3RRFA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with atp
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 177
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rrfA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rrfA02
3RRFA 3BF5A 4K9CA 1V19A 3FHYA 3IQ0A 4C5NA 2RBCA 2JG5A 1WYEA 4WJMA 2JGVA 4LBXA 4K9IA 3UQ6A 4JKSA 4C5MA 3H74A 3RTBA 3BGKA 2ABSA 4S1IA 2DG2A 1LIKA 4C5KA 2XTBA 1RFTA 3GO7A 4DC3A 3DRWA 3LOOA 4KBEA 4EUMA 3DZVA 3RQ8A 4YWRA 3CQDA 2DDMA 2V78A 2C4EA 3RY7A 1EKQA 3RTDA 2PKFA 1V1AA 1EKKA 3KEUA 2AJPA 2PKNA 3NBWA 3KTNA 3NL3A 1RFUA 3RT7A 3RSGA 2C49A 2F02A 4LC4A 4LCAA 4C5JA 1TD2A 4S1HA 3UQDA 3UBOA 2AX3A 3ROXA 1RKSA 3B1PA 1BX4A 4O1GA 4X8FA 4YL5A 3RSSA 3RO4A 4GM6A 2QHPA 4U7XA 3N1CA 1TYYA 4B8SA 3I3YA 3RTGA 1RKAA 2F7KA 3W4SA 1VK4A 5C40A 5BYEA 5COJA 2I6BA 1V1BA 1GC5A 3K5WA 3B1QA 3NC2A 3D3KA 3Q1YA 4K8KA 4S1MA 2I6AA 1YGJA 3ROEA 3HICA 3RU2A 3NL6A 5BYCA 3IBQA 4E3AA 3RRJA 2NWHA 4XDAA 3RM5A 3B1NA 2DDWA 3RPZA 3LKIA 3NL5A 3UQ9A 1KYHA 1VM7A 3RTEA 5F11A 4EBUA 5EYNA 3QAIA 5C3ZA 2AWDA 1U2XA 3LHXA 2VARA 1C3QA 2I5BA 4S1IB 4E69A 3RU3A 3RSQA 2AJRA 4EN4A 5BYFA 1LIIA 1UA4A 3KZHA 4K8CA 2O8NA 3RNOA 4K93A 2FV7A 4O1LA 3ZS7A 4DU5A 4EOHA 5CGAA 2AA0A 1L2LA 2R3BA 2YXTA 3MBHA 3ROZA 2A9YA 3UMPA 1GQTA 2PKKA 3IE7A 1DGMA 5EY7A 1ESJA 1TZ3A 2Q5RA 1ESQA 3HYOA 2PKMA 4KAHA 5B6AA 3RREA 3EWMA 3IN1A 4LBGA 2HLZA 3QA2A 4E84A 3FHXA 5C3YA 4N08A 3RRBA 3RSFA 4N09A 1RK2A 2JG1A 4JJPA 3RQQA 3RQ2A 4E8WA 3PL2A 3VAQA 4K8PA 4KADA 1LHRA 3NM1A 5BYDA 1RFVA 4B8RA 1JXHA 4K8TA 1UB0A 3RS9A 3IH0A 3RQ6A 4KALA 3LJSA 3B3LA 3PZSA 3RTCA 3NC9A 3RQHA 3ROGA 3MBJA 3IKHA 4E8YA 3RTAA 3NM3A 2HQQA 3UMOA 1V1SA 4UBEA 4XF7A 1LIJA 2ABQA 4E8ZA 3RQXA 4C5LA 4XF6A 3B1RA 3K9EA 4PVVA 3RO7A 3NL2A 1JZTA 5TQIA 3RT9A 3HPDA 1TZ6A 5CM5A 1YHJA 1RKDA 1VI9A 3KD6A 3NCAA 3Q92A 3VASA 3RS8A 2AFBA 3GBUA 3GO6A 1YGKA 2AB8A 4KANA 5CGEA 5C41A 2QCVA 4XCKA 4JKUA 1JXIA 3RPHA 5TRWA 3NBVA 2R3EA 2DDOA 1LIOA 3JULA 3OTXA 3B1OA 2DCNA 2YXUA 3RQ5A 3UQEA 5F0ZA 2HW1A 2A9ZA 1LHPA 3H49A 3D3JA
chains in the Genus database with same CATH superfamily
1M8PA 3I3SR 2YWBA 2E4VA 3ISTA 3K8ZA 2G17A 4AY2A 5JADA 2HCRA 5A03A 1J25A 1QG2A 1W0KA 3KT0A 4MQUA 3SJ7A 2MYNA 4Q1CA 1NPTO 4Z2YA 1L5KA 3TZQA 4WKPA 3IVGA 1Z62A 3E2PA 5JZBA 2FSSA 4G4GA 5LLTA 4A23A 4BXOB 3Q6MA 2CXQA 4FMBB 4K86A 2W42A 1U7OA 1G6OA 3EVNA 2IF0A 2P8JA 5DBIA 5KMGB 3UA3A 3QG1A 4AY3A 4O0LA 3ZW9A 4YRNA 3L02A 1G4HA 4YAOA 3U4GA 3JU3A 2D5LA 3OOHA 3KEUA 4R7GA 2H2AA 4ICIA 4TWRA 3F47A 1W8IA 1OLUB 2IYXA 2R4TA 3ILXA 4S1VA 1I4OA 1NLUA 4Q15A 4HVLA 4K7JA 3MJFA 1E63A 3BRWA 1U6KA 4LJKA 1UZNA 2F9FA 1P1HA 1XQ1A 3Q3CA 3MAJA 5CURA 3WNZA 1Y42X 4CM9A 4ZEWA 4EG8A 4FBMA 1X2BA 4JV5B 5ALZA 2ZAOA 4X6YA 1QE3A 2WD7A 2O2CA 1QS0B 4UARA 4Z5XA 2PU7A 1GPMA 4YPVA 2ONZA 4YRKA 5J58A 5F9FA 1L9XA 5ILGA 3ZE8A 4EJ6A 2HLDD 4Q4AB 3UWDA 1P3JA 3EXEA 1NNI1 2XWJI 3FJOA 2LR0A 1DT5A 4II7A 1KYQA 4JJKA 4AKGA 1JR3E 4BLSA 4Q7MB 1GQRA 2I4IA 2W6IA 3OJEA 1Y1RA 5FUVA 1K7SN 3JARA 4P58A 4HVTA 4JASB 3F5QA 1CUZA 3R3JA 3WJ1A 3S2GA 1NMEA 2BCJQ 3A58B 1AHHA 3L82B 5EWLA 1OLOA 5J1TB 1F0YA 4MW5A 2JEOA 3QXCA 1ACLA 3HLTA 4DIDA 4X92A 1JDBB 4EUNA 5K4GA 1RU3A 3DEYX 4DYDA 4IX1A 1SCIA 5JWRA 2IZ1A 3FLEA 1PW7A 2FEOA 3FGPA 3MCZA 1II8A 5FHQA 2V45A 4MV7A 4N7MA 3DE7X 2PRJA 2D0PB 4NPHA 4JL5A 4DJTA 4EJSC 2R3SA 3I53A 2Z2IA 3NQ41 3OJ0A 4KKVA 5JQWA 2XUZA 4PY2A 1ADYA 2PGLA 5AK4A 1YQ9A 2IWHA 1SKYE 3CNBA 1C7FA 1PR3A 5LQDA 2BHLA 1WEKA 2V6JA 3TM4A 3W9BA 4QXAA 1YS6A 3RRBA 4KOEC 4J3JA 4ZC1A 3NBAA 2D5CA 2ZE7A 3SQDA 5H3HA 3DDUA 2NO6A 4ENPA 5C5IA 1IFXA 1OBVA 2IGBA 2ZBRA 4O2AB 2C5AA 3PFIA 2FPSA 1WL8A 2VDUE 2IXGA 1W76A 2EOAA 1MB2A 1KP9A 1GL9B 2QTBA 5P8WA 4ZAVA 4CM3A 4O25A 4BQOA 2SCUB 3ZNNA 2R5NA 3IR6A 3QY0A 4Z99A 1JEYA 2OCKA 1JAIA 2C59A 3HJFA 3KSDO 1KL7A 4X8MA 2QW1A 3MWDB 3FCCA 3MLAA 4BWFB 1GFZA 4DWOA 3QKRB 4QODA 5FTLA 3KJXA 4IWXA 2FXIA 4KFRA 2WE7A 1RWOA 1KKUA 2X19A 4DRXB 4IV5A 4OK3A 3DLIA 4GZ6A 1M34E 1PT5A 4MITA 4TYWA 3RVQA 1MMFB 4RPHA 1RLMA 3RRFA 1W36B 3DAHA 2X8LA 3DOOA 3A3OA 4X1KB 1HUQA 4UUPA 1FLAA 5J2TA 1J70A 4MRRA 3B53X 1G8PA 2X0JA 3CUWA 4V3BA 4ZQIA 1XK7A 3L07A 2VAVA 4I55A 4C78A 4BDTA 4AROA 1REQA 2VQFB 1I1HA 4H7IA 4Y18A 1T15A 3ZZNA 1QFMA 2GCOA 3HYNA 4JA2A 1EFPA 2B82A 3PYLA 4KW7A 4IICA 4UUNA 3RVRA 4AZ0A 5KYUB 5FNVF 2AXPA 3AETA 2BGKA 4DIFA 3AERA 1EX6A 3HO6A 5IJZA 3O03A 1E9EA 4W9NA 1U63A 3ZHOA 2IEZA 4TS1A 3JAWA 2AOUA 2MSLA 4QSHA 5EKDA 1JG2A 2ECPA 2JKVA 3AR7A 3LHIA 4WK2B 5A4FS 5KREA 1RC8A 4CXMA 1G42A 1KIFA 3BCHA 3PDJA 2G5GX 2P9BA 1L7AA 1BYIA 4J0IA 4ZAWA 3V1MA 4QPPA 4N9QA 4YS6A 5C7YA 5KUTA 1T3HA 3LVFO 3II6X 3NDRA 1YBFA 1RRCA 1VKZA 2J0UA 3NB0A 3LHFA 3NWBA 4Z7JA 1K3UB 1KYZA 3NC0C 3OLWA 4LZWA 1G63A 4OQZA 1DUIA 1EU1A 1BSVA 4EVIA 4HVCA 5KTPA 1ULBA 4MDEA 3GEDA 3HM9A 1NHGA 1DO0A 2J8ZA 3PUJA 2WWGA 1ZJYA 3NGMA 4A9AA 5EGNA 4BQSA 4LJ9A 1ZH2A 4LHYA 1HLPA 3IKTA 4B6OA 3HXMA 1T0IA 1E6LA 2PGNA 1RTTA 5AM2A 2TYSB 3BE8A 3C74A 5IT5A 5LLSA 2RGXA 4I9UA 4KI7A 5IASA 1VSQA 1US8A 2E2WA 2XI4A 4INJA 3D5TA 4F4HA 3H6KA 3IMKA 3N5CA 4CTJA 4YMLA 2ODQA 1J5XA 2AGVA 1QPGA 5EERA 5GY7A 1RYHA 4IDCA 4BN5A 3IVCA 3CE6A 4YBZA 3P71T 3ZM6A 3HU1A 2XQGA 5KYXA 3T06B 2FY8A 3DOJA 2MSDB 5ICFA 1M66A 3H1AA 3W9SA 2MINA 2R3BA 3MJVA 4FQ8A 1Y8QA 5KNBA 3C1AA 2WWTA 1V5WA 4X7BA 5GWXA 5JR3A 2PKKA 2XRMA 1K6MA 1UDAA 2QI9F 1D2MA 2OK8A 3AR3A 2Q7DA 4XQGA 4KPYA 5EY7A 2ZBVA 3LCRA 3DF7A 4P4SB 3ZHYA 4CCYA 5B6AA 4QATA 1W25A 4M1EA 4O4HB 3FM9A 2DFTA 4UQLA 3FYUA 3EPKA 3LXXA 1R0XA 2W93A 1C8BA 1JR2A 4D9FA 4OB8A 2ANBA 2W6CX 4OGLA 5EEGA 3E5HA 3WGZA 1DC3A 1FNNA 2H9YA 2J3HA 4DR3B 3GFSA 5J9FA 4AN1A 4O2AF 2OUKA 2Q4RA 3PTLA 1Y3IA 4EQZA 2QK4A 1T1SA 1R37A 2CKDA 3GQBB 1G20E 3RTCA 2XE6A 3D4IA 4HGOA 4EHLA 5BWOA 1F8YA 3SGLA 1LV7A 3FA2A 4E7OA 4DXDA 4EUSA 1U3WA 4YN3A 2R65A 4GE0A 4UM5A 4UAJA 3VO8A 2WB2A 2P1ZA 3FF1A 1MR3F 2E7ZA 1S2DA 4U3JA 1AD2A 1YRBA 1JTEA 2CLKB 1GCIA 2EBUA 4ND8B 4PG6A 2WEKA 4MR7B 5BNFA 2OZLB 3H5WA 4IG4A 1YS2X 5TQ2A 4B7CA 2AFBA 2R2GA 2ECOA 3DXFA 3PGXA 4R4JA 1RJWA 2QTVA 3LVRE 3DKVA 1G8AA 5F0ZA 2E37A 3RC2A 1C4OA 4JIGA 2GETA 2ZS7A 3OZCA 2NUAB 3KZKA 3PNVA 5TNXA 1BQEA 2G1UA 4DLKA 1ZMOA 2ZG6A 1RQXA 2IYFA 3EHDA 4J2OA 1X1EA 2CNDA 3F6CA 4K9OA 1C9DB 1YSCA 3NTOA 3SZRA 1QE0A 4DCCA 4HEA1 4FXOA 4QTXA 4US2R 2KPOA 5BV0A 4H3SA 3AEYA 4KBEA 4CHTA 5E8RA 2VVTA 1W59A 3ZWCA 4MQFB 1DQSA 5EZ6B 4M36A 3RUFA 1KEZA 4HY3A 4UE2A 1GAWA 2GEVA 1KDOA 1Z0KA 2HLHA 2PMCA 1ONPA 4B4VA 1GXSB 2FVYA 2VQEB 3R77A 1E3JA 2FW9A 1A7UA 1E89A 5I7SA 4MROA 1VYUA 3HA2A 4C6RA 1WSDA 2JZCA 3AERB 2REXB 1G4AE 1ZCFA 4UM9B 3AETB 1JVNA 1PU2A 4G6ZA 4JLMA 4MVJM 4U02A 4V03A 5BN4B 4QRIA 3D02A 4A6PA 2YC2C 3U4MA 3NBKA 3ZCVA 3LLVA 1QCZA 2HPZA 4JQYA 3SC6A 4LX0A 5K3SA 1K63A 2AH5A 3DZDA 2X23A 5EYPB 5KINB 3GBSA 3TRIA 5JY1A 4MUHA 4QBIA 4QA9A 3WL7A 3CXRA 1SRRA 1K06A 4UZEA 9LDBA 2CSUA 2CMDA 1OT5A 1QG0A 4F46A 4YT2A 1N2HA 3PRKE 1GARA 1XXLA 1PIWA 3CF6R 1EMDA 1T6NA 4P82A 4WW0A 5E9JA 4AYXA 4E3ZA 2D74A 3FI0A 5FCDA 1ESMA 2W8BA 2ZK7A 3R3SA 5DYNA 5K0LA 1I6KA 3CUYA 4EW6A 4JD5A 1DAMA 3BHJA 3P27A 3LL4A 2UUCB 4BRZA 5BWLA 1U9JA 2O2SA 1L6RA 3RHZA 3OX2A 3EMBA 2YQ5A 2I5BA 1J4AA 2VPQA 2P6UA 3WSVA 1JU9A 1K68A 1C81A 2Z2JA 1Z7YA 3Q0EA 4HXYA 3U3ZA 2AB0A 3EDQA 1YJQA 4DWJA 4IGKA 1CRWG 2Q2WA 3N59A 4TTPA 5D1HA 3ROZA 3WYDA 1GADO 2Y1CA 5LMCA 4LF9B 5IABA 1NHWA 5IVIA 1FRFS 2FUCA 3C1UA 3I30X 1P8AA 1L8OA 1BXGB 4YRTA 2EJCA 1NQTA 4RTQA 3PHHA 1OFUX 1EB9A 1KI6A 4WZZA 4CIVA 5J47A 1QAMA 1KAHA 5FPTA 4BE4A 3BERA 4B8ZA 9MHTA 2XT9A 2CNWA 1MIHA 3F98A 5TGTA 1C0PA 2C2GA 5CA1B 4EHIA 2AXEA 4JODA 1W2GA 1N8NA 2HA2A 3A3NA 4JVMA 2HYDA 1JLLA 2LVBA 2QRLA 3RS2A 5B3LA 2O19A 3E5RA 2VBGA 3ZU6A 1FDVA 3GDHA 4C5NA 2IOQA 4M86A 4LZOA 1XA0A 3DOUA 4H7PA 4PU0A 5F21A 5FUQA 5LPNA 2HA7A 5JCZA 1P5JA 2A5YB 3FCUB 4R1TA 4BCCA 2YHIB 3DTVB 4I1OA 4WINA 1CT9A 3W3ZB 3GUHA 3NUGA 1KTVA 5I4CA 4DIOA 3CS3A 3I0NA 4QHSA 4M88A 5JE8A 4C0QC 4ZI7B 3EZYA 4HPXB 1NYTA 4JJFA 3U49A 2X3UA 3WIDA 3NYWA 3EGXA 2X0DA 2O2JA 4OEHA 3NUZA 1XJWA 3R23A 4PAMA 1N0VC 1KOGA 3OZGA 4EI8A 3AO0B 3AHEA 3ZNPA 3FKSD 5HS6A 4KG7A 1RYZA 1CERA 1QYVA 2VCYA 1ZUHA 4S12A 4ZYTA 4UVEA 2DEUA 3TFQA 3EGEA 2H5JA 1KF0A 5CA0B 1H2AS 2YMLA 3GDGA 3HI6A 4BGDA 5DHTA 3ODPA 4J4TA 3DULA 3GB9A 3RR2A 1EXDA 1FA9A 2NUPB 3E61A 4CLXA 3LT2A 4M98A 3GT0A 3H9BA 4YHBA 4I6EA 4NENA 5DJ5A 2C5GA 4EVQA 3GD7A 1BKYA 1MQ8B 2G72A 4YWJA 2QU7A 5LM3A 3GGOA 3UHJA 2YVKA 5J3JA 5I9TA 3Q5GA 4MW6A 4Y9RA 2VTVA 4K6CA 5GONA 3STVA 1P2FA 4AAYA 2QNIA 1WLSA 4PZ0A 2V1XA 3KQVA 3ZTTA 3M6UA 4ALLA 3G3EA 3HJGA 4RHUA 4DADA 5IJAA 1TZMA 1WY5A 3K6RA 7ABPA 1WV1A 5JUWA 3NRJA 3U48A 4KAJA 1ORWA 1M5TA 3VVBA 4B33A 5IHXA 4E08A 3W06A 2EFHB 3WFZA 2PX4A 4KZPA 3EFOA 4ZCTA 3A6ZA 2H3EA 1NXSA 2ZPUA 3KZCA 3LDGA 3ZLJA 3F5MA 1AGNA 3DZKA 4AVYA 4ZZ3A 2WNSA 4IG9A 2GM5A 4ZOEA 3VR1A 1DOZA 3EARA 4OMUA 4R1QA 1FUKA 2QX7A 3OCCA 2EKDA 3HEBA 4JA0A 3EA4A 2X2FA 1SR8A 2FP3A 4OH1A 3IAHA 1VMAA 3CQ9A 4L15A 3AKDA 5JSZB 1ZONA 3C7DB 4NESA 1C4XA 5DYGA 3IPRA 2VT6A 4N4AA 2XKJE 5M5BA 4RDIA 3F9IA 3G82C 3KLMX 2QT9A 2WG2A 3D8TA 1MZVA 4YJ3B 1D2AA 3N3BC 1FDIA 4B0OA 5JQGF 4FW9A 1RM3A 1QZZA 1HRDA 1N5LA 2DETA 3ZQJA 1ODFA 1NDQA 3KD2A 3DZIA 5IZCC 4LA4A 1SUEA 2VBCA 4IUYA 3PDCA 3LDFA 2Y4NA 3QE3A 1SVNA 2AD5A 5CGAA 3UB2A 3D59A 1WHTA 2QROA 4QYWA 4KXQA 3EQ8A 1KYXA 1OT3A 3GZNB 5LZ5A 4DMMA 1DBPA 3DBOB 2IDMA 5HDQA 4BNDB 1IXZA 1L8LA 2BE7A 4PG5A 2JBAB 2RJNA 4ZOLB 4DUYB 3KVOA 3WE7A 4Q7KA 1QIKA 1NM5C 4HN4B 3FKQA 4QAJA 4KODA 1IN7A 4GRAA 4B87A 4D0GA 4WXMA 3MK31 1NY6A 1R8QA 1KAMA 4B6SA 1Z4NA 3Q1LA 1TCCA 4DJ5X 3TFWA 4M9ZA 3QFRA 5AJWA 5DO9A 3VAQA 2EBWA 5GQSA 1HPLA 2HIMA 5EP3A 4V2UA 4D9HA 4Q6BA 3KOZA 2YR0A 5C7LO 3EZLA 1JALA 3WTCA 3A9UA 5CXSA 1FBTA 1IK6A 1OXVA 3GLRA 3I76A 5F7JA 4TWIA 1X86B 4OX9Y 1BWPA 1S89A 1GRNA 3VC2A 2WMNB 3OEEA 4Z54A 5JPDA 5DTJA 5LQRA 2JIOA 2YQ4A 3ONWA 3CUVA 3DZCA 4Y0AA 3ETHA 3GZNA 5FFNA 3ZVRA 2RGUA 3ED5A 3DTVD 4P33A 1NONA 1ZINA 2HA4A 3BL6A 2WMOB 2YBDA 1GT91 2Q62A 1GCOA 2W22A 3WK6A 1H1LA 5AWFC 1YZGA 2CN1A 1FNMA 2DFKB 1LWNA 4UM7A 4YMVA 3CPEA 2VXBA 2X0EA 3B5EA 3L6DA 4EY5A 3BF5A 3EPPA 4AUNA 1V9CA 2K87A 2OWDA 3F5DA 1MJ5A 3LC7O 3HDYA 4I1VA 3T6KA 3ZTYA 3ZE2B 3DE2X 1XDDA 1PHRA 1H8HA 4QFCA 4P2GA 2RC6A 3PHBE 1QKJA 2OFPA 1DKPA 3PJGA 2BH9A 1F8XA 1HFKA 2B4TO 2NO7A 2OO5A 1HG1A 1N7GA 3Q15C 3DXYA 3TRKA 2HF8A 4DLLA 3QJGA 4X8LA 3LLUA 3ZCTA 3NDBB 1PJQA 1X94A 2LKCA 4WFIA 5ER6A 3B3JA 1RWMA 3CNEA 1LFAA 3UT6A 2NO0A 5J2UF 4TX1A 3UYLA 2O2XA 4C7JA 4ND3A 3OE1A 2GZ2A 1M75A 2ZS9A 4O2BB 3VPSA 2QIPA 2QTMA 1RJDA 3PNBA 4PVDA 4WIAA 1KEEB 5GM1A 4ZIRA 1G21B 1VFNA 1ZNYA 3RDPA 4O5AA 1CULC 1DEAA 2BFWA 1AKQA 1QIFA 3FDXA 4B2YA 1LPBB 4LXGA 2A3RA 5T67A 3R0JA 5E4JA 1LLQA 3JR7A 3TZLA 5IG2A 3HO8A 4C6TA 2GC5A 4QQFA 4R2JA 3GEPA 2ECKA 3MGGA 1Y7IA 4ZQCB 1STOA 3ZU2A 2IXAA 3MS7A 4Z1MA 2ZRMA 2FZ5A 4CVKA 4LG1A 1XOIA 2CVHA 2VRCA 4DSAA 2XKAA 3EQ6A 1J49A 4LHXA 3FNIA 3GGPA 3JZAA 4KBYA 4U2DA 3CGWA 2AE2A 3A06A 5CLJA 3O9VA 2YCBA 4XDHA 5TX7A 3TLAA 4C4PA 2AM1A 1D2GA 4I4LA 4ESOA 3B51X 1LF0A 2CXXA 3SXJA 3MTIA 1IOVA 4E15A 4MJLA 3QPWA 1J7KA 1MX3A 3I64A 1RWVA 4IDPA 2BKEA 3ND7A 5DCUA 4Y2TA 5KKAA 4I55B 3ZCQA 4C7MA 3LUHA 4PC1A 5BWBA 4I4CA 3MSCA 4HZGA 3GAFA 3EGXB 3KBBA 2HBZA 2AG5A 4QXMA 3AR2A 4OQLA 4CHGA 2A9YA 1J33A 5KJEA 4NYIQ 4XFKA 2Y66A 4ARAA 1ORRA 4JMPA 3EBOA 1OPRA 2FZKA 3OCYA 4ZPJA 1P6QA 3B48A 2ZYTX 4CETA 1RKVA 2KW5A 2IDJA 1AV7A 5ALTA 3UJ6A 2IYPA 3VM6A 3CG4A 1P5HA 1RQGA 2XEXA 1UZUA 2AT1A 3RHSA 3TX2A 1Z7GA 3ZZ0A 1SBIA 1V35A 4EPVA 1L3BA 4M8IA 1A7AA 4KLRA 1SOUA 1DC6A 2FSPA 4BBJA 3QI7A 1XTTA 4UU7A 4KBFA 2PCLA 2NMVA 3LYAA 4U7PB 1A9QA 2GRUA 3D4NA 3KXIA 3PZSA 1TMYA 1X7ZA 1ZMRA 2HDOA 1V7ZA 3HHPA 1L5QA 3GY0A 1TTQB 5F7ZA 3UFBA 1J8FA 3WBFA 3H5OA 1SXQA 1JHQA 1R5NA 2FVXA 3MELA 3JPWA 2ZIXB 2P65A 2P0YA 3E4CA 1GNVA 4WV3A 1X8JA 3DTTA 3CF4G 1VLHA 3H11A 3EEIA 3GMTA 5LUBA 3CW9A 2GVNA 1ZEMA 3JY6A 2NQ2C 3P9PA 1ORHA 1NU8A 3E35A 3I2FA 1T26A 4NS4A 4B84A 4BJ3A 3J7AC 1GTZA 3PLNA 3K0HA 1MO3A 3DNMA 5EVJA 3PQCA 4HQKA 4YLEA 1AN9A 2PX0A 1KFEB 3PFWO 3KVRA 5B58T 5HM8A 1C3JA 3THYA 3LA6A 3NFRA 4CWAA 1RQLA 3BWYA 1AQLA 3QXSA 3GPBA 5FF9A 1N0HA 2OBMA 4L27A 4IIJA 4URFA 5BSHA 4C7OB 4EKIA 2VTDA 2WHYA 3IEMA 4Y6OA 2ZJOA 1OI3A 5FPHA 2G82A 3RYTC 1QP4A 2QEQA 3MFQA 4CTNA 5G41A 1JSCA 4LOJA 1CB0A 1F4PA 4UREA 2QG6A 4CDRA 3CC8A 5INTA 1LLCA 1YIOA 3GMIA 3CLUD 4M1SA 2JEZA 2P2LA 2Y2VA 2A35A 5H81A 4ARUA 1W29A 3M5PA 1F0PA 2GKGA 4K40A 3TL3A 1DUSA 1E6MA 1BU8A 2XIJA 3EG5A 1PW5A 3DW3X 4WA8A 2M6SA 4EQ6B 1N5MA 3P2IA 1ARZA 2IW1A 2UXCB 1E4YA 2Z9CA 4IV0A 5EZYB 1TGYA 2ZKLA 1DWPA 2TS1A 5CEEA 1HR0B 2IIBA 1IN6A 3OPYI 2X77A 3H83A 1DKOA 3GH1A 3RKSA 4E5UA 3RJ5A 2VOJA 3MJEA 3T61A 4ALNA 4EOGA 1P5RA 1FTNA 1ZUD1 2APJA 2WKPA 4G01B 3UJ8A 3B5JA 3ZHCA 4AJOA 4P8RA 1PZHA 1JLHA 4OAQA 4UE6A 4BNKA 3IV9A 3M6VA 3NX4A 1CDOA 1KK2A 4IWNA 1SHKA 5EJGA 2KYRA 3AHJA 3K1TA 2H5LA 3FUTA 4HBGA 2NO4A 3D7NA 4EY4A 3EX7C 2JNWA 3PQ8A 3IYLW 1E66A 1EK0A 2BHTA 1W5AA 1AQ6A 2VHTA 4FW8A 1G5RA 2GTIA 4K6GA 2CF5A 2RHTA 2ETVA 1K6IA 3GCDA 4LYEA 4WNAB 2WY2D 4HXFB 5BW5A 4N18A 4W5OA 1S1CA 2HJWA 1CS0B 1M0WA 4EY3A 4F2HA 1ECLA 1YL7A 2A8YA 2ZEJA 4NMWA 4W1QA 2OP1A 3R09A 4DU5A 1T6YA 4YXWD 2XY4A 3OKPA 1MIOB 3OZWA 3BCRA 5DI3A 1UT8A 4WPGA 3L0OA 1ZITA 2P40A 5CH5A 2IODA 1C3VA 3RIEA 4F91B 4RJLA 4Q3EA 2ZTMA 1KJQA 4BFZA 4YDQA 3ZDYB 5MDHA 2Z30A 4FWTA 5DTMA 2B7CA 1HLFA 4H1UA 1DV1A 1CDZA 1SVKA 2VT2A 3HYOA 1YB6A 5HKAA 1E3LA 4U2KA 4WSOA 4PR3A 3T34A 3CH7A 3LW7A 1KMQA 2D3WA 4K9QA 5SZKB 1M2HA 1WWKA 4JB0A 5DGIA 3L6CA 3T3HA 5DWQA 4XR4A 1VL5A 2G5CA 2HHLA 2N1BA 3KPVA 3SLKA 4OUKX 3D0QA 1PT6A 3DCNA 3CLKA 3O4VA 1V8ZA 1K4KA 4DC0A 2D2EA 2ZI6A 4G8DA 3VPXA 1XDBA 3GNQA 1VG0B 1WDLA 1WM1A 5CLFA 1I4TD 4PYMA 4BU1A 1EJ2A 3A9VA 3UBMA 4WXEA 4XM0A 2P78A 1MIOA 4FDTA 4FFSA 1D2RA 1EK1A 1USVA 2J9YB 3K1AB 3ORSA 3AF1A 1HQCA 5G3ZA 4F3RA 3TQQA 3GBUA 3GO6A 1GLNA 3W2GA 4LXYA 5E8JA 3WWCA 3CO0S 2DYKA 2NACA 4GM0A 3KB1A 2FPPB 4P1ZA 3WQSB 4MYCA 5KQRA 3J81A 2H8KA 1UF9A 4Q03A 3UQEA 2NP7A 4FU0A 4GOJA 1X8KA 5JZ9A 4QJ5A 4IH9A 4NDNE 3MIIA 4OBXA 3LXRA 1X7DA 2CYCA 2VARA 3JQGA 2G0TA 4L7VA 5CXUA 2FSHA 1J2YA 1F9EA 5KSOA 1II9A 1NJ1A 5CT5A 4W5RA 1LNQA 2GBPA 5LIRA 3D3EA 3KD3A 4G86A 1JXAA 1F8FA 3MT0A 1CUSA 5F2EA 3GUYA 2J9RA 4RJKA 2YC4C 5L4LA 4GKJB 4CI0B 1HMYA 4RUKA 3TK1A 3QX8A 1RRVA 2M1ZA 3L7CA 2EGGA 1RMTA 3JZIA 3GWZA 4PVCA 1LX6A 4IGIA 3K9WA 1O6ZA 3JRNA 1MTZA 1W6RA 1TRHA 2YOHA 4HP8A 4K9MA 3VHXB 3MYRA 1Q0UA 1LPSA 2A33A 3CRMA 5AOAA 1TLLA 3PEEA 3PQ4A 5I5GA 2VH5R 2I7CA 2YN0A 1T4MA 3U4QA 3LF2A 2XZOA 5C8VA 3VAAA 1SIOA 3O4HA 1T2CA 4W9RA 2XNDA 3C3AA 5I7FA 2WF8A 2PUGA 2NU8A 4X8FA 2QD4A 5HQJA 5AUOB 4S3MA 4QWWA 1DBRA 5A9RA 1V8OA 2QSJA 4MK4A 1IPEA 3LP8A 3OZSA 4HS9A 3W4SA 1IY2A 5A9SB 1EVYA 1P72A 1VP9A 1J2UA 4Q4HB 4LYFA 2DMRA 5IYZF 1YTLA 1OIXA 1EFUA 1KDRA 1YQQA 3GRCA 2DR2A 2MU1A 3NC2A 1JIVA 3FETA 4FSDA 4N49A 2YV1A 4IIJB 4G1VA 1H0RA 1CR0A 1KK1A 1Z5NA 1ESZA 3UB3A 2DPLA 4QQRA 1T91A 5KJCA 3LQRA 5BR8B 5EJAA 5T8KC 1JHVA 1EAYA 3AUUA 3IULA 4XASA 3IQHX 4GX0A 1MEOA 2CLLB 1PWYE 1ECFA 3VNUA 2Z2XA 3OURA 3K5IA 1WCV1 2HF2A 4B76A 2WF9A 4EDFA 3R6WA 4MRMB 1CY6A 1OA1A 5LA6A 3X0DA 3GAMA 4WOKA 3F1KA 1AXEA 4TXNA 3GLIA 2F1RA 1LLDA 1CJUC 2B37A 3AKYA 3E5MA 2O8NA 2VAXA 5D86A 5IXJA 4OYYA 4K93A 4O1LA 3PF8A 2QYOA 4TMVA 3ESBA 1J0CA 4OJTA 2WHXA 3RC1A 5B7PA 1O4WA 1XE3A 4IKOA 4Z8YA 4C5CA 3BG5A 3BT7A 1SA0B 3QVTA 3RK1A 3DFIA 2VZLA 1GRVA 2JJMA 4WMLA 3IV7A 1EFPB 4CIWA 5ESXA 1W94A 2FWRA 5AI4A 1P0IA 2H51A 3KQLA 3CF4A 2CNWD 3OM0A 4LFBB 1BE0A 1E2UA 4QUBA 2OOSA 2R8OA 5I7HA 2RH5A 3QE2A 2ZXUA 3DEFA 4ZCLA 3K0BA 1UL1X 1V6SA 3GFOA 5FTMA 3AJEA 3GOQA 4QIHA 1UWCA 2FFBA 4GOND 4DCVA 3N2AA 5CFNA 3GFGA 4NFLA 2JB9A 4J1TA 1DC8A 1Z07A 2WWWA 4BNJA 4E07A 5HUJA 1Z22A 3JQ8A 2AI1A 3A1CA 1L5NA 2OKGA 4C89A 5C37A 3OVMA 4UTOA 2AEJA 1IY1A 2FG5A 3LAWA 2IHJA 4IDEA 4NXNB 3IV6A 3KQTA 4F12A 4FFWA 4Z0PA 2Y0DA 3SIRA 3QX3A 4KQJA 3UGQA 4XF6A 3KKQA 4FX2A 3KETA 4OX9B 2D5BA 2WJWA 3P9CA 4LC1A 2QTWB 2EATA 4MPPA 1E1QA 3U4IA 4JAVC 4LHEA 3F74A 1N6NA 2FJUA 3JD1A 3OLZA 4RKFA 2WHQA 4ZPXA 5EXEA 5FHRA 3RUEA 3S6JA 3UJCA 3ZVMA 1LPAB 2O8DA 2QCVA 1ESNA 2REOA 1XO1A 3A26A 1TA0A 1TTPB 1Z15A 1FUYB 1VKJA 1SQGA 1WDKA 2VYVA 3K73O 1EDDA 1NZJA 2RGBA 4LCEA 3T5MA 8GPBA 1CF4A 1F8GA 1KSJA 2C00A 2F3UA 5AW2A 1Q21A 4YJ2F 4C07A 4K9CA 4FEYA 2HMVA 4J1TC 4MUKA 1PEAA 4IQ0A 3JWEA 2J32A 2ZUSA 3MWLA 4FMDB 4PHGA 1O9GA 1QPBA 2ZDQA 3VSBA 5E1MA 5L3SA 2JIZA 4IQGA 2XKKA 3VYTB 2AOVA 3REOA 1UEJA 3SXUB 5AXAA 3LF1A 5JWOA 2IYEA 1WZCA 1S2MA 1M2JA 1P2UA 1OHHA 2C8JA 3DRWA 1LPPA 1SPXA 4K6HA 1JR6A 1S2IA 2VAWA 3I8XA 3G2JA 3LUBA 1V6AA 1XZGA 3DD1A 1QS0A 5LJLA 4WZAE 3FLAA 1N2GA 3HVJA 4BUCA 2JHPA 5CPFA 4Q6WA 4N54A 5I7VA 1WIWA 3PD0A 2JPDA 1KIMA 3ONNA 3WIUA 4U2GA 4P92A 3GP5A 5AUNB 4O2BA 1IBLB 1MORA 3KJHA 4PHFA 4UBLA 4XI9A 4C5JA 1KWKA 1WZNA 2PQ0A 3RC9A 3SKVA 3EJWA 5K1ZA 521PA 5B36A 2XOEA 1MAVA 3O8BA 4EECA 2XJ4A 4J0HA 3L7AA 1PFYA 1TDJA 5J5VA 4BNVA 2HXGA 4ZVKA 4BECA 2QRUA 5F1OA 1NBMA 1DAIA 3N2YA 4II2A 3PG5A 3C6XA 1KJJA 3GCWA 1QP7A 1PDVA 2OY0A 5KTYA 2ZPTX 3J81k 4YY3B 1OVMA 3I8OA 1OZAA 1YL5A 1NRWA 2HWKA 5JATA 1M2OB 1UJMA 3B7PA 5C4IA 2COKA 4C0XA 5LUAA 3RRJA 2QLLA 1JQAA 3D81A 1PO7A 2P75A 2QRVA 3O82A 1S9HA 3C7AA 4K46A 1ZVVA 1AGYA 3PDUA 2B94A 1J2RA 1AGXA 5C8XA 4FNMA 5ALXA 4WBNF 1Y34E 1L3IA 1U2PA 3OIUA 3VMMA 1HK7A 4R01A 1YVDA 5HG0A 3KQSA 4LKRA 1RM4A 5IM4F 1L8XA 3ET4A 3ZE6A 1BXRA 1M8GA 1UJ5A 1XKLA 1I10A 2AMLA 3LPAA 1EDOA 4FFDA 3IDFA 4MR9A 3C87A 4NFSA 1VI6A 3TD6A 5IKMA 2G71A 1NJ8A 1OV4A 1V71A 1X1BA 3AF4A 2NXNA 3KEQA 3PNPA 4MWCA 4Y0NA 2VP3A 3ZNOA 4CTMA 2A1UB 3PHIA 4BX9A 1Z6GA 2BKUA 2JGJA 2Y0EA 2VP5A 1P1IA 2HDNB 3ZWXA 1L5WA 3HNOA 3I5UA 4MVWA 1U65A 3IN1A 2JH8A 1XGKA 5BNTA 1TJPB 3NP9A 1MGOA 4P86A 4QOIA 1A95A 3ER9A 4ETMA 5LMNB 2A1TR 1JW9B 2JG1A 5TPWA 2JK1A 1VIDA 3O3CA 4L4XA 2IU3A 3GA7A 3PC4A 1S3IA 1OX5A 1X9HA 5K09A 4XCVA 1JBWA 1V0JA 3NAMA 2R1TA 4TUYF 1QC5A 4EJFA 3GGGA 4LRSB 2OV8A 3I52A 4TTQA 3TKAA 3EH1A 1NBHA 3QLUA 3HU2A 3IO5A 3BMCA 4GDMA 5LR6A 3DUWA 4JUBA 5THXA 4D6YA 1JDBC 1Q3KA 4Q9LA 1IOZA 1TW3A 4EI7A 1OH7A 3ZX4A 1T2VA 3PNMA 3A1FA 3IEUA 4U0JA 2DVMA 4W5JA 4MYDA 1R4NA 4UAUA 4L6IA 1LI7A 4R0VA 2GQ0A 3WSWA 4HBZA 3M9XA 4NAUA 5IXYA 1MJFA 4HLCA 4A27A 2GCAA 3CKYA 4JSYA 1G64A 3E9YA 2V9CA 1RAGA 1ISFA 4YAGA 2G06A 1DTEA 2Q5OA 3WK4A 1MX9A 1OAOC 4HGPA 4KQEA 3GJSA 3PGKA 1KH2A 3TOVA 3ZD7A 1QKIA 1GTG1 1XP5A 2J0QA 2OKCA 4DANA 4QYIA 3IVAA 3C7CB 5F2KA 2VTBA 2CEKA 4AUEA 2YWDA 4BBZA 4CT5A 3LOOA 3E84A 3VX4A 4Z7NB 2WM3A 3LHKA 1TM5E 3OX1A 3T7SA 1GZ6A 2Q6LA 3KYBA 2Q99A 1Y5RA 4LFAB 1WCYA 4S1WA 3B1JA 4Q1BA 2ZBPA 2C9YA 3T95A 1P33A 1QO0A 2B6NA 1JVSA 3IVRA 3GFVA 5A5DA 1SRQA 3KVYA 3RSGA 4LCBA 4N9WA 3B9QA 5HZGA 1Q19A 3B1PA 4PC7A 4HSEA 1ISHA 1O0BA 3N0XA 3QMPA 4DUPA 2XGGA 5DULA 4E88A 4I3FA 1DKRA 5JLJA 2WWXA 3AEUB 4RZSA 4WUVA 5GTDA 3I1IA 1CRLA 1XR3A 3BPSA 1YZLA 4JOCA 4KEAA 4REQA 3R8CA 4Y1RA 3CIOA 2H4YA 5CB4B 5JSUA 4C06A 3EDYA 1E1NA 1XFAA 1P3DA 3SM9A 3QNUA 1YFKA 2IITA 1ZNWA 3HVIA 4YJHB 2OP0A 3H05A 1NJFA 2I2FA 2IV2X 2EDCA 4O4LB 4FDUA 2Y1LA 1ZM2A 5FOWA 3RYFA 4Q4JB 2O3TA 4J0EA 2NVWA 1XQXA 3CZ5A 1WB9A 4IINA 4C30A 1QGED 3ZG6A 1O94C 4K87A 2RKWA 2X8JB 4P08A 1NQUA 4N3CA 5JW6A 1XZCA 4EHHA 3L1UA 4L74A 1IG0A 4OQNA 4GEGA 4TTSA 1N6RA 1TCUA 3GJ5A 4HRYA 1AU9A 1RNLA 1SZDA 2WFZA 3SX2A 3DE5X 1VPEA 2DHRA 2JH3A 3D43A 4PQEA 4YROA 5FA8A 2Z1NA 5CD9A 3K2EA 4XW2A 5J4LA 2XCTB 2DF8A 3E3MA 4L4UA 3WK9A 5JROA 4Q00A 1UEIA 3IQDB 2I4NA 2VH2A 1TZBA 3NCTA 4L08A 1M2KA 4WFQA 4Y1RB 1XHLA 5EJ8A 1VL6A 2WAXA 1YBHA 1W85A 5K6AC 3S27A 2ZI7A 1F1BA 2QAIA 1E2DA 1E32A 2PLFA 3BGIA 5DLDA 2IV3A 3TNLA 3VHLB 1E2EA 4FILA 3W4KA 1TZKA 2HRZA 3GA0A 5K3CA 4CKCA 1SC9A 5DTQA 3G68A 4MJ7A 5C18A 1JZQA 3GEEA 1D6JA 3IUQA 3FBGA 1ORTA 1KBZA 4D42A 2C0QA 2DJIA 4JQZA 2VKTA 2F1JA 1MB9A 1S2LA 3A1UA 3BAZA 3HR8A 4CQMD 1ISMA 2G77B 4LYAA 2BH2A 5C0OE 1B15A 3H5NA 3PQDA 4YPFA 3MJ4A 1JU3A 1PT8A 3A70A 4I46A 3GUUA 4NOLA 3FTFA 2X8BA 2DULA 1EUDA 2HF9A 4BQIA 1NRJB 1NUAA 4G0UA 2OBLA 2ISSD 5TDHA 4E5PA 1W8DA 4MDYA 3Q87B 2ONKA 3IXLA 4F5YA 2RI0A 1FZQA 2HIGA 2J6CA 3QOXA 4NYJQ 3F6BX 1QC5B 1NXOA 5AVOA 3JQQA 3Q2IA 5FUYA 1YF3A 1XSEA 3OTQA 5FI1B 1NAIA 1NTRA 1NOIA 2VT7A 1HTBA 2JS7A 3LU1A 4YQEA 1I2AA 5TQVA 4TS3A 5IP5A 4CM1A 4L16A 3LP6A 3PYXA 3W34A 3VJRA 4KK4A 4KX3A 1I8TA 2X1MA 4KWHA 2QN6A 4ND2A 3T12A 1G291 1BAPA 1WCIA 3MEQA 4RFLA 3DOHA 1Z3IX 2ATVA 1R4NB 2CNLA 2OQ2A 3JQ9C 2O1XA 2QXTA 4O0MA 2J3DA 5G0SA 4BN4A 2YXLA 3KFVA 3S8MA 3GP8A 2YNMA 3WWOA 4JLVA 3C41J 1E1DA 3N05A 5JD6A 2D0IA 4GOXA 2EBHX 4BBPA 4DR7B 1I4DD 3IAM6 1AB5A 3BMCB 4FFMA 4MGKR 1JFFA 4ZGWA 1C2YA 4YYZA 4RNDB 4UEJA 1S2NA 5BNZA 1Q7BA 2B4KA 1HT3A 2WA2A 3LZDA 5J5CA 1EUQA 2C4EA 5ICEA 3PTZA 1W73A 3V2UA 4N1AA 1F17A 3NPAA 4KVGA 4Q21A 3OX3A 4DNPA 5H5JA 3CUSA 4PNEA 3S99A 4C4SA 1T9ZA 3JTMA 5KZMB 2B2XA 3SF0A 1UMBA 4IBOA 4P4LA 3ADBA 4QXPA 4P22A 3JALA 1U9IA 1N7HA 4YL5A 4MWGA 4W5QA 3JQ9A 5HM6A 3B1XA 5D6OA 3HB5X 2XVMA 1JEQB 3Q7RA 3PNKA 4I5FA 1LBIA 2ODWA 3LP5A 5C1IA 2HNKA 1DADA 4YDRA 3HBLA 1P1BA 1LSSA 1GR0A 4PQYA 3MCWA 2EP5A 3W6NA 3BRSA 2RGWA 4HGNA 4JYCA 3H18A 5I3ZA 2F9LA 1L4MA 2XNCA 3HR4A 5FJIA 3TZEA 3C3XA 1CC1S 1OCEA 4H7HA 3ZW8A 4XVUA 1A8HA 3AP2A 3R7WA 5AHKA 5LZ8A 3SQMA 1CKEA 2B35A 5J4VA 5EHZA 2NO9A 2NUAA 3LIIA 1R0WA 3DE6X 4EB0A 2DDWA 1VPVA 1N57A 2O2GA 3IODA 2GBGA 2RBGA 4U7HA 3UMVA 4D8UA 4I6JA 2OD9A 1PK8A 2PUBA 5EYNA 5F5LA 3CTPA 1F0NA 1UDXA 1AO3A 3CMCO 2FWAA 1W4ZA 1JKIA 1T2AA 1BQ4A 3KUCA 5A3JA 3TX6A 3ROFA 3KJQA 2WF6A 2RSLA 3ISVA 3IE0A 1UAYA 3NDIA 3L6BA 4IXWA 4AMBA 2Q0HA 5K3FA 1K8ZB 2E3JA 1QU3A 3WFJA 1N2IA 1Y63A 1N0WA 4XWTA 3TMYA 3ESRA 1JT2A 3P9YA 1B14A 1U4NA 1X1AA 4EO7A 1UBUS 5B3JA 1T5IA 3DO8A 2FEAA 3RE1A 2WZBA 1GN8A 1U5AA 4DA6A 3DNPA 3K6JA 3R6TA 1FFXB 3F4LA 3CZRA 4AMYA 4BX0A 4ZI7A 2IUSA 3H9JA 3UJAA 2XQKA 3P0RA 1C7QA 1ZJ6A 2JLRA 1DELA 3F5FA 3O38A 3ASVA 3R76A 2OV2A 1Y1LA 2B2CA 2BOVA 1R6AA 2OV4A 3D6UA 4NABA 4X94A 1E99A 5G1NA 1CRPA 4YP6A 2XOKD 4KALA 3BMNA 1FMJA 4BCBA 1EVZA 1GUZA 3RTAA 4ZP1A 4AULA 5A1TA 1ZPDA 3ORFA 4IVQA 2HQSA 2I22A 3D31A 2F4NA 2W2VA 3B1RA 5JWHA 2FHSA 1FLDA 4CL2A 3GRZA 4HAUA 1QTNA 1JFSA 2OV6A 5DMHA 1EK5A 5HIIA 5ULLA 4KLAA 3VDRA 1RKDA 1EE2A 3J7TA 1ZLYA 1LU9A 1D04A 4RLSA 1OXXK 2ETXA 1A5BB 2XB6A 4X3CA 3LCJA 4E51A 3MWEA 5HUQA 1NOJA 4IF4A 1MC5A 2KJQA 2PANA 1DAKA 2BGJA 2FDXA 1GNSA 2FV8A 3K20A 4G8BA 4N40A 3G0OA 2G4LA 4Y9UA 2TMYA 3FIUA 1E2NA 4D3FA 1ZN8A 1GYRA 3C3WA 1VBKA 2W6JD 3DNFA 4G37A 5BY2A 4CEIB 3R20A 4ZT2A 2JGLA 4V2IA 1ORVA 1QR6A 4ZT5A 4DR5B 4KXNA 1DQZA 3ROKA 2GKOA 5C81A 1KJIA 3NNDA 4RW0A 4I4NA 5EESA 4OG2A 4ZCPA 3C7TA 3BTVA 1F06A 2RMKA 1W1WA 1U1EA 1LRKA 1X9GA 3T9CA 5CTAA 2H0RA 2IS6A 3ND9A 2PS3A 3KAKA 4J0JA 2KSQA 4F4DA 3SY8A 4WOCA 2GK6A 1RHRA 2QQGA 5GV7A 3RTDA 1FYFA 1AY0A 1NBWB 4EMBA 2CXUA 2E1PA 5KTNA 4EHKA 1BJRE 1IHUA 2X2EA 4KDRA 3WIBA 1FMFA 3SYNA 4QPNA 2ACKA 3DDHA 1XNQB 1T5DX 1TD2A 4BKPA 4CEJA 4KYVA 2FP4A 5AJXA 3KL2A 3LQYA 2DFVA 1PQ4A 3RO4A 2JC3A 2RAUA 3LCUA 4GPAA 5I9SA 4WERA 5K05A 1JP7A 1CQWA 3TGLA 5FFMA 2JIRA 4NBUA 4AZ0B 1JL3A 2QJWA 3P2KA 5JTUA 3KVVA 1A9XA 2ZJ1A 1QK4A 3TZ6A 2PHZA 4LZJA 5I9IA 4MYSA 2IUUA 4EJMA 3OU7A 3PCTA 3H1BA 3HB7A 3QTTA 2GSDA 2QQ5A 4O4JF 4RLFA 1USUA 5I7EA 4S1MA 3KR0A 4AG5A 3A1SA 4KO8A 1VECA 4Z4HA 2DY0A 4U1RA 1XCPA 3C0KA 4WJZA 4EZEA 1M2OA 2BHNA 2B34A 4UXIA 1WXIA 2PK3A 4LXQA 3GYGA 3RLFA 3S2SA 4ZDIA 1Q1GA 1KR2A 3LVBA 1PZEA 3K8QA 4ILEA 5KVAA 2VK2A 4FMPA 4H27A 1WBDA 1H2FA 4BP8A 4GEKA 5CLGA 1WBJB 1HO3A 4ZZ2A 4BYMA 1RXYA 2ZJ4A 4FD2A 3CW2A 2O52A 2R8RA 1J7JA 2Q4DA 3K4QA 2WVAA 4M8SA 4BFVA 5BYFA 1O6BA 1IZ9A 3KKPA 4BQNA 2QDKA 4PLVA 2HV8A 2SCUA 1Y3BE 3E7DA 3B7WA 3FCEA 4LJSA 3EWSA 5CVCA 3X43A 1C3OA 5J40A 2EKQA 3K8OE 5I7UA 2VTEA 3N6VA 2WU3A 3OMWA 4KTTE 3VDQA 3R8FA 2F59A 1Q3TA 3DZ8A 5KDLA 4OSOA 3TJZA 1Z5WA 4HRVA 1E6EA 3WGYA 5JC8A 1U9ZA 2IHNA 3HB0A 2VSFA 3DLAA 3M0EA 4UAGA 1NBAA 5IAOA 4ZCRA 7YASA 4K6MA 3OF5A 1XZKA 5B1SA 4LZPA 2JAOA 3OPYB 1XKTA 1VLVA 3ILYA 3ICCA 1JG6A 4R8LA 2FPPA 2Q41A 4I50F 3D7RA 3IHKA 1PR9A 5JNUA 2I2WA 2QKYA 4RABA 3ZHZA 1NVTA 1QIDA 3ZHBA 1RPAA 2LXNA 2JHCA 5ITWA 1FLNA 1KFJB 1K7CA 2K2QB 3U6BA 4JUFA 4KMRA 3IP6A 3WNVA 1SMKA 2JHAA 1OTHA 4NATA 2QYHA 2IS1A 5A3RA 3CBGA 5JDCC 4GPD1 1O89A 4P4TA 1ULTA 1ZKDA 4DBZA 2O7NA 4F9GA 1SUBA 1RI5A 4GMKA 4I1YA 4UNPA 3LDHA 3F90A 2CLIB 1APBA 1JZSA 3QITA 1KU0A 1RCTE 3GELA 4GICA 4MVYA 1Q0RA 2V0NA 1WDWB 2I4MA 2HIAA 1KHTA 1VHLA 2UUPA 3FWPA 4KJXA 3U37A 1EWQA 1YZYA 3R3YA 2C2WA 4TLDA 3AR5A 3ZGLA 1K5DA 1X74A 3LL7A 1XELA 3FSGA 5ALLA 3ZPXA 2O14A 2B7LA 5EP4A 1IXRC 5BSMA 4JT2A 2P4UA 2VPWA 4RO0A 3LOUA 4WL0A 3WIEA 1U3FA 2IXTA 4CVMA 2AR9A 1K6XA 4JT8A 5U9CA 1KQOA 5GINE 4NONA 2WD7B 3F0TA 4BP1A 4C2BA 1RLIA 4FYIA 1DHTA 5CCXA 4V1CA 3ORHA 2EFDB 2EW1A 1EM6A 4X95A 5EIAA 1TL7C 2R62A 2P4SA 4ZKDA 4PYJA 3TMAA 1BHQ1 1DIHA 1QRRA 2H4JA 2RHHA 5DV9A 3O7WA 4CUJA 1XXHE 2Y05A 1ZGGA 3H04A 3P0JA 4DCPA 2ZU6A 1YBAA 2I4LA 1QG6A 4FS3A 2PZKA 3AEQA 1PGJA 3OCWA 5EY5B 4B47A 1XDSA 3QG5A 3P0IA 3UV3A 3ZH2A 5K6RA 2ZJYA 2F3SA 1G18A 3RSSA 4LRWA 3IAS1 2SKCA 4B6PA 4QVGA 2HHAA 2VAMA 1N36B 2F7KA 3HCPA 4QE3A 4G5QA 4RDCA 4A0QA 1YZHA 2PLAA 2GZRA 3DVQX 1XX6A 3EDOA 3MMNA 4UHCA 2ZIGA 1ZNXA 1WCWA 2C4MA 2GASA 1KP3A 1P75A 1T25A 2JVIA 1ZD3A 4BMVA 3GF4A 4G0VA 3AI1A 1O57A 5EZYA 1GP2A 2QUHA 4JC0A 3TN7A 3U7HB 2ZSBA 3WWZA 1KVUA 4OYRA 2ZVQX 2BTQB 5FWXB 3LOPA 4G63A 4DCNA 1R5JA 1KMHA 3VI3B 2VDKB 2QUKA 2JIPA 3B9PA 2AK2A 1GT6A 1DRUA 3H5RA 1W4AA 5A9SA 2VRWA 2AF3C 1EPUA 1L7DA 2BEWB 2FV7A 3ZS7A 3QIAA 3UNXA 1JEJA 1KQGA 4Y2YA 3E53A 3LT0A 2J3MA 4U00A 1WTCA 3A4MA 2DFDA 1K89A 1LC0A 1YQDA 1C9MA 2EX1A 2YWXA 4OLHA 2QB5A 3WYGA 1M1YA 2ZAYA 3PIDA 3THWB 2O6LA 5C8YF 3AUSA 3MD9A 4N5NA 4GP7A 1PQWA 1JQ5A 5JARA 5MF6A 1UBEA 2SKEA 4HYQA 5FXMA 5DTRA 4JXKA 1WXGA 4WLOA 4AN0A 2Z83A 1TYZA 1F48A 1V2GA 5HTKA 4K8PA 2OGSA 1JSXA 2ZE8A 4EF6A 2AMVA 3WZMA 1WG8A 4CFYA 2HWXA 2VHVA 4YA6A 2BHRA 2QENA 3PHLA 4O4IF 2IOFA 2OOKA 1H2XA 3BXGA 1L4GA 4UBOA 1J0AA 4O2AA 1O6FA 4P4NA 1XNHA 1GPWB 2YHBA 2O3UA 3CINA 1XDGA 4KLCA 2YJGA 5BSEA 3IP3A 2ECQA 3VYSB 1E9RA 1FRNA 1M0SA 2VJLA 4GP6A 4GOOD 3G8DA 4CEHA 4PHHA 1UK6A 3C3KA 3FGNA 2WFMA 2BR4A 2W37A 4YJGA 3BL8A 5CFRA 3FZQA 3AUXA 3PRJA 2AUTA 2PPVA 5LXTF 5BQPA 5C35A 4OHBA 1N3IA 5CM2Z 5FH9A 3W77A 4YV2A 5CBKA 3TIIA 2BFDA 3ODGA 3NP7A 3KE9A 1QAQA 4F72A 4DREA 1W52X 5DBEX 5IBPA 1Q11A 1WUKS 3VSEA 2IE8A 4Q05A 2DE0X 3ESDA 4CNBA 2CNNA 4D4GA 2XAAA 1ZK2A 3NDJA 4GMFA 4B79A 3NEJA 4MQ4A 5C5DA 1IWBB 1JILA 2BKVA 1W5FA 3GEMA 4NFYA 2AB8A 1OXBB 5JNSA 4XWOA 3FMFA 2XNHA 2NTEA 4URVR 3FNQA 2REBA 3AXSA 4RH0A 4G0MA 4GOKA 2IVFA 5TQJA 3RJTA 4TVSA 4FHZA 3IURA 4UMFA 4LDZA 3BA6A 3SD7A 1N33B 2FPGA 3NBUA 4DARA 5H83A 1WQ3A 4LOKA 3VDXA 1J24A 1Z9BA 1L4EA 3AVQA 5IYZA 3HFSA 2YW2A 4IJ6A 2EQAA 2ZSEA 1R4MA 2GPBA 3U3OA 4AZSA 4NOJA 2HHHB 4HRAA 4BUBA 5C40A 1PLJA 3H7IA 1CS0A 3CJTA 3TLGA 2IF2A 4DEXA 3PZBA 4LSWA 4BIMA 4C3UA 1FMTA 2OCIA 3UCXA 4G0YA 5K2MA 3PC8C 4U7WA 5CK5A 4RL4A 5L7YA 3SNKA 3KYDA 1GUFA 1DJNA 3CLSD 4Y2GA 1OLUA 2IEGA 2QM3A 3R7WB 4N41A 4OKSA 4RIGA 3RU2A 3V7UA 3CX7A 2QMZA 1PWXA 4Q9HA 4HNAA 3E9QA 3H2GA 3G2HA 1O08A 3WKCA 5D7NA 4FB5A 1OH6A 2C2HA 3H2JA 3HYTA 1BEEA 4BTVA 3MQFA 4MULA 2CXHA 1P2VA 1RMQA 2PRSA 1OROA 3AESA 3KR2A 1E61A 3BS4A 3NBXX 4B3CA 1GG9A 5KS2A 4JXXA 1E7MA 4ZXPA 3IB6A 4X7PA 1U0LA 3H5AA 4FGKA 4MIKA 4DF3A 3VZDA 2GBCA 2G04A 4KN9S 3CTMA 1G7SA 3OTIA 3NTUA 3I6QA 1KDZA 2PVPA 1Y7LA 1CTQA 4RE6A 4C4AA 3NFYA 1EFDN 1TM7E 2WUDA 4BPBA 1T9BA 3R1IA 4EYOA 1E6UA 4WNYA 3E0QA 5CUQA 1KZHA 5F12A 4ZAGA 3WQRA 1JE1A 3D2CA 3WI7A 2SKDA 2PU5A 4ARBA 5C8YB 4V0KA 2F90A 3ZTWA 4D4LA 3RQQA 2RH4A 1G59A 3OPMA 5C53B 1TUBA 3QPUA 3CNOA 3G7SA 5IF9A 1UXGA 1WW3A 1T6ZA 2IGTA 3EWIA 1M34A 3B3FA 1UB0A 3RC3A 1WP4A 1LBQA 1ZVQA 3CNLA 3LY9A 3HO1A 1N8TA 2Q4OA 2EW2A 3R9XB 1Z8FA 3PT9A 1VL8A 2VZ0A 5EIWA 4B4OA 2ALJA 1N6LA 3BRCA 3L6OO 5MN4A 1RRKA 4XF7A 5K3AA 4ENUA 1I0ZA 2HK9A 4RTRA 4HNRA 3FE2A 3CLTC 2RG1A 5TJHA 3S29A 1EI9A 5A3VA 1PS0A 3MMPA 1U04A 3G6WA 2GDZA 3BFVA 1F6WA 4IVRA 3M9WA 2F3RA 4D3DA 4Z0TA 3VKWA 3MTGA 4B7XA 3EDMA 3C45A 3KTDA 1U9CA 5EUMA 4PPNA 2PUCA 1S1MA 5CVJA 3DKPA 1Z36A 2B1RA 4FMDF 2VPPA 5E0KB 2PH3A 4MHOA 2NTJA 2V4ZA 2GB4A 2ZIXA 4EPXA 3R5KA 5TGDA 1DO2A 3OF3A 3N2KA 3PDIB 3BIFA 1TCBA 1U8XX 2W2PA 5FWNA 4KU4A 3AGQA 5BOSA 2W6ZA 1CHNA 4J0CA 4D3ZA 4PC2A 1N1EA 4MVJG 4AG3A 4F85A 3S1LA 2WMDA 3LBIA 3U5TA 3JAKB 3MGAA 1VL1A 1ZH4A 2XA9A 3DCYA 2ZT6A 5DM1A 1I33A 1NBMD 2PKFA 1HDOA 1YNSA 1K5HA 4LF7B 1V96A 2AN3A 3IP1A 2J5XA 3KSUA 1GPUA 1WV0A 2FUKA 5KYVA 4RVUA 1S9DA 2QSYA 2IZOA 3BGWA 2BMVA 3IH5A 3NATA 5GONF 5IKOA 2AW5A 2JBWA 3QE4A 3G8BA 4OHMA 5BRAA 1SQ6A 4RIIA 1JSRA 2JLVA 1SUCA 3UJBA 1SUAA 2L82A 3IQXA 1JYSA 2C8KA 1ZM4A 4BO3A 2Y77A 1RYMA 2NSDA 2YXPX 3LX5A 2IOFK 4A10A 3I3YA 3QENA 2Z43A 4HDMB 2HK6A 4S24A 2BP7B 5B53A 5M29A 3LPCA 4I36A 4LPSA 5JLAA 4Q7QA 1ONOA 5EMHA 1L4UA 2JCSA 2OXFA 4KYIB 3NV9A 1LI4A 3B6KA 5COJA 1BMDA 2RK3A 2EJBA 1SFRA 4KFCA 1PHPA 1YDGA 1P9WA 2FK7A 1AF7A 1TI7A 1GQQA 4KQFA 2OYCA 1TK3A 2VJCA 4MPDA 2II6A 2P8SA 5BSUA 4BZWA 4UHHA 2A5LA 3C16C 3F7TA 2VJMB 5HCIA 3NNSA 4DA8A 4IYRA 4KIFA 5F51A 3RPZA 1CF2O 1U8ZA 3G9QA 4EPRA 1FFWA 1M83A 3B1YA 4N5DA 3MRSA 1UKEA 2QVLA 4U39A 4ER7A 3HN6A 1AHIA 4C6TB 1RKUA 2Q9CA 4QO8A 3RVDA 1U0OC 2GPAA 3JQRA 1CIPA 3QBEA 1X7YB 2O05A 1FW8A 2YMQA 3R3ZA 3RAGA 3UTCA 1E2KA 1SXPA 3G2PA 4X6XA 5DFAA 3M6IA 2EG9A 2AN9A 4MV8A 2HGSA 1H2RS 1TVEA 4DRYA 4BKQA 3QE0A 4M46A 3LQ1A 3O84A 3LIPA 5LYYA 3C24A 2IX3A 2Y4OA 1SBCA 1R6DA 2EARA 5BURA 3EXHA 4U9UA 3N2EA 2O8BB 3IUJA 4DY4A 5F3WB 1AK1A 4KBGA 1CZNA 3HZZA 3SKYA 4C3VA 1W34A 3R7LA 5MFPA 2SICE 1RLJA 1XLWA 1CUVA 1F2DA 2H7YA 1YDEA 3TQFA 3E2IA 5CFZA 2B3DA 2O2DA 4L4SA 1A5SB 1LW6E 5E2BA 2XCRB 2OFXA 5KC8A 5JS2A 4NENB 1D2NA 1SUDA 2VDJA 3V55A 1V5GA 3IIJA 4C0BA 5CB4A 2QNRA 3QVJA 3DVAB 1PJ2A 5ICCA 4YLYA 2UKDA 1H1LB 2N9UA 3EIWA 4YUZA 1CUUA 1E3WB 9ABPA 2UZ1B 2NUBA 3T1HB 3IOMA 2AJLI 2GO7A 3ELBA 2I67A 4LC4A 3SDSA 4K03A 5EIXA 3JQ7B 2DQSA 1WYEA 1H8ED 2C88A 2JFQA 2C0CA 3SBOA 3LBAA 4JNKA 3HCRA 1RYNA 4LGCA 1PX0A 1Y80A 1NVVQ 2VZ8A 3OOYA 4GMHA 3AOEA 2WV9A 4HNHA 4XZ3A 1KAOA 3UCEA 3D3NA 5CG2A 3U7JA 3W1WA 3AVVA 2YW9A 3CWQA 3L5KA 4EG5A 3ZV4A 2X6QA 3D0OA 1POXA 2GM9A 5IAJA 3W5SA 1EFTA 3UHAA 3U19A 3GLHA 1GY8A 2QTLA 2DR0A 3EOBI 1VA4A 2EX0A 3RFXA 1FTYA 3T9AA 4B7UA 4JI4B 3RT7A 2X9LA 2QI9C 4I50A 7ADHA 4P9NA 4NH4A 4Y6QA 3QNWA 3NC4A 3ONEA 3H19A 2Q3CA 2W70A 4URZR 4MKFA 3WYCA 4B17A 4H7FA 4OB7A 3PPWA 4P84A 4EI9A 2NPOA 5IUNC 4CKBA 3HBAA 2AZTA 3IUMA 4N6GA 2X7JA 4ITRC 4N8EA 5BR7A 2Y9MB 4HMPA 1RKAA 1JJ7A 1DAGA 4EZBA 5JNWA 1W49A 4UUQA 1FNSA 4UBKA 4R54A 2WA1A 1OB5A 5EI5A 2I3BA 1NW9B 3D7MA 4DCOA 5B4TA 3Q3IA 3W7AA 1L5VA 2WJ6A 3V7NA 1VGRA 4YMIA 3TXYA 3NL6A 3WLLA 4YI3A 4CKEA 3MM4A 5C1DA 3C98A 3HJCA 4Y6GB 4DSUA 1NR7A 5JSZA 3UQ9A 2QX6A 1E1YA 1SCUB 1XD8A 1BRMA 4JLWA 2B1GA 1BXKA 4YUXA 5JFOA 5GIOE 1QF6A 4FUTA 2OK7A 1O96A 1NX6A 2GN6A 4JXZA 1LK7A 1U28C 3P0HA 4CV3A 3KALA 3KZHA 3A14A 1XBTA 2LBPA 2C1XA 2JJQA 1X1CA 3QWAA 3AHGA 2HFJA 2IRWA 5DLYA 2Q8NA 4Y6RA 5IVKA 3C6BA 1N75A 3JTEA 2FUG6 4KL8S 1CLUA 2VHCA 2WFAA 3L0SA 5A1JA 1TUBB 4PLCA 2J1LA 3SOPA 4AM8A 2CJYA 2OHFA 1E7SA 2P0EA 2OHVA 4IDGA 4LOAA 1QONA 3DE0X 1TD9A 2YRFA 4JU9A 3F7NA 4X0EA 5KVQA 1KAEA 2H1OA 3F9RA 1IBRA 3QKWA 3JZDA 3QUQA 5A4AA 3DZFA 5BN4A 5E9QA 1ZEJA 2DUNA 3ONDA 2O0LA 3EC7A 4MGZR 1NVXQ 1Z0ZA 3HFJA 3QFCA 4ZALA 5FWXA 4EA8A 5HK9A 2C4KA 3IEKA 3RBZA 1Q1QA 5H68A 3VGJA 4Y2JA 1XD9A 2FSUA 2KX7A 4IIBA 3V8MA 3I4FA 2NUPA 2Y67A 3AEXA 3IOBA 5TJ9A 4BZZA 4X91A 3A4LA 1FVXA 2PZBA 2Q6IA 2Y1XA 3FNFA 2AWNA 5KBYA 3SI7A 5KHOC 4MQFA 2AC7A 1FUEA 3NKLA 4TUYA 4RULA 1FS5A 3K8YA 1N2JA 1TJYA 4ZVSA 3F3YA 4BNIA 4JJAA 2PA3A 1DDOA 2C99A 1SUWA 1PYGA 4JBXA 4P2BA 4RACA 4XJSA 3RHTA 5LMZA 3CRRA 5LBTA 2DDOA 4M2LA 4X60A 5H8WA 1ZGCA 1Z3CA 2A9ZA 2G1PA 3NBQA 3S7TA 1BRTA 2KS6A 3UPDA 4EFNA 3WAGA 4FINA 2JI7A 1MPTA 2OXRA 5J63A 2FOXA 4PQRA 5HK8A 3I23A 3OQMA 1XA3A 5A4JA 5FA6A 2CXNA 4OBBA 1NLFA 1J2EA 1ABEA 1I2BA 1VMEA 3KOMA 4HZIA 4CMCA 3E9ZA 4V1CB 1JG7A 2R11A 4DGSA 1UXJA 4IZ6A 2X4DA 1G5FA 2RCYA 1F4LA 4L8YA 1T9DA 2GZAA 4OIFA 3JX9A 5JAHA 1XQ9A 2FR1A 1HC7A 4CL3A 2VDRB 3HP1A 2EGHA 1WKVA 1WW8A 2H85A 3C85A 3Q0TA 2BD0A 1RS0A 3F8SA 4XPIA 1IUPA 1XF9A 2R97A 4PYLA 2DLDA 3K30A 1XCBA 3MUFA 4ENWA 1M6YA 5L3SB 1GUBA 3UCFA 3V2GA 4NICA 3LA8A 4K1LA 4EVSA 2QRZA 3T5GA 3TR5A 5KOJB 2BTOA 4DKXA 4TXJA 4BCDA 3P20A 3U44B 2YINC 3VKVA 4RHCA 1OZFA 2Z95A 3JWHA 3QSGA 4CCSA 3R9IA 1WNTA 2P2GA 2WTNA 3M1YA 2XUOA 1DFGA 2L2QA 1R8JA 3BEOA 4JT4A 4CM8B 3CH4B 1AQIA 1FP6A 1GYQA 1R0LA 1U8AA 3F7MA 3FPEA 3HZOA 4JXJA 4P34A 3KDAA 1G0OA 2NIPA 4DC9A 4EGQA 3C14C 4YCNA 3TMKA 3W79A 2VSQA 3WGGA 3R7FA 2C98A 3DP7A 4L9SA 3THWA 1XB2A 1USIA 4KXLA 4CEHB 3PVCA 5ER9A 1SHTX 3QYJA 1GILA 3AOGA 1AS3A 1NFQA 2AOTA 4OMDA 4NMXB 2BLNA 2DQZA 2H07A 4ZHQA 2PBZA 1BS9A 4YRAA 2PT5A 1BX1A 2VHJA 3ZD9A 3P9ZA 1QV7A 2RHCA 2Q1TA 1PR6A 3E3OA 4A5OA 5FLXA 1DG1G 2P2DA 2JW5A 1A1SA 1FJXA 4J75A 3RJMA 3TCXB 4LTDA 4CI9A 3CYFA 4DMKA 3LHSA 4EX7A 5BN3A 5IK2A 3GFBA 1KDPA 2AXNA 1TE2A 2VHXA 3LV8A 4G3XA 5CLHA 5LQCA 1PJLA 2VNIA 3UAZA 5AW0A 4RKEA 5COQA 4KAHA 1G8HA 2ZIWB 2HO4A 3GP3A 4LJLA 4MARA 3E23A 1EWTA 5HFNA 1CRQA 2IDKA 2OBYA 2G8NA 3GVCA 4YP5A 5B1YA 5D3MA 4U9HS 4M9QA 2ZYHA 4EK9A 4OB6A 4DIMA 1SHZA 5EIOA 5AVUA 4B2PA 4EYQA 4CMGA 2BDEA 3PXAA 4YJKA 3VUFA 3SPXA 3CR3C 5LU9A 1IBSA 4HWGA 4H7EA 5HF5A 2QE6A 2EJUA 3DAYA 4G65A 5HF6A 3T5CA 1A8UA 2POQX 3ZQ6A 1UBGA 5I47A 4UTVA 4U63A 2WJGA 1G9XA 4B44A 2CLFB 2E0IA 2O0HA 2R6DA 3QYPA 4J2HA 3DG9A 3T4PA 3CCBA 4JB3A 4NZYA 5JO0A 4TS9A 1BA2A 1J07A 2HMUA 4C2UA 1IJFA 2K7FA 1YV9A 1IM5A 2H5IA 2OT3B 3PFBA 2Z98A 5J2TB 4ZHQB 5DIZA 3L1KA 1RRGA 2QN1A 1H94A 1EH5A 1JSZA 1E4OA 3PDHA 4G23A 3DXZA 4J8PA 1RD4A 4O8CA 4TVBA 5A0FA 2PWAA 4FC6A 4FJ2A 1Z33A 4DBLC 5TMEA 5ADWA 3WKBA 1JLMA 4DPLA 1YL6A 1HDRA 1YB7A 3D6TB 3RTBA 2VBIA 2GEJA 1HFWA 5JSYA 1KO8A 4I14A 5HHTA 2G5PA 3AY7A 1Q0TA 1T5LA 4JJEA 3T7IA 1W2WB 4E5MA 3OF2A 2A30A 3AEQB 1NSTA 1X14A 1AO0A 3I45A 1IBCA 2Q28A 2CFCA 4HDKB 5B57C 5DBFA 4AP9A 5IEJA 3R44A 2VK1A 1HE3A 4UQPA 2H1SA 4LIPD 4OJYA 2JAXA 3EODA 1RT9A 1L4YA 4JZKA 1U1DA 3FW1A 1ZK3A 4P3KA 3RS0A 3EH2A 2JVJA 3RAEC 2NXJA 1FU7A 2E5WA 2JIZD 1HGXA 1GM5A 1LH0A 2IYOA 3Q7SA 1Q50A 2GJSA 4G56A 3EVAA 5AKKA 2C9ZA 3QU4A 4LBWA 2GSWA 2MINB 3FI9A 3WLHA 1IOLA 4YWHA 4QGSA 1UK8A 4MW9A 2H2HA 3WHKA 5ESWA 3AJRA 5AVKA 3IE2A 3DDWA 1VJ0A 2QTNA 3PXDA 4YEDA 4RVSA 2C58A 2Y99A 1OGYA 3KYIB 3TW0A 3WHLA 2R1UA 1HTTA 3WNQA 2FQQA 3YASA 3L41A 2J3QA 4F8JA 2X6TA 5BN5B 3AVTA 2IPXA 3UJ7A 2ILTA 2GUGA 1MT0A 4EA9A 1PVVA 1BG6A 1PLLA 2E4WA 2QAGA 3FHJA 1XV5A 2GHTA 4OM7A 2FMXA 3DV0A 1DE0A 4IDFA 1OR8A 1A77A 1RACA 1UXIA 2VT3A 1C3OB 3E5NA 4A26A 3ZDCA 4JI0B 4IVNA 4OU4A 3QVMA 2PJDA 2QMOA 1M6EX 3LGSA 4RCZA 1QE5A 2SHKA 4EW3A 3U7EB 3WL6A 3E48A 1I2ZA 3FDIA 2A4KA 2BUBA 3G9UA 3GIDA 3AFOA 3L4SO 4IDHA 4O1MA 5F2OA 2XGMA 4ZVQA 1QP8A 1YR1A 1KP2A 4KQKA 3CBQA 5LA6F 1FXWA 1T3GA 1T0UA 1MC4A 2I4RA 4QYMA 1K7YA 2AVNA 3GFQA 5JCOA 5ES4B 3P8ZA 3D6AA 1X1TA 4MQBA 3SHQA 4F7DA 2JCVA 8ADHA 3AQIA 4B8YA 4ER6A 1E7RA 1W36C 1JQEA 2VEOA 4S05A 1UBJS 3D3WA 1G5PA 1GKYA 2YJ4A 5C3YA 1E8CA 4LI3X 5KCZA 1Q16A 4FEAA 1PSWA 1QMGA 4RY8A 3GH3A 5IAGA 1HYBA 1LIOA 3FCSB 1TQ4A 4BMDA 3RUIA 1UDBA 2A0UA 3WZLA 1N9KA 1Q0LA 4L5IA 1ZLXA 3K9CA 3NVAA 1DLIA 3QX7A 1T1JA 1AX9A 5LZ2A 1EAMA 3HDVA 3SN6A 3UJDA 2GAAA 4YCJA 1WVIA 3BXXA 3OTWA 2OCDA 3CPJB 4HF7A 2AJBA 3B36A 1V8PA 1SB9A 2IPOA 5CT4A 4FNOA 1KJNA 5AP9A 4D56A 4LF8B 5TT1A 1PDOA 2IPAB 1E2MA 2QPOA 4I8XA 3RFCA 5IAAA 3TUIC 4K2HA 2PNFA 4OHUA 4ASUD 3T1YB 2JJ1D 3KJGA 4PYIA 2VXYA 1RQNA 1JAZA 2C5BA 3DUFB 4G24A 4WY8A 4Y1FA 1WE2A 1YU9A 4QTUB 1C0EA 4DRXA 3HSSA 2IK8A 2C4TA 2PZJA 2X0RA 4JSTA 1IK4A 2F67A 3RQSA 1RHQA 1CJBA 3WB0A 5JCJD 1JU4A 1JPNA 2PLNA 1K27A 2XV1A 5CX1A 1W5BA 3BB4A 5C8ZA 2XADA 3TPFA 3WYBA 5T4EA 2Q3FA 1EVEA 2BAGA 3CNHA 4JI6B 4XRGA 2VHWA 2ASVA 1Y8RB 4YUVA 1QHIA 2LPMA 4MAMA 3TSOA 3HNRA 1U0SY 1DRKA 3EPLA 1PV4A 1EK2A 3IAS6 2CFOA 3WMFA 2R4QA 2D0OB 3GXOA 1YDHA 2OPHA 1O95A 2PVCA 1X19A 2Q3JA 1NMYA 3I1JA 1SULA 1M1NB 3OZFA 2DECA 3KYCB 2IH5A 4TLEA 1UPAA 2V78A 2ZE5A 3LO5A 4HLDA 1PKEA 2HK8A 3ENQA 2DU8A 4YBRA 5IW8A 3ZDAA 2Q3MA 2ANCA 3PNYA 5IK2D 4TV9B 5CT8A 5KNBH 2WOJA 4EABA 2CVQA 2XBUA 5KYNA 4QGHA 4WZBB 4I50B 5CB8A 5AK5A 3S3TA 1GQ2A 3K7EA 3RM3A 4MW7A 5B4VA 4C5AA 1OLSB 1WXXA 8ATCA 1HBJA 2VDNB 4PZPA 4XYMA 3EGWA 4GM6A 4LNUA 3U4DA 4AJ2A 1BHJA 4ZMSA 4LJRA 2J07A 5LFAA 3OZIA 1NMSA 3QYAA 4INOA 5B3AA 4D43A 2NTYC 3B8EA 3HUDA 4C4ZA 3B1QA 2W0MA 2EJVA 1KFKB 2B1IA 2V65A 4O6VA 4GI1A 3SIXA 4C76A 3N9IA 3PQFA 3DM9B 2CUNA 1AC5A 4KPFC 1CNFA 1ESDA 4MDHA 3L8ZA 2CV2A 1I9CA 1ZM9A 4YQZA 3G9ZA 3V5NA 3HGTA 4MX8A 5C1PA 3ABOB 1VJ5A 1CS4C 3JQ7A 5K8JB 3TEMA 1HDGO 2DSNA 1UBSB 2IYYA 1D0VA 2ZPAA 3GLHE 3ROTA 2HU5A 3RYFB 1B42A 4Q4AA 3WLAA 1VYTA 2G6TA 4QVKA 3ETJA 2CMHA 1PG2A 2WHEA 2WIAA 3LX8A 4EFKA 1C80A 3WKEA 4D45A 4QTYA 5DGXA 4Q16A 4OQMA 2WE8A 2LIVA 3HNPA 3Q3GE 3DGEC 4O29A 4JENA 5AI5A 4YRMA 3OM9A 1SUIA 4NMMA 1P6XA 1NW6A 3TQSA 1TT5A 2YFQA 2ZZKA 4XQ0A 3UMJA 4FGLA 4KR2A 5MN5A 2YWCA 5IUJC 3CZCA 1R6UA 2XPCA 3SHOA 1H3NA 1U99A 2OAP1 3H4IA 1O97D 1DIOB 4HZUA 1XKXA 1A96A 5EEHA 3I6YA 2R44A 3GFFA 1X7GA 4XLZA 3SR4A 4CLRB 1JPUA 2XGOA 4G1BA 5REQA 2WOOA 3GOHA 3EXHB 5COAA 4YXWA 3HXOA 4JJPA 1XMOB 3UEOA 4UVHA 4KXUA 1G2PA 1Z4KA 3UUFA 5U1PA 5B12A 2XLBA 2Q3BA 4GBGA 3CRVA 3BREA 4HJXA 3NC9A 1YR8A 1K5GA 1DQNA 4GD3Q 1Z39A 1CEYA 3KUKA 3AHCA 1E5LA 1V1SA 5KVSA 2FXVA 3I72A 2DWCA 1NGSA 2XD9A 3EC1A 4KGVA 4HX9A 1Q7EA 3OA0A 2VWQA 1W581 3LY8A 3P52A 4NK5A 5ARDA 5FL7A 4DA9A 3VU3A 5CIYA 2UU9B 4OQFA 3WA7A 1KH3A 2MYUA 5SYMA 3VZCA 1LBSA 2A86A 4AN4A 2HMAA 2GEBA 4MVXA 2W6PA 2ZETA 2BEUB 2VL7A 3OH8A 3KQNA 3M3PA 1MB4A 3NBFA 4KRGA 2VPIA 2QQEA 4PCUA 4RGVA 5BOSB 1O5OA 1RBYA 3OJLA 2DKFA 1QH0A 2BJHA 1SD2A 5D51S 3DFUA 4AKTA 1GAQA 4G1CA 4MIOA 5FWYA 3DO5A 5DHAA 2IEBA 2Q5EA 2ZYSA 4RK0A 1XCLA 1W36D 2QX8A 2RCNA 3E7FA 3IEXA 3F5SA 1ZQ1A 5F64A 4MV4A 3OQJA 3T9EA 4PAWA 3A4VA 4R2XA 3SG0A 2UZAA 3BXZA 4KR6A 5AVZA 1DJQA 5CRIA 3A4YA 2Q3EA 1XYGA 2P4HX 1DS6A 3I42A 3IAUA 1TU4A 4LTNA 3W1VA 2K7ZA 4NP6A 3ZCSA 3M9LA 4CU2A 5F2NA 1ZFNA 3H3JA 1PWEA 5CYGA 4DB2A 4LRTB 1E0KA 5HEKA 3TQIA 2O48X 3LDAA 4MEBA 4ZV4A 2JFOA 1LX7A 3NTVA 4QGAA 4YHHB 1WHSB 5K0NA 4QZVA 5HKLA 2WSSA 1XK6A 3BFJA 3CR7A 3KSMA 3SP1A 4YRZA 1N8SA 1HE5A 5B30A 1QWSA 1YUBA 2W58A 5SV2A 5AJHA 4XWWA 4MUEA 4A4DA 1I3KA 2IYSA 4TSFD 1V7CA 4HO1X 4CIDA 4ZQFA 3RB8A 3CN7A 3E22B 5A05A 4Q3KA 1M6VB 3RRXA 4RFSA 1QGAA 2YS7A 4UHJA 3FDZA 3GRVA 1Y5IA 5FLYA 2C3OA 2PPLA 3KJNA 5EUQB 3RS3A 1VLLA 3X1KA 5BYEA 3LT4A 3IOCA 1GAEO 5T5QA 1KERA 4TXHA 3X1MA 1GC5A 3SJAA 4BMCA 1KJYA 3LPDA 1YDMA 3FFTA 4ZVLA 1USKA 4KUHA 2WTEA 4UUMA 5DNYB 1QPZA 5MGBA 4NCNA 2NYVA 5FLEX 1Z7BA 3DYBA 1DXQA 1PJAA 2DP4E 4KXVA 3ZWPA 1QTQA 4EX6A 4FCCA 4B85A 4UMDA 1BO6A 1SIUA 2X42A 3PXCX 1TTHA 4TQAA 4LQ4A 3RROA 3PR2B 4AXXA 2WZCA 5KTRA 2HMTA 4Q47A 1PVDA 1H6AA 4IRMA 5BYBA 1QLJA 4XEHA 1QRSA 1NDHA 2D8MA 5BO5A 1ECBA 4K9NA 2YFKA 5AI0A 5DW3A 4ER3A 5A71A 1UKYA 1JHRA 1HT0A 1R6TA 1DQRA 3BZUA 3RIYA 1H9AA 2R8XA 3OM8A 4LQDA 3DMRA 2QRGA 2XDAA 4UCQA 2OFFA 3FGOA 3ZW7A 3I37X 1T8RA 4NCIA 1KY5A 1DMRA 1WHTB 3KYDB 4LOHA 5H80A 2CWDA 3N0TA 3S2EA 5G0WA 1R9GA 3Q6NA 3WP1B 4CKCB 5KPDA 2Y2UA 3UWOA 1YRLA 4GLFA 5BSRA 3GN2A 1TT5B 3P5BA 1V1JA 1EP1B 3ITNA 4GQBA 3R7SA 2A57A 3ZD8A 3EVEA 2JGDB 1A27A 3L18A 3TAXA 2PFSA 2JH9A 3HJNA 1LQTA 3K09C 4ODIA 4RM2A 5D8DA 3C6QA 1JKJA 2GN9A 2ZTLA 1GQYA 4B80A 4LSZA 1DAPA 5E3JA 3LKBA 3LMKA 4L4YA 5IXSA 2ABQA 2XNDD 1CUJA 1GGKA 1IL0A 2JLQA 4LV5B 4KO2S 4DQ0A 4L2IA 1DIGA 2Y1KA 4PNPA 3HKCA 4Q1DA 3A6FA 2OHXA 5FKJA 4OK6A 4NU0A 3RS8A 3RK0A 2C20A 1IPFA 1WD7A 4HYYA 4KV7A 1OFGA 3S2YA 1V95A 3JSXA 4YV7A 2JLYA 1IU9A 1I30A 1ICIA 4XFDA 5DCLA 4TKUA 2V3WA 4EUHA 3B1OA 1S8AA 1UDWA 2YX1A 3CB4A 4IIXA 3KX2A 4CDGA 2ZUVA 1XUOA 1HKUA 3EFOB 3ZWYA 4WD3A 1ZICA 4EEKA 4WBNB 3WLPA 1TKRA 2FMUA 1D2EA 2GPWA 1A4IA 3T7JA 3HDHA 3QQ5A 3TD2A 5LXTA 3A9RA 1N2BA 4D92A 1P19A 5HRAA 4EKDA 1Z2CA 2H6EA 2INGX 2PL1A 2HSDA 1K0UA 2WINI 4M83A 3W3AD 5K8TA 2TECE 3IA2A 2A1TS 2MDTA 2PY6A 2IBMA 4FM9A 1L4HA 4L5JA 1PJ3A 3K9GA 5ILQA 4BBAA 3SXUA 2YCLA 1DO8A 1KRHA 4DCUA 2JASA 4Z86A 1V5EA 1I7NA 5FI0B 1RRPA 1UWKA 1H22A 2HTFA 2GZHA 4F2WA 1Y7PA 1PZXA 4FCVA 3R41A 2GBLC 1ADFA 3F73A 2XMRA 1YHZA 1G4UR 2GUWA 2YJ5A 1LTHR 3LKDA 3IAFA 3PKZA 3HH8A 1VBMA 4JWTA 4LJ7A 3VDNB 4C01A 3WYEA 3BXPA 2N42A 4JEHA 4K9LA 4TYNA 1YC5A 5HX7A 3K0CC 2HT6A 3VZPA 1D07A 2XDQB 1KOFA 1J9EA 1OA0A 1VMIA 3ZN2A 2VTBB 4UM9D 2GWHA 4R41A 5C9ZA 5JPCA 3REQA 5CX4A 1SGWA 1ZRHA 2J3IA 1MU0A 3QXXA 3ZU5A 3ZHQA 2WU0A 2XTZA 1GR1A 2HA6A 2XR1A 2QRPA 4FT4A 4PLFA 1LW7A 4XQCA 4LRXA 1W2HA 3WO1A 2C7QA 1FJHA 3FFAA 1CJCA 2ATCA 4TXMA 1NE2A 4EJSB 2NXCA 4CUZA 1E6CA 2FI1A 4IKPA 1XTVA 1BYUA 1CUXA 3QU7A 4MR8B 4QOJA 4YRFA 2ODAA 1V1MA 2IYVA 2JGIA 3IP8A 4M38A 5F1KA 3TVYA 2P90A 2P27A 1EHIA 4NG5A 1QOPB 3L92A 4PRKA