3RRNA

S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
395
structure length
389
Chain Sequence
GAMAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 118
structure length 389
sequence length 395
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrnA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrnA02
2RGCA 1HE1C 2Q21A 1G3UA 2QP3A 3I92A 4LYAA 4M9ZA 1HQCA 4BFZA 2Z0MA 3B7GA 3QKTA 1Z6YA 1A4RA 4LV6A 4NCIA 2OCAA 1N6KA 3D6TB 2KI5A 4OJQA 1HURA 3THYB 3OF5A 2IYRA 3NEJA 3QXSA 1ZCBA 3E5HA 1MRSA 4JMPA 4WOPA 4B34A 3KKOA 1DBSA 3EZ9A 4M21A 4MGIR 5B58C 4ZV4A 1IHUA 1BOFA 1PLLA 3QXXA 5BW8A 2ZJ2A 1ONBA 4M9QA 2QP9X 3K09C 2GA8A 2QA5A 1JAIA 2F3RA 4OK3A 5LD2C 4AKGA 5JRZA 4PC1A 3U7GA 1W4RA 4IKEA 3KFVA 3AVXA 2C5LA 1Z0IA 2JA1A 4PHHA 2GCPA 4BFYA 4I1VA 5EE3A 4BLOA 3ICEA 3MSXA 4A8JA 2NO1A 3TR5A 4NBSA 4PHTA 3ZZTA 4ESHA 4NMMA 1UKYA 1ZW6A 3QF7A 4E03A 2G83A 3EIEA 5AJZA 1NBMD 2DWOA 4PPGA 2XGJA 3LV8A 2QT1A 3GCGA 5FPHA 3D3QA 5G3YA 2IT1A 2WSMA 2GESA 5FPTA 1YZTA 4RD1A 1QHYA 2NO0A 3O47A 4RD6A 3MCAA 2KE5A 1ZM4A 1T4GA 2J7PD 1KI3A 3L0PA 2RGNC 4LCBA 3RNLA 5HKKA 3I4LA 3WYGA 2JAQA 4MKGA 2WBLC 2C03A 2NQ2C 1E2JA 1OB5A 2OILA 1E2PA 1LS1A 2E87A 3IHLA 5FL3A 4A8JB 5J4VA 1Z2CA 1R5BA 3LWNA 1ZM9A 5EUQB 4N3NA 4OI2A 4DC9A 3MAAC 4UNRA 1Z0AA 1Z83A 2D2FA 4QJ5A 3CZPA 3GJ7A 3I73A 2ZAMA 2ZRGA 3QKRA 1NVVQ 2ATXA 5JEDA 3B9QA 1FX0B 1Z29A 4M1TA 4RY2A 1VECA 3WBKA 5GJWC 4TLCA 1JEDA 2ZYUX 2NGRA 2QMOA 4B3GA 3W6OA 2QPOA 2YC4C 2Z4RA 2QGNA 3GMTA 2DY1A 4K46A 4TMXA 3UMRA 4RVCA 4MRVA 4LYHA 6Q21A 1Q57A 4HSEA 5DYIA 2V54A 4TYNA 1S3GA 1E1QA 4A0HA 3SQXA 1JR3E 1SKQA 1SXJD 4TLBA 4TMVA 3P4XA 4M1WA 2AL7A 1US8B 3T1OA 1KO4A 4AKHA 4CEJA 2PEZA 2QL6A 2WWHA 2OBNA 3SJCA 3I5XA 4M8NE 2H17A 3P1JA 4M2LA 3ADBA 2OSBA 4U00A 1U99A 5FI1B 5D3MA 4DCTA 5TARA 4Q01A 3CB4A 4D4JA 1R0WA 3BIFA 4GZLA 1Q20A 1T91A 2GCOB 4ZDKA 1OH7A 1SVKA 2O8FA 5KU1A 3AEZA 3G0HA 2ZSFA 4NYIR 3K0CC 4NYMR 5DI3A 4DDVA 5E3HA 1KSHA 3FB4A 3QPVA 1N5KA 5AR1A 1XXHA 1R10A 3FFAA 4GOXA 1IQPA 4R98A 5JCZA 1XCPA 2VF7A 4S35A 5TB5A 5SZIA 5JI2E 4KODA 1XFAA 4AWXA 1HYQA 1IXRC 3L43A 3C41J 3VKGA 1E2HA 4G5QA 4IOMA 5LBIA 3T5GA 4JLNA 3EPHA 2VBCA 4JL6A 2QROA 1P62B 2YV5A 3KB1A 4IW3B 1VHLA 2ZSEA 5AUPB 3VX3A 1G8HA 1W44A 1OT3A 1U94A 4YMWA 5SZJA 1R8QA 1VMAA 1TEVA 4P4UA 1P61B 1P6XA 5C1BA 2ANCA 4GPTA 4L4UA 3QF4A 1A7JA 4RZ2A 4OYHA 4RZUA 3IQWA 2ZJ5A 2CK3D 2ZYVX 2GKSA 1E2DA 1GRQA 1T3LA 3P26A 5KPJA 4Q1DA 4FIDA 4LHXA 4WW0A 2PMKA 4LJ4A 2ZRLA 3WNBA 2A3RA 4R2IA 1KI8A 4P31A 5AUNB 1J8MF 5FTMA 1JNYA 2IYXA 2RAPA 3UANA 1QHHB 4I1UA 3NC1C 4O3MA 3QE0A 1OJLA 3K53A 4U02A 4MH0R 2WZQA 4AG5A 2B8WA 5FUWA 1WB9A 4A82A 1KZ7B 1NIJA 4TQAA 1OSNA 1D9ZA 4FMDF 2PT7A 5FL7A 3D7MA 2J5XA 3RDPA 4WVFA 1DAHA 2F43A 1M2OB 1XJCA 2VEDA 2WV9A 3F5FA 3KUDA 1OPXA 3AF0A 2QG6A 3HP1A 3S1AB 4MYCA 3LH5A 1Z0DA 2BCJQ 4ZKEA 2WOOA 5FBVB 2RGNA 4TL9A 1EX7A 1I2DA 2Y8EA 2YC2C 4YLGA 4D2IA 1XDBA 2IYVA 4LHZA 2PX3A 4B2LA 1DVRA 1SULA 3RRNA 3OAAD 4OQMA 4YQFA 3SJBA 4TL7A 1ETUA 3THWA 3A1UA 3B78A 2OLKA 2ZTSA 1NBMA 1ZUHA 4BE7B 4DSUA 2G6BA 2JJ1D 2CL6X 1ZC3A 2HF8A 2WSSD 1WQ1R 2ONJA 2QRNA 3EX7C 4OJKA 3U4QB 3UPUA 3AV0B 4CT5A 3AVPA 5D3MB 3AKDA 3CONA 5KNCA 4QM7A 4YMTA 2P6RA 4ITRC 4D81A 2AHOA 2G1KA 2J0UB 3T34A 2WMNB 4C3ZA 2GF0A 1OXXK 2TMKA 2CLCX 5BYJA 1R0XA 3L0SA 3M6AA 4AG6A 4F92B 1T0HB 2QN6A 4DB4A 3RS0A 3AGQA 3TQFA 3FYHA 4PQRA 3QKSB 5KDOA 4RFVA 4LJ8A 1J70A 5JSZB 4LHWA 1YJ5A 8OHMA 4KCGA 2ZYWX 1QHIA 5L3QA 1AM4D 3MMPA 2O52A 1VG0B 1RJ9A 3FGNA 2ZJAA 3UWOA 3SU8A 1R2QA 1NSFA 1NIPA 1ZBDA 2CDNA 2N46A 3OE7D 4AURA 4DLVA 1MO6A 2WKRA 1E0JA 1G8GA 4PZYA 1Q21A 3AUYA 1UEJA 4HDCA 2KBEA 1OE0A 2IW3A 2AXNA 5CM9C 4LYJA 4Z51A 3OEHD 2CJWA 2XSZA 1UBCA 3KQKA 2R6CA 2VF8A 1AS2A 1Z6TA 2CLSA 2GBLA 3DKPA 5BN3A 4D25A 3VMFA 4GFDA 2XZLA 4Q02A 4ZI3A 5JECA 2J0UA 2D2EA 4DIDA 3TSOA 2ZUBA 1IOZA 5EP1A 4TYYA 2OCBA 2AWNA 3REFA 1GNQA 1BKDR 1AKYA 2C04A 2P3SA 4QNMA 4DRZA 1UADA 1XTJA 3I72A 2RH5A 2FGKA 3QQ5A 4KSCA 3UG7A 1OXVA 2GAOA 1KK3A 3K0CA 3TUJC 4TSFD 5EJEA 5KSYA 3JZMA 2WWXA 5KSZA 3B60A 4HB4A 2ZRMA 4F91B 3W90A 2G77B 1S9DA 4H1VA 5A4JA 3VNUA 4EPTA 2VA8A 3TVDA 3K09A 5G53C 4C30A 5FL7D 1WRBA 2QZ4A 3P20A 1LY1A 5DHFA 1FNMA 1P9WA 2QTFA 3HYTA 1X8JA 4EUNA 1KTVA 1Z2AA 3NDBB 3TIFA 2C9CA 1AIPA 3ZZ0A 3EZ7A 1PUJA 2FOLA 3BWDD 5IDVA 2BVNA 3VAAA 4XTCS 5C4GB 4EPVA 1EXMA 4WA7A 2AFIE 4DLWA 3QVVA 2RGDA 4Q7MB 3W6NA 4BPBA 2F43B 1Z5ZA 1GL7A 1DAEA 2X77A 4Q7LA 1UDWA 4B75A 4M4SA 2VPPA 4ASUA 2O8CB 2QUZA 3NBZC 2FGJA 4E5UA 3CPEA 4M1OA 1NVXQ 2RGGA 3I32A 4FW9A 1ZJ6A 2EVWX 5IHPA 2IXFA 5H1YA 4D0GA 1YZQA 1SVMA 2C99A 4NH0A 2ZRBA 3U6BA 1T0JB 4HAYA 1P5ZB 4ARZA 3DL0A 1K6MA 3IIJA 2JCSA 5FFMA 2F9LA 2FSHA 1U98A 2R6DA 1QRAA 1L7VC 3VR3A 3O8CA 5FUYA 1RIFA 1XTIA 3EC1A 4GBMA 3P4YA 1F2UA 2WAXA 3H1TA 2DHRA 1S9HA 3ADCA 2VRWA 5JWHA 2H92A 2ZUCA 4KAXA 1GKUB 3PITA 3HR7A 2ODEA 4GOKA 2A30A 2OV2A 5AJXA 4ZI2A 1DG3A 2JLVA 1XD2A 3FMIA 1XTKA 4LI0A 3TUIC 5F2EA 3EPJA 4GT1A 4RSGA 5DIFA 3U7HB 3WBJA 3RC3A 2VIIA 5JBQA 2V3CC 3X1YA 4HAXA 1RYFA 4RD0A 1CLUA 1Z6AA 1G6HA 1D2EA 3LDAA 2ATVA 1YE8A 2QGZA 2IF2A 1JXMA 4M22A 4NPHA 4P4SB 4HAWA 5AWFC 2BOVA 3L8ZA 2PEYA 3RHFA 4CDGA 4RD2A 1RRPA 2UKDA 5JEEA 1ZM2A 1R0YA 3NG1A 1DOAA 2MSCB 1XWIA 2CLDX 3QBVA 5C4MA 3KKQA 2REBA 4HAZA 3CWQA 2QBYB 1GFIA 4PXAA 4DSNA 3LBIA 2NTYC 4DLZA 4QBFA 4US1R 1NG9A 3NC0C 2ZI4A 1PUIA 3MGCA 3GEHA 3Q9LA 3O8BA 4URYR 1E6CA 5BXQC 5FOXA 5L3SA 5EE1A 1WBDA 1N6LA 5TXGA 3LRPA 2AFHE 2F7SA 1N2CE 1FMJA 2CK3A 2A5GA 2G0NA 2VQSA 3MG9A 1T3HA 2LKDA 1ESNA 2DFLA 1N0WA 4II7A 3FOZA 4C9BA 2J45A 2Z6VA 2BMDA 3MRSA 4B47A 2V8OA 1SHZA 4LV5B 4UQOA 2C78A 1LV7A 3OESA 3LLMA 4I1SA 3T5DA 2WOJA 2IS1A 4QC2A 1PLJA 2GHIA 2YOGA 5SZHB 3BERA 3DVLA 4CYMA 1KZGB 3Q5EA 4EKDA 2WWYA 1TEXA 3PQCA 3JVVA 1MO5A 2A5FA 2ZRIA 4MDEA 1EWRA 5L8VA 4IDPA 1OFUX 3EWAA 1FOEB 4BEBA 2FSGA 4BFSA 2HEIA 1H8HA 4TSFA 5HTKA 1E2LA 2JATA 1IXSB 3GLIE 3V4RA 4ERNA 4A6PA 3X1ZA 1F2UB 2W00A 2GXAA 3EC2A 4LJ6A 1U2RA 2F3TA 3QIAA 3AQ4A 3QUSA 1E2MA 2C98A 2JLRA 3IGFA 4DT1B 4E09A 1XD9A 2VP9A 3OIVA 5L3QB 2FU5C 4DVGA 4IEIA 3BK7A 1E9BA 3LQRA 4N0EA 3IDQA 3RRMA 3QF4B 3RVBA 1WE2A 2WHXA 2SHKA 3A8TA 3I8SA 5CLLA 3SZRA 3BORA 1OXTA 1WDTA 2OHFA 2QAGA 2BC9A 5G3ZA 2CCGA 4I1OA 4M0LA 3ZS8A 5CYPA 3TJZA 3AKYA 3EAQA 3DMDA 2IS2A 3LQQA 3R9WA 2FA9A 2DCUA 3LAWA 1S8FA 2CCJA 3EPLA 1E32A 3G5UA 4MUBA 5DGXA 4WXPA 2HT1A 4GZMA 2BCGY 2AD5A 3AUXA 4PPQA 2O8DA 3VTKA 2ZXUA 4DUGD 2W58A 3VR1A 3IKJA 3CRMA 3NHBA 3VKWA 5C46F 4B43A 1L4UA 2CNWD 2JLQA 1I4TD 4YC7A 5KDDA 2ZS8A 1G19A 1MABB 3BH0A 1TL7C 2IHYA 2OUKA 1KSGA 1A2KC 1NJFA 3UK6A 4O2RA 1UEIA 2HJGA 4EFNA 2YKGA 2GJ9A 1P2SA 3R7WA 1IN5A 2XX3A 3DEFA 1J90A 4DCUA 1U0LA 2AN9A 1EFRD 1SQ5A 4OQFA 2NG1A 4UXJA 5FPKA 5FH9A 2AWOA 2G88A 3CPHA 5EE0A 3SS8A 4C2UA 1R7RA 1S3SA 3PUYA 1X6VA 5FBRB 1H8EA 5CJ2A 3U2QA 4R9UC 1HE8B 2RHMA 1Z63A 1A1VA 1FNNA 1Q1ZA 4BZPA 2ODWA 1JBKA 4Z54A 4OQXA 4FCWA 4P33A 4UNPA 1W4AA 4NCNA 4RKEA 1NY5A 3AP3A 5F98A 2R6GA 3FWYA 2ZYTX 1G7TA 1U9IC 2HXSA 3BB4A 1HY3A 2PT5A 3A4MA 3RYTC 1N0UA 4M1KA 4HAUA 3RWMB 5JRJA 1CKEA 4Q9IA 2V55B 3GJ4A 1GOTA 4Q1CA 4CT4B 1E9FA 1IONA 3MUFA 3NIBA 1G3QA 2C77A 2DB3A 2FWRA 3QY0A 4NTZA 5DNYB 5E4FA 1N6PA 3CM0A 4XSGA 2OFWA 2GXQA 2QY9A 5JSZA 3T1VA 1XEWY 1YR8A 4BFVA 4TTQA 4OHZA 1F2TB 4C0JA 4QM6A 4LY6A 5JCPA 1SVWA 1XZPA 3EZ2A 3SDZA 3THWB 3T61A 2HCBA 3QEOA 3U61B 1XJQA 3OIWA 4JKYA 1R5NA 1S4QA 1JAHA 1UM8A 3C5CA 3FTQA 3VFDA 1TUEA 5CYOA 3BH7A 5E7JA 1P2UA 1E1RD 3FMFA 3Q5DA 1UKZA 2XXAA 3DZDA 3K9HA 2J0VA 1CR4A 1KO8A 3AVVA 3ZVNA 3BRWD 1HTWA 4C7OB 2I4IA 1VTKA 4LPKA 2C2HA 2PZGA 4V0ME 5D3QA 3PJRA 3KKNA 2QQ0A 521PA 1UFQA 4V0OA 1A82A 4NU0A 4LBYA 3ZIAD 4HLQB 1Z0KA 3QXCA 2BBWA 1AZTA 3NHAA 3QKSA 2V6JA 1Y63A 3FKSA 4OL0A 1SZPA 4TT3D 2A2ZA 2GDJA 4DDUA 4WZ6A 2BIFA 4DLRA 4LC1A 4QBGB 4DT1A 4WZBE 3FMOB 1W5TA 4P4TA 1AA9A 2FSIA 4A0FA 2ZR9A 1BMFA 4Q4AB 4XIGS 3BBPA 1EK0A 3W5IA 2VSXA 3AF2A 1KDPA 3LXXA 5KPDA 4MRRA 3I8XA 3KJEA 2IS6A 3AVTA 1DAFA 1YR7A 1KY3A 1XEFA 1P9NA 3LA6A 4GP7A 4XVRA 3SC3A 3AKEA 5AK0A 3C8UA 2IA5A 3QEJA 3SBDA 3UMSA 3CRRA 4LC0A 2JDID 3RS3A 3KQUA 2QM7A 5DHAA 2X19A 4N1AA 2XNDA 2BJWA 2QE7A 3AF4A 3ND9A 4RCZA 2ZSBA 3SR0A 1U9IA 4TYPA 1GKIA 3ZD7A 5TV2A 4AC9A 1W36C 5JJKA 2IYZA 2ZS9A 4FWTA 5TDHA 4PR0A 2QPAA 2Z43A 4KFSA 3M1IA 1RRCA 3QOFA 3DDCA 1EGAA 1NN0A 3PUXA 2FFBA 4TTPA 3EIQA 3A36A 1W0KD 4JKIA 4MRSA 1ZC4A 4Z8XA 5L3SB 5DI3B 3ASZA 4PPFA 4TYQA 1VDZA 1M7GA 3QPUA 4B6FA 1KI1A 1ZNXA 1TQ4A 3BXZA 1TPZA 4KVAA 2QMHA 4UNQA 2BV3A 3W34A 3WRYC 3WMGA 2ODNA 3L0IB 2JLXA 3K0SA 3IEUA 2QTVB 3CLVA 4DWJA 4PTLA 2J0QA 4QOSA 1Q3TA 1NVWQ 1D2MA 4K8OA 4GMDA 4HZIA 4GRAA 4M9SA 3K9LA 5FBLB 4JSTA 2KSQA 3MWYW 1FMLA 5BQ5A 1FL9A 2W0SA 2XZPA 2EFCB 2G3YA 3T1QA 1TAGA 3GLGA 3X2SA 3NH9A 1N3BA 2D06A 1OKKD 4A8JC 3ETLA 1CS4C 3OEHA 4KHZA 4OI4A 4ZCMA 4JLJA 3RS4A 3EASA 1E4VA 4I99A 1T5IA 3GLGB 1TTTA 3C7KA 2FH5B 3CPJB 3E70C 4MYHA 4W5WA 3EZ6A 3CRQA 2FEMA 3KUCA 4RKFA 1J7KA 2IK8A 3SEAA 4U7DA 1FX0A 4W9MC 3KDSE 4HYYA 4KFUA 1G17A 5G40A 1QDEA 2V1UA 2R2AA 1N5IA 5DI9A 5E95A 1DO0A 3GP8A 2QAGC 1ZU5A 3DM9B 1B0UA 2QENA 4FXPA 4NKRA 3E1SA 3UIEA 5KSOA 2VP6A 4DEXA 1NKTA 3A58B 121PA 1NNEA 2IYQA 5JWOA 1E0SA 4JL5A 1ZD9A 3TAHA 2WKQA 2HV8A 2O8FB 3EZFA 4HUQB 2EQBA 1D9XA 2QTHA 3GEEA 1BH2A 2IC5A 4D0LB 4HB3A 2PBRA 5FOWA 4A2WA 3BGWA 4LJ7A 4LGMA 4DSOA 3AVUA 2O0KA 1H65A 5CB8A 2WM9B 2N1BA 1UKVY 1SKYE 1FUUA 2Q3HA 4A1FA 1XEWX 2XXAB 5BN5A 3M0EA 2F9MA 1AGPA 2X1VA 4BLQA 1ZM7A 4QJ4A 3ZLJA 3L8YA 3A37A 3W5JA 3CRW1 1W0JA 1P73A 2V7QD 3IO5A 1MO4A 2BHRA 4ACBA 5J4HA 3OEEA 3KXLA 5EP3A 2UZ3A 1NMZA 3OZXA 1U8AA 2XNDD 4EQ6A 4OHXA 2NPIA 5CB6A 4PC6A 4RD4A 3OFND 3X1DA 1KJWA 3MLEA 1Q0UA 1QHSA 2QNRA 3T12A 2MSEB 1OIXA 1Q1BA 3GJ0A 1BO6A 1ZMXA 4P3YA 4B76A 1CJVC 1GAJA 1M74A 1T5LA 1DS6A 4PO1A 4RFSA 1R5OA 1XD8A 2Z83A 4Q4HA 4Q4LA 5GVSA 4EJSB 2F1IA 1H8HD 4A9AA 1AN0A 3HPQA 3KXIA 2VSOA 4Q9LA 2ZM5A 1DAIA 4IJMA 1R4AA 1E2FA 3NH6A 3OE7A 4AYTA 4C0KA 1II8B 1IN8A 3PUZA 2GEDA 2C8VA 3CR7A 4US2R 2PMDA 4QRHA 1F5NA 1QG2A 3ZQJA 2JJ2D 2R44A 1TX4B 4JS0A 4TT3A 3WMEA 4ZIRB 1KO7A 5LB4A 2EW1A 2VO1A 2FJUA 2JLUA 3BFVA 1V5WA 4MKIA 4Q9HA 1F48A 1T8UA 1RJ9B 2BJVA 5FR2A 1OXSC 1G291 4CEHA 4LHVA 1BIFA 1DE0A 1G16A 4DDWA 1VG9B 2V4ZA 3CBQA 2R8RA 3BB1A 1GITA 3PUVA 4G0NA 3AVOA 4E07A 4OI0A 4XD7A 4H1UA 2B7BA 4MYTA 2P2LA 1XEXA 4MKFA 4DLSA 5J5CA 1IXZA 3ZDQA 2XTNA 2B21A 1NKSA 3K0FB 2ZRPA 2EWVA 4IHQA 2CVHA 5AUOB 2VHTA 2ZRKA 2QP4A 4JSYA 4B3CA 2ERYA 1YRBA 3GLFA 2JLWA 1G5RA 4O2LA 4IVRA 1E2EA 3UG6A 5F9HA 2FPLA 3WNCA 4ZKDA 2FF7A 1NVUQ 3IHWA 3K0EA 3QXHA 2BMEA 3QVUA 3S1AA 3TMKA 2I1VB 2ZR7A 2I1QA 4F4IA 1RZ3A 1VCOA 3KZ1E 3O8DA 3KKPA 4Q7KA 4R2HA 4Y0AA 1LTQA 3GJ3A 3IIMA 2WWGA 3REGA 1Q1QA 2ZETA 1MV5A 1X1SA 3OAAA 4IDHA 1A2BA 1WXQA 4FINA 2KBFA 3A4LA 1F2TA 3LBNA 3ADDA 1RW4A 1QF9A 2A5JA 1Y3AA 2PH1A 4IFEA 4JYCA 3B2EA 1JQLB 2IHBA 4O0MA 3TBKA 3AF1A 4JLVA 4YONB 4ILEA 2GRJA 4QGFA 2VP0A 1Z6GA 2FPKA 2OCYC 1MO3A 3U7EB 1D2NA 4BFUA 2J3EA 1Z3IX 2ZI9A 1QBKC 5GADl 3CX8A 1P2TA 3Q7QA 2ZAOA 4KLNA 4JLDA 3ZVRA 4BFXA 1Z47A 2DFKB 4KBGA 4KO8A 4Y0VA 3B1VA 2J7PA 4BGDA 2ODBA 3U44B 5CLQA 3THYA 1SVOA 1KGDA 1ZIPA 4AKIA 5FTKA 2IEZA 4NCHA 1EFUA 3ZZUA 2ZE7A 4C0SA 1W4CA 2ZJYA 2C9OA 5IT5A 2ZROA 1NF3A 4IOKA 1X8KA 4KXFB 4L9WA 1DO2A 1RFLA 4B3BA 3LVRE 1S2MA 2FZ4A 4GI7A 1JJVA 1AS3A 3LX8A 3OEED 1LFDB 1NN1A 1SGWA 3C5HA 2H5EA 1E9DA 1C9KA 1U90A 4IXNA 3LW8A 1OH6A 2WICA 3Q85A 2H16A 2O0HA 4US0R 4QL3A 3MWKA 2Q9BA 1G3MA 2ZU6A 2GJSA 4Q03A 2EFHB 1KK0A 1JPJA 1M7BA 1OHHD 3O8RA 2YWHA 1TF5A 3ECCA 4JLKA 3ZVMA 2LCFA 2RGAA 5FOTA 5CDFE 1FUKA 1KI4A 1COWA 3RWOA 1FP7A 1OYWA 3K8YA 3GLHE 2OXCA 2R65A 1RE0A 3DOEA 5H70A 2Q9CA 4Q7JB 2GEVA 1W2HA 4JT4A 721PA 1E9RA 1KOFA 3TKLA 5M04A 4MRPA 1II9A 2GZDA 5GJBA 4XVQA 2BMFA 2R62A 2W6JA 1GP2A 4HLDA 3NVAA 1AGRA 2JEOA 1P2VA 4CRWB 3K0AB 2HLDA 4ARZB 5UKDA 3FKQA 5CITA 4CEJB 3DM5A 1G9XA 3AP2A 3SHFA 5KDLA 1RVDA 3HDTA 2YJTD 4HLCA 2ZS7A 3F3YA 3FHOA 4L5BA 4HEJA 2ZQ5A 5DYGA 4GNKA 4PO9A 1G41A 2AR7A 4AYWA 4DZZA 4C0QC 1KI9A 1ZNWA 4DDTA 4RD3A 3J81k 3GJ5A 3LX5A 3GJXC 2XEXA 3THXB 4WXRA 2HCJB 1ZNZA 2PX0A 4QG7A 3EWSA 4FMDB 1AJEA 1X8LA 4AI6A 2HUPA 2YWEA 4UNNA 2DWPA 1E98A 4DLYA 5HE8A 3SOPA 2OFXA 4LJYA 1OFHA 1KAOA 1NN3A 4Z1MD 1KMHB 1KO5A 3SFZA 4QHTA 4ZPXA 4PC3A 1GILA 1BYUA 1Z28A 3H86A 1XCMA 4GOJA 2ZIAA 1NLZA 2FG5A 2BEKA 1CRQA 1KDTA 2GBLC 2W0MA 2EYUA 4DLUA 1XP8A 2GTPA 1G7SA 1O3YA 3RS7A 5DN6D 5HR5A 1U0HC 1RRFA 1KI6B 1X3SA 3K1JA 4KU4A 5JJIA 5E7MA 1F60A 4GDFA 1U81A 4HAVA 1GIAA 4B33A 2W2XA 4NZYA 1TU4A 3B1ZA 2IWRA 4LK2A 3B6EA 1XU4A 4BEJA 5KTYA 3T1TA 3PEYA 4NE2A 1G20E 4PC2A 4IRUB 1G5TA 3I61A 4G3XA 1IN6A 1E1RA 4NYMQ 3W3ZB 1YKSA 4F4JA 1L2TA 2P5TB 1Z8FA 1ZP6A 4FN5A 2Q0HA 3IPXA 5HCIA 2WWFA 3SNHA 2GILA 3PIRA 4LJ5A 4PSAA 3C16C 3MWLA 3HU2A 4ZDJA 3LD9A 3KQHA 4TMTA 1T8TA 3ADKA 1G3IA 2WJJA 4JVMA 2ZITA 4XVUA 2O8EA 1GG2A 2A9KA 2FN4A 4HDQB 4P32A 3D8BA 2K5UA 4S2EA 2BBTA 4JBWA 3ZJYA 4V0LA 2WJIA 4X8LA 1UKEA 3PFIA 4KFTA 2DPXA 4CW7A 2XITA 2P5SA 2QEQA 3GFOA 4TLAA 2PLFA 1QHXA 4URVR 1Q3HA 2ZRFA 3B13B 4HUTA 2ZANA 1XEXB 2CHGA 4BRUA 2BBOA 3GPLA 3X1XA 4BLTA 1W7AA 1MOZA 3U44A 5JI3E 2A5DA 2ONKA 4GSYA 3F0TA 3K9GA 3TVTA 2DBYA 3PENA 3RABA 5FR1A 5J4YA 2NOAA 3VX4A 3ZS9A 2WKPA 4QHYA 4GL2A 1N6IA 4B71A 3KL4A 2FX3A 4CEHB 3QKUA 4DBLC 1HV8A 3LFUA 1XPUA 2W2VA 1OLOA 2X2EA 3H2YA 4UXIA 3OIYA 1JPNA 2QU8A 4Q00A 3QKRB 4OK5A 3TQCA 4F93B 1Z06A 2ZJZA 2IWHA 3RS2A 2WPDD 3U3MA 4G5OA 4ABYA 4Q9JA 3QSYA 3Q3JB 2WIAA 3KJHA 4IXMA 1ZYUA 2W83A 5LDDC 3T15A 3SYLA 2AKYA 3R9IA 1KAGA 4MGKR 4EAQA 1O87A 2ASEA 3NBXX 1FTSA 4KI0A 1VIAA 5EP2A 2CHQA 2G9NA 2A7QA 4B74A 2WMOB 2EYQA 3ZYCA 3PEWA 2FPMA 2ZSDA 4UKDA 1YU9A 1GVNB 1C1YA 4RJLA 3FHCB 3U60B 4D4KA 4FCVA 2O8BB 1M7HA 2HLDD 4C0BA 1CXZA 2AX4A 1ZNYA 2CCKA 2OBLA 4Q9KA 2NPFA 3F8TA 4Q1EA 2QT0A 2H8KA 4TMKA 5K8TA 4LBVA 4PAQA 3H4MA 1W4BA 1VHTA 3CH5A 1RKBA 4DCSA 3VR5A 2ZRJA 3N2IA 4IVQA 4BZQA 1NN5A 1CF4A 5JLJA 1M1YE 2GZHA 1Q44A 4YDSA 3NWJA 1VG8A 4HLUC 2GJKA 821PA 3GFPA 2ZI5A 2WAYA 3ZD6A 3R7WB 3B5JA 1UDXA 4DSTA 5GJCA 3HU1A 2KWIA 2YNMA 3MJHA 1VYTA 2Z4SA 1BS1A 4TL8A 5BWMA 1H8ED 2RB4A 5J40A 3THOA 1PV4A 2FDCA 2VP4A 4QHSA 2BKEA 2HDNB 4FMCB 1DEKA 2CL0X 5HE9A 1KK1A 3PEUA 4LYFA 4NCKA 2J59A 1PJRA 2GK6A 2WPDA 3GD7A 3NBYC 1XCGB 1SXJA 2NZJA 2EFDB 1W47A 1CJKC 2CJWB 3PV0A 1NP6A 4EJSA 3N70A 4A0RA 4BFTA 4MGZR 5GJVC 2V6IA 5JS8A 4OQLA 2QSYA 4AKEA 4FWIB 4BZXA 2R6AA 2XNSA 2PLRA 4B3FX 4TWZA 4YMUA 5H8WA 4PAOA 2YHSA 2AK3A 2V9PA 3AM1A 4KLZA 1IY1A 3GFTA 4FMBB 2VLIA 3SJAA 4I81A 2ZJ8A 3RSOA 2RHDA 2WJYA 1E3MA 2RGBA 1EFTA 4BLPA 1X86B 1J8YF 3ASYA 1KDRA 2CVFA 2W6ID 1JR6A 1JEEA 5DE3A 1LF0A 5ELXA 4BQSA 1G1MA 1CJUC 2PL3A 5HZKA 1L8QA 5EE9A 2WTUA 1E2GA 1J2JA 4ACAA 1OFTA 2Q9AA 2Q6TA 4A2PA 1VCMA 4LBZA 3VHLB 1CR2A 2NMVA 1P72A 2CE2X 3TSWA 1U8ZA 2DFTA 3N5CA 2GNOA 1ODFA 4CIDA 2OE2A 1ZRHA 1XX6A 5EZ6B 5JHHB 5EZ5A 1JXOA 1YVDA 1N6OA 5FUXA 2O8EB 4POAA 5B30A 4CF7A 3CF0A 1CU1A 1VKJA 2GZAA 2IUTA 3EXAA 4AIIA 4OHWA 3I62A 1EG7A 5AJWA 4QNRA 3B9PA 4PAMA 3L82B 4A6XA 4EQ6B 1HT2E 2XOKA 4LV8B 4MGYR 4UXHA 4XTRA 2R9VA 1G8PA 1YHNA 1YR9A 1KY2A 2X2FA 2JJ8A 4JLPA 1W36B 4ZCIA 2EU8A 4NL4H 1CR1A 2UZIR 3LXRA 2ORIA 3CR8A 3L2OB 1QVRA 1XZQA 1D6JA 4W5HA 2R6FA 1XPOA 4P4SA 4A15A 2FSFA 1UBFA 2QE7D 3RRZA 1JI0A 1Z07A 4JBYA 4OQNA 3CNLA 5JZVA 1NMXA 3WYAA 2CEAA 1FTNA 3ND8A 3TRFA 1MH1A 3AKCA 4PC7A 1E2IA 1SXJB 3AGPA 2AK2A 4MDFA 2RKOA 5DSZA 421PA 1OH8A 1NMYA 3HU3A 2ANBA 2ZREA 4DCNA 3HR8A 4PO8A 1CEEA 4DEYA 1JJ7A 3BS4A 1W49A 3C14C 4C0AC 3TH5A 5F3WB 2FNAA 3C4JA 1E99A 5TY0A 1NRJB 1UBEA 3CZQA 1NI3A 3WHKA 4A2QA 2QSZA 1TUIA 3B85A 5CDFA 5KOYA 3GLGE 3KJGA 2ZVPX 3JVUA 4TMWA 3QG5A 3V4FA 2VHCA 5FPYA 3K9NA 2OAQ1 2V7QA 1ZINA 2YVUA 5L3VA 3THXA 4LWZA 3BFKA 3UWKA 4C0HA 1YZLA 3IIKA 3LW7A 4WZAE 3VR6A 4Q47A 2VHJA 2Z5FA 4NYJR 2GJAA 3SYKA 1T6NA 1U0JA 1W0JD 3AH8A 1P75A 4N0DA 4TQUS 4Q4JB 2VL7A 3QNUA 4OKSA 4TL6A 3W6PA 2F1RA 4HDOB 4WAUA 4V03A 4CEIA 4DIEA 1S1MA 2GVDC 3A1TA 2FFHA 3QG1A 4EPWA 5C2JB 3CX7A 2QMUA 3I1FA 4HB0A 1N0VC 3BFXA 2B7CA 2V1XA 1HH4A 3IQXA 1ANKA 5DISB 5EQTA 3GLHA 2OT3B 1KSJA 2YWFA 4PSVA 2IUSA 3CUEF 1CTQA 4M53A 4ZDIA 5E7IA 4CGZA 4RZXA 4A0GA 2WWIA 5FTJA 1PLKA 5CJPA 5J4LA 3BB3A 4JVLA 5DO9A 3N2EA 4B3XA 4BUJA 2NZ8A 3R9XA 2ZRNA 2N42A 4NDZA 4MYUA 1XTQA 2E9SA 3KB2A 3P32A 3H0KA 4M9XA 5CM8B 3FDIA 2DR3A 4XWOA 4NHOA 5EE5B 1N5LA 1F6BA 2D3WA 4BWYA 4FMCF 2YINC 1YRAA 3FHTA 1US8A 2P67A 3WNDA 5IRCD 5L3RA 3B82A 3AVYA 1II0A 3JZAA 3MFYA 3CH4B 2WIBA 5K8LA 4XWAA 1GKYA 2WJHA 4BECA 2O8CA 3CKLA 4TTRA 2QORA 1LB1B 2MSDB 1XTSA 3W8RA 4BLSA 3VR4A 3NBFA 3R8CA 2VP2A 3EARA 4C7OA 1DAKA 4KYUA 2OM2A 2ZI6A 3BC1A 2W6JD 3BAFA 4JVNA 3PG5A 5HKKD 5KUTA 5EXSA 4ZIRA 4Q4AA 2O5VA 4QGAA 4V02A 3SN6A 1D5CA 5B2ZA 2MMGA 2OZEA 5CK4A 2NO6A 1GSIA 4D6PA 3FKSD 2H18A 3WY9A 5KNDA 2OG2A 2PCJA 1UPTA 1XMJA 1II8A 2FV8A 4GP6A 3SI7A 1FZQA 1EESA 1HEIA 4MQBA 4G5GA 1VYUA 1YR6A 2X8AA 4DLTA 1SVLA 1IJEA 4NYJQ 2O8DB 2E1RA 4Q4HB 3IILA 3ICQB 1AQUA 1NL3A 4R71A 4BFWA 2KJQA 1Z08A 1M34E 1RPZA 2IX3A 4URZR 2IF0A 4BASA 1WF3A 1VG1A 1JB1A 1N6HA 4HLUA 1KI7A 1A5TA 1S96A 4IFBA 5FOSA 5K8UA 5A0FA 4Q5IA 1DG1G 2BM1A 1LS6A 1Q12A 1ZAKA 3B1YA 3CNNA 1XB2A 1AKEA 3GEIA 2XAUA 2OXRA 3NXSA 2FE4A 2B8TA 2FFAA 3MWJA 1XNJA 3IO3A 5DH9A 4C2TA 2BEJA 5IK2D 3FPAA 1HT1E 3PR1A 4CZ2A 3KFXA 3MD0A 4V0NA 3T35A 3AVQA 2CXXA 3QI2A 2GF9A 1OHHA 4HZUB 4Q1BA 4URWR 4B6EA 4Z1MA 1DPFA 1TQDA 4IOLA 2OBMA 3U3KA 4PQYA 2IUUA 4B2IA 1TU3A 3FFBA 4CVNA 1X1RA 2ZPTX 2FZLA 2ZUDA 4QJ3A 5TVKA 1FFHA 2OLJA 4EJSC 1WCV1 3U3JA 3TW8B 2QRZA 5KSPA 2ZRCA 2REOA 2RCNA 4YXWD 1G6OA 2HT6A 3MJRA 3NTUA 4PFSA 4XSHA 1OV4A 4QGHA 4IDQA 1E69A 4UJ5A 2ZSAA 3KTAA 5FUVA 1ZUNB 2GK7A 5CIQA 3K70B 3PCRB 1WMSA 3V00A 621PA 1Q1EA 2HYIC 5KHOC 1KMHA 4XOIA 4URXR 4Q66C 4A4DA 5KNBA 1DARA 3BE4A 5HPYB 1KIMA 2GVZC 3K0AA 3V9PA 4LX0A 1UAAA 1HA3A 3ZVLA 1LNZA 1MRNA 3VNVA 1IBRA 4KSBA 4OHVA 3TK1A 3SYNA 2I3BA 4Q48A 3C15C 3VU9B 2VHQA 4G5RA 2ZJOA 4DJTA 4JVSB 1PZNA 1YZNA 2GEUA 3CF2A 4M1MA 4O25A 1CIPA 1YZGA 2NO7A 1XJ0A 4NONA 1IY2A 3EA5A 3Q8XB 3CO5A 4KVGA 2O0JA 4U5XA 3CWZA 3RSLA 1WBBA 2FFQA 3ONWA 3GJ6A 4D4LA 3IPYA 1I4DD 3BJIC 1UBGA 2JIZD 3B8HA 4MRNA 2CBZA 2QI9C 2LWIA 5TMPA 4JL8A 3T06B 1FW6A 4LHYA 4OBEA 2MMCA 4LPSA 5FTLA 1KI6A 3RLFA 2ZU0C 3EPKA 4D26A 1DAMA 1NJGA 1YZKA 2J0SA 4ON9A 2ZI7A 4M1SA 2BKUA 3PEVA 1IAQA 1T3SA 3SBEA 3G82C 3KX2A 2PZFA 1Z0JA 1IN7A 1OIWA 3GLIA 3H84A 2BBSA 2IS4A 3HYRA 1J99A 2QAGB 3GQBA 4I4LA 4NYIQ 4IDOA 1RC8A 3HJNA 5H68A 4KBFA 4ASUD 4B35A 1K8RA 4G1UC 4YMSA 3TNFA 4D82A 1KO1A 2J41A 1KHTA 3IUYA 3P27A 1P9RA 1VCNA 1IY0A 2AKAB 4AK9A 3KJIA 3DO6A 4Q18A 1E2KA 1W36D 1IM2A 4FI3C 5JS7A 4QGGA 2OESA 5AJVB 2JLSA 1OH5A 1NLYA 2FMXA 3WP1B 2DFNA 2IYWA 2IXEA 5B64A 2IYLD 2XJ4A 1OW3B 3CNOA 4YXWA 1LW7A 4D0NA 3OIUA 1ZM3A 1F3OA 4F38A 1E79A 2J7KA 3ZH9B 2QM8A 2GXSA 1Q22A 4F7WA 5FBWB 3QENA 1Z0FA 1W1WA 2NIPA 5EP4A 1EFCA 2EFEB 4AD8A 5HZHA 3AVWA 1KK2A 2DYKA 1OYYA 1P3JA 1W5SA 3VHXA 1GDDA 2CHVA 3DPUA 2D7CA 2IBMA 5A5GA 4MUAA 2Q3FA 1NVVR 4JZKA 1WA5A 1PVOA 2P0EA 1OIVA 4TZ0A 1I4LD 1GNPA 2ZE5A 2XOKD 1Z22A 1VPLA 3ZGXA 4H9GA 2ZE8A 1XF9A 3A6PC 3LNCA 4MITA 4DB2A 2D74A 2OAP1 3K70C 5FI0B 4UNSA 5EXXA 3WHLA 1D8TA 2IEYA 4D80A 4EFMA 5ANRB 5JFGA 4PQFA 4F4CA 1XTRA 2PCLA 4LBWA 1NG1A 1FQJA 4BLRA 3RS5A 3U7FB 3NDPA 3IEVA 4W7SA 3D31A 5P21A 3I5YA 2PJRA 4TZ6A 4L16A 3HPRA 2B6HA 4HZUA 2YOHA 1SVSA 2GETA 4X8MA 2BMJA 2EFGA 3WRXC 4DLXA 4V0KA 3FE2A 2ZRDA 1K5GA 1RRGA 4EDHA 1XPRA 3AP1A 5J47A 2HJVA 3PUWA 3SE0A 3QJYA 2ZI3A 1SKYB 2F6RA 2C9YA 4DCVA 3B1WA 1E2NA 1QG4A 4A92A 4LZZA 1SHKA 2AD1A 2XTZA 2ZR0A 1N6RA 2PJZA 5BN4A 1GWNA 1KI2A 2GCOA 4RZ3A 1FPMA 4EPXA 5SZKB 4EPYA 4JYBA 5FTNA 3DHWC 4LSGA 5EXTA 3WXMA 4ZO4A 1NBME 3U4QA 3WP0A 4LJAA 4ZCLA 4B48A 2QPTA 1C4OA 2YOFA 1E94E 1OFIA 2A78A 4Q1FA 3ZQ6A 1E96A 5CIWA 1E1QD 3CW2A 4JLAA 1L4YA 4MA4A 2ZE6A 1XBTA 2ZRHA 2RGXA 1KNXA 4C4PA 4QBHA 5JHGB 2D7DA 2D4HA 5F9FA 3BOSA 4NCJA 2H1LA 1N25A 3WMFA 2IYYA 4XJXA 2JGNA 1B23P 4L8GA 2ZVQX 1P7CA 2CNWA 4JIMA 1ZIOA 2CL7X 1N5JA 4DXAA 3TGPA 2JLYA 3R8FA 1Z6XA 2PZEA 4HATA 4PANA 5IF9A 3A1VA 3E2IA 4EPRA 2VHUA 3DZ8A 3TAUA 2UVQA 3UXMA 4GMXA 2QBYA 3A1WA 4L15A 1QZXA 4LUCA 4Q4JA 1EX6A 2OFOA 2BM0A 2FEOA 1G5PA 1G64A 2C95A 1AZSC 1XMVA 2W6IA 4KV9A 5DN6A 2VYFA 1DAGA 4E22A 2GCNA 3LO5A 1GL6A 3Q7PA 2JLZA 3W3AA 3K0FA 2L0XA 4G5SA 2JIZA 2YYZA 4KITB 3A1SA 3IBYA 4QXAA 1TQ2A 5KYKA 4QFMA 1W0KA 4NP6A 4Q19A 3GLHB 1KKMA 2B92A 1XMSA 2VTKA 1ZD1A 5GVRA 3VQTA 2D62A 5JWRA 1QHHA 3RC8A 4JJZA 2F55A 1UJ2A 4PZZA 2ERXA 5G41A 3SQWA 1E2QA 1E9SA 4ZDWA 3SHWA 1JR3D 4CEIB 4XH9B 2G1JA 2ZRAA 1TQ6A 1QHGA 1GUAA 3TLXA 3TW4A 4X8HA 1CBUA 4XWKA 2IYTA 4B44A 4EFLA 4URUR 4R7ZA 2WJGA 3A4NA 1ESMA 3GLFB 1MABA 1MKYA 221PA 4LRWA 4DHEA 1OB2A 2JDIA 2BDTA 4C0LA 5AJYA 4WIAA 3RANA 4TLDA 2P6UA 1FQKA 4B3DA 1GL9B 4XD7D 5KO2A 1ZUIA 3WYFA 4B2PA 1G18A 3OFNA 1OKKA 1EWQA 5LD2B 2H7VA 3VKHA 2J1LA 3SFVA 4AYXA 2QMEA 2YZ2A 2XB4A 5LB2A 2ORWA 2IYSA 4OK6A 2OO7A 2OEPA 1JALA 5BYKA 2IXGA 3DMNA 4IOJA 1W2GA 2C96A 2HF9A 2Q3MA 2GJ8A 3FMPB 4FCTA 1CR0A 2HYDA 4MKHA 1DELA 1WP9A 4QBIA 1SXJE 1SVIA 1T9HA 4DUGA 2F1HA 1UF9A 2NO9A 2IL1A 5IK2A 5JJLA 1AQYA 3IBGA 1VIYA 4Q1AA 3EA0A 2A5YB 4PPNA 3CF6R 4RCYA 4OI1A 3VU9A 1I2MA 3UATA 2VSFA 4KYIB 4L9SA 2ZJBA 2WJVA 2YWGA 3NEYA 1E0KA 3QBTA 2XB2A 1GZSA 1R0ZA 1N6NA 4YDHB 1E0AA 5AUQA 1W48A 3ZIAA 3TUZC 3Q72A 2F1JA 3KXKA 4KFRA 4ESVA 3HWSA 1E9EA 2J46A 1P4SA 2J9RA 1V43A 5FOVA 4TYWA 1KNQA 3B1XA 1GRRA 4PSKA 5C18A 2RMKA 3CIOA 3EW9A 4PHGA 4JLBA 3KQNA 4OHYA 2IYUA 5HCNA 4PHFA 1TNDA 3KTAB 3QXJA 1XRJA 4HUQA 1KSFX 4PX9A 4M1YA 3SJZA 4LJ9A 3VR2A 2ZEJA 1EFHA 5CK5A 5EUMA 3GJ8A 2QQEA 1SXJC 4Q21A 1CULC 1M8PA 4IEEA 5FPSA 2EWWA 3KKMA 3AF3A 1HUQA 1COWD 1HQYE 3PVSA 4TLEA 5J4KA 4A36A 2OCPA 3LY5A 1E79D 3PXGA 1CJMA 1JECA 1K5DA 4HB2A 3LBHA 4LDJA 1ELOA 3LLUA 3W8NA 1M6NA 2AXPA 1BYIA 3NKVA 4Z8YA 1AK2A 3TR0A 1GRNA 3U5ZB 1GM5A 5JMTA 1KJZA 3LVQE 5FOUA 1NLFA 1ZD8A 1KDOA 2WVJA 3X1WA 3K70D 1DADA 2XSZD 1XMIA 3GLIB 2ECKA 2XTMA 3U3OA 1TMKA 1JQJC 3I3SR 2G0TA 4LOAA 1P60A 4D4MA 1TF2A 1R8SA 4K81B 3UKDA 4WBSA 3U6KA 1KKLA 1CRPA 1G3RA 5K8IA 3TE6A 3U3RA 4JT2A 1TF7A 4W5JA 4FD2A 4YMVA 1GNRA 4QKQA 1QVAA 1G8YA 2H57A 3DOFA 4B73A 4PZLA 2HXYA 1G8FA 4KJZA 1G7CA 1ZVQA 5FBQB 2JASA 1KYIA 1YZUA 2GXUA 3FVQA 4G01B 1EFRA 1CP2A 1MR3F 1E9AA 1ZCAA 1OF1A 1JR3A 1XXHB 3UMFA 1S1CA 5DLQC 3EIHA 1NSTA 1G21E 2BWJA 2GAAA 1KMQA 2JJ1A 2VP5A 3DKVA 1NY6A 4J0QA 4X8OA 1IN4A 4JLOA 3RRYA 2CE7A 3R20A 1XXHE 1MT0A 4EIWA 4P0TA 4UJ3A 4JJKA 3L0OA 2RGEA 2QAJA 1E4YA 1GTVA 2GWHA 3M4YA 1ZU4A 4B32A 4IVPA 2J87A 1VCIA 2P6NA 1U8YA 4TN1A 1VYVA 1QHNA 1FP6A 1R6BX 3RAPR 1G4AE 4DKXA 1AS0A 3BH6A 2VH5R 3BD9A 2JJ2A 2WSSA 1YQTA 2WWWA 4IDNA 4JLMA 4BRWA 1XD2B 1KJYA 3TSZA 2XZOA 1BMFD 1E9CA 1S0UA 4RFSB 3CX6A 3QPWA 1G7RA 3KQLA 2XJ9A 2LKCA 4TQ9A 4HI0E 3W9YA 2ORVA 1RYHA 4JBXA 4V0MA 2P65A 1OXUA 1IJFA 1W46A 1G4UR 2CMKA 2DWQA 2KB0A 1DTSA 2O8BA 3CRVA 1LF5A 5LPNA 4AY2A 1TADA 5B57C 3GLFE 1CJTC 2REXB 3AB3A 3OHMA 5EXPA 3EG5A 4TMZA 2W2TA 1LVGA
chains in the Genus database with same CATH superfamily
3S55A 1D0SA 1B8VA 2RGCA 4GPZA 1G8JA 4X84A 3ZHVA 4B8WA 1XKQA 1VGQA 4LYAA 2BFEA 1RXUA 4RHXA 4BFZA 3ZY3A 1FIUA 1W93A 1IC6A 2CNBA 1TM4E 5KYUA 2HA6A 4GLOA 2OCAA 1U5CA 4OJQA 4B3DA 4WECA 1HURA 3THYB 1F9AA 1RQGA 3OF5A 4IFTA 1KHHA 4LC9A 1F0KA 2IYRA 4YRGA 4PG4A 1KPGA 5AM4A 3QXSA 2AZXA 1MC8A 3BTUA 4O59O 5CT9A 3TW6A 3CE9A 2DFPA 2ZPUA 1TAQA 2NVOA 2QWXA 5CFZA 4MGIR 5GV7A 2BLNA 2OZVA 4NSNA 1XHLA 3MUNA 1PLLA 3K8QA 4K3VA 3T3DA 1RZVA 3O1IC 3QXXA 1Q50A 3BTSA 1YR2A 4JI2B 2QP9X 2L18A 2IZ5A 3WDKA 1JAIA 1JI3A 1P0CA 3LCJA 4OK3A 4Y2VA 4CM8A 4RTRA 1PDVA 1V4NA 3KJXA 4CM3A 2R47A 3KFVA 4CHTA 2YJ3A 5KYYA 1HFWA 2C5LA 1ZJJA 1OWNA 1UK9A 2JA1A 4IWYA 4OHPA 4BFYA 4JWKA 3N6XA 2FPGA 3PHHA 4P53A 1ZMOA 2HKIA 4OKIA 2GLUA 1WTCA 3JR7A 3ZWPA 1MIHA 2NO1A 3TR5A 4F3NA 3IP7A 3GMIA 4BQQA 2JFQA 3HRHA 4ESHA 2VYND 3G9UA 1ZW6A 3EGCA 2G83A 4X3CA 3CINA 2RDMA 1FFDA 1GDHA 3HA7A 1SBHA 5TPWA 4CKCA 1FNCA 3UOWA 5IJ0B 1I3KA 1YZTA 2JK1A 4RD1A 1IK6A 1WPQA 5CT8A 1QHYA 3G5MA 4MEBA 1AHIA 4BMOB 2J7PD 1AKTA 5HKKA 3GZNA 3I4LA 2CFTA 3KOZA 4FFNA 3FKJA 4MKGA 5E6UB 3WYGA 4F2PA 4INPA 16PKA 2WIDA 2Y0DA 3FPLA 2X8WA 4R2XA 2YFHA 1NP3A 4EG3A 5IVHA 1CVLA 3U7QA 1LBIA 4TKZA 3S5UA 1WB5A 2E87A 2VDPB 2XQVA 3IHLA 4IICA 4Z0TA 5J4VA 1WHSB 3ZX5A 2MSWA 2XWSA 4O4IF 5JAIA 3PT5A 5EUQB 4N3NA 3EQ8A 5C8YA 3CIFA 4YEDA 3LCUA 5AXAA 2D2FA 5THXA 2PKYX 3UAWA 3GJ7A 1BSVA 4EBFA 2QV7A 1M0SA 1S2LA 2CNOA 4DV5B 2W2LD 1J1IA 4I7EA 1YHYA 2ATXA 5JEDA 3DHEA 2VWPA 1JJFA 3ILSA 3WX0A 5AVVA 3G7NA 3CQ9A 1UJ6A 1Z29A 4NPCA 3CURA 3THSA 4UM9B 4B7AA 1W88B 3WBKA 3N05A 1YVRA 3PQ7A 7ADHA 2ZYUX 1CY8A 1HG1A 2F3SA 2NGRA 3W6OA 3TZ6A 5JZSA 1Y8QA 1PR5A 4KK3A 3DXZA 2A8YA 4DUZB 4LYHA 1G5FA 2BR5A 2XMGA 3IMKA 3MRXA 4JSRA 4LECA 3RQSA 1NNUA 1DX9A 1PEDA 1E1QA 1E8MA 4X41A 3SQXA 4X1IA 5F3RA 1IPEA 2P7IA 3S2GA 4TLBA 4TMVA 3UN1A 2GBCA 4YRKA 1RMYA 3H1FA 3T1OA 1KO4A 3H9GA 3BVPA 3FVVA 1JHRA 4QULA 4CEJA 2FR1A 4LTDA 1DX4A 4B79A 2A86A 4LE0A 3MBKA 3PGXA 4QT4A 2H9AA 1U4OA 2Q2WA 4M2LA 4M8NE 4XQ0A 4QQFA 3V1YA 3FPCA 2RI6A 3B7PA 1C8BA 2G1PA 5FI1B 5G0WA 3INYA 1PNOA 5JASA 4ATNA 5D3MA 1V16B 3CGWA 2IE0A 2J3HA 4YJDA 1QFSA 1V2HE 2W2KA 4BAZA 1EFPA 3UUEA 4IPTA 2XOXA 3HCWA 1A77A 2GCOB 3MTQA 1EI9A 4R9VA 1JHZA 1Q19A 2XMCA 2Z2ZA 1TMOA 1JAYA 2H00A 3MYRA 4NYIR 3L07A 3PXCX 4B3TB 4P7FA 3LK6A 3AXSA 2NYUA 4QYMA 5E3HA 3AYXB 4BAUA 1NOJA 1PTKA 3QPVA 4JEHA 4MUYA 3C3JA 5AR1A 1ZGGA 4BTVA 2FRDA 4GOXA 5KOIA 3Q7EA 2V5UA 5JI2E 4KODA 3FTPA 8ADHA 3WLOA 4RK1A 3FAZA 3HZHA 1XFAA 3OJEA 4AWXA 2D6FA 2IDMA 1H5NA 3K9CA 4IILA 2C7PA 3W7AA 5LBIA 4GPIB 3NZEA 4HNRA 3T5GA 3MJSA 2ZSKA 4S0XA 4CR6A 1YVEI 5C4MA 4LF4B 1KYXA 1RHKA 2IP4A 2J3LA 4JP1A 4UHKA 1BHO1 1P62B 1WCWA 2YV5A 5AI8A 3T7AA 1MJNA 1PWHA 1XVVA 1JHPA 3NHMA 3LNTA 5AUPB 1Q5PA 1W44A 2H63A 2R60A 3VX3A 1TA0A 1JE1A 2B37A 1RM5A 2YJ5A 4OUDA 4OU5A 5AXBA 3T7TA 2ZJ7A 2YFYA 3V8MA 5EJIA 1KOLA 5CBPA 4GPTA 3II6X 5DXFA 1J25A 2GF2A 1SPBS 2XY4A 3QF4A 4RZ2A 4RZUA 1FCJA 5KWVA 1PEYA 3VR4H 1BRMA 1QDLB 4WPGA 5K8CA 2G8LA 1GRQA 3DLCA 4L5YA 3M6FA 1IPHA 1XYVA 2M1ZA 1ZEJA 3V7UA 1RKQA 3AB8A 2PFSA 3KAKA 4FU0A 4L5AA 4P3NA 1Z9BA 4Q1DA 1Q83A 4WW0A 4CTOA 5HX7A 3EAGA 3AC0A 3C1OA 4K0RA 4JQYA 3O8QB 2ZYHA 4LJ4A 2A3RA 3W3AH 4P31A 3WNBA 3E2MA 5C8XA 2K4MA 3UYKA 2XTJA 1ADFA 2YHIA 4R0VA 2A5LA 3S44A 1U7TA 2B7LA 3OE4A 3STUA 2I55A 1OFUA 2M9MA 2PSDA 4IHJA 3CZAA 9ABPA 4AJEA 1A0OA 1Z15A 2WLTA 1WSAA 4FZVA 2NLOA 1JIVA 4ALJA 5ITZB 4G1VA 2B8WA 4AG5A 4OX9B 1DO8A 4DS3A 1C1DB 3FNHA 3T9DA 4IVNA 4KIWA 1ZOOA 2PT7A 3NTOA 4K6GA 1Q1GA 3LLVA 1MB2A 4D3ZA 1WKBA 5HF6A 1E2BA 2O6HA 2YWRA 1M67A 5A06A 2F43A 1KIAA 1M2OB 2WV9A 4V0SA 1A9XA 1GNVA 3AJRA 1V1RA 4PY2A 4H7EA 4MYCA 2O8FB 10MHA 1HETA 3H99A 3UT5B 3VO8A 1GPNA 3AHDA 3JQCA 3SYTA 1HDIA 1IZ9A 2YC2C 2XIJA 4MIOA 1XDBA 2ZAYA 1UMDB 1X7YA 2W7TA 3RYFA 4B2LA 4MW4A 3SBOA 3OAAD 4YAGA 3ZV5A 4G41A 3ADOA 5DYTA 1WHTA 4ZOAA 4II3A 3SJBA 2BUBA 4IQGA 4B8YA 4MVJA 2QRVA 4N3CA 3EEYA 3F78A 1MXFA 1J00A 1Q0QA 1G38A 2Q28A 1V25A 1ATZA 3KWMA 4PCAA 2A9VA 1LD3A 2JJ1D 4OLBA 3SQMA 1ZC3A 1I14A 4BEVA 4ROSA 3I1IA 5BQOA 4FGJA 4LIPD 2D2IA 2NNWB 3FLMA 4AL4A 2R4UA 1N7JA 2E55A 2HZBA 4KIGA 4COOA 5AHRA 1YU6A 3QLUC 3FTCA 4P36A 4P38A 1A9QA 4MP8A 2OGUA 2F3UA 4Y1FA 3T34A 4LNAA 1TCBA 2YNMC 4AKSA 1MJGA 5HKLA 2GF0A 1FYEA 4JXJA 4ENRA 2Q3JA 3VDNB 5AMXA 2FPOA 3DOOA 3KKLA 4AG6A 4DB4A 3GA5A 3BL8A 1XLVA 2HJSA 3AHEA 3C7AA 1Z75A 3M9WA 2YYSA 2NVUB 1QXSA 3TQFA 4MWSA 3FYHA 1LKZA 4CIYA 4R9NA 4RFVA 2C00A 3C3MA 3PQ2A 1J70A 2XKJE 2OQVA 3W2FA 1EP3B 1Y3BE 3NOXA 1XLUA 3SIXA 4DNXA 1LDEA 2G1UA 1QV9A 4LHWA 4JY7A 1Q2UA 2GUGA 2R7KA 3D4PA 3W7VA 3DE5X 2ZYWX 3HJCA 3IJRA 3L7AA 4GLFA 3SEQA 1VLMA 4CV0A 5JANA 4NFHA 2XODA 2XMDA 4HJRA 4DFDA 2W8BA 1LWNA 3PDIA 3AK4A 3IT3A 4Y9UA 5TJ9A 3HLKA 4EUKA 1N2GA 3MUOA 3FGNA 1Q7BA 1FJGB 2ZJAA 3UWOA 1DBIA 4EK9A 1J4AA 4ZQFA 1PQ4A 2W6OA 3O26A 4AURA 4BB0A 1B00A 2AC4A 3DVSX 3JQPA 4Q34A 3C3EA 2NQTA 4TN5A 4DM3A 3Q3VA 1FP1D 1UEJA 4M0PA 2V3VA 2VPQA 2WSIA 4CLDA 5LSAA 1V3TA 5ELLA 4E6EA 4JXXA 3H2JA 2P4SA 3N7AA 2QL5A 3SC2A 1YE3A 1ZSYA 3ESYA 3UYLA 3AMVA 4D6YA 2BR4A 3RM3A 2D4AA 2LV8A 4X1KB 3YASA 4Y2QA 4WOKA 1Y4UA 1Z6TA 3KDAA 4ZGWA 3O1HB 3RUIA 3PGMA 2C2MA 4ZHQF 3ZE6A 4YCLA 4GFDA 2JBAA 4F5EA 3WK7A 2J0UA 3H42B 2D2EA 2H5JA 5DT9A 2YZKA 1JU4A 1QZTA 1IOZA 5EP1A 3EUWA 1UDRA 4FSDA 4MXDA 4C7XA 3OZSA 3I72A 1XTJA 2FGKA 3H83A 2DUMA 1BWPA 3TUJC 4TSFD 4WZBA 4BNGA 1ZH4A 1A96A 3OOSA 2QPLA 3JZMA 4YRJA 4CL8A 1RT9A 4P6VF 3P9KA 2RAFA 1ZD5A 5A4JA 1S9DA 1DQPA 4H1VA 1KVRA 3LCCA 2EV9A 3S27A 3VNUA 1QX4A 3TVDA 4EECA 1UBSB 3PRJA 5G53C 2CGEA 1XCOA 4P82A 2Y1EA 1UM9A 3P20A 1Z18A 1LY1A 2EEZA 1XTBA 2QTFA 2GO1A 4YJKA 5DTQA 3T0FA 2PV7A 1Z2AA 2ZIVB 3NDBB 5T57A 1U2GC 3B12A 1GLNA 3AESA 2GRAA 3TCNA 3TVYA 4AW9A 4D0SA 1FXSA 3BWDD 1HSZA 3HBAA 2JZNA 4L0QA 3VAAA 4DYDA 5DM70 4JC8A 5CGQB 3R1IA 3PFHA 1H2WA 1L8LA 5HF8A 3IA7A 4K8RB 4Q7MB 5KTTA 1USUA 1WEKA 1BS2A 4FFMA 3F1LA 1R4NB 2O2XA 3G13A 1Q1AA 3PJDA 1UDWA 4M9CA 5ALUA 5C9ZA 2JZCA 4M4SA 3BMNB 2ZBUA 4ND2A 4P98A 5CD1A 4M1OA 2DMRA 3SZ3A 2HIHA 2Q3LA 4EZIA 1JFRA 2JNWA 1ZJ6A 1QP8A 4D0GA 3MCTA 1GG5A 4FR5A 2C99A 1ICIA 1R18A 3I30X 2P3LA 4IJWA 4PAGA 3RROA 3U0VA 1JQBA 2I54A 2I76A 1JUDA 3IIJA 3LP8A 2JCSA 3O5AA 4AJJA 2R6DA 1LNSA 2ACEA 1L7VC 2XNCA 4RNCA 1D7AA 2NUTA 1XTIA 1ZXBA 3H6HA 3KETA 3DXFA 4K05A 1YDEA 5E1OA 5IF3A 1S7GA 1CG6A 1ZH0A 2E37A 3O83A 5NLLA 2ZB8A 4PRZA 1QYDA 2FWAA 2CF6A 3HYLA 3IP3A 4H17A 4JB2A 4EYSA 1DCFA 5KYNA 5IFKA 1NBIA 1P3DA 2H92A 4KAXA 2VNSA 4D8TA 4FW8A 2ICAA 1GKUB 1XTTA 2H1IA 3JWGA 4JJ4A 4J0DA 3TSYA 5KWJA 2PH5A 2WYVA 4IQ4A 4GOKA 4ZI2A 1GVHA 1M0WA 2D7JA 4OO3A 4TV8A 5KAPA 3KZOA 3OPYA 1GG8A 3N28A 4LI0A 3TUIC 3BMOB 2OHXA 5F2EA 2Z3ZA 3EC7A 3NT4A 1PFKA 3OZWA 4Z0HO 2FLVA 2QYHA 3OCJA 5DIFA 4IIFA 5JBQA 3NDJA 2AVDA 2I4OA 2V3CC 2G9RA 2PS3A 4HAXA 1K88A 1XQWA 3H9JA 3OCVA 4DGQA 4EELA 3OZFA 2FWJA 2O2DA 4ZQGA 1G6HA 5IM5A 3TZKA 2Y9PB 1D2EA 3GZTB 2ATVA 5IKXA 2QGZA 4I5DA 5AKGA 3L93A 1EJ2A 5IAJA 3QFSA 4CPDA 1I33A 4P4SB 2CB0A 2QOEA 1MAWA 2PEYA 3D7SA 1CQIB 4W6QA 2ZTUA 4LA4A 5L7YA 3RVOA 2UKDA 5JW6A 1ZM2A 1R0YA 3NG1A 3ZD8A 1EUQA 2DCMA 2CVZA 3A9WA 4KWIA 1XWIA 1X94A 2CLDX 3QV2A 3KKQA 3NFYA 3DC7A 2QX9A 3CWQA 1N2CB 1ILWA 1GFIA 2PWBA 3DW3X 5DM1A 5F33A 4FNAA 4K1XA 4JFRA 4GD3Q 4BIMA 5FOXA 4E7OA 4EI7A 4JNKA 3GLKA 4DMHA 1WNTA 3MJ4A 2IPXA 2G0NA 1SU6A 2J33A 3HXLA 1HBJA 4G6ZA 4QUAA 2XWBF 3FVWA 4UTXA 4MKRA 2O5RA 5A6VA 3F98A 2BMDA 3MRSA 4BO2A 3VOAA 2O19A 1JAXA 1EB9A 3K8ZA 1YS1X 2A7XA 2DKOA 3FYUC 5TQ2B 5AVYA 3LLMA 3AFIA 1PLJA 2CZQA 2INGX 4KP7A 5SZHB 3RTEA 3WGHA 4LFBB 3ABIA 2WWYA 2R8ZA 1TEXA 3GZJA 1Q0TA 4X1OA 1NUUA 5A0VA 4RKYA 1MO5A 3CGGA 1WUJS 2ZRIA 3DWEX 4MHOA 1FVOA 1OFUX 4BJ5A 1KYZA 1T3GA 1FX1A 1FU7A 3DG9A 3BQMB 1O03A 5B2FA 5HTKA 2EKDA 4CTJA 2BFOA 1F14A 4IZHA 4B5LA 4A6PA 3X1ZA 3IQGX 1E5VA 4NNJA 1C8LA 3LUHA 2NNLD 4MRAA 5LQNA 1XZAA 2GXAA 3E61A 2P4QA 3EC2A 4KLRA 2WSBA 4REMA 1E2MA 1Y1SA 3E84A 3N2YA 3RK0A 4QYWA 4RAOA 3VZPA 1XD9A 4EO4A 1XA4A 3EXHC 3BK7A 1CNFA 3D8UA 2UZ0A 3A6LA 3B38A 3QTLA 3I8SA 5CLLA 5TS2A 1QGAA 2FKAA 2WFMA 2QAGA 3WJ7A 1NUSA 1ADCA 3RYHB 4CM1A 4JKOA 3OU7A 2PNFA 1NLUA 3L6CA 3TJZA 4KE8A 4MWEA 1JG3A 3PFBA 1O54A 1HFKA 3LQQA 3GY0A 2IS2A 4NR0A 3F90A 1F8UA 2CCJA 5EWLA 5HYVA 3JWHA 3OC0A 2XI4A 4MLPA 3WYCA 2VF5X 3ZHRA 2VPIA 2D5CA 4O0LA 3T4UA 4MUBA 1JFVA 5HKOA 2X3YA 5LZ4A 3IAHA 4HQ6A 3OF2A 4EJFA 2BE7A 2V98A 4KQMA 4PPQA 2YQ4A 3BE6A 3CLTD 1O8BA 1ZD4A 2O8DA 3VTKA 4DQVA 1ISFA 3BXGA 3SMVA 3KD2A 3IKJA 3G8CA 3FAKA 3VKWA 2CNWD 1JSZA 3LWDA 1I4TD 3G0IA 4YPOA 1P0MA 1X13A 2QN2A 3VZCA 2TS1A 4KOEC 1MABB 4BL5A 3CSUA 3FD8A 1MB3A 3H97A 4HEQA 1I5RA 2IHYA 2OUKA 4WCFB 3D4NA 1A2KC 4Z7OB 4O2RA 5LJIA 2CDRA 1CJSA 4EFNA 2YKGA 1XZNA 1IN5A 3EF0A 1J90A 1Y8RA 5ENVA 2WDZA 3TQQA 4DCUA 4XRRA 5JBNA 3QX9A 1YVPA 4LFAB 3D4BA 1Z8HA 1I1NA 1H2XA 2NG1A 2I4MA 2WW8A 3KXPA 5FPKA 1IEVA 3G88A 4QRIA 4WE3A 3JQAD 1S3SA 1X7ZB 2FZWA 4ANFA 3UC5A 1H05A 3Q9NA 4HAIA 3A1DA 1PWXA 4EFKA 3PUKA 4L1KA 4WUVA 4OTZA 2ZR8A 4TX1A 1I6WA 5EKTA 1PS9A 1Z4MA 2RHMA 1QHFA 2F1KA 4V2IA 1FNNA 1Z63A 2WWTA 1C41A 2ODWA 2CJXA 5F12A 4YIHA 5EHNA 4RKEA 5HFAA 5FUBA 1FRZA 2XRYA 3KEGA 4DLNA 4EEKA 1P1BA 2F8TA 3M2PA 1Y98A 3CCCA 2ZJ6A 1QPZA 1VPEA 4KN5A 2IEBA 1JHQA 2Y71A 2JVKA 2PT5A 4M1KA 5B3AA 3R3JA 3RKRA 3RWMB 1XRNA 5JRJA 3PCXA 4Q9IA 3DXXA 3KHKA 3O74A 5GONB 4BV3A 3EXG2 4CT4B 4FB4A 1SELA 1G3QA 1U3WA 1Q0HA 1EIZA 4U39A 3DW1X 1YOBA 3C3AA 2DB3A 4EMTA 1NU8A 1NUQA 2F8MA 3AWDA 3EGOA 5TEVA 5DNYB 3R7LA 3A2MA 4DCOA 3KV1A 1K8ZB 1RJFA 3E8XA 1NNSA 2EARA 2WT4A 4H08A 1RJDA 1F2TB 3CEPB 4BFVA 4C0JA 4MW1A 5AFSA 4QM6A 4OD0A 1SVWA 1XZPA 3SDZA 3JQFA 4CIVA 4BOYA 1R5NA 1JAHA 3FTQA 3X2FA 2PAFA 3PGLA 3ESXA 4LZWA 2PRSA 4BV8A 1X87A 3IIEA 4RKWA 4NI5A 4RYDA 4WNIA 3FMFA 4L9AA 4GM4A 1L1QA 3K9HA 3P0IA 1J2RA 1UIRA 2ERCA 1OR8A 2Q07A 1TMYA 1HTWA 2ZLBA 4MIEA 2I4IA 2D3TA 2C3PA 3FNIA 5E4YA 3PA6A 5FV7A 4K9OA 1BN7A 1VE7A 4BLVA 1JZTA 3B1KA 2VYNA 4GE3A 4BO0A 3S8YA 3DKRA 2P62A 521PA 4V0OA 4BXOA 3AB7A 1UBJS 1A82A 1YVUA 2LPMA 4B7ZA 2F48A 2WJ3A 3OOYA 3QXCA 3QKSA 1JQ3A 2V6JA 3FKSA 3W4IA 3WLJA 2GDJA 1NI5A 2XXJA 1N0HA 2ZSJA 1A76A 4JX8A 5EKXA 2WJWA 2IHUA 1EFKA 1CC1S 2DTXA 5DGHA 1W5TA 3K7EA 3R5FA 2QQ5A 1WHTB 4BC0A 4C7BA 2B78A 2HIMA 2LE0A 5EVJA 3U4HA 2ZR9A 4A0FA 1ZMTA 5CA1A 2JCVA 3H6KA 3G7SA 3I2FA 2J6CA 1M2NA 1KWGA 4XIGS 3E7DA 3BBPA 1B2LA 1AMUA 2QVZX 3W5IA 3R74A 4ALNA 1ORVA 3KJEA 2NUPB 1YR7A 3JD1A 1BW9A 4KIUA 4L6CA 5EFZA 1P9NA 4XVRA 3UV7A 2HRRA 1JNXX 1ZBQA 1JDNA 2HLNA 1VPTA 3NAZA 2GN0A 2R8OA 1ZZEA 1UXJA 2WILA 3EDOA 3QEJA 4KC0A 4ZEXA 3RS3A 1XDGA 3KVNA 4D98A 3QVMA 3KQUA 1R1DA 4ZI7A 4I50B 5DHAA 4AP6A 4U7FA 5C1OA 1LSJA 1FVFA 1S02A 1JQ5A 2VFAA 2X9GA 3DLAA 3IAXA 2XYRA 4L0DA 4G4SP 3UTCA 3UPDA 3SR0A 3WJ2A 4TYPA 2B8EA 3ZD7A 1PGJA 2GMWA 3HHPA 3UB4A 4OFBA 5IU6A 4RVNA 5JOQA 2Z43A 5GZ1A 1GGMA 1OC2A 3M1IA 1FE8A 1WMAA 5HIJA 2O3TA 4CM5A 1EGAA 1RWKA 2FFBA 2V6FA 2R86A 4MRSA 1ZC4A 1H4TA 1RI5A 4EG6A 3I01A 1DHTA 5L3SB 3SICE 2V96A 1MAUA 2L2QA 2PKQO 2LCQA 1RI4A 1VDZA 1M7GA 3P45A 1EK6A 3QPUA 4FM9A 1CJBA 1ZNXA 3N53A 2B1IA 3BXFA 4WXYB 4P0PB 4KVAA 3BM5A 2QMHA 3A9VA 4GI2A 4TV9B 1RQRA 2BEVA 1ZN8A 4UNQA 3W34A 2ODNA 2W90A 1KZ1A 4NF2A 1ZR2A 3GJYA 1LJLA 1DOZA 1X7WB 1USGA 2QTVB 2WU4A 3IEUA 4UVDA 2IOHA 5DMHA 3DAHA 4QOSA 3TTWA 4DWJA 3U1BA 4BMNA 1D2MA 4GMDA 5EIBC 4HTAA 4GRAA 2IDKA 3EOBI 4R1TA 2AS0A 3T1QA 1FL9A 6REQA 2G3YA 1JLHA 1A27A 1X1TA 2B4TO 2B5WA 2GJ4A 2RHTA 4PFQA 4UDOA 5K3AA 3SSNA 2YW9A 5AVXA 4LXQA 4UM8B 5L7WA 3A06A 3X2SA 1Z38A 4MR8B 4R1PA 4X93A 4CL3A 1QZUA 4XOUA 1AQLA 1N3BA 3FUVA 3DYIA 4MUIA 1CS4C 3K15A 2OKGA 2H5IA 3NOQA 3R77A 2X9LA 4NBLA 4OI4A 4X9XA 3U4AA 3ZCRA 5HOEA 3FZNA 3ODGA 4JLJA 4B6PA 1LPMA 1T5IA 3M1YA 4QUKA 4Y2TA 3OKAA 3G49A 3CRQA 1EFPB 2XQJA 1QIFA 1IPFA 1E1DA 2FEMA 1KBOA 1O8CA 2Q41A 1VJGA 4L7VA 1B0PA 4RKFA 5FXMA 1KYYA 3T38A 3SEAA 4U7DA 3I58A 3KHTA 3KDSE 3O92A 1B74A 4KFUA 5G40A 3VHQA 3UUGA 5IAOA 2V58A 2VHEA 1JLRA 4F5YA 4UQLA 5E95A 2QAGC 3A4VA 4NKRA 2QENA 3ZIUA 1QTNA 3M89A 4YB8A 1Z56C 3EQ2A 4KPGA 4DXHA 2P30A 2RI1A 3GGCA 2Q5LA 3LP5A 5JSFA 1PFVA 1YACA 2L17A 2VP6A 1FDOA 4RTLA 1HLPA 1WDLA 3DBHB 1QJ4A 3R6GA 4ID9A 5CUQA 1QQ6A 2FJ0A 3WNVA 4MQMA 3MT8A 1GTL1 1NHWA 3HKEA 1KBQA 2YIVX 2EQBA 1A8IA 1PJ2A 4F0JA 4KHPB 1BH2A 1PGQA 2IC5A 3V7WA 5B55A 1PN3A 1BW9B 4HB3A 3CUYA 4HL6A 3SX2A 4AZSA 4LJ7A 1JZQA 2O3RA 3LYHA 4FDVA 1YWGO 3EYWA 3PE4A 4UVIA 5DYYA 4ZCPA 3M33A 5TIIA 3M7IA 1KH3A 4A1FA 2B1GA 2XXAB 3JD0A 2IPLA 5BN5A 4JJ6A 1R6AA 3DKIA 4LGYA 5BV1A 4L5IA 4R1UA 1EX1A 2X1VA 4BLQA 2BFFB 1C7RA 2VOJA 2ZB7A 1T2CA 2IX9A 1ISGA 1JDJA 3ISTA 1JBEA 3T5BA 2V7QD 5LYJA 1MO4A 2BHRA 3OD1A 3W5SA 3DEYX 1EQ2A 2FN8A 3NKLA 4Y2SA 5CW1A 5DPMA 2Y9MB 2OL4A 3U3ZA 3JRXA 4BJ3A 4DANA 2Z3WA 1AK1A 2UZ3A 2XT0A 5A5FA 3PXDA 4ALLA 1U8AA 2V0NA 4F85A 4OHXA 1I6LA 5CB6A 4IIDA 4YBRA 5E2BA 2JH3A 3ETCA 2DQYA 4F9TA 2AEFA 4FFOA 3OFND 4C03A 3X1DA 1IZ8A 2HSEA 5LU8A 2VQDA 4WVLA 1QHSA 4LE2A 2MSEB 3HY3A 1KAHA 5EPUA 3OCYA 1X9GA 3GJ0A 5JNSA 1EE1A 4P3YA 1ENPA 4D57A 5GOTA 1CJVC 3RGGA 4NBUA 1GJRA 4LOJA 4XW2A 4HNVA 2WD7B 4GX2A 2PYDA 4ODIA 1DS6A 2XRMA 5FQOA 2HA3A 3F96A 3CV3A 1G8KA 1YJ8A 3KOMA 4PS1A 1SHLA 1M2HA 4Q4HA 4Q4LA 4WLUA 2F1IA 1XZKA 4A9AA 1AN0A 1DJLA 2CYAA 4GGMX 3U4MA 4FP9A 1JIIA 1DAIA 2ZM5A 1R4AA 1VP3A 3NH6A 4RHCA 4AYTA 2WINI 1IN8A 1RE1A 3GDWA 3G9ZA 1DI0A 1OI2A 1IH8A 1GEEA 3QSGA 3SSAA 2Q0SA 3CR7A 4FVTA 2PMDA 2ZG6A 5GONF 3F9IA 4TSKA 3RSSA 2ILTA 1NW9B 4TT3A 2VUTA 1Y3DE 4ZO8A 5DSTA 5LB4A 4FNGA 3LHKA 2PR7A 2FW6A 3FG9A 3K0KA 1ZGHA 2Q2OA 3AESB 3G89A 3M5WA 3EFEA 1MOQA 2YJGA 4P92A 4Q9HA 4CEHA 4MCIA 2KM1A 4M36A 1GQ2A 3O38A 4Y6RA 5DV9A 1PCXA 4F12A 4DDWA 2R8RA 3UMCA 3PUVA 4OI0A 4JYAB 1IUKA 1OZGA 2LDXA 4XR4A 2ODTX 4WLFA 2AJTA 4MYTA 2QN7A 2Q2NA 1TYEB 4JUBA 3JPWA 4ZAVA 4I50F 1RHQA 2R1VB 1NKSA 4X63A 1UPXA 2O8VA 2XQGA 3K0FB 3JVEA 5ARCA 2EWVA 3HC7A 4IHQA 4L74A 2V7VA 1O97D 1SAYA 4MVJM 4DV4B 4JSYA 2W8ZA 4PYJA 4KFCA 2ACKA 2VXCA 4CI9A 1EUDA 2JLWA 1ZGJA 1ZHFA 3D1VA 3CFYA 4PLYA 4RVGA 1I1HA 1E2EA 4W7HA 4YP0A 4ZEVA 4O4JA 5CLGA 5HG0A 4ZKDA 1RWOA 4O02B 3K30A 4HS9A 3K0EA 3QXHA 3AEQA 3QVUA 3S1AA 4BVKA 5J1TB 2YCBA 1NX6A 3I28A 2I1VB 3IHTA 3Q6NA 2I1QA 3Q8KA 1RZ3A 1VCOA 4PZAA 2P2NA 3SM9A 2ZKIA 1LTQA 3HR4A 3R0IA 1Q1QA 3IURA 3X1MA 1DC7A 1MV5A 1NDHA 2FZGA 3CKKA 4JROA 1A2BA 4FINA 4R4JA 5FFNA 4XYLA 3VNBA 2KBFA 1OAOA 1RW4A 2A5JA 2PH1A 4IFEA 4XIYA 1HLGA 5AVZA 5I9NA 3B2EA 2XLBA 4MARA 2AKEA 1SBCA 1NYRA 2WG1A 3AF1A 4JLVA 1V1JA 2GRJA 4EJ6A 1QE3A 2X5XA 1OZAA 3IODA 3NIGB 4CL2A 1MO3A 3V80A 3D4OA 4MPJA 5AVOA 3JR3A 5I7OA 4D45A 4D42A 3NTLA 3DZJA 3WYEA 2FPIB 2NT3A 3G9XA 3K31A 1QBKC 1PFYA 3BHIA 3NTRA 5GADl 1H4SA 3QU4A 1TJ3A 4KLNA 1ORHA 3R24A 1GNTA 4JLDA 1T2DA 4QREA 3INRA 2EX1A 1DX6A 1MN6A 4QWWA 4HBZA 5F1PA 2J7PA 3DE4X 4BGDA 2ODBA 3U44B 3NOOA 2VAVA 2ATEA 4DMUB 4HPXB 4NCHA 1QH1A 1EFUA 5FUQA 4DV2B 3LC7O 3ZZUA 4X66B 2GZ2A 3V4PB 1MDBA 2C31A 3V7YA 3WNQA 1V45E 1ARZA 1HQDA 1DFGA 4HRVA 4BVLA 5GZ3A 2UVPB 4IOKA 4L2IB 4AFNA 2ZBRA 1GSHA 1RFLA 5BP7A 2I34A 3G23A 2WU8A 1QO7A 3LVRE 3P2YA 5BQPA 1R9MA 1VIMA 5G0VA 2JCYA 3MCZA 4NAHA 4A10A 5HJ7A 1LLDA 1RI3A 4M0DA 4BJ1A 1SBNE 2FSVA 1E9DA 2ZIUB 4TMFA 1N5MA 1C9KA 3H5TA 4RWZA 2PQ0A 4UNIA 1GQRA 4G89A 4GKBA 4MV5A 3TLBA 4DA8A 4JI0B 1QYIA 3QVKA 4US0R 5EWJA 2O1EA 3K94A 3MWKA 2HA4A 2JGKA 2Q9BA 2ZU6A 2GJSA 3QMVA 2EFHB 4Q03A 4FPXA 3VPHA 1PJSA 1U1CA 4DZTA 4ABTA 2YWHA 3K4PA 1TF5A 3CX4A 3PJFA 2M6SA 3KQNA 5CPFA 4JLKA 2LCFA 2JRCA 2RGAA 4G26A 5KCZA 1MGPA 3R3YA 3GLHE 2OXCA 4GWGA 4XARA 1BQ4A 1LTHR 1JFLA 4JBNA 1W2HA 1PD0A 4G4IA 5M04A 3PKZA 4I1IA 5DTIA 5EWMB 2GZDA 5GJBA 1KQ3A 2CWDA 3ILXA 2W6JA 2R62A 4HH0A 4OQDA 1GZ5A 2CW5A 2PUWA 2PZLA 3K0AB 1C8VB 8ATCA 3UT5A 4MO9A 5UKDA 3G8YA 2X9QA 5CITA 4Y6QA 3RUHA 3AP2A 2ZQZA 3AONB 1XELA 1KJ8A 1XVTA 3D2CA 1H2HA 4D6XA 5FOQA 2YJTD 2ZTHA 3PC3A 4JJ8A 4B9EA 2XEDA 5C7IO 5M34A 4L5BA 4MEAA 3DOCA 2ZQ5A 1ADYA 4PO9A 4GM0A 3RRBA 1JEOA 4NK4A 1KI9A 2P1DA 4DDTA 4MUFA 1MG0A 3G2QA 3GJ5A 2MINA 1P4JA 2SCUB 4RHTA 4EUHA 3OTHA 4F96A 2XEXA 3KAJA 4WXRA 2HCJB 4PLPA 1DDIA 1QYVA 1BX0A 3DC2A 1X8LA 2HFKA 1GZ3A 2CUNA 3STYA 3FOFC 4F9GA 2HDHA 1UKAA 3U7RA 3SHQA 4UHBA 4UBNA 5CA1F 2B4KA 1YGPA 1I24A 1Z0SA 1NE7A 2E3JA 3CE6A 3N0VA 1RXSA 2B99A 1NN3A 4HQRA 1KMHB 1AV6A 1H22A 3P5SA 3GVHA 1YT5A 3T7JA 1WSWA 2HDWA 3OIDA 3TLEA 3GMDA 1V96A 1X1DA 4OXIA 1LI5A 4OUDB 3H86A 4XFDA 5ALFA 1EDEA 3RTAA 3HFRA 3JAKB 1XCMA 4GOJA 3RVPA 3W8FA 4E3ZA 2BEKA 4YCAA 1CRQA 4YRFA 4XCVA 4ZT4A 2XGGA 3KEOA 3D8NA 3E22B 4U2KA 3QVXA 4RQAA 1SZCA 4GC9A 1WY7A 4MVJP 3WZ2A 2P2DA 1QCZA 3KXDA 1IHDA 3W05A 2PUDA 3H13A 2V5AA 4O2AA 2C5SA 5HR5A 1ND5A 1ACMA 4TWAA 1E6LA 3K1JA 5JMWA 2DPYA 5CLFA 1F60A 3NVKI 2OENG 1U81A 2ZDHA 3TEMA 2VNIA 2R6ZA 1X7WA 1M8KA 4LS3A 2FUCA 2YRWA 3B1ZA 3I8OA 4LK2A 3VOBA 2POCA 4TV9A 2V45A 3T1TA 4PR3A 4R01A 1G20E 4BCCA 2O7SA 2QRMA 5I8PA 2UYHA 3BZWA 1Z13A 5C81A 1THZA 1XQXA 3F6CA 4WACA 2CXTA 1E6EA 4C3VA 3AR2A 2BKVA 4F4JA 3G2MA 3IULA 3S1LA 1Z8FA 1V6AA 1BH6A 1ZP6A 4FN5A 3GCDA 1AUVA 1QRRA 1F5SA 1YXMA 2GILA 2WWFA 4N5LA 4PLCA 3HU2A 4ZDJA 2PJDA 4FSHA 1M6VA 2W2NA 2PRIA 3MS4A 3L1UA 4JU8A 5AOCA 3KQHA 1R8YA 1Y3CE 2AMVA 3A04A 3VH4A 4UEOA 2VT3A 1SWVA 3ADKA 1V11B 3C45A 3DVQX 3OBIA 4XVUA 2ZITA 1SUCA 3OTGA 5LMZA 5D8DA 2FN4A 2EFJA 2XH8A 2H59A 1M1XB 2QLLA 3D8BA 2BBTA 4JBWA 1QC5B 1K0FA 4M98A 5ALJA 1T26A 1KMNA 2D0OB 2HBYA 4MEJA 5T7BA 4YJFB 3Q8WA 4GEKA 1BGVA 4F45A 5BOVA 4WKOA 1ZK1A 3RU7A 2FEPA 2XVAA 1TW2A 3OZVA 2DGDA 2GYUA 3QKIA 3AR8A 4TLAA 4URVR 4ZU6X 4S1OA 4HMOA 1IM8A 1XDDA 1XEXB 4YLEA 3TFQA 4CMEA 3JARA 1W7AA 1B26A 4A2QA 2JHPA 4OOEA 4WESA 5JI3E 1GCUA 1LDNA 3QOYA 4RPCA 2H08A 5GQSA 3KZNA 4C2BA 4BO8A 5FT9A 1GTMA 1GEGA 3WKCA 3ZHQA 4P08A 2BFMA 1ODLA 1XCLA 2ZSUA 3QKUA 4TUYA 3TLGB 3LFUA 4CQMB 2BGUA 1CQXA 3H2YA 3OJFA 4IO1A 3O31A 1JPNA 3P0RA 2YN4A 3OE1A 3BJRA 5AJUA 4N3AA 3IOMA 2ZJZA 2IWHA 5T6MA 3NBMA 3RS2A 3U3MA 5BVHB 3ZDDA 2WU0A 4K9KA 1TQ8A 4MB0A 4YRCA 1ZYUA 3ZK9A 3H18A 5DKFA 1VIDA 5IJAA 3H3FA 3SYLA 4F21A 3WK9A 1OOEA 4RVUA 2MJLA 3R9IA 1T34A 4LY3A 1DV1A 3NGLA