3RRLB

Complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
207
structure length
207
Chain Sequence
MREAIIKRAAKELKEGMYVNLGIGLPTLVANEVSGMNIVFQSENGLLGIGAYPLEGSVDADLINAGKETITVVPGASFFNSADSFAMIRGGHIDLAILGGMEVSQNGDLANWMIPKKLIKGMGGAMDLVHGAKKVIVIMEHCNKYGESKVKKECSLPLTGKGVVHQLITDLAVFEFSNNAMKLVELQEGVSLDQVKEKTEAEFEVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
publication title Complex structure of 3-oxoadipate coA-transferase subunit A and B from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 50
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature ec 2.8.3.5: 3-oxoacid CoA-transferase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01144 CoA_trans Coenzyme A transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3rrlB00
1POIB 3CDKA 2HJ0A 1OPEA 3RRLB 1K6DA 3DLXA 3EH7A 3CDKB 4KGBA 2OASA 2NRBA 5DBNA 3D3UA 1OOZA 1O9LA 1POIA 3GK7A 2AHWA 2AHVA 2AHUA 1OOYA 3RRLA 1XR4A 3K6MA 3OXOA 5DBNB 1M3EA 3QDQA 2NRCA
chains in the Genus database with same CATH superfamily
1POIB 3CDKA 2HJ0A 1OPEA 3RRLB 1K6DA 3DLXA 3EH7A 3CDKB 4KGBA 2OASA 2NRBA 5DBNA 3D3UA 1OOZA 1O9LA 1POIA 3GK7A 2AHWA 2AHVA 2AHUA 1OOYA 3RRLA 1XR4A 3K6MA 3OXOA 5DBNB 1M3EA 3QDQA 2NRCA
chains in the Genus database with same CATH topology
1POIB 3CDKA 2HJ0A 1OPEA 3RRLB 1K6DA 3DLXA 3EH7A 3CDKB 4KGBA 2OASA 2NRBA 5DBNA 3D3UA 1OOZA 1O9LA 1POIA 3GK7A 2AHWA 2AHVA 2AHUA 1OOYA 3RRLA 1XR4A 3K6MA 3OXOA 5DBNB 1M3EA 3QDQA 2NRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POI B;  3CDK A;  2HJ0 A;  1OPE A;  3RRL B;  1K6D A;  3DLX A;  3EH7 A;  3CDK B;  4KGB A;  2OAS A;  2NRB A;  5DBN A;  3D3U A;  1OOZ A;  1O9L A;  1POI A;  3GK7 A;  2AHW A;  2AHV A;  2AHU A;  1OOY A;  3RRL A;  1XR4 A;  3K6M A;  3OXO A;  5DBN B;  1M3E A;  3QDQ A;  2NRC A; 
#chains in the Genus database with same CATH topology
 1POI B;  3CDK A;  2HJ0 A;  1OPE A;  3RRL B;  1K6D A;  3DLX A;  3EH7 A;  3CDK B;  4KGB A;  2OAS A;  2NRB A;  5DBN A;  3D3U A;  1OOZ A;  1O9L A;  1POI A;  3GK7 A;  2AHW A;  2AHV A;  2AHU A;  1OOY A;  3RRL A;  1XR4 A;  3K6M A;  3OXO A;  5DBN B;  1M3E A;  3QDQ A;  2NRC A; 
#chains in the Genus database with same CATH homology
 1POI B;  3CDK A;  2HJ0 A;  1OPE A;  3RRL B;  1K6D A;  3DLX A;  3EH7 A;  3CDK B;  4KGB A;  2OAS A;  2NRB A;  5DBN A;  3D3U A;  1OOZ A;  1O9L A;  1POI A;  3GK7 A;  2AHW A;  2AHV A;  2AHU A;  1OOY A;  3RRL A;  1XR4 A;  3K6M A;  3OXO A;  5DBN B;  1M3E A;  3QDQ A;  2NRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...