3RRNB

S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
293
structure length
293
Chain Sequence
FDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 114
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrnB00
3RRMB 3RRNB 3PEVB 3PEUB
chains in the Genus database with same CATH superfamily
3KSLA 3APFA 4MRUA 2IY0C 2XCCA 2R2LA 3L54A 3T8MA 4RSYA 3PUKA 4BERA 4ME2A 4L23A 4JB8P 4LG6A 3UKRG 3DBSA 1TR4A 5ENTD 2FEZA 1N9AA 3ABLE 4YNDA 3ML9A 1LD7A 3TWWA 2QY7A 3AU4A 4I6JA 3ASGA 4U8VD 5T3RA 4FULA 4HI8A 3E33A 3QJZA 4K5BA 2WXKA 3DXMG 2GRRB 4R7LA 4X8QA 2DIWA 3JCKC 3GZSA 2NC9A 4HLLA 1YA0A 4JHJA 5JJ6A 2UWJG 5JHBA 3ENEA 3NQPA 1Y8MA 2I1KA 2IEJA 5M72A 4J7WA 2BKGA 1TN6A 5KJKA 5J08A 1QYMA 4A63B 4O6FA 3HXEA 4IN3B 1E8YA 2YQ8A 2HR2A 4AY6A 3Q5MA 4UI9K 4FHJA 4EZLA 3NZUA 2J07A 2RFMA 4DPRA 5EIBE 4APFA 2C0LA 3NOGD 3SBTB 1OWPA 3S7DA 5G2NA 1KT1A 2LXMA 4ANUA 2FI7A 4XI0A 4ANVA 3Q79A 3B7UX 3X2QE 3L22A 2CHZA 4Q94A 1ELRA 3JXJA 2WXLA 3SI5A 3AU5A 4G26A 5FZQA 3TWUA 5T4YA 4GYWA 5EX0A 1IYGA 3NZSA 4ANWA 3FUEA 4FJYA 4FA6A 2VSXE 4HXIA 1UJKA 5AAOA 5FINA 4IYPA 4KVMA 1MX2A 4JA9A 4A1GA 3ESLA 4U7EB 2QFCA 5CRVA 3QB2A 3UIOC 2XZTG 4UQXA 3OXGA 3AG3E 5AYWD 3RRNB 4FU3A 2ZU6B 2ZXWE 2CFUA 4WNDA 3UQ3A 5G55A 3ONLA 4GZCA 3CVPA 1UOHA 2RKKA 3EJNA 2KCKA 2WXMA 3HXDA 5JJTA 5C2YA 4CDMA 2KZTB 1NI1A 1Q2ZA 5FZRA 2XENA 1Z5SC 1H2VC 3C3OA 2VSOE 3UMVA 2XHEA 3W9GA 3CK8A 4A3TA 4FP7A 1JCQA 2VGXA 2H6GA 4FLHA 3DSTA 3AS4A 4OAUC 1N11A 2DYSE 3CVWA 3TWTA 3PVLA 2IF4A 5ENRD 1EF1C 1NA0A 4KBQA 3MZLB 4GZ5A 5ITZF 3QDNA 4HQDA 1UJJA 5CHEE 3NF1A 2J49A 3CVVA 4GTMA 1H6KA 1E7VA 4DX7D 4LNUD 3PEVB 3UUXA 4HRMB 4JA7A 1E8ZA 2UY1B 3DRAA 1Z3XA 4JEHA 1N52A 3UM1A 1QQEA 2C2LA 1YYHA 4E6HA 2Y1LE 1HZ4A 5ENSD 3T8KA 2OOEA 3P2BA 3AJIA 3C5RA 4GZDA 5EYPF 5JMND 4J8DA 3FY4A 2ZIRA 4XKCA 3ZHEA 3RU0A 1OCZE 3ASFA 4J8SA 5LFAA 4LERA 3SFYA 4BX8A 5CERB 3MV3B 5CCMA 4N2QA 2WPVA 1TNBA 2FF4A 2DYRE 1QNFA 2WXIA 2R59A 3T5XA 2QYJA 3ULYA 2DZNA 2I6HA 4ANXA 2IO3C 1TYQG 4DLQA 4TXPA 4WNGA 2F8XK 3OXFA 3TG4A 3G2WA 3CHSA 4JHRA 3AAAC 4ATZD 2QZAA 2WB2A 1PY1A 3EU9A 3ESKA 3EIJA 4YVQC 1D8EA 3LY8A 4H7XA 1JPLA 1TJFA 3ZRHA 2CG3A 3ZYKA 3Q73A 3OXLA 1TNZA 5CRUA 1NFIE 3PZ2A 3Q9NC 4TUMA 1JUQA 5BT1A 5HRYA 2P2CP 3PEUB 4CCAA 1OWNA 2YHEA 4FJZA 3ZNGA 3HYMB 2LSUA 4ABNA 1TEZA 2KCVA 4YVOA 4YDOA 4DJAA 3V2XA 3D3MA 2LAHA 2WMOA 3K9IA 1MX4A 3QNKA 4CZ2D 3RKVA 4CGWA 1PAQA 1MJ0A 2ETAA 2X38A 3R9MA 3FU6A 2KCLA 4GB9A 3ZGQA 1BU9A 4I17A 3OTNA 2WXQA 1KZOA 2VQ2A 3JYSA 3ZU7B 4U0SA 3R7RA 2P9NG 3PDNA 4GMJA 2EINE 5AJDA 3DSWA 4GU5A 2V4LA 4HFGA 4CT4A 2ETCA 4OYSA 4K5AB 4L1BA 4HOQA 2M63A 3C72A 2XGSA 4XKBA 1NP7A 3FTZA 4G11A 2A4ZA 1N4PA 3KEAA 4RG9A 2XEEA 1EPUA 1HU3A 2KZTA 3CV0A 3UIPC 1MYOA 1OXJA 5FQ7A 3G2SA 3C98A 4ACKA 2GRLA 1LF8A 2BF0X 4APOA 3CKCA 2HM8A 1FT2A 2R05A 4C48B 4BSXA 3DPYA 2IOLA 3IBEA 2P9PG 2ZGGA 1WAO1 2V8SE 3FUHA 2J8SD 2YINA 1W3BA 2LUHA 2V0PA 5EKQD 1YMPA 3ZKJA 3LY7A 3PRZA 1DVPA 2B0OE 3LDZA 4ACLA 1LTXA 3TWRA 3U9WA 3JUEA 1WM5A 1HFAA 2VGEA 5FT9A 5CBOA 3CSFA 5KJLA 3CVNA 3E32A 4BEPA 2P58C 3S7BA 3QAQA 3SFZA 3D9OA 3LVQE 4BTAA 2VGXB 1RZ4A 4U63A 3PNLB 1HF8A 4IRUA 2VSNA 3FUKA 2KXPC 4QQIA 1FVFA 3SO8A 1RW2A 2WXOA 3QWVA 1SA5A 4GTVA 2OEWA 2R03A 3HIZA 2GRMA 4KYOB 1YCSB 3CKBA 5EILA 5AIJA 2R5SA 4UWGA 5CEDB 2WXJA 1JCSA 3U64A 1HX8A 4AY5A 4IULA 4ZHBA 4MBGA 4GYYA 1H0AA 1SW6A 4AXHA 4WWPA 3AG2E 3PE3A 3FTSA 1HS6A 3RRMB 4N3CA 3TGOA 3ZIMA 3BEEA 2BKKB 3JQ0A 3WG7E 2PQRA 1FPPA 2WVIA 4EZJA 2LSVA 3ASNE 5EDSA 3CQGB 3BG0B 3ZHEB 3ABKE 5HI7A 4Y6CA 3UM3A 3S7JA 3ASOE 1SZ9A 1IQRA 3RSEG 1K8KG 4GZ6A 3RJVA 1BPOA 2P9SG 1OCRE 5FJYA 4NACA 3MA5A 2DVWA 1E90A 3QOUA 1SZAA 3GYZA 3CQCB 3DEOA 3FTVA 4XX5A 2JLBA 3E4BA 3ZPJA 2L6BA 2X6HA 4UWHA 1X5BA 3SHFA 4BETA 5BW8C 2IJGX 2XGOA 2L6JA 5CECB 3TWVA 3ASDA 5LCWC 3PUJA 1NZNA 2XQ0A 3PZDA 5H7PA 1EYHA 3KS2A 2XRZA 5D0QD 2Y69E 1KPSB 3HHMA 4LUNU 1NA3A 5ARGA 2XRYA 4URKA 2JEKA 3Q49B 2EIKE 4G8LA 2WQ6A 1L5JA 2X6FA 3J5PA 4I43A 2L0IA 4TXRA 3L6AA 5B3SE 1ZU2A 4JL0A 4DI3A 3HRAA 5ANRA 4BSZB 2WXGA 3PNTB 3PE4A 4HB5A 4XIFA 3UPVA 4EHMA 1DCQA 4WWNA 5EIDA 2H6IA 4MLPA 5EYLA 1VDYA 1HE8A 4F53A 4JVSA 2LO6A 5AQBA 3FTWA 2I1JA 1A5EA 3Q78A 3W9FA 3CEQA 4BX9A 1UN8A 2BUGA 4OAVB 2WM9A 3T9KA 4CEMA 4GPKA 4FC8A 5AQAA 1P5QA 3VLEA 4EQFA 4TXQA 5BXOA 5BUZA 1BI8B 2XPIA 5EN5D 1E96B 2F8YA 3EHMA 4L2LA 5LP0A 3U3WA 2HYZA 2PZIA 4C0MA 4UWKA 2WXNA 3HDXA 3CHPA 4XZ4A 1EDUA 3HXBA 4DK5A 3UINC 4PUCA 3B7BA 3ZXPA 3GZ1A 4I9EA 4RG6A 3DXKG 3NOCD 4Q69A 1JWFA 4FHKA 2EILE 1TJCA 4DLOA 4BFRA 5LCWJ 3CVUA 2PNNA 4J8FA 3FTUA 2FO7A 1DNPA 3EDTB 4EZKA 4C0EA 3IXEA 4EBAG 4F7AA 5KNGA 5ENNA 5AN8A 2X6KA 4PS7A 3Q7FA 4N2SA 1SVXA 1X81A 2Q7FA 1OWLA 5E76A 1N0QA 4D10C 5HKPA 3VTXA 2AVPA 1NL4A 3EHNA 3AG1E 3ZN3A 3ZYQA 2XS8A 4AVXA 5B1AE 4M7CA 4ILIA 2L0TB 3R7QA 1DC2A 3U66A 2GRQB 2XEVA 1UN9A 4GA2A 4O1OA 5AJLA 3T5VA 2NXPA 4J0UA 5CBNA 4NQ0A 3R9AB 3V79K 3D9IA 2AXUA 4HNAD 4FADA 3ML8A 3UM0A 3LJNA 1U2VG 3NBNB 2X3MA 2WXPA 3FULA 5CMYA 1XGWA 4I9CA 1S64A 1TNOA 1UG3A 4F3VA 3IHVA 5FQ6A 4HLEA 4PS3A 3CVXA 2KATA 4G2VA 3PZ1A 1K1AA 3FUDA 4LSZE 2ZGDA 3EHQA 3BU8A 4RQIA 4JC8A 1SQMA 3FHEA 4B8CB 3BG1B 3TJPA 3FUMA 2LXLA 2PL2A 3CVYA 3L9TA 4LCTA 3ZEFA 1AP7A 4UI9C 2IOSA 3SZ7A 1OY3D 1V55E 4N39A 4UQYA 1O1RA 3DSXA 3CVQA 3TAXA 2DWZA 3F6QA 4EBAA 4G23A 2VJ8A 5EX3A 3EIQC 2XS1A 4NURA 2WMNA 3G2VA 4Z68A 4RLYA 2CHXA 2DZOA 1BI7B 2V4HC 3KSQA 5ENOD 4AJWA 2GW1A 3ISMC 4G25A 2IFUA 3APCA 2PM6A 3AS5A 2AJAA 5FWQA 2FO1E 3L13A 1UW4B 3I5PA 3LYAA 4O1PA 4GCNA 4N5CA 3FH7A 2DBAA 4G8KA 4LNBA 2LNIA 2OEVA 2X6IA 3MKRA 4GTQA 2KBXA 1H6PA 3NAWA 5ENQD 1FT1A 5AARA 2H6HA 5CCLA 2P9UG 1H2UA 5B1BE 2E2EA 2HO1A 4B93B 4WNEA 4GMLA 2B6CA 2KM4A 4GTRA 2JABA 2IQCA 4UUCA 5J90A 3B7RL 4J6IA 4J8YA 3ZYLA 4U0UA 3SQVA 2XPZA 4OVUA 3CIAA 4UWLA 3JXIA 4V3IA 4E85A 4L9PA 3ZYMA 1G3NB 2VTBA 5FTPA 4B94A 3B7TA 2RFAA 3RO2A 4YDWA 5CMWA 5BV1A 5JA4D 4I2WA 4G1TA 4BT9A 1KZPA 3L16A 3L08A 4JXTA 3UT4A 3FH5A 3D9JA 1N54A 2H6FA 1O1TA 3N71A 3SD5A 3CHMA 4O60A 3AG4E 3Q15A 1ZBPA 4UI9J 1MX6A 5FQ4A 4WUYA 3PZ3A 4OVVA 2GRNB 2XZDG 4AV7A 3UKUG 4KMOA 5D2MC 4N3BA 2J09A 3HG0D 3IKOB 3FH8A 5CEAA 4HS2A 3P1UA 3GZ2A 1E7UA 2V5FA 5KBAA 4H7YA 1E8WA 1ELKA 4GAAA 4GTPA 4QFVA 5BXUA 2GRPB 2Y0BG 4KVOA 1N95A 3FUNA 4DX6D 2VGYA 4DX2A 2ETBA 5KJMA 4B0ZA 3LS8A 3HXCA 3QC1A 3HVEA 4ATGA 5JJ7A 4GPMA 1TNYA 1U3DA 4BY6A 4LNGA 3MJWA 2QYUA 3LY9A 2F0YA 4FLBA 2E0IA 4F6RD 1ZB1A 3FU5A 4UWFA 3E34A 2MHKA 4CYMD 5HQ8A 1LD8A 1O5MA 3EUVA 4YDYA 4BWRA 1S63A 4K5CA 2X6JA 1OUVA 4U8YD 2EQXA 3SBSA 4WWOA 3V30A 3D9MA 2C0MA 3LXUX 3NB2A 3DEPA 3VLFA 4I1MA 1BD8A 5AQ9A 3D9NA 4K03A 1BLXB 2A5UA 3AS8A 4GTSA 3UT8A 5LOZA 5BPPA 3LEWA 3FFLA 3MKQA 1N4SA 1MQSA 2XEHA 2L9BA 3CK7A 3OAWA 4I2ZA 3ZFWA 4AIFA 5JHAA 3CR3A 4PS8A 3HXFA 3S7FA 4EECA 2J9QA 2CFZA 1S0PA 1OT8A 4HBDA 3PZ4A 3MX3A 1H2TC 4GTOA 3CLJA 3ZW3A 3CSTA 4GCOA 4GZ3A 3RK6A 4DX1A 1WDYA 3EHRA 2EIME 5KJNA 1WG0A 2YHCA 2OCCE 4KZCA 3CVLA 3Q4AB 3KAEA 4F1PA 4U95D 3BQOA 3SY2A 2J08A 2I9CA 3D9HA 1KLXA 3FEYA 4F1SA 2FBNA 3Q7AA 2EIJE 2I2OA 2YNQA 4N3AA 2NSZA 2PQNA 3IHYA 1H19A 4M3OA 3ABME 4G24A 4I6GA 3CHRA 3FUJA 2ILRA 5BV0A 2DCPA 4NRHB 3I4GA 3RIBA 1Z3YA 2GGFA 3UTMA 2XGMA 1HO8A 4KXKB 4AEZC 1D8DA 4HOTA 3TWSA 2PM7A 4Q96A 3O48A 4XE0A 4GYOA 3I3NA 4AM9A 3QARA 3CHQA 3MV2B 1MHQA 5BNWA 3TG5A 4NIKA 3UT7A 3ULEG 1FCHA 1SA4A 3S2AA 4HI9A 2A5EA 4HORA 3APDA 3LPZA 1IHBA 2WXFA 5A6CA 4U07A 3ZVVA 1ELWA 1TN8A 2VTBB 2R02A 3MGBA 3ASHA 2VSYA 4I6EA 4TRQA 2BEDA 4GTTA 1IQUA 3O4ZA 2GROB 3WXXA 3MYVA 2RG8A 1K3ZD 1HG5A 5FZSA 3TWXA 2F37A 3I4RB 2P9LG 4W9RA 1H6OA 4HOUA 4LEUA 5G04C 3UM2A 3TXMA 3LVRE 3BUAA 5G05C 1D9SA 5DBKA 1HG2A 2WQ7A 1N0RA 3JQ1A 4KZ0A 2XPYA 1TNUA 1XNFA 4TV3A 4CDNA 3L17A 3E37A 4J8EA 2V5QC 2XCBA 4HVBA 4JEUA 3UXGA 3ZUVB 2HE0A 3U4TA 4GA1A 3DPDA 3KD7A 2IO2C 4ILHB 3G2UA 2OV8A 2BTDA 2MYOA 3LJ3A 4GA0A 3ONKA 3DWLG 4JHKA 2ONDA 3Q9UC 2P9KG 3DSUA 5ANLA 1PC2A 3HVEB 2IONA 1DCEA 1Y6IA 2CHWA 4WNFA 3UI2A 1Z6TA 3CGHA 3SFXA 3JUIA 4HRNA 5A23A 3Q75A 4C9BB 2MOWA 3VTYA 1S70B 5LX8A 2Y3AA 4L7TA 4EPZA 1E8XA 2WQHA 4A1SA 1MZCA 4K0RA 3FU0A 3FP3A 1KT0A 3B13A 4AP2A 4ZFHA 2IU1A 1AWCB 4L2YA 1A17A 2WXRA 4CRWA 4U8HA 4MKTA 1HXIA 3D9KA 3QKYA 4WAFA 1IKND 5AENA 4XI9A 4DI4A 4N5QA 3PS6A 5D0OD 3Q47B 4HRLA 3MKQB 5FIOA 5KCMA 1OCOE 1IXVA 3IV0A 4P29A 3RO3A 2LAIA 3DSVA 4GMRA 5C1DA 4ILGA 3FDHA 2Y4UA 5E75A 5G04J 3LCAA 2KC7A 4PH4B 5A7DB 3FUIA 5G05J 3UX4A 4XEIG 2MRIA 3TL5A 2AXVA 3CK9A 1GW6A 4I1AA 3TXNA 4JPSA 1HH8A 2AWIA 1K1BA 2VYIA 1V54E 4JZYA 3QK0A 1B89A 3IEGA 3MEKA 4YDEA 3CHOA 2J4BA 3RAUA 2J4DA 2R17C 5D66A 1TN7A 1U3CA 3E30A 4CDRA 4U04A 2OVBA 4HOSA 1QZ2A 3SNXA 3G2TA 4MS6A 3RRUA 5ENPD 3FEXA 1FVHA 3PH0C 3FWVA 4BT8A 2CG2A 4U96D 5HS0A 2Y4TA 2ZISA 3EU5A 3KEZA 4BESA 1JCRA 4JD2G 4I1OB 4A3VA 3QWPA 5FQ8A 3FUFA 4PDXA 2P9IG 1OWMA 1OCCE 3B7SA 3VLDA 4KT6B 4RVBA 5KWDA 1OWOA 2WXHA 3J5QB 4CT0A 3URZA 1JWGA 4JW1A 3V2OA 1QBQA 3QWWA 3FTYA 4Y6WA 4UQZA 2RD0A 3FU3A 3MCXA 3V31A 5DIZA 3ZXSA 3D9LA 5ARFA 3B95A 3GW4A 5T8IA 4TUUA 3SGHA 1O1SA 4AOFA 3PREA 4B89A 4BTBA 4A55A 4CGVA 1N4QA 3FTXA 3TWQA 5AQ7A 3DSSA 4LRZA 4B8AA 2FULA 1WY6A 2NYJA 1N94A 3L82A 2AW6A 3C3RA 2QC9A 1IHGA 2AXZA 1N4RA 2UY1A 4U0ZA 3SF4A 2OVFA 3ULQA 4DUIA 3C3QA 4DRXE 4DX5D 3LKUA 5KNHD 5IY5E 3D9PA 1INZA
chains in the Genus database with same CATH topology
1PAQA 3APFA 4MRUA 2X38A 2NSZA 2XCCA 3FU6A 2KCLA 2PQNA 3IHYA 4GB9A 3L54A 1H19A 4ILIA 3ZGQA 3T8MA 4M3OA 2L0TB 4RSYA 4I17A 3PUKA 3OTNA 4G24A 2WXQA 4I6GA 4ME2A 3R7QA 3U66A 3CHRA 4L23A 2VQ2A 2XEVA 3FUJA 3JYSA 1UN9A 4GA2A 2ILRA 5BV0A 4U0SA 2DCPA 5AJLA 3T5VA 4NRHB 2NXPA 4J0UA 3R7RA 3DBSA 4NQ0A 3PDNA 4GMJA 3I4GA 5AJDA 1Z3YA 2FEZA 2GGFA 3RIBA 4GU5A 3R9AB 2XGMA 2V4LA 3D9IA 2AXUA 1HO8A 4HFGA 4KXKB 4AEZC 4CT4A 4HOTA 4OYSA 4FADA 3ML8A 4L1BA 2PM7A 4Q96A 3O48A 4YNDA 4XE0A 4HOQA 4GYOA 2M63A 2X3MA 2WXPA 2XGSA 3ML9A 3I3NA 4XKBA 4AM9A 3FULA 1NP7A 3FTZA 1XGWA 4I9CA 5CMYA 4G11A 2A4ZA 3CHQA 3MV2B 3QARA 4RG9A 2QY7A 1UG3A 3AU4A 4I6JA 1EPUA 1HU3A 2KZTA 4F3VA 1MHQA 3CV0A 5FQ7A 3IHVA 3ASGA 5T3RA 3G2SA 5FQ6A 3C98A 4HLEA 4FULA 4PS3A 4ACKA 3TG5A 5BNWA 3CVXA 2GRLA 1LF8A 2KATA 4G2VA 2BF0X 3QJZA 3UT7A 3FUDA 1FCHA 4APOA 3CKCA 2WXKA 2HM8A 4R7LA 3S2AA 4HORA 2DIWA 3APDA 3JCKC 3GZSA 2NC9A 4JHJA 1YA0A 5JJ6A 4BSXA 2UWJG 3LPZA 2WXFA 5A6CA 5JHBA 2IOLA 3ENEA 3NQPA 1Y8MA 4U07A 3IBEA 3ZVVA 2I1KA 4JC8A 1WAO1 5M72A 1SQMA 3FHEA 4B8CB 2V8SE 1ELWA 3FUHA 3BG1B 3TJPA 2YINA 1W3BA 3FUMA 5KJKA 2V0PA 2VTBB 5J08A 2PL2A 3MGBA 4O6FA 5EKQD 3ASHA 2VSYA 4IN3B 4I6EA 1E8YA 3LY7A 3PRZA 4TRQA 3CVYA 1DVPA 3LDZA 2YQ8A 1IQUA 2HR2A 3O4ZA 4LCTA 3WXXA 3ZEFA 3Q5MA 3MYVA 4ACLA 4AY6A 4UI9K 3U9WA 4FHJA 1WM5A 4EZLA 2RG8A 3NZUA 1HFAA 1HG5A 5FT9A 5FZSA 4UI9C 2IOSA 3SZ7A 2J07A 3CSFA 4N39A 4UQYA 3I4RB 4DPRA 4APFA 5KJLA 3CVNA 2P58C 4W9RA 3S7BA 3QAQA 2C0LA 3CVQA 4HOUA 3SFZA 4LEUA 3D9OA 5G04C 3TAXA 4EBAA 3LVQE 3TXMA 3SBTB 1OWPA 3LVRE 3S7DA 5G05C 4G23A 2VJ8A 5EX3A 3EIQC 2VGXB 5G2NA 4BTAA 4NURA 4U63A 5DBKA 1KT1A 2WMNA 3PNLB 3G2VA 1HF8A 1HG2A 4ANUA 2WQ7A 3JQ1A 2FI7A 4IRUA 2CHXA 2VSNA 3FUKA 4KZ0A 4XI0A 4ANVA 2XPYA 1FVFA 3B7UX 3L22A 4AJWA 1XNFA 2WXOA 2CHZA 3QWVA 2GW1A 4TV3A 4Q94A 1ELRA 4G25A 2IFUA 4CDNA 3L17A 3HIZA 2GRMA 3APCA 2PM6A 3AS5A 4KYOB 5FWQA 2WXLA 4J8EA 2XCBA 3SI5A 3L13A 4HVBA 1UW4B 3AU5A 3CKBA 3I5PA 4JEUA 3LYAA 5AIJA 4G26A 4GCNA 4N5CA 2R5SA 3FH7A 4UWGA 4GA1A 3DPDA 2DBAA 3KD7A 5FZQA 4ILHB 3U4TA 2LNIA 2X6IA 3MKRA 3G2UA 2OV8A 5T4YA 2WXJA 2BTDA 3LJ3A 4GA0A 3U64A 4GYWA 1HX8A 3ONKA 5EX0A 4AY5A 1IYGA 4IULA 2ONDA 4JHKA 3NZSA 4ANWA 3FUEA 4FJYA 4GYYA 5ANLA 5CCLA 1PC2A 4FA6A 3HVEB 1H0AA 1H2UA 2E2EA 2HO1A 1Y6IA 2IONA 2VSXE 4WNEA 2CHWA 4HXIA 4WNFA 4AXHA 1UJKA 4GMLA 1Z6TA 4WWPA 4IYPA 3CGHA 3JUIA 3PE3A 5A23A 3FTSA 1HS6A 2KM4A 4KVMA 4C9BB 4JA9A 4A1GA 3ESLA 2MOWA 3RRMB 4N3CA 2QFCA 3TGOA 3ZIMA 3VTYA 2IQCA 3BEEA 5LX8A 3QB2A 5J90A 2Y3AA 3B7RL 4J6IA 4UQXA 4L7TA 3JQ0A 3ZYLA 4EPZA 4U0UA 3OXGA 2PQRA 1E8XA 2WQHA 2XPZA 3CIAA 4OVUA 4A1SA 4K0RA 3FU0A 4UWLA 5AYWD 3RRNB 4V3IA 3FP3A 1KT0A 4FU3A 2WVIA 4EZJA 2ZU6B 2LSVA 3B13A 4AP2A 4E85A 5EDSA 3CQGB 3BG0B 3ZHEB 2CFUA 4WNDA 2IU1A 3UQ3A 3ZYMA 2VTBA 5FTPA 4L2YA 5G55A 5HI7A 4B94A 3B7TA 4Y6CA 3RO2A 5CMWA 3ONLA 4GZCA 3S7JA 5BV1A 1A17A 3CVPA 1SZ9A 2WXRA 3EJNA 4I2WA 2KCKA 2WXMA 4G1TA 4BT9A 4CRWA 3L16A 3L08A 5C2YA 5JJTA 1IQRA 4CDMA 4U8HA 2KZTB 1HXIA 4MKTA 3D9KA 4JXTA 3QKYA 4WAFA 5AENA 4XI9A 3UT4A 3FH5A 3D9JA 4GZ6A 4DI4A 3RJVA 1BPOA 1N54A 5FZRA 3PS6A 5FJYA 5D0OD 3Q47B 4NACA 3MKQB 3MA5A 1E90A 1H2VC 3N71A 5KCMA 3SD5A 3QOUA 1SZAA 3CHMA 4UI9J 3Q15A 2VSOE 1ZBPA 3GYZA 3CQCB 3FTVA 4XX5A 3UMVA 3IV0A 4P29A 2JLBA 3E4BA 2LAIA 3RO3A 3ZPJA 2XHEA 5FQ4A 4WUYA 3CK8A 4OVVA 4ILGA 5C1DA 4A3TA 4FP7A 2X6HA 3FDHA 4UWHA 2Y4UA 2VGXA 5E75A 1X5BA 4AV7A 5G04J 3LCAA 2KC7A 4KMOA 4PH4B 5A7DB 4FLHA 4N3BA 2J09A 3FUIA 5G05J 3UX4A 3SHFA 3IKOB 3AS4A 5BW8C 2MRIA 2IJGX 3FH8A 3TL5A 2XGOA 2L6JA 4HS2A 3P1UA 2AXVA 3ASDA 3CK9A 5LCWC 3CVWA 3PUJA 1NZNA 2XQ0A 3PVLA 3GZ2A 2IF4A 1GW6A 1E7UA 3PZDA 4I1AA 1EF1C 1EYHA 1NA0A 2V5FA 4KBQA 3MZLB 3TXNA 4JPSA 4H7YA 1HH8A 1E8WA 2AWIA 3KS2A 1ELKA 2XRZA 4GAAA 4GZ5A 5D0QD 2VYIA 4JZYA 3HHMA 4LUNU 4QFVA 1NA3A 5ARGA 3QK0A 1B89A 3IEGA 2XRYA 3MEKA 4URKA 3CHOA 2JEKA 2J4BA 1UJJA 2J4DA 2R17C 3Q49B 3FUNA 3NF1A 3QDNA 4KVOA 5CHEE 1U3CA 2WQ6A 2J49A 3CVVA 2VGYA 1L5JA 4CDRA 5KJMA 4B0ZA 1H6KA 2X6FA 3LS8A 1E7VA 3QC1A 3HVEA 4ATGA 4I43A 4U04A 2L0IA 2OVBA 3PEVB 4HOSA 5JJ7A 3L6AA 3UUXA 1ZU2A 4JL0A 1U3DA 4JA7A 4BY6A 1QZ2A 4DI3A 3MJWA 1E8ZA 2UY1B 5ANRA 1Z3XA 4JEHA 2WXGA 1N52A 3SNXA 1QQEA 3PNTB 2C2LA 3G2TA 3PE4A 4XIFA 4MS6A 3RRUA 3FEXA 3LY9A 3UPVA 4E6HA 4WWNA 4FLBA 1FVHA 4MLPA 2E0IA 1HZ4A 3PH0C 3FWVA 4BT8A 1VDYA 1HE8A 4F53A 4JVSA 2CG2A 2OOEA 2LO6A 3P2BA 3FU5A 4UWFA 2MHKA 2Y4TA 4GZDA 5HQ8A 3KEZA 4J8DA 3FTWA 2I1JA 4BWRA 3FY4A 2X6JA 1OUVA 4XKCA 3RU0A 3ZHEA 4I1OB 3ASFA 3CEQA 4J8SA 2EQXA 4A3VA 5LFAA 3QWPA 5FQ8A 4LERA 3FUFA 4BX9A 1UN8A 4PDXA 3SBSA 4BX8A 4WWOA 1OWMA 3D9MA 2C0MA 2BUGA 3LXUX 3MV3B 3VLFA 5CCMA 3B7SA 4I1MA 4N2QA 2WPVA 2WM9A 3VLDA 3D9NA 4K03A 4KT6B 4CEMA 2A5UA 2FF4A 4GPKA 3AS8A 4RVBA 4FC8A 3UT8A 1OWOA 1P5QA 1QNFA 2WXIA 2R59A 3VLEA 4EQFA 3T5XA 5BUZA 5LOZA 2WXHA 4CT0A 5BPPA 3LEWA 2XPIA 3URZA 2I6HA 1E96B 1JWGA 3FFLA 3EHMA 3MKQA 4ANXA 4JW1A 4L2LA 5LP0A 4DLQA 1MQSA 3U3WA 2HYZA 4WNGA 3QWWA 2L9BA 3FTYA 3CK7A 2PZIA 4C0MA 3OXFA 4UWKA 3OAWA 4Y6WA 4UQZA 2RD0A 2WXNA 4I2ZA 3HDXA 3TG4A 3CHPA 3G2WA 4XZ4A 3ZFWA 1EDUA 4AIFA 3CHSA 5JHAA 3FU3A 3MCXA 4DK5A 4JHRA 3CR3A 4PS8A 5DIZA 3ZXSA 4PUCA 3D9LA 3S7FA 4EECA 2J9QA 3GZ1A 5ARFA 2WB2A 2CFZA 3GW4A 1S0PA 4I9EA 4RG6A 4Q69A 1PY1A 5T8IA 1JWFA 3ESKA 4FHKA 4TUUA 3EIJA 3SGHA 4AOFA 4YVQC 1TJCA 3PREA 4DLOA 3LY8A 4H7XA 4BFRA 1JPLA 1TJFA 5LCWJ 3MX3A 1H2TC 3ZRHA 4B89A 3CVUA 4BTBA 3CLJA 4A55A 4J8FA 3ZW3A 2CG3A 3FTUA 3ZYKA 2FO7A 1DNPA 3CSTA 3EDTB 3OXLA 4CGVA 4EZKA 4C0EA 4GCOA 3FTXA 4GZ3A 4EBAG 1JUQA 5BT1A 4F7AA 3RK6A 3PEUB 4CCAA 1OWNA 5ENNA 2YHEA 4FJZA 4LRZA 4B8AA 5KJNA 3HYMB 2LSUA 2FULA 4ABNA 1WY6A 2YHCA 1TEZA 2KCVA 4KZCA 2AW6A 2X6KA 4YVOA 4PS7A 4N2SA 4DJAA 3CVLA 3D3MA 2Q7FA 3Q4AB 3KAEA 1OWLA 1IHGA 2AXZA 2LAHA 2UY1A 5E76A 4U0ZA 3SF4A 2J08A 2OVFA 2WMOA 2I9CA 3ULQA 4D10C 3VTXA 1KLXA 2AVPA 3FEYA 3K9IA 4F1SA 3EHNA 3QNKA 3ZN3A 3LKUA 3ZYQA 2FBNA 3D9PA 2I2OA 1INZA 2YNQA 3RKVA 4CGWA 4N3AA 4AVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRM B;  3RRN B;  3PEV B;  3PEU B; 
#chains in the Genus database with same CATH topology
 3KSL A;  3APF A;  4MRU A;  2IY0 C;  2XCC A;  2R2L A;  3L54 A;  3T8M A;  4RSY A;  3PUK A;  4BER A;  4ME2 A;  4L23 A;  4JB8 P;  4LG6 A;  3UKR G;  3DBS A;  1TR4 A;  5ENT D;  2FEZ A;  1N9A A;  3ABL E;  4YND A;  3ML9 A;  1LD7 A;  3TWW A;  2QY7 A;  3AU4 A;  4I6J A;  3ASG A;  4U8V D;  5T3R A;  4FUL A;  4HI8 A;  3E33 A;  3QJZ A;  4K5B A;  2WXK A;  3DXM G;  2GRR B;  4R7L A;  4X8Q A;  2DIW A;  3JCK C;  3GZS A;  2NC9 A;  4HLL A;  1YA0 A;  4JHJ A;  5JJ6 A;  2UWJ G;  5JHB A;  3ENE A;  3NQP A;  1Y8M A;  2I1K A;  2IEJ A;  5M72 A;  4J7W A;  2BKG A;  1TN6 A;  5KJK A;  5J08 A;  1QYM A;  4A63 B;  4O6F A;  3HXE A;  4IN3 B;  1E8Y A;  2YQ8 A;  2HR2 A;  4AY6 A;  3Q5M A;  4UI9 K;  4FHJ A;  4EZL A;  3NZU A;  2J07 A;  2RFM A;  4DPR A;  5EIB E;  4APF A;  2C0L A;  3NOG D;  3SBT B;  1OWP A;  3S7D A;  5G2N A;  1KT1 A;  2LXM A;  4ANU A;  2FI7 A;  4XI0 A;  4ANV A;  3Q79 A;  3B7U X;  3X2Q E;  3L22 A;  2CHZ A;  4Q94 A;  1ELR A;  3JXJ A;  2WXL A;  3SI5 A;  3AU5 A;  4G26 A;  5FZQ A;  3TWU A;  5T4Y A;  4GYW A;  5EX0 A;  1IYG A;  3NZS A;  4ANW A;  3FUE A;  4FJY A;  4FA6 A;  2VSX E;  4HXI A;  1UJK A;  5AAO A;  5FIN A;  4IYP A;  4KVM A;  1MX2 A;  4JA9 A;  4A1G A;  3ESL A;  4U7E B;  2QFC A;  5CRV A;  3QB2 A;  3UIO C;  2XZT G;  4UQX A;  3OXG A;  3AG3 E;  5AYW D;  3RRN B;  4FU3 A;  2ZU6 B;  2ZXW E;  2CFU A;  4WND A;  3UQ3 A;  5G55 A;  3ONL A;  4GZC A;  3CVP A;  1UOH A;  2RKK A;  3EJN A;  2KCK A;  2WXM A;  3HXD A;  5JJT A;  5C2Y A;  4CDM A;  2KZT B;  1NI1 A;  1Q2Z A;  5FZR A;  2XEN A;  1Z5S C;  1H2V C;  3C3O A;  2VSO E;  3UMV A;  2XHE A;  3W9G A;  3CK8 A;  4A3T A;  4FP7 A;  1JCQ A;  2VGX A;  2H6G A;  4FLH A;  3DST A;  3AS4 A;  4OAU C;  1N11 A;  2DYS E;  3CVW A;  3TWT A;  3PVL A;  2IF4 A;  5ENR D;  1EF1 C;  1NA0 A;  4KBQ A;  3MZL B;  4GZ5 A;  5ITZ F;  3QDN A;  4HQD A;  1UJJ A;  5CHE E;  3NF1 A;  2J49 A;  3CVV A;  4GTM A;  1H6K A;  1E7V A;  4DX7 D;  4LNU D;  3PEV B;  3UUX A;  4HRM B;  4JA7 A;  1E8Z A;  2UY1 B;  3DRA A;  1Z3X A;  4JEH A;  1N52 A;  3UM1 A;  1QQE A;  2C2L A;  1YYH A;  4E6H A;  2Y1L E;  1HZ4 A;  5ENS D;  3T8K A;  2OOE A;  3P2B A;  3AJI A;  3C5R A;  4GZD A;  5EYP F;  5JMN D;  4J8D A;  3FY4 A;  2ZIR A;  4XKC A;  3ZHE A;  3RU0 A;  1OCZ E;  3ASF A;  4J8S A;  5LFA A;  4LER A;  3SFY A;  4BX8 A;  5CER B;  3MV3 B;  5CCM A;  4N2Q A;  2WPV A;  1TNB A;  2FF4 A;  2DYR E;  1QNF A;  2WXI A;  2R59 A;  3T5X A;  2QYJ A;  3ULY A;  2DZN A;  2I6H A;  4ANX A;  2IO3 C;  1TYQ G;  4DLQ A;  4TXP A;  4WNG A;  2F8X K;  3OXF A;  3TG4 A;  3G2W A;  3CHS A;  4JHR A;  3AAA C;  4ATZ D;  2QZA A;  2WB2 A;  1PY1 A;  3EU9 A;  3ESK A;  3EIJ A;  4YVQ C;  1D8E A;  3LY8 A;  4H7X A;  1JPL A;  1TJF A;  3ZRH A;  2CG3 A;  3ZYK A;  3Q73 A;  3OXL A;  1TNZ A;  5CRU A;  1NFI E;  3PZ2 A;  3Q9N C;  4TUM A;  1JUQ A;  5BT1 A;  5HRY A;  2P2C P;  3PEU B;  4CCA A;  1OWN A;  2YHE A;  4FJZ A;  3ZNG A;  3HYM B;  2LSU A;  4ABN A;  1TEZ A;  2KCV A;  4YVO A;  4YDO A;  4DJA A;  3V2X A;  3D3M A;  2LAH A;  2WMO A;  3K9I A;  1MX4 A;  3QNK A;  4CZ2 D;  3RKV A;  4CGW A;  1PAQ A;  1MJ0 A;  2ETA A;  2X38 A;  3R9M A;  3FU6 A;  2KCL A;  4GB9 A;  3ZGQ A;  1BU9 A;  4I17 A;  3OTN A;  2WXQ A;  1KZO A;  2VQ2 A;  3JYS A;  3ZU7 B;  4U0S A;  3R7R A;  2P9N G;  3PDN A;  4GMJ A;  2EIN E;  5AJD A;  3DSW A;  4GU5 A;  2V4L A;  4HFG A;  4CT4 A;  2ETC A;  4OYS A;  4K5A B;  4L1B A;  4HOQ A;  2M63 A;  3C72 A;  2XGS A;  4XKB A;  1NP7 A;  3FTZ A;  4G11 A;  2A4Z A;  1N4P A;  3KEA A;  4RG9 A;  2XEE A;  1EPU A;  1HU3 A;  2KZT A;  3CV0 A;  3UIP C;  1MYO A;  1OXJ A;  5FQ7 A;  3G2S A;  3C98 A;  4ACK A;  2GRL A;  1LF8 A;  2BF0 X;  4APO A;  3CKC A;  2HM8 A;  1FT2 A;  2R05 A;  4C48 B;  4BSX A;  3DPY A;  2IOL A;  3IBE A;  2P9P G;  2ZGG A;  1WAO 1;  2V8S E;  3FUH A;  2J8S D;  2YIN A;  1W3B A;  2LUH A;  2V0P A;  5EKQ D;  1YMP A;  3ZKJ A;  3LY7 A;  3PRZ A;  1DVP A;  2B0O E;  3LDZ A;  4ACL A;  1LTX A;  3TWR A;  3U9W A;  3JUE A;  1WM5 A;  1HFA A;  2VGE A;  5FT9 A;  5CBO A;  3CSF A;  5KJL A;  3CVN A;  3E32 A;  4BEP A;  2P58 C;  3S7B A;  3QAQ A;  3SFZ A;  3D9O A;  3LVQ E;  4BTA A;  2VGX B;  1RZ4 A;  4U63 A;  3PNL B;  1HF8 A;  4IRU A;  2VSN A;  3FUK A;  2KXP C;  4QQI A;  1FVF A;  3SO8 A;  1RW2 A;  2WXO A;  3QWV A;  1SA5 A;  4GTV A;  2OEW A;  2R03 A;  3HIZ A;  2GRM A;  4KYO B;  1YCS B;  3CKB A;  5EIL A;  5AIJ A;  2R5S A;  4UWG A;  5CED B;  2WXJ A;  1JCS A;  3U64 A;  1HX8 A;  4AY5 A;  4IUL A;  4ZHB A;  4MBG A;  4GYY A;  1H0A A;  1SW6 A;  4AXH A;  4WWP A;  3AG2 E;  3PE3 A;  3FTS A;  1HS6 A;  3RRM B;  4N3C A;  3TGO A;  3ZIM A;  3BEE A;  2BKK B;  3JQ0 A;  3WG7 E;  2PQR A;  1FPP A;  2WVI A;  4EZJ A;  2LSV A;  3ASN E;  5EDS A;  3CQG B;  3BG0 B;  3ZHE B;  3ABK E;  5HI7 A;  4Y6C A;  3UM3 A;  3S7J A;  3ASO E;  1SZ9 A;  1IQR A;  3RSE G;  1K8K G;  4GZ6 A;  3RJV A;  1BPO A;  2P9S G;  1OCR E;  5FJY A;  4NAC A;  3MA5 A;  2DVW A;  1E90 A;  3QOU A;  1SZA A;  3GYZ A;  3CQC B;  3DEO A;  3FTV A;  4XX5 A;  2JLB A;  3E4B A;  3ZPJ A;  2L6B A;  2X6H A;  4UWH A;  1X5B A;  3SHF A;  4BET A;  5BW8 C;  2IJG X;  2XGO A;  2L6J A;  5CEC B;  3TWV A;  3ASD A;  5LCW C;  3PUJ A;  1NZN A;  2XQ0 A;  3PZD A;  5H7P A;  1EYH A;  3KS2 A;  2XRZ A;  5D0Q D;  2Y69 E;  1KPS B;  3HHM A;  4LUN U;  1NA3 A;  5ARG A;  2XRY A;  4URK A;  2JEK A;  3Q49 B;  2EIK E;  4G8L A;  2WQ6 A;  1L5J A;  2X6F A;  3J5P A;  4I43 A;  2L0I A;  4TXR A;  3L6A A;  5B3S E;  1ZU2 A;  4JL0 A;  4DI3 A;  3HRA A;  5ANR A;  4BSZ B;  2WXG A;  3PNT B;  3PE4 A;  4HB5 A;  4XIF A;  3UPV A;  4EHM A;  1DCQ A;  4WWN A;  5EID A;  2H6I A;  4MLP A;  5EYL A;  1VDY A;  1HE8 A;  4F53 A;  4JVS A;  2LO6 A;  5AQB A;  3FTW A;  2I1J A;  1A5E A;  3Q78 A;  3W9F A;  3CEQ A;  4BX9 A;  1UN8 A;  2BUG A;  4OAV B;  2WM9 A;  3T9K A;  4CEM A;  4GPK A;  4FC8 A;  5AQA A;  1P5Q A;  3VLE A;  4EQF A;  4TXQ A;  5BXO A;  5BUZ A;  1BI8 B;  2XPI A;  5EN5 D;  1E96 B;  2F8Y A;  3EHM A;  4L2L A;  5LP0 A;  3U3W A;  2HYZ A;  2PZI A;  4C0M A;  4UWK A;  2WXN A;  3HDX A;  3CHP A;  4XZ4 A;  1EDU A;  3HXB A;  4DK5 A;  3UIN C;  4PUC A;  3B7B A;  3ZXP A;  3GZ1 A;  4I9E A;  4RG6 A;  3DXK G;  3NOC D;  4Q69 A;  1JWF A;  4FHK A;  2EIL E;  1TJC A;  4DLO A;  4BFR A;  5LCW J;  3CVU A;  2PNN A;  4J8F A;  3FTU A;  2FO7 A;  1DNP A;  3EDT B;  4EZK A;  4C0E A;  3IXE A;  4EBA G;  4F7A A;  5KNG A;  5ENN A;  5AN8 A;  2X6K A;  4PS7 A;  3Q7F A;  4N2S A;  1SVX A;  1X81 A;  2Q7F A;  1OWL A;  5E76 A;  1N0Q A;  4D10 C;  5HKP A;  3VTX A;  2AVP A;  1NL4 A;  3EHN A;  3AG1 E;  3ZN3 A;  3ZYQ A;  2XS8 A;  4AVX A;  5B1A E;  4M7C A;  4ILI A;  2L0T B;  3R7Q A;  1DC2 A;  3U66 A;  2GRQ B;  2XEV A;  1UN9 A;  4GA2 A;  4O1O A;  5AJL A;  3T5V A;  2NXP A;  4J0U A;  5CBN A;  4NQ0 A;  3R9A B;  3V79 K;  3D9I A;  2AXU A;  4HNA D;  4FAD A;  3ML8 A;  3UM0 A;  3LJN A;  1U2V G;  3NBN B;  2X3M A;  2WXP A;  3FUL A;  5CMY A;  1XGW A;  4I9C A;  1S64 A;  1TNO A;  1UG3 A;  4F3V A;  3IHV A;  5FQ6 A;  4HLE A;  4PS3 A;  3CVX A;  2KAT A;  4G2V A;  3PZ1 A;  1K1A A;  3FUD A;  4LSZ E;  2ZGD A;  3EHQ A;  3BU8 A;  4RQI A;  4JC8 A;  1SQM A;  3FHE A;  4B8C B;  3BG1 B;  3TJP A;  3FUM A;  2LXL A;  2PL2 A;  3CVY A;  3L9T A;  4LCT A;  3ZEF A;  1AP7 A;  4UI9 C;  2IOS A;  3SZ7 A;  1OY3 D;  1V55 E;  4N39 A;  4UQY A;  1O1R A;  3DSX A;  3CVQ A;  3TAX A;  2DWZ A;  3F6Q A;  4EBA A;  4G23 A;  2VJ8 A;  5EX3 A;  3EIQ C;  2XS1 A;  4NUR A;  2WMN A;  3G2V A;  4Z68 A;  4RLY A;  2CHX A;  2DZO A;  1BI7 B;  2V4H C;  3KSQ A;  5ENO D;  4AJW A;  2GW1 A;  3ISM C;  4G25 A;  2IFU A;  3APC A;  2PM6 A;  3AS5 A;  2AJA A;  5FWQ A;  2FO1 E;  3L13 A;  1UW4 B;  3I5P A;  3LYA A;  4O1P A;  4GCN A;  4N5C A;  3FH7 A;  2DBA A;  4G8K A;  4LNB A;  2LNI A;  2OEV A;  2X6I A;  3MKR A;  4GTQ A;  2KBX A;  1H6P A;  3NAW A;  5ENQ D;  1FT1 A;  5AAR A;  2H6H A;  5CCL A;  2P9U G;  1H2U A;  5B1B E;  2E2E A;  2HO1 A;  4B93 B;  4WNE A;  4GML A;  2B6C A;  2KM4 A;  4GTR A;  2JAB A;  2IQC A;  4UUC A;  5J90 A;  3B7R L;  4J6I A;  4J8Y A;  3ZYL A;  4U0U A;  3SQV A;  2XPZ A;  4OVU A;  3CIA A;  4UWL A;  3JXI A;  4V3I A;  4E85 A;  4L9P A;  3ZYM A;  1G3N B;  2VTB A;  5FTP A;  4B94 A;  3B7T A;  2RFA A;  3RO2 A;  4YDW A;  5CMW A;  5BV1 A;  5JA4 D;  4I2W A;  4G1T A;  4BT9 A;  1KZP A;  3L16 A;  3L08 A;  4JXT A;  3UT4 A;  3FH5 A;  3D9J A;  1N54 A;  2H6F A;  1O1T A;  3N71 A;  3SD5 A;  3CHM A;  4O60 A;  3AG4 E;  3Q15 A;  1ZBP A;  4UI9 J;  1MX6 A;  5FQ4 A;  4WUY A;  3PZ3 A;  4OVV A;  2GRN B;  2XZD G;  4AV7 A;  3UKU G;  4KMO A;  5D2M C;  4N3B A;  2J09 A;  3HG0 D;  3IKO B;  3FH8 A;  5CEA A;  4HS2 A;  3P1U A;  3GZ2 A;  1E7U A;  2V5F A;  5KBA A;  4H7Y A;  1E8W A;  1ELK A;  4GAA A;  4GTP A;  4QFV A;  5BXU A;  2GRP B;  2Y0B G;  4KVO A;  1N95 A;  3FUN A;  4DX6 D;  2VGY A;  4DX2 A;  2ETB A;  5KJM A;  4B0Z A;  3LS8 A;  3HXC A;  3QC1 A;  3HVE A;  4ATG A;  5JJ7 A;  4GPM A;  1TNY A;  1U3D A;  4BY6 A;  4LNG A;  3MJW A;  2QYU A;  3LY9 A;  2F0Y A;  4FLB A;  2E0I A;  4F6R D;  1ZB1 A;  3FU5 A;  4UWF A;  3E34 A;  2MHK A;  4CYM D;  5HQ8 A;  1LD8 A;  1O5M A;  3EUV A;  4YDY A;  4BWR A;  1S63 A;  4K5C A;  2X6J A;  1OUV A;  4U8Y D;  2EQX A;  3SBS A;  4WWO A;  3V30 A;  3D9M A;  2C0M A;  3LXU X;  3NB2 A;  3DEP A;  3VLF A;  4I1M A;  1BD8 A;  5AQ9 A;  3D9N A;  4K03 A;  1BLX B;  2A5U A;  3AS8 A;  4GTS A;  3UT8 A;  5LOZ A;  5BPP A;  3LEW A;  3FFL A;  3MKQ A;  1N4S A;  1MQS A;  2XEH A;  2L9B A;  3CK7 A;  3OAW A;  4I2Z A;  3ZFW A;  4AIF A;  5JHA A;  3CR3 A;  4PS8 A;  3HXF A;  3S7F A;  4EEC A;  2J9Q A;  2CFZ A;  1S0P A;  1OT8 A;  4HBD A;  3PZ4 A;  3MX3 A;  1H2T C;  4GTO A;  3CLJ A;  3ZW3 A;  3CST A;  4GCO A;  4GZ3 A;  3RK6 A;  4DX1 A;  1WDY A;  3EHR A;  2EIM E;  5KJN A;  1WG0 A;  2YHC A;  2OCC E;  4KZC A;  3CVL A;  3Q4A B;  3KAE A;  4F1P A;  4U95 D;  3BQO A;  3SY2 A;  2J08 A;  2I9C A;  3D9H A;  1KLX A;  3FEY A;  4F1S A;  2FBN A;  3Q7A A;  2EIJ E;  2I2O A;  2YNQ A;  4N3A A;  2NSZ A;  2PQN A;  3IHY A;  1H19 A;  4M3O A;  3ABM E;  4G24 A;  4I6G A;  3CHR A;  3FUJ A;  2ILR A;  5BV0 A;  2DCP A;  4NRH B;  3I4G A;  3RIB A;  1Z3Y A;  2GGF A;  3UTM A;  2XGM A;  1HO8 A;  4KXK B;  4AEZ C;  1D8D A;  4HOT A;  3TWS A;  2PM7 A;  4Q96 A;  3O48 A;  4XE0 A;  4GYO A;  3I3N A;  4AM9 A;  3QAR A;  3CHQ A;  3MV2 B;  1MHQ A;  5BNW A;  3TG5 A;  4NIK A;  3UT7 A;  3ULE G;  1FCH A;  1SA4 A;  3S2A A;  4HI9 A;  2A5E A;  4HOR A;  3APD A;  3LPZ A;  1IHB A;  2WXF A;  5A6C A;  4U07 A;  3ZVV A;  1ELW A;  1TN8 A;  2VTB B;  2R02 A;  3MGB A;  3ASH A;  2VSY A;  4I6E A;  4TRQ A;  2BED A;  4GTT A;  1IQU A;  3O4Z A;  2GRO B;  3WXX A;  3MYV A;  2RG8 A;  1K3Z D;  1HG5 A;  5FZS A;  3TWX A;  2F37 A;  3I4R B;  2P9L G;  4W9R A;  1H6O A;  4HOU A;  4LEU A;  5G04 C;  3UM2 A;  3TXM A;  3LVR E;  3BUA A;  5G05 C;  1D9S A;  5DBK A;  1HG2 A;  2WQ7 A;  1N0R A;  3JQ1 A;  4KZ0 A;  2XPY A;  1TNU A;  1XNF A;  4TV3 A;  4CDN A;  3L17 A;  3E37 A;  4J8E A;  2V5Q C;  2XCB A;  4HVB A;  4JEU A;  3UXG A;  3ZUV B;  2HE0 A;  3U4T A;  4GA1 A;  3DPD A;  3KD7 A;  2IO2 C;  4ILH B;  3G2U A;  2OV8 A;  2BTD A;  2MYO A;  3LJ3 A;  4GA0 A;  3ONK A;  3DWL G;  4JHK A;  2OND A;  3Q9U C;  2P9K G;  3DSU A;  5ANL A;  1PC2 A;  3HVE B;  2ION A;  1DCE A;  1Y6I A;  2CHW A;  4WNF A;  3UI2 A;  1Z6T A;  3CGH A;  3SFX A;  3JUI A;  4HRN A;  5A23 A;  3Q75 A;  4C9B B;  2MOW A;  3VTY A;  1S70 B;  5LX8 A;  2Y3A A;  4L7T A;  4EPZ A;  1E8X A;  2WQH A;  4A1S A;  1MZC A;  4K0R A;  3FU0 A;  3FP3 A;  1KT0 A;  3B13 A;  4AP2 A;  4ZFH A;  2IU1 A;  1AWC B;  4L2Y A;  1A17 A;  2WXR A;  4CRW A;  4U8H A;  4MKT A;  1HXI A;  3D9K A;  3QKY A;  4WAF A;  1IKN D;  5AEN A;  4XI9 A;  4DI4 A;  4N5Q A;  3PS6 A;  5D0O D;  3Q47 B;  4HRL A;  3MKQ B;  5FIO A;  5KCM A;  1OCO E;  1IXV A;  3IV0 A;  4P29 A;  3RO3 A;  2LAI A;  3DSV A;  4GMR A;  5C1D A;  4ILG A;  3FDH A;  2Y4U A;  5E75 A;  5G04 J;  3LCA A;  2KC7 A;  4PH4 B;  5A7D B;  3FUI A;  5G05 J;  3UX4 A;  4XEI G;  2MRI A;  3TL5 A;  2AXV A;  3CK9 A;  1GW6 A;  4I1A A;  3TXN A;  4JPS A;  1HH8 A;  2AWI A;  1K1B A;  2VYI A;  1V54 E;  4JZY A;  3QK0 A;  1B89 A;  3IEG A;  3MEK A;  4YDE A;  3CHO A;  2J4B A;  3RAU A;  2J4D A;  2R17 C;  5D66 A;  1TN7 A;  1U3C A;  3E30 A;  4CDR A;  4U04 A;  2OVB A;  4HOS A;  1QZ2 A;  3SNX A;  3G2T A;  4MS6 A;  3RRU A;  5ENP D;  3FEX A;  1FVH A;  3PH0 C;  3FWV A;  4BT8 A;  2CG2 A;  4U96 D;  5HS0 A;  2Y4T A;  2ZIS A;  3EU5 A;  3KEZ A;  4BES A;  1JCR A;  4JD2 G;  4I1O B;  4A3V A;  3QWP A;  5FQ8 A;  3FUF A;  4PDX A;  2P9I G;  1OWM A;  1OCC E;  3B7S A;  3VLD A;  4KT6 B;  4RVB A;  5KWD A;  1OWO A;  2WXH A;  3J5Q B;  4CT0 A;  3URZ A;  1JWG A;  4JW1 A;  3V2O A;  1QBQ A;  3QWW A;  3FTY A;  4Y6W A;  4UQZ A;  2RD0 A;  3FU3 A;  3MCX A;  3V31 A;  5DIZ A;  3ZXS A;  3D9L A;  5ARF A;  3B95 A;  3GW4 A;  5T8I A;  4TUU A;  3SGH A;  1O1S A;  4AOF A;  3PRE A;  4B89 A;  4BTB A;  4A55 A;  4CGV A;  1N4Q A;  3FTX A;  3TWQ A;  5AQ7 A;  3DSS A;  4LRZ A;  4B8A A;  2FUL A;  1WY6 A;  2NYJ A;  1N94 A;  3L82 A;  2AW6 A;  3C3R A;  2QC9 A;  1IHG A;  2AXZ A;  1N4R A;  2UY1 A;  4U0Z A;  3SF4 A;  2OVF A;  3ULQ A;  4DUI A;  3C3Q A;  4DRX E;  4DX5 D;  3LKU A;  5KNH D;  5IY5 E;  3D9P A;  1INZ A; 
#chains in the Genus database with same CATH homology
 1PAQ A;  3APF A;  4MRU A;  2X38 A;  2NSZ A;  2XCC A;  3FU6 A;  2KCL A;  2PQN A;  3IHY A;  4GB9 A;  3L54 A;  1H19 A;  4ILI A;  3ZGQ A;  3T8M A;  4M3O A;  2L0T B;  4RSY A;  4I17 A;  3PUK A;  3OTN A;  4G24 A;  2WXQ A;  4I6G A;  4ME2 A;  3R7Q A;  3U66 A;  3CHR A;  4L23 A;  2VQ2 A;  2XEV A;  3FUJ A;  3JYS A;  1UN9 A;  4GA2 A;  2ILR A;  5BV0 A;  4U0S A;  2DCP A;  5AJL A;  3T5V A;  4NRH B;  2NXP A;  4J0U A;  3R7R A;  3DBS A;  4NQ0 A;  3PDN A;  4GMJ A;  3I4G A;  5AJD A;  1Z3Y A;  2FEZ A;  2GGF A;  3RIB A;  4GU5 A;  3R9A B;  2XGM A;  2V4L A;  3D9I A;  2AXU A;  1HO8 A;  4HFG A;  4KXK B;  4AEZ C;  4CT4 A;  4HOT A;  4OYS A;  4FAD A;  3ML8 A;  4L1B A;  2PM7 A;  4Q96 A;  3O48 A;  4YND A;  4XE0 A;  4HOQ A;  4GYO A;  2M63 A;  2X3M A;  2WXP A;  2XGS A;  3ML9 A;  3I3N A;  4XKB A;  4AM9 A;  3FUL A;  1NP7 A;  3FTZ A;  1XGW A;  4I9C A;  5CMY A;  4G11 A;  2A4Z A;  3CHQ A;  3MV2 B;  3QAR A;  4RG9 A;  2QY7 A;  1UG3 A;  3AU4 A;  4I6J A;  1EPU A;  1HU3 A;  2KZT A;  4F3V A;  1MHQ A;  3CV0 A;  5FQ7 A;  3IHV A;  3ASG A;  5T3R A;  3G2S A;  5FQ6 A;  3C98 A;  4HLE A;  4FUL A;  4PS3 A;  4ACK A;  3TG5 A;  5BNW A;  3CVX A;  2GRL A;  1LF8 A;  2KAT A;  4G2V A;  2BF0 X;  3QJZ A;  3UT7 A;  3FUD A;  1FCH A;  4APO A;  3CKC A;  2WXK A;  2HM8 A;  4R7L A;  3S2A A;  4HOR A;  2DIW A;  3APD A;  3JCK C;  3GZS A;  2NC9 A;  4JHJ A;  1YA0 A;  5JJ6 A;  4BSX A;  2UWJ G;  3LPZ A;  2WXF A;  5A6C A;  5JHB A;  2IOL A;  3ENE A;  3NQP A;  1Y8M A;  4U07 A;  3IBE A;  3ZVV A;  2I1K A;  4JC8 A;  1WAO 1;  5M72 A;  1SQM A;  3FHE A;  4B8C B;  2V8S E;  1ELW A;  3FUH A;  3BG1 B;  3TJP A;  2YIN A;  1W3B A;  3FUM A;  5KJK A;  2V0P A;  2VTB B;  5J08 A;  2PL2 A;  3MGB A;  4O6F A;  5EKQ D;  3ASH A;  2VSY A;  4IN3 B;  4I6E A;  1E8Y A;  3LY7 A;  3PRZ A;  4TRQ A;  3CVY A;  1DVP A;  3LDZ A;  2YQ8 A;  1IQU A;  2HR2 A;  3O4Z A;  4LCT A;  3WXX A;  3ZEF A;  3Q5M A;  3MYV A;  4ACL A;  4AY6 A;  4UI9 K;  3U9W A;  4FHJ A;  1WM5 A;  4EZL A;  2RG8 A;  3NZU A;  1HFA A;  1HG5 A;  5FT9 A;  5FZS A;  4UI9 C;  2IOS A;  3SZ7 A;  2J07 A;  3CSF A;  4N39 A;  4UQY A;  3I4R B;  4DPR A;  4APF A;  5KJL A;  3CVN A;  2P58 C;  4W9R A;  3S7B A;  3QAQ A;  2C0L A;  3CVQ A;  4HOU A;  3SFZ A;  4LEU A;  3D9O A;  5G04 C;  3TAX A;  4EBA A;  3LVQ E;  3TXM A;  3SBT B;  1OWP A;  3LVR E;  3S7D A;  5G05 C;  4G23 A;  2VJ8 A;  5EX3 A;  3EIQ C;  2VGX B;  5G2N A;  4BTA A;  4NUR A;  4U63 A;  5DBK A;  1KT1 A;  2WMN A;  3PNL B;  3G2V A;  1HF8 A;  1HG2 A;  4ANU A;  2WQ7 A;  3JQ1 A;  2FI7 A;  4IRU A;  2CHX A;  2VSN A;  3FUK A;  4KZ0 A;  4XI0 A;  4ANV A;  2XPY A;  1FVF A;  3B7U X;  3L22 A;  4AJW A;  1XNF A;  2WXO A;  2CHZ A;  3QWV A;  2GW1 A;  4TV3 A;  4Q94 A;  1ELR A;  4G25 A;  2IFU A;  4CDN A;  3L17 A;  3HIZ A;  2GRM A;  3APC A;  2PM6 A;  3AS5 A;  4KYO B;  5FWQ A;  2WXL A;  4J8E A;  2XCB A;  3SI5 A;  3L13 A;  4HVB A;  1UW4 B;  3AU5 A;  3CKB A;  3I5P A;  4JEU A;  3LYA A;  5AIJ A;  4G26 A;  4GCN A;  4N5C A;  2R5S A;  3FH7 A;  4UWG A;  4GA1 A;  3DPD A;  2DBA A;  3KD7 A;  5FZQ A;  4ILH B;  3U4T A;  2LNI A;  2X6I A;  3MKR A;  3G2U A;  2OV8 A;  5T4Y A;  2WXJ A;  2BTD A;  3LJ3 A;  4GA0 A;  3U64 A;  4GYW A;  1HX8 A;  3ONK A;  5EX0 A;  4AY5 A;  1IYG A;  4IUL A;  2OND A;  4JHK A;  3NZS A;  4ANW A;  3FUE A;  4FJY A;  4GYY A;  5ANL A;  5CCL A;  1PC2 A;  4FA6 A;  3HVE B;  1H0A A;  1H2U A;  2E2E A;  2HO1 A;  1Y6I A;  2ION A;  2VSX E;  4WNE A;  2CHW A;  4HXI A;  4WNF A;  4AXH A;  1UJK A;  4GML A;  1Z6T A;  4WWP A;  4IYP A;  3CGH A;  3JUI A;  3PE3 A;  5A23 A;  3FTS A;  1HS6 A;  2KM4 A;  4KVM A;  4C9B B;  4JA9 A;  4A1G A;  3ESL A;  2MOW A;  3RRM B;  4N3C A;  2QFC A;  3TGO A;  3ZIM A;  3VTY A;  2IQC A;  3BEE A;  5LX8 A;  3QB2 A;  5J90 A;  2Y3A A;  3B7R L;  4J6I A;  4UQX A;  4L7T A;  3JQ0 A;  3ZYL A;  4EPZ A;  4U0U A;  3OXG A;  2PQR A;  1E8X A;  2WQH A;  2XPZ A;  3CIA A;  4OVU A;  4A1S A;  4K0R A;  3FU0 A;  4UWL A;  5AYW D;  3RRN B;  4V3I A;  3FP3 A;  1KT0 A;  4FU3 A;  2WVI A;  4EZJ A;  2ZU6 B;  2LSV A;  3B13 A;  4AP2 A;  4E85 A;  5EDS A;  3CQG B;  3BG0 B;  3ZHE B;  2CFU A;  4WND A;  2IU1 A;  3UQ3 A;  3ZYM A;  2VTB A;  5FTP A;  4L2Y A;  5G55 A;  5HI7 A;  4B94 A;  3B7T A;  4Y6C A;  3RO2 A;  5CMW A;  3ONL A;  4GZC A;  3S7J A;  5BV1 A;  1A17 A;  3CVP A;  1SZ9 A;  2WXR A;  3EJN A;  4I2W A;  2KCK A;  2WXM A;  4G1T A;  4BT9 A;  4CRW A;  3L16 A;  3L08 A;  5C2Y A;  5JJT A;  1IQR A;  4CDM A;  4U8H A;  2KZT B;  1HXI A;  4MKT A;  3D9K A;  4JXT A;  3QKY A;  4WAF A;  5AEN A;  4XI9 A;  3UT4 A;  3FH5 A;  3D9J A;  4GZ6 A;  4DI4 A;  3RJV A;  1BPO A;  1N54 A;  5FZR A;  3PS6 A;  5FJY A;  5D0O D;  3Q47 B;  4NAC A;  3MKQ B;  3MA5 A;  1E90 A;  1H2V C;  3N71 A;  5KCM A;  3SD5 A;  3QOU A;  1SZA A;  3CHM A;  4UI9 J;  3Q15 A;  2VSO E;  1ZBP A;  3GYZ A;  3CQC B;  3FTV A;  4XX5 A;  3UMV A;  3IV0 A;  4P29 A;  2JLB A;  3E4B A;  2LAI A;  3RO3 A;  3ZPJ A;  2XHE A;  5FQ4 A;  4WUY A;  3CK8 A;  4OVV A;  4ILG A;  5C1D A;  4A3T A;  4FP7 A;  2X6H A;  3FDH A;  4UWH A;  2Y4U A;  2VGX A;  5E75 A;  1X5B A;  4AV7 A;  5G04 J;  3LCA A;  2KC7 A;  4KMO A;  4PH4 B;  5A7D B;  4FLH A;  4N3B A;  2J09 A;  3FUI A;  5G05 J;  3UX4 A;  3SHF A;  3IKO B;  3AS4 A;  5BW8 C;  2MRI A;  2IJG X;  3FH8 A;  3TL5 A;  2XGO A;  2L6J A;  4HS2 A;  3P1U A;  2AXV A;  3ASD A;  3CK9 A;  5LCW C;  3CVW A;  3PUJ A;  1NZN A;  2XQ0 A;  3PVL A;  3GZ2 A;  2IF4 A;  1GW6 A;  1E7U A;  3PZD A;  4I1A A;  1EF1 C;  1EYH A;  1NA0 A;  2V5F A;  4KBQ A;  3MZL B;  3TXN A;  4JPS A;  4H7Y A;  1HH8 A;  1E8W A;  2AWI A;  3KS2 A;  1ELK A;  2XRZ A;  4GAA A;  4GZ5 A;  5D0Q D;  2VYI A;  4JZY A;  3HHM A;  4LUN U;  4QFV A;  1NA3 A;  5ARG A;  3QK0 A;  1B89 A;  3IEG A;  2XRY A;  3MEK A;  4URK A;  3CHO A;  2JEK A;  2J4B A;  1UJJ A;  2J4D A;  2R17 C;  3Q49 B;  3FUN A;  3NF1 A;  3QDN A;  4KVO A;  5CHE E;  1U3C A;  2WQ6 A;  2J49 A;  3CVV A;  2VGY A;  1L5J A;  4CDR A;  5KJM A;  4B0Z A;  1H6K A;  2X6F A;  3LS8 A;  1E7V A;  3QC1 A;  3HVE A;  4ATG A;  4I43 A;  4U04 A;  2L0I A;  2OVB A;  3PEV B;  4HOS A;  5JJ7 A;  3L6A A;  3UUX A;  1ZU2 A;  4JL0 A;  1U3D A;  4JA7 A;  4BY6 A;  1QZ2 A;  4DI3 A;  3MJW A;  1E8Z A;  2UY1 B;  5ANR A;  1Z3X A;  4JEH A;  2WXG A;  1N52 A;  3SNX A;  1QQE A;  3PNT B;  2C2L A;  3G2T A;  3PE4 A;  4XIF A;  4MS6 A;  3RRU A;  3FEX A;  3LY9 A;  3UPV A;  4E6H A;  4WWN A;  4FLB A;  1FVH A;  4MLP A;  2E0I A;  1HZ4 A;  3PH0 C;  3FWV A;  4BT8 A;  1VDY A;  1HE8 A;  4F53 A;  4JVS A;  2CG2 A;  2OOE A;  2LO6 A;  3P2B A;  3FU5 A;  4UWF A;  2MHK A;  2Y4T A;  4GZD A;  5HQ8 A;  3KEZ A;  4J8D A;  3FTW A;  2I1J A;  4BWR A;  3FY4 A;  2X6J A;  1OUV A;  4XKC A;  3RU0 A;  3ZHE A;  4I1O B;  3ASF A;  3CEQ A;  4J8S A;  2EQX A;  4A3V A;  5LFA A;  3QWP A;  5FQ8 A;  4LER A;  3FUF A;  4BX9 A;  1UN8 A;  4PDX A;  3SBS A;  4BX8 A;  4WWO A;  1OWM A;  3D9M A;  2C0M A;  2BUG A;  3LXU X;  3MV3 B;  3VLF A;  5CCM A;  3B7S A;  4I1M A;  4N2Q A;  2WPV A;  2WM9 A;  3VLD A;  3D9N A;  4K03 A;  4KT6 B;  4CEM A;  2A5U A;  2FF4 A;  4GPK A;  3AS8 A;  4RVB A;  4FC8 A;  3UT8 A;  1OWO A;  1P5Q A;  1QNF A;  2WXI A;  2R59 A;  3VLE A;  4EQF A;  3T5X A;  5BUZ A;  5LOZ A;  2WXH A;  4CT0 A;  5BPP A;  3LEW A;  2XPI A;  3URZ A;  2I6H A;  1E96 B;  1JWG A;  3FFL A;  3EHM A;  3MKQ A;  4ANX A;  4JW1 A;  4L2L A;  5LP0 A;  4DLQ A;  1MQS A;  3U3W A;  2HYZ A;  4WNG A;  3QWW A;  2L9B A;  3FTY A;  3CK7 A;  2PZI A;  4C0M A;  3OXF A;  4UWK A;  3OAW A;  4Y6W A;  4UQZ A;  2RD0 A;  2WXN A;  4I2Z A;  3HDX A;  3TG4 A;  3CHP A;  3G2W A;  4XZ4 A;  3ZFW A;  1EDU A;  4AIF A;  3CHS A;  5JHA A;  3FU3 A;  3MCX A;  4DK5 A;  4JHR A;  3CR3 A;  4PS8 A;  5DIZ A;  3ZXS A;  4PUC A;  3D9L A;  3S7F A;  4EEC A;  2J9Q A;  3GZ1 A;  5ARF A;  2WB2 A;  2CFZ A;  3GW4 A;  1S0P A;  4I9E A;  4RG6 A;  4Q69 A;  1PY1 A;  5T8I A;  1JWF A;  3ESK A;  4FHK A;  4TUU A;  3EIJ A;  3SGH A;  4AOF A;  4YVQ C;  1TJC A;  3PRE A;  4DLO A;  3LY8 A;  4H7X A;  4BFR A;  1JPL A;  1TJF A;  5LCW J;  3MX3 A;  1H2T C;  3ZRH A;  4B89 A;  3CVU A;  4BTB A;  3CLJ A;  4A55 A;  4J8F A;  3ZW3 A;  2CG3 A;  3FTU A;  3ZYK A;  2FO7 A;  1DNP A;  3CST A;  3EDT B;  3OXL A;  4CGV A;  4EZK A;  4C0E A;  4GCO A;  3FTX A;  4GZ3 A;  4EBA G;  1JUQ A;  5BT1 A;  4F7A A;  3RK6 A;  3PEU B;  4CCA A;  1OWN A;  5ENN A;  2YHE A;  4FJZ A;  4LRZ A;  4B8A A;  5KJN A;  3HYM B;  2LSU A;  2FUL A;  4ABN A;  1WY6 A;  2YHC A;  1TEZ A;  2KCV A;  4KZC A;  2AW6 A;  2X6K A;  4YVO A;  4PS7 A;  4N2S A;  4DJA A;  3CVL A;  3D3M A;  2Q7F A;  3Q4A B;  3KAE A;  1OWL A;  1IHG A;  2AXZ A;  2LAH A;  2UY1 A;  5E76 A;  4U0Z A;  3SF4 A;  2J08 A;  2OVF A;  2WMO A;  2I9C A;  3ULQ A;  4D10 C;  3VTX A;  1KLX A;  2AVP A;  3FEY A;  3K9I A;  4F1S A;  3EHN A;  3QNK A;  3ZN3 A;  3LKU A;  3ZYQ A;  2FBN A;  3D9P A;  2I2O A;  1INZ A;  2YNQ A;  3RKV A;  4CGW A;  4N3A A;  4AVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...