYA 2P9CA 1J97A 3N74A 4GPBA 2IJGX 2O2ZA 5HTOA 5G0TA 5CH8A 4DY6A 1EBUA 2Q3MA 2UZAA 4J9VA 1GD1O 5ICCA 5AQEA 2LVBA 3QE0A 4ADSG 1X7HA 3UH1A 1NJSA 1BGWA 4RSHA 2XKKA 4N12A 1DXYA 1U4SA 2AI3A 3QVTA 4DQ0A 4O2BB 4YRPA 1GFZA 1UXHA 3EZYA 5TEWA 1GL3A 3GLIB 2F9MA 4JU9A 5HG0A 4MW4A 4NR0A 4GOXA 1I51A 1YZ3A 3MS2A 2NT4A 1EQ2A 4WRRA 4X62B 3ORQA 4HDQB 5JS6A 3WFZA 1YVRA 2IYVA 4OMFG 3E22A 4JLSA 1OCEA 4YAJA 4P22A 4J0IA 1Y5IA 4B3BA 2YOHA 4MWEA 6PFKA 4C5AA 1U80A 4G4SP 3A6KA 1WB4A 5FF9A 3T1YB 2Y4OA 3WMFA 1SO8A 1E69A 2PJDA 4KBYA 5A3RA 5JROA 2D00A 5ALDA 3H5NA 3T9CA 2PY6A 3BJRA 3W0LB 4INZA 4D42A 4WBNB 5BWBA 1OJ7A 3SX4A 1JNXX 4K81B 1ZOIA 1XA0A 4PIMA 4QAQA 3V4VB 2WA1A 4KTVE 4ZYTA 4C2AA 1P7CA 2VJBA 3ZXUB 2B8TA 1MAUA 4WESA 4YCBA 4L5IA 4JA2A 3M2TA 5LP6F 3SFZA 4DXDA 1SXIA 4ENUA 4HVLA 3DHEA 1SKQA 2QSUA 4O2LA 4ETNA 5K8VA 5K3FB 2H18A 1G63A 1K7CA 4H3SA 3WWOA 4A92A 5CVTA 3ICQB 1E8MA 1UCFA 4K9KA 4P4NA 4Z0PA 2AEEA 1ZMXA 1QYIA 4NCNA 4B7UA 4AI6A 4IDAA 4F5YA 3KPVA 2R3BA 1EJBA 4FGSA 4PFJA 3PJRA 3DZGA 1K8YB 1GLGA 1Q95A 1WSDA 1FJXA 3OZTA 4YV2A 4PLVA 3OHPA 3ZQKA 1N32B 2HQSA 1F60A 2O06A 1J9GA 3BD9A 4IHJF 2J4DA 1P75A 1WXXA 4WK2B 4BVGA 5KNBH 3LY9A 4HXFB 4P6VF 5IEJA 4C6SA 4NMLA 4TSFA 2DJIA 1A96A 5B4TA 2HGSA 1NA5A 1S9HA 3G8AA 4IXDA 4PNHA 3LX5A 3K1YA 3UATA 1NUSA 1P72A 2O1SA 3RCBA 3UA3A 4GX2A 2CNLA 2R1VB 2PGJA 4DZRA 4WXRA 3AEKA 3SY8A 4B8SA 4LYYA 1OYOA 3W34A 4GEGA 1WUJS 1WUKS 1R0WA 1TFRA 1IDOA 1ZCFA 2R6JA 2ZUBA 3C3PA 3PC7A 4P32A 5K3AA 1L5LA 4B3IA 3O74A 2SNIE 2PUFA 4B2PA 1D1TA 4IUDS 1BGVA 2QX8A 3RODA 1YAHA 5GIPE 3E3LA 2E18A 1CUBA 2PJRA 4JKSA 3IUPA 1VSVA 1E7QA 1SCIA 1L7DA 3U9LA 1LCIA 3BWBA 3IALA 4QOEA 4ZAGA 1E2HA 2HLNA 1QAOA 2ATVA 4GXTA 4NY1A 1FRZA 4UASA 4PG6A 4AJ4A 4MQBA 4ZTZB 3L8DA 4MUNA 1HK7A 5I9BA 1TCVA 1IN6A 3D7KA 4AIRA 1LLFA 3HB7A 2GA8A 3KFXA 1VIYA 1CTQA 1YCHA 1M2VB 1LWNA 2HF7A 2J9GA 4R8SA 4J16C 4RZUA 3BWEA 1DXOA 2YCBA 3TH5A 3WGLA 1PSDA 3G1WA 2PO7A 3HWX1 2VUUA 5A9TA 1BCRB 1RYHA 1TM2A 2QLBA 4U2GA 2IEDA 2AFIB 5CM5A 3KQLA 5KOYA 4BO5A 1K89A 4U3JB 1K98A 4Y6QA 2FFJA 3EVDA 3L8EA 4OK5A 3ILVA 4ON9A 5J59A 1H4QA 1KGDA 5LQUA 1TTHA 3PBKA 3KBBA 3WBBA 3I39X 2X4LA 1G5PA 5IZ4A 2I6SA 4WK4B 4C43A 2Z5FA 3DDUA 3OT1B 4R9SA 4AYTA 3MUNA 1E63A 4ML3A 1NVWQ 3QX9A 3EWSA 2KBFA 5B3KA 1ISGA 2Y2UA 2YJ4A 4B44A 3N75A 2QIOA 2AW5A 1XSEA 3OZWA 1A7JA 4JOQA 3FY4A 4HMQA 5DNDA 4BTVA 2I3GA 1YMVA 1EK2A 2IEGA 2X1VA 3FF1A 4GI3A 2NVUA 3NIBA 1GQ2A 2NSYA 1ZM2A 4IIJF 4M1TA 3RAEC 3LT4A 4QJIA 1D4AA 3AUKA 3DKKA 3NIDB 3H3XA 1RAAA 1HOXA 3B6ZA 4JFAA 4FI3C 1YKSA 4G84A 1RPAA 1SBHA 3EY9A 3TR6A 3GGSA 1BVRA 3AVYA 3FI9A 2PWBA 2J6BA 3OM9A 1QU2A 4MW1A 3UHOA 3D4OA 2H2DA 4Q9LA 3HACA 5I9SA 4ZQHA 3T9FA 1M2JA 3RYFB 3TLAA 1XQXA 4BLQA 3DGEC 4N4AA 5FL7D 5EJ8A 3KZOA 5KPDA 3ICOA 2RH8A 2VO1A 3CCBA 4JB0A 3LT1A 3CSSA 3IR6A 2J6CA 2N9UA 5EJFA 5EWMA 4BV3A 1NDHA 1YR7A 3MQ2A 4LXHA 4RF4A 1M8KA 1J0BA 3W6OA 4D5EA 3AHDA 1KOFA 1XQ6A 1J2JA 2MR6A 1GFWA 1USGA 2AE2A 4HWKA 4H2DA 2ZRDA 2NT3A 1SEVA 3PWZA 1VJCA 3GFVA 4KK3A 1JYSA 1XRNA 4LEIA 4WFIA 5EEHA 5JVDB 2FJUA 4MKXA 5T64A 5A4AA 4ECEA 2O5VA 1JBWA 1PJ8A 1WQ1R 4TTAA 3CUEF 4H17A 4PAMA 3T4EA 3VUEA 2PE5A 4ABTA 3K70B 1F3OA 3VO1A 2IU3A 3VPSA 4PZZA 3HBNA 1W44A 3BF7A 1SBZA 4G8BA 4PC6A 1DUSA 3R5HA 3DMDA 2FW1A 3HR4A 4LHYA 4BFYA 4XZ3A 3SFTA 5CCBA 2WD7A 3U61B 1AS3A 1N2BA 4G5HA 4IY1A 2AC4A 4N40A 3AVOA 4PLYA 5GZ1A 3PWSA 1M1YA 1CDZA 4FINA 4HQOA 1VHWA 4B3MB 4RBNA 4M0EA 1VE7A 2A0WA 2XUZA 4QU0A 2H5JA 1P9WA 4IGFA 5DBIA 1PG2A 4M0CA 4AVYA 1S8FA 3R5FA 1PT7A 1U8UA 1XZCA 3HM2A 2YHIB 1WLYA 1MJNA 4BNVA 3RQHA 5KAPA 1ISRA 2Q1UA 3MHPA 4CBVA 4P7BA 6LDHA 1GAEO 2H9YA 1JEEA 5IHXA 5KKCA 1T5OA 4QOGA 1GZSA 2ZSJA 1E64A 2YDXA 2GSDA 1JG7A 4HAVA 4FDUA 4IPTA 3WRYC 1E2GA 1KSJA 3VQTA 1TC2A 1SELA 2RGUA 4RVSA 3QMMA 3STUA 3X1ZA 2JFFA 3WGJA 5ES3A 1I94B 2QVBA 2NTNA 2Y1OA 3KUCA 1M0SA 2IDKA 4X94A 2WBLC 2HREA 2SCUA 3BRWA 1Q57A 4AF7A 1UXJA 1XKLA 3ED1A 5LQRA 3HJUA 3KPJA 2YWDA 4OOFA 3IILA 1L7XA 2IT1A 1I4DD 3GYGA 1KR2A 4JWKA 5D01A 2CLLB 3A8TA 2X4IA 3CXRA 3Q10A 3TNYA 4AL4A 2O23A 5CB4F 2XA2A 2ZTSA 4YYZA 2EP5A 1FUEA 1NXWA 2ZIEA 1XTBA 3JQEA 4CEHB 2GN9A 2ACVA 3A9VA 2AM1A 1C50A 2JD2A 2FWNA 1XMVA 3GMSA 3S27A 3IJEB 4EFMA 1DP4A 1SUAA 3KEUA 4QGAA 4B4OA 1FUYB 3UG7A 1YJBA 4ZRMA 4LXXA 2J9YB 3W6UA 1M1NB 2ZJZA 2UYHA 4TV9F 1VIAA 4KPYA 2JJYA 2Z1NA 2GHQA 3JQFA 3E2MA 4ECAA 3ABSB 1UL1X 5NLLA 2FAXA 1TW2A 3C3CA 3E9MA 1IJFA 2GJKA 2Y77A 4K03A 5HGJA 4YRKA 3L9XA 1I8TA 4UJ3A 5C1DA 1TC1A 3T0IA 3SEQA 4HNHA 3DJYA 4IVRA 4QT0A 5A0TA 1ATZA 1IXRC 4BQIA 5EE1A 4W6ZA 3UMGA 5REQA 1GRCA 4A2CA 2FNAA 1Y33E 2FUG6 2IZZA 1AGPA 1JHAA 2DPHA 4CL8A 2FPMA 3FNQA 4IINA 3KKZA 4NC9A 1FRVA 4HDKB 4YI3A 2V96A 2OPHA 3R0JA 3IIIA 3RSQA 2EWWA 4K5QA 4E4RA 1C80A 1Z68A 5FOXA 4D4JA 3PFKA 3FGOA 1Z15A 3JWHA 4TM8A 4D4GA 4B40A 4FWIB 2XQGA 1TUEA 4YT4A 1OLXA 1ZW6A 1T6NA 4BN0A 4BXOA 3U40A 3PENA 1OILA 1XZMA 2D06A 3DFZA 3G13A 2BGRA 3I01M 3OC0A 1W0CA 2OESA 2ADMA 3O8DA 1V26A 3ESDA 4IMIB 2XB4A 1OJLA 4IWYA 5DRTA 3R76A 4MV8A 1N6PA 1BS2A 3IESA 3RU3A 1WUHS 1ZMOA 3UAWA 3DVAA 4A0QA 2HCJB 2J0QA 4XPIA 2C54A 2Z83A 5G0UA 1T13A 4XYGA 2O5EA 4GC5A 1P3Y1 2BP7B 2Z1MA 2ZYWX 3R3HA 2PSHA 3UM9A 2D1TA 5H5JA 3QU5A 3VVBA 3ZWBA 1BX1A 3KKLA 3TG8A 3USZA 1PZNA 1VOTA 2P6UA 4DM4A 1PNQA 3C6MA 3I6BA 2IE8A 2PKQP 2AHRA 5FI5A 1YNSA 4R1UA 1F8GA 2IHBA 1GADO 1WO8A 2W2QA 1CYDA 1UM9B 2ZTHA 3RS8A 2WYVA 5FO1A 1ZNWA 2BELA 3OLCX 4NBNA 2BMJA 5EWJA 721PA 1I13A 5JHHB 2A35A 2CLEB 1U5CA 1QGDA 3V7FA 3M7IA 1I4TD 1WDKA 3DE5X 2FCAA 4JJZA 5AMXA 2QRZA 1CQIA 1WPQA 1EDDA 1UMBA 3EOZA 4S1IA 4OMUA 5ALSA 4ITVA 3BH0A 3FOCA 1N0VC 3CIFA 1SIOA 3V8EA 4BEBA 5J5VA 4FGZA 3KCQA 4LSGA 4TOIA 4XIGS 5EZYA 3SDBA 3U7JA 3TIXB 4YAGA 1T0JB 4YGYA 4DMKA 1ELOA 5A3QA 4MQFB 4GZLA 1CS4C 1D5CA 1UEJA 1YL7A 3EC1A 2A9FA 3W8NA 4DG5A 5L3QB 3PEYA 1RM4A 3QYFA 1AMNA 2R4UA 2R2AA 3DE2X 3TD6A 2OILA 3ENNA 3GPDG 1EP9A 2VUSA 4DCOA 2YMPA 1JFFA 5T4HA 2FPWA 3LUJA 4HX9A 3X1DA 1BSVA 2FQ1A 4F46A 5LYJF 1ZVQA 4NG4A 2NU8B 3VSCA 1HDEA 4CF3A 1Y82A 2NN3C 3B1JA 3DW3X 3MJHA 1WJGA 5FBVB 3A31A 3DBRB 1D8AA 3JY6A 4H7IA 4XUEA 3DE0X 3OCUA 4I4LA 3WOHA 3EWMA 1YTUA 4GU5A 3UMOA 1W19A 3M4JA 4Q6BA 4L9RA 3TR5A 2RBCA 2YUTA 1C7ZA 2YHBA 2R6DA 5A6SB 3BFXA 4RTNA 4JUBA 2QLTA 4G4SO 1B8PA 2G5TA 2R5FA 1UDWA 5TQ2B 2BFCB 1R4ZA 4RDXA 4MIKA 2D74A 1JAIA 3EZFA 4S2UA 1M0EA 1CD5A 3KHKA 3O3OB 4OLFA 3D6FA 4PZUA 3C85A 2ZAOA 2WZDA 5GAJA 2XHZA 2RC5A 2GM9A 3OO0A 2HDOA 2OM6A 4MWSA 2VJCA 2E1RA 5ICEA 4WVLA 1S7CA 1GO2A 1UDCA 3I12A 3VH2A 5FOQA 2DUMA 3UEOA 1ZM7A 4G5OA 1XROA 3K3PA 2W2KA 3FNEA 3IUJA 2FZVA 4EELA 2WDPA 4LCJA 2WE7A 1JTVA 1KFCB 1XLTA 1O9HA 1ZGHA 3ECSA 3M4NA 1ZJWA 1XJCA 3ZVMA 4KQKA 3H4TA 1NXTA 2R79A 3K94A 2IYYA 3AI1A 4W9RA 3CH5A 4HNGA 4AJJA 3MINB 3JQ8A 3A9TA 4XVQA 5AK4A 4EB3A 2QZ9A 4KJZA 4CG2A 3COPA 2NXCA 4DKJA 1AD2A 4W63A 3I2JA 4K6HA 4M38A 4YQYA 3UAGA 1LSJA 4YCJA 5CVEA 4AKTA 4P3PA 3VZPA 4UJ5A 5BV0A 1IN1A 1GNTA 2QT9A 4BB9A 3NTVA 2CEKA 1Y63A 4JGBA 3BDIA 4UAGA 5ALJA 3ZK9A 1L4BA 4Y9SA 2HPHA 4BU1A 2PS1A 5FADA 4OF4A 1T6YA 4PZPA 2CCJA 3ZBPA 2PS9A 1MO5A 1BWRA 2WF5A 3D4NA 1VGVA 4N6GA 3TLYA 4DSNA 4ENRA 4ZHSA 4UEQA 4C5LA 3PD7A 4DYVA 2JGVA 1XPJA 5ALUA 2X1MA 4FYXA 1A4XA 3CO5A 1FUKA 4LGYA 4GI1A 1HKUA 1OREA 4RD1A 2ZJFA 2ZUDA 4J2HA 3RQXA 2PX8A 1FNSA 1ZYUA 5D51S 3A3YA 1SBNE 1IY0A 2G63A 3MS4A 4DBVO 1EFRA 4C88A 1AC5A 3FJOA 1ZD2P 1DCMA 2O8BB 5M7EA 4UUOA 3EVTA 1VBNA 5A9SB 2NZJA 2YN4A 3OZXA 4EHFA 5IRCD 2EP7A 2O8CA 1IQRA 4LZAA 4CVNA 2FR8A 4QPCA 2W42A 1REQB 3UO8B 3KUKA 4OHFA 3C3YA 4PPFA 4S1TA 5TRTA 4WQMA 1D0IA 4N39A 2R97A 2VTBA 2FPXA 3G2HA 2R8XA 4ND8A 2DCMA 1QLWA 4RTLA 3HO6A 2FX2A 5JAQA 1T2UA 1XQWA 4L5BA 4N6NA 2WJ3A 4BECA 1SD5A 2WHPB 5J4VA 3GP8A 1XHEA 3OICA 3VU1A 5LDHA 2E5FA 2QYSA 2X40A 3R2JA 4PVDA 4DTCA 3NAGA 1PR1A 4LJ6A 4PIPA 1GCOA 4PX3A 4GI5A 5JW6A 1W5SA 3HVRA 1O94C 1O6CA 2XQIA 3H1BA 3I2YX 2XUJA 3MBKA 3AESB 3I1IA 4FNAA 1E2DA 3DE6X 2PT6A 3MMZA 3M49A 4RQBA 4YJGA 2WIKA 3NHKA 3R9XA 4Q3AA 4M1SA 2YQ4A 5KQSA 5IBCA 1RXSA 2GXQA 1DARA 4KACA 3TXAA 2J6IA 3TOSA 5BN3B 4ZAYA 2PA3A 2GCAA 5AVTA 4A36A 2VG8A 1C3OA 3EVCA 3AUFA 4A1FA 1VM7A 5IUKC 2IBMA 1QYVA 3S3TA 4A8TA 1PU2A 5TPZD 4EB6B 1JHDA 1WXDA 1GPWB 1WPRA 1E0SA 2OC4A 4M36A 4DV7B 5F9FA 1R0BA 2B1IA 1KTIA 4F56A 3B5IA 3RWBA 1PDOA 4TUYF 4NBVA 4FX5A 1NKTA 1W6RA 5KTYA 1GWNA 4MP3A 5DB4A 3FH0A 4BNWA 1UP4A 1JDZA 3AUJB 1EZZA 4HEHA 4NJMA 1DKNA 4BDSA 1YB2A 3D8SA 4IWXA 1T0IA 3AP3A 3DLAA 1OI7A 4E03A 4RY8A 4M9UA 2CBZA 4HYYA 2F8TA 1NBMA 1Z17A 2EJCA 3ZV5A 1H8HA 1YQ9A 2FPKA 3KSZO 3NUGA 3GLFA 5K0JA 3IS3A 3HUFA 4RZHA 2P4UA 2Z43A 4DLVA 5IYZF 2H1WA 1RQ7A 2N75A 3WYEA 1WXFA 2QRMA 3DMTA 1T4MA 3KU4A 2P9JA 3P0IA 4FJ0A 5HF6A 3SPXA 2FR0A 1E6UA 4EW3A 4PFKA 4FYKA 5FL7A 3HKEB 2WY2D 3AJ8A 3DBIA 3O8OB 4AECA 2BFOA 2DQ4A 2XCUA 1LHRA 4ZQIA 1N3YA 4J90A 1TJ4A 2E4XA 3F6RA 1Q7BA 4GKBA 3O73A 5KYWA 2CDCA 3OO1A 2VDNB 1TQDA 1Q74A 3D2BA 3KWJA 2J3KA 1C3LA 4DRXB 2PZAA 1PR9A 1Y8QA 3MGGA 3L5KA 1GP2A 3T4UA 3TQIA 4B4VA 2HN9A 4PYRA 1H2WA 4MK4A 1HYBA 1NC3A 3V7UA 4Y67A 4KLRA 5HZGA 1DZIA 5E2AA 4KUGA 1G38A 4W7SA 1FNBA 1RJ9A 1VM6A 1FB5A 1JVSA 2GPNA 1RE1A 3FFTA 3N58A 2I1WA 4LRWA 1LDMA 5AXCA 2Z6AA 2W2PA 1JLLA 1TNDA 2CHGA 1SH7A 4DA6A 2PX5A 4RV4A 3ISTA 1RHKA 1WVGA 3JAKA 5FIUA 4XIFA 3MGAA 4WZ6A 2W2MA 5HMLA 3I3SR 5JSFA 4MAMA 1N5LA 4EKEA 3KKMA 2YZ2A 1BRTA 2IXBA 3EQ8A 4ZV7A 3RTEA 2ASEA 3ZHOA 3AR5A 2JB9A 3CCFA 3K9HA 3NORA 4I55F 4AKEA 4BP1A 3WK6A 3RPZA 4RTRA 1WTAA 5E6UA 1DAHA 2HGZA 2OO7A 5C3MA 1PR2A 4JI4B 1JIUA 1SCAA 1W25A 2DKNA 2QLJA 2L17A 2ZETA 2ZKIA 4O4HA 1BJRE 3MCZA 2YV1A 5TF4A 3VU3A 4JS0A 5ALXA 1P74A 4LJRA 4RPJA 2Y1FA 1HXHA 3E0QA 5FRDA 5CDTA 1DHRA 4G0ZA 1NE7A 1PWEA 3EXIB 4XF6<