3RRNB

S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
293
structure length
293
Chain Sequence
FDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 114
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrnB00
3PEUB 3RRNB 3PEVB 3RRMB
chains in the Genus database with same CATH superfamily
3HXFA 3ULYA 4BX9A 2YNQA 5LCWJ 4CCAA 3VLDA 3P1UA 4I2WA 4E6HA 2IU1A 2KZTB 4PDXA 2OOEA 4K5BA 4CYMD 3CKCA 4QQIA 3Q7AA 4EHMA 4GZ3A 3MEKA 4EBAA 3Q73A 1N11A 3HG0D 3L13A 2ETAA 3TXNA 4HOTA 4G8LA 4KZCA 2CFZA 3CVUA 3ML9A 4GZ5A 4HVBA 2IO3C 3FTYA 2H6GA 3JUIA 5T3RA 4FLBA 2R59A 1PAQA 1Z6TA 3SQVA 4DX6D 3TWWA 3EJNA 3PZ3A 5G05J 4N3BA 2R2LA 1SQMA 3KAEA 1JPLA 2IOSA 5CRUA 4EZKA 2CFUA 5ENQD 3MYVA 3PEUB 5BV1A 1H6PA 4MS6A 4UI9C 3PNTB 5KJNA 2XEHA 5ENRD 4JHJA 3FUEA 1KT1A 2OV8A 5G04C 4O6FA 3G2UA 3SNXA 5AARA 3CVXA 2MRIA 4O1OA 1RZ4A 3NF1A 4I17A 4JXTA 4K5CA 1OCRE 5FQ7A 2V5QC 3TJPA 4DUIA 4UQYA 3LPZA 4HRLA 4U0SA 1WM5A 3PVLA 4HXIA 4G2VA 2J8SD 2WXLA 4GA1A 4RVBA 4AP2A 3AU5A 3EUVA 5B1AE 2OEVA 3T9KA 2P9IG 3ISMC 2IF4A 1HH8A 2VSYA 4C48B 4J8YA 3BG0B 3PE4A 4ATGA 5BV0A 4URKA 4NURA 4P29A 2J4DA 1DC2A 3D9NA 2E2EA 2GROB 5CEDB 2GGFA 4DRXE 1IYGA 4J7WA 2C2LA 3FTXA 3L54A 3AS5A 1ELRA 5BW8C 1NP7A 2CHXA 3UKUG 3DSXA 3CK7A 4JHKA 2FI7A 4HNAD 4U7EB 3EIJA 1QNFA 3CIAA 3U9WA 5CEAA 3ONKA 1E90A 1BI7B 3UT4A 3VLFA 2V5FA 3MKRA 3PREA 3C72A 1H6OA 4FADA 4CEMA 3ZXPA 3SY2A 1EDUA 3PDNA 4B0ZA 1OXJA 2VSXE 4LNGA 2PM6A 4YDWA 1NZNA 1OY3D 2RD0A 4N3AA 2M63A 2ETBA 3D9OA 4FHJA 1WAO1 4RG9A 3FU5A 3HHMA 3UTMA 3RJVA 1NI1A 2RFAA 2J9QA 3QJZA 4GCOA 3QARA 2PZIA 3E4BA 3RO2A 3C5RA 5JHBA 3KEAA 3FU0A 3D9PA 4YVQC 3LXUX 4B89A 3AG4E 2Q7FA 2XENA 3O4ZA 4GPMA 1X81A 2C0LA 3AG2E 3R9AB 1NA3A 3L17A 3RRNB 1JCRA 4OYSA 1E8XA 5CCLA 1MX6A 2P9NG 2WPVA 3LVQE 3SFXA 3MKQB 5HRYA 1E7UA 3PH0C 5DBKA 3FH8A 3GZ2A 4WUYA 3IEGA 4R7LA 3B7BA 2FO1E 2XCCA 3ABME 3HVEA 4A55A 3Q4AB 2ONDA 5EX3A 3BEEA 4Q96A 3CVLA 2OEWA 2HM8A 1TNBA 3QOUA 4WWNA 3Q75A 4IULA 3MV2B 3L16A 1QBQA 5KCMA 4J8SA 4PS7A 1O1SA 4I2ZA 3IBEA 3S7FA 4XE0A 5LCWC 3AU4A 4L1BA 3CVYA 2WQHA 2VGXB 2QYJA 2QYUA 2WXHA 2VSNA 2J09A 3EIQC 3L08A 1U2VG 3DPYA 2RFMA 1SW6A 2EILE 4IN3B 1RW2A 3RSEG 2I1JA 3FU3A 5DIZA 3SBSA 4LCTA 3ASDA 3QB2A 3FUFA 3S7JA 4U0UA 2WXQA 3ASGA 3LJ3A 4AXHA 3DWLG 4FHKA 2UY1B 3JQ1A 4N3CA 2EINE 2KC7A 2XRYA 4HRMB 3UQ3A 3LCAA 3PZ4A 4A3VA 1XGWA 2CHWA 3KSLA 2P9KG 3ASOE 1H2UA 2I6HA 2HR2A 3ZYMA 3UT8A 3CVPA 4BT8A 1Z3XA 4N5CA 3JCKC 3FTVA 2AXVA 4U63A 4HORA 3JXJA 2BTDA 3PE3A 1UN9A 2DZOA 1DCEA 5LOZA 1HG2A 5ANLA 5FZQA 2XPIA 5EILA 3CK9A 2Y4TA 5E75A 5CRVA 3PZ2A 3Q9UC 1TR4A 1N9AA 1MHQA 1Y8MA 4J8FA 1U3DA 3ULEG 3C3RA 4N39A 3I4GA 1S63A 3MZLB 4GTVA 2P9SG 3TWXA 1QYMA 5G2NA 3Q79A 4MRUA 4N2SA 1FVHA 2V8SE 3HIZA 4BEPA 1D8DA 1NA0A 2LUHA 5IY5E 3PUKA 5D0OD 3FTWA 3FTUA 3FUJA 1PC2A 4FJZA 3TWSA 3KEZA 3QAQA 4U07A 3IXEA 5BXOA 2LSVA 1OT8A 2V0PA 1OWMA 1ZU2A 5EX0A 3TL5A 2QY7A 5FQ4A 1TEZA 2IO2C 2WQ7A 2BEDA 5KNHD 4AY5A 2ETCA 4B93B 5FZSA 1DNPA 3CHMA 3JXIA 3Q7FA 3Q78A 2LAHA 1IQRA 1HU3A 5HQ8A 3C98A 1NFIE 3R7RA 3ZRHA 2J4BA 2R02A 4N5QA 2CG3A 1FCHA 4TXPA 3EHRA 3QWPA 1JCSA 4XI0A 2F8XK 1GW6A 3CEQA 5AN8A 5CECB 4HI9A 3C3OA 3D9LA 2V4HC 5D0QD 3R7QA 2JLBA 1UG3A 3NB2A 5CERB 3CGHA 1H2VC 4HI8A 5AQ9A 3FU6A 3DSVA 1FPPA 2OCCE 2EQXA 4OVVA 1K1AA 4I6JA 3APFA 4CDRA 4DX7D 2I1KA 3ZYLA 2WVIA 3IHYA 4CT4A 1FT2A 4HS2A 3UT7A 4J8EA 4XZ4A 3B7TA 2LAIA 3FHEA 4F7AA 4AY6A 3QWVA 2X6JA 3APDA 4F53A 2FEZA 1KT0A 2VGXA 2XGSA 4A3TA 3EU9A 3G2WA 4I43A 2OVBA 1OCZE 2BKGA 4JEUA 4WNFA 3ASNE 3IV0A 3JQ0A 5AIJA 2ZGGA 4ABNA 2LO6A 4G23A 3Q15A 4JPSA 1IKND 2WMNA 4EBAG 5EDSA 3AAAC 3TGOA 2XS8A 4U8VD 4O1PA 4K03A 4AEZC 1U3CA 5ENOD 2Y1LE 1N4QA 3DSSA 3QKYA 3S7DA 5AQ7A 3ESKA 3ZVVA 4KMOA 3CVWA 1E8ZA 4IRUA 1HZ4A 2EIME 2GRLA 4F6RD 4GCNA 5C1DA 1HE8A 3TWUA 3NQPA 2F0YA 1UJKA 3NOGD 2NC9A 4FU3A 4O60A 4ILIA 3OXGA 3MKQA 1TJFA 3ZHEB 3FUHA 2QFCA 5ENSD 1FT1A 1KZOA 1S70B 4BY6A 2AWIA 4AM9A 2GRNB 3DSTA 2I9CA 3UM2A 4RSYA 4JB8P 3ULQA 1O1RA 3NZUA 1LF8A 2V4LA 4LEUA 3O48A 4GTSA 4LUNU 1OCOE 4RQIA 4U0ZA 3CVQA 3UM0A 3AJIA 2P2CP 3J5QB 1LTXA 5FINA 4EECA 2JEKA 1HXIA 2CHZA 1JWFA 2PL2A 4GYOA 3U66A 3D9MA 1IHGA 3ABKE 4DK5A 4HFGA 4FP7A 1IQUA 1X5BA 2UY1A 5FJYA 1YCSB 3EU5A 1EYHA 1MYOA 1HFAA 4UWLA 3Q49B 5CMYA 1TNZA 1OCCE 4LRZA 5J90A 3F6QA 1JCQA 5A23A 1S0PA 3PZDA 4DX1A 4OAUC 3JYSA 1ELWA 3Q5MA 3UIOC 1HS6A 3FUKA 3JUEA 1MX2A 1JWGA 3KD7A 3X2QE 1MX4A 2FF4A 5KWDA 1HF8A 4HOSA 3MGBA 2X6HA 1KPSB 4CGVA 4I9EA 4H7YA 4BERA 4XKBA 4BSZB 1TN7A 2Y69E 1TNOA 5LP0A 5ENTD 3K9IA 2H6IA 2BUGA 4GYWA 5AJLA 4KZ0A 2ZXWE 4WNGA 4U8HA 4G24A 3LS8A 1E96B 3TWQA 3FULA 3ZXSA 3E30A 4GZDA 1K1BA 2XHEA 1Z3YA 3FEXA 1IXVA 3I5PA 2R17C 4LNBA 4WNDA 2FBNA 3DXKG 4TUMA 2LXMA 3UINC 4PS8A 3L82A 2L0TB 4MBGA 1MJ0A 3FP3A 3QK0A 5KJMA 4N2QA 4JZYA 1EPUA 3DEOA 3UIPC 3FEYA 4HOUA 4C0EA 1BLXB 4DPRA 3UKRG 1E8YA 4PH4B 4HQDA 3WXXA 4ANUA 1B89A 4GTOA 1UOHA 3QNKA 3CHSA 2VGYA 2RKKA 3U4TA 3WG7E 3SFZA 2DIWA 1HO8A 1YA0A 2IOLA 3ZEFA 2R03A 3DBSA 5EIBE 3TG4A 2L6JA 2EIJE 4B8CB 2MOWA 3QDNA 3SZ7A 5EYPF 2P9UG 1UN8A 3P2BA 4HLEA 2KATA 4EQFA 2HE0A 3RK6A 4J0UA 4UWGA 3BG1B 2X38A 1D8EA 4BFRA 3DPDA 4A1SA 4WNEA 1K3ZD 3MV3B 3G2SA 2Y4UA 4KBQA 5LX8A 3T8MA 2KBXA 1XNFA 1NL4A 3B13A 1OWOA 1LD7A 4AJWA 3SD5A 4JA7A 5HKPA 2IONA 4GMJA 2YQ8A 1VDYA 3HRAA 3FUMA 1A5EA 3TG5A 2XPYA 4KT6B 4ILHB 4V3IA 5A6CA 1LD8A 4I6GA 4IYPA 3B95A 1H0AA 4GU5A 4XIFA 3SO8A 3B7RL 5KJKA 1YMPA 3LY8A 5CCMA 2IJGX 1TNYA 2NYJA 2DWZA 5BXUA 3PRZA 2XQ0A 4FULA 4KYOB 5LFAA 2DYRE 2A4ZA 3CVVA 1SA4A 4XEIG 4B8AA 4KVMA 3OAWA 4YDOA 4FJYA 3Q47B 4UWHA 3ZHEA 4U04A 2ZISA 4XI9A 2YHCA 2KCVA 2PQNA 2F37A 4JW1A 5FT9A 2P9LG 4L9PA 2PQRA 3UM3A 4ANXA 2ZU6B 2WB2A 4J8DA 4EPZA 4GB9A 2R5SA 3EHMA 1OWNA 3NBNB 5JMND 3ABLE 3RO3A 5EN5D 3FDHA 1L5JA 4HLLA 2WXGA 2VJ8A 3ZFWA 3LDZA 3UX4A 4HOQA 3EDTB 2B0OE 3MX3A 3NZSA 5ARFA 4NRHB 3ZW3A 2WXOA 4DI4A 3SBTB 4CGWA 3ZGQA 4G25A 4ZFHA 1TN6A 2BF0X 2J07A 1OWPA 4DLOA 1AWCB 4JA9A 3FWVA 3LY7A 3SF4A 1JUQA 3RKVA 3NOCD 4AOFA 3ZN3A 3IHVA 5JJ7A 3HVEB 2ZIRA 5ENPD 1ELKA 4YDEA 3TWTA 4DLQA 3APCA 5T4YA 2EIKE 2X6FA 2PNNA 2Y3AA 1N52A 4K5AB 1H19A 3DRAA 3FFLA 4PS3A 2F8YA 2VGEA 4WWPA 3W9GA 3TWVA 4NIKA 4D10C 4OAVB 2GRPB 3HXCA 4TXQA 2A5UA 4CDMA 4F1SA 2CG2A 2E0IA 1FVFA 3I3NA 4F1PA 4CT0A 4GTPA 1V55E 4M7CA 3CQGB 3CKBA 2HYZA 4L23A 2IEJA 4L2LA 2L6BA 4EZLA 3EHNA 2H6FA 2DZNA 4MLPA 3GYZA 3D9JA 4Q94A 2A5EA 2JABA 3E34A 3DEPA 1SVXA 3E37A 5EKQD 4ATZD 4PUCA 5JJTA 4TXRA 4FC8A 3PUJA 4JHRA 3RRUA 4YVOA 4HBDA 3PZ1A 4TRQA 4ILGA 5KNGA 4ACKA 5AJDA 5AENA 2GW1A 3LVRE 4G11A 4I1MA 4C0MA 1E7VA 4U95D 3ZPJA 2XPZA 3FTZA 4DX2A 3VLEA 3T8KA 2VYIA 3KSQA 3TWRA 1G3NB 1H2TC 3CV0A 4JL0A 3FUNA 3UUXA 3BQOA 4GMRA 3RRMB 4UQXA 5EYLA 4Y6WA 3QC1A 4ZHBA 1PY1A 3B7UX 4G1TA 4GTQA 5AQBA 1N95A 1WY6A 4K0RA 3GZ1A 3UI2A 2QZAA 4GZ6A 5JHAA 3QWWA 5M72A 4MKTA 3DXMG 3G2TA 2DVWA 3AG3E 3HDXA 2DYSE 4BWRA 3CLJA 4DJAA 4I9CA 5JA4D 5AYWD 2IY0C 5G55A 4NACA 5H7PA 5KJLA 1OUVA 5BUZA 4CDNA 2WMOA 4E85A 3L9TA 1Z5SC 2KCLA 4JC8A 1O5MA 4BTBA 3V31A 4H7XA 4GMLA 3CSTA 1AP7A 2MYOA 4A1GA 1MQSA 5HS0A 4YDYA 4L2YA 1S64A 3LY9A 5BNWA 3ASHA 3D9IA 4YNDA 4WAFA 2LXLA 2XCBA 5ENNA 3AS4A 3U3WA 2WXKA 4ACLA 4GZCA 3L6AA 1N94A 5KBAA 2XEEA 5ANRA 4GTTA 4NQ0A 5FQ8A 5EIDA 5HI7A 3CSFA 1QQEA 3ZKJA 2QC9A 4B94A 1EF1C 4JVSA 3D3MA 4UWFA 3FY4A 2VQ2A 2L9BA 2XS1A 3J5PA 2DCPA 4BETA 4APFA 2VTBB 3OXFA 2NXPA 5FTPA 3T5XA 2KZTA 3UPVA 3PEVB 4F3VA 4G26A 5CMWA 3VTXA 1TN8A 2XGOA 3V30A 5AAOA 3CK8A 3UXGA 2AJAA 5ITZF 5D66A 2GRRB 5D2MC 1K8KG 3ML8A 1UJJA 2L0IA 2IFUA 3ZU7B 3BU8A 3PS6A 2XRZA 4TV3A 3HXEA 5CBOA 3ENEA 4M3OA 3FH7A 2X6KA 4QFVA 2J08A 4CRWA 2AVPA 4ANWA 2GRQB 1OWLA 4BTAA 2AXZA 3CHRA 2WXNA 2XZTG 2UWJG 4AVXA 5G04J 3IKOB 3ZNGA 3C3QA 3FUDA 3EHQA 1N4RA 3R9MA 3U64A 1DVPA 3VTYA 3DSUA 4UUCA 4TUUA 4J6IA 4BX8A 1W3BA 2AXUA 4BESA 1BI8B 1SZ9A 4JD2G 4UWKA 1N0QA 4I6EA 5ARGA 1HG5A 2FULA 1ZB1A 3CHPA 5BT1A 1BD8A 5CHEE 3MCXA 1KLXA 5T8IA 5C2YA 3TAXA 3I4RB 4LSZE 4ME2A 3GZSA 5B3SE 1TJCA 3FH5A 3OTNA 2PM7A 2NSZA 1D9SA 3ESLA 4RLYA 3SFYA 3S2AA 3URZA 3E32A 4UQZA 4I1OB 2MHKA 3N71A 4LG6A 2BKKB 4FA6A 4FLHA 3BUAA 2XZDG 4Z68A 4DX5D 3CQCB 3SGHA 4Y6CA 1KZPA 1TYQG 3AS8A 4C9BB 2B6CA 1BU9A 2DBAA 4JEHA 2XEVA 3CVNA 5J08A 2R05A 4WWOA 4GTRA 3PNLB 4U96D 5E76A 1IHBA 2VTBA 2KCKA 2YINA 1Y6IA 3UM1A 4LERA 3NAWA 4KVOA 3T5VA 1SZAA 1ZBPA 4XKCA 3TXMA 3UMVA 4BT9A 1N0RA 4LNUD 3CR3A 2WXMA 3SHFA 4AV7A 4U8YD 1YYHA 5FZRA 2KXPC 5FWQA 1MZCA 3Q9NC 3V2XA 2X3MA 2WXRA 1O1TA 2XGMA 4HRNA 4GA2A 3LYAA 5A7DB 4A63B 1V54E 2P9PG 4GTMA 3ZUVB 2VSOE 2GRMA 2WQ6A 1E8WA 2I2OA 2ILRA 2WXIA 3AG1E 2RG8A 2FO7A 1H6KA 3HYMB 3G2VA 4W9RA 1Q2ZA 1DCQA 3HXBA 5JJ6A 4GA0A 4CZ2D 2IQCA 4Q69A 5AQAA 3E33A 2HO1A 3MJWA 4ANVA 5FIOA 3HXDA 2WXPA 2OVFA 5B1BE 3L22A 5BPPA 2WXFA 5G05C 3RAUA 3CHOA 5FQ6A 4UI9J 2H6HA 3D9KA 1INZA 5CBNA 3SI5A 4KXKB 2J49A 3DSWA 3W9FA 4BSXA 2AW6A 4UI9K 2ZGDA 4EZJA 1P5QA 4GYYA 3B7SA 3GW4A 3ASFA 2WXJA 3S7BA 3ZYQA 4GAAA 3RIBA 1QZ2A 2LSUA 3V2OA 1UW4B 1BPOA 2YHEA 3LJNA 2WM9A 3LKUA 3FUIA 1N4SA 4I1AA 1WDYA 3ZYKA 2C0MA 3CHQA 4GPKA 1TNUA 1WG0A 1HX8A 4L7TA 2LNIA 3D9HA 1A17A 3KS2A 4APOA 3LEWA 4G8KA 4XX5A 2X6IA 4RG6A 4X8QA 4HB5A 3RU0A 2KM4A 3V79K 3MA5A 4DI3A 4OVUA 4AIFA 1N4PA 3FTSA 2P58C 3ONLA 3OXLA 2Y0BG 1SA5A 1N54A 3ZIMA
chains in the Genus database with same CATH topology
4BX9A 2YNQA 3DBSA 5LCWJ 3CSFA 1QQEA 4CCAA 1MHQA 3TG4A 1Y8MA 2L6JA 4J8FA 3VLDA 1U3DA 3P1UA 4B94A 4I2WA 1EF1C 4E6HA 4JVSA 4B8CB 2MOWA 2IU1A 2KZTB 3D3MA 2OOEA 3I4GA 3QDNA 4N39A 4PDXA 4UWFA 3MZLB 3CKCA 2VQ2A 3FY4A 3SZ7A 2L9BA 1UN8A 3P2BA 5G2NA 4HLEA 2KATA 4GZ3A 4EQFA 3RK6A 3MEKA 4J0UA 4MRUA 4UWGA 4EBAA 4N2SA 1FVHA 2V8SE 2DCPA 3BG1B 3HIZA 2X38A 4APFA 2VTBB 1NA0A 3OXFA 3L13A 2NXPA 3PUKA 5D0OD 5FTPA 2KZTA 3T5XA 3DPDA 3TXNA 3FTWA 4A1SA 4BFRA 3PEVB 4WNEA 3FTUA 3FUJA 4G26A 4F3VA 3MV3B 1PC2A 4FJZA 3VTXA 5CMWA 3G2SA 2Y4UA 2CFZA 2XGOA 3KEZA 4KBQA 4KZCA 3CVUA 5LX8A 3T8MA 3QAQA 4U07A 1XNFA 2LSVA 3ML9A 3B13A 1OWOA 3CK8A 4GZ5A 4AJWA 2V0PA 1OWMA 1ZU2A 5EX0A 3TL5A 4HVBA 3SD5A 3FTYA 2QY7A 4JA7A 2IONA 4GMJA 2YQ8A 3JUIA 5FQ4A 1TEZA 1VDYA 3FUMA 3ML8A 1UJJA 5T3RA 4FLBA 2WQ7A 2R59A 1PAQA 2L0IA 2Y4TA 2XPYA 2IFUA 3TG5A 4KT6B 3PS6A 2XRZA 4ILHB 4AY5A 4V3IA 1Z6TA 4TV3A 5A6CA 3ENEA 5FZSA 4I6GA 1DNPA 3CHMA 4IYPA 4M3OA 3EJNA 5G05J 3FH7A 1H0AA 4GU5A 4N3BA 4XIFA 2X6KA 4QFVA 3B7RL 2LAHA 5KJKA 3LY8A 1IQRA 1SQMA 2IJGX 2J08A 5CCMA 1HU3A 3KAEA 5HQ8A 3C98A 2AVPA 4ANWA 4CRWA 1JPLA 1OWLA 3R7RA 3ZRHA 2J4BA 2IOSA 4BTAA 3PRZA 2AXZA 2XQ0A 4FULA 4KYOB 4EZKA 2CFUA 3CHRA 3MYVA 5LFAA 2CG3A 1FCHA 2WXNA 3PEUB 2A4ZA 5BV1A 2UWJG 3QWPA 4MS6A 4UI9C 3CVVA 4XI0A 3PNTB 4AVXA 5KJNA 1GW6A 3CEQA 4JHJA 5G04J 3IKOB 4B8AA 3D9LA 3FUEA 4KVMA 5D0QD 3OAWA 3R7QA 1KT1A 3FUDA 2JLBA 2OV8A 5G04C 4FJYA 3Q47B 4UWHA 4O6FA 3G2UA 3U64A 1UG3A 3ZHEA 1DVPA 3SNXA 4U04A 3VTYA 3CVXA 2MRIA 3CGHA 1H2VC 3NF1A 4I17A 4XI9A 4JXTA 2YHCA 4TUUA 2KCVA 2PQNA 4J6IA 4JW1A 5FT9A 1W3BA 4BX8A 2AXUA 3FU6A 1SZ9A 4UWKA 4I6EA 2PQRA 5ARGA 5FQ7A 1HG5A 4ANXA 2ZU6B 2FULA 2EQXA 2WB2A 3TJPA 4OVVA 4J8DA 4UQYA 4EPZA 3LPZA 4GB9A 3CHPA 1WM5A 4U0SA 2R5SA 5BT1A 4I6JA 3EHMA 1OWNA 3PVLA 4HXIA 5CHEE 3APFA 4CDRA 3MCXA 2I1KA 3ZYLA 1KLXA 2WVIA 3RO3A 3IHYA 5T8IA 4CT4A 3FDHA 4G2VA 2WXLA 4HS2A 1L5JA 5C2YA 2WXGA 3TAXA 3UT7A 3I4RB 2VJ8A 4J8EA 4GA1A 4RVBA 3ZFWA 3LDZA 3UX4A 4ME2A 4HOQA 3EDTB 4AP2A 4XZ4A 3B7TA 3GZSA 3AU5A 3MX3A 1TJCA 3NZSA 5ARFA 3FH5A 2LAIA 2PM7A 3OTNA 3FHEA 4NRHB 4F7AA 2IF4A 2NSZA 3QWVA 2WXOA 2X6JA 1HH8A 2VSYA 3ZW3A 4DI4A 3APDA 3ESLA 3SBTB 4F53A 2FEZA 4CGWA 3ZGQA 1KT0A 3BG0B 3PE4A 2VGXA 2XGSA 4A3TA 4HOTA 4G25A 3S2AA 3URZA 3G2WA 4I43A 2BF0X 4ATGA 2OVBA 1OWPA 2J07A 5BV0A 4URKA 4JEUA 4UQZA 4DLOA 4JA9A 4I1OB 3FWVA 2MHKA 3LY7A 4NURA 4P29A 2J4DA 1JUQA 4WNFA 3RKVA 3SF4A 3IV0A 4AOFA 3JQ0A 3N71A 5AIJA 4ABNA 3ZN3A 3D9NA 3IHVA 2E2EA 5JJ7A 3HVEB 2LO6A 4G23A 3Q15A 4FLHA 4FA6A 4JPSA 1ELKA 2GGFA 1IYGA 3CQCB 2C2LA 3FTXA 3L54A 3SGHA 4DLQA 3APCA 5T4YA 3AS5A 4Y6CA 2X6FA 2Y3AA 2WMNA 1ELRA 3AS8A 5BW8C 4EBAG 1NP7A 1N52A 5EDSA 2CHXA 4C9BB 1H19A 2DBAA 4JEHA 2XEVA 3CK7A 3CVNA 4JHKA 2FI7A 5J08A 3TGOA 3FFLA 3EIJA 4WWOA 1QNFA 4PS3A 4AEZC 4K03A 3CIAA 1U3CA 3U9WA 4WWPA 3QKYA 3S7DA 3ONKA 3PNLB 4D10C 3ESKA 1E90A 5E76A 3ZVVA 4KMOA 3UT4A 2VTBA 2KCKA 3VLFA 3CVWA 1E8ZA 2YINA 2V5FA 1Y6IA 4IRUA 4LERA 1HZ4A 4KVOA 2GRLA 3MKRA 3T5VA 1SZAA 3PREA 2A5UA 4GCNA 5C1DA 4CDMA 1HE8A 4F1SA 2CG2A 4FADA 2E0IA 1ZBPA 3NQPA 4XKCA 3TXMA 1FVFA 4CEMA 3UMVA 1UJKA 3I3NA 4CT0A 1EDUA 4BT9A 2NC9A 4FU3A 4ILIA 3CQGB 3OXGA 3PDNA 3CKBA 3MKQA 3CR3A 2HYZA 2WXMA 3SHFA 4B0ZA 1TJFA 3ZHEB 4L23A 4AV7A 2VSXE 3FUHA 4L2LA 5FZRA 2QFCA 5FWQA 4EZLA 2PM6A 3EHNA 4BY6A 1NZNA 4MLPA 2AWIA 3GYZA 4AM9A 3D9JA 2RD0A 4N3AA 2M63A 3D9OA 4FHJA 2I9CA 2X3MA 1WAO1 4RSYA 4Q94A 4RG9A 3FU5A 3ULQA 3HHMA 2WXRA 2XGMA 3NZUA 3RJVA 4GA2A 2J9QA 3QJZA 1LF8A 3LYAA 2V4LA 4LEUA 3O48A 4GCOA 5A7DB 3QARA 4LUNU 2PZIA 5EKQD 3E4BA 3RO2A 4PUCA 5JHBA 2VSOE 3CVQA 4U0ZA 5JJTA 3FU0A 3D9PA 2GRMA 2WQ6A 4YVQC 1E8WA 2I2OA 4FC8A 2ILRA 3LXUX 3PUJA 2WXIA 2RG8A 4JHRA 2FO7A 1H6KA 3HYMB 3G2VA 4EECA 4W9RA 2JEKA 3RRUA 4B89A 1HXIA 2CHZA 1JWFA 2Q7FA 4YVOA 3O4ZA 4TRQA 4ILGA 2PL2A 2C0LA 4GYOA 3R9AB 4ACKA 5AJDA 5JJ6A 1NA3A 5AENA 3U66A 4GA0A 3L17A 2IQCA 3RRNB 3D9MA 2GW1A 1IHGA 4OYSA 4DK5A 4HFGA 4Q69A 2HO1A 4FP7A 1E8XA 1IQUA 1X5BA 2UY1A 3LVRE 5FJYA 5CCLA 4G11A 4I1MA 4C0MA 1E7VA 3MJWA 2WPVA 3LVQE 1EYHA 3ZPJA 2XPZA 3MKQB 1E7UA 3PH0C 3FTZA 5DBKA 4ANVA 3VLEA 3FH8A 2VYIA 3GZ2A 2WXPA 2OVFA 4WUYA 3IEGA 1H2TC 1HFAA 3L22A 4UWLA 3Q49B 5CMYA 4AY6A 3CV0A 4R7LA 4LRZA 5J90A 4JL0A 3FUNA 2XCCA 3UUXA 2WXFA 3HVEA 4A55A 5BPPA 3Q4AB 5A23A 5G05C 2ONDA 1S0PA 3PZDA 3CHOA 5EX3A 3BEEA 5FQ6A 3RRMB 3JYSA 4UI9J 3D9KA 1INZA 1ELWA 3Q5MA 4Q96A 1HS6A 3CVLA 4UQXA 3FUKA 2HM8A 4WWNA 3QOUA 3SI5A 1JWGA 4IULA 3KD7A 4KXKB 3MV2B 4Y6WA 3QC1A 2J49A 2FF4A 3L16A 4BSXA 1HF8A 2AW6A 5KCMA 3MGBA 1PY1A 4J8SA 4PS7A 4UI9K 4HOSA 4EZJA 3B7UX 4G1TA 1P5QA 4I2ZA 4GYYA 3IBEA 3S7FA 4XE0A 2X6HA 1WY6A 4K0RA 5LCWC 3B7SA 3GW4A 3GZ1A 3AU4A 3ASFA 2WXJA 4L1BA 4CGVA 4I9EA 4H7YA 3S7BA 4GZ6A 3ZYQA 5JHAA 3QWWA 3CVYA 4XKBA 4GAAA 3RIBA 1QZ2A 2WQHA 2VGXB 5M72A 4MKTA 2WXHA 2VSNA 3G2TA 2J09A 2LSUA 5LP0A 3EIQC 1UW4B 3K9IA 1BPOA 3L08A 2YHEA 2BUGA 4GYWA 5AJLA 3HDXA 4KZ0A 4WNGA 4U8HA 4G24A 4IN3B 4BWRA 3LS8A 2WM9A 1E96B 3CLJA 3LKUA 4DJAA 4I9CA 2I1JA 3FU3A 5DIZA 3FULA 3FUIA 3SBSA 5AYWD 3ZXSA 5G55A 4GZDA 4NACA 4LCTA 2XHEA 3ASDA 5KJLA 3QB2A 3FUFA 3S7JA 1Z3YA 3FEXA 4I1AA 2WXQA 4U0UA 3ZYKA 3ASGA 1OUVA 3LJ3A 4AXHA 2C0MA 4CDNA 3CHQA 4FHKA 5BUZA 2UY1B 3I5PA 2R17C 3JQ1A 4N3CA 4GPKA 2WMOA 4WNDA 2KC7A 4E85A 2XRYA 2FBNA 1HX8A 2KCLA 4L7TA 2LNIA 4JC8A 4BTBA 1A17A 3KS2A 4GMLA 4H7XA 3UQ3A 3CSTA 3LCAA 4A3VA 4APOA 4PS8A 3LEWA 1XGWA 4XX5A 2L0TB 2CHWA 2X6IA 4A1GA 1MQSA 3FP3A 4RG6A 3QK0A 1H2UA 4L2YA 2I6HA 2HR2A 3LY9A 5KJMA 3ZYMA 3ASHA 3D9IA 3UT8A 4JZYA 3RU0A 2KM4A 3CVPA 1EPUA 4YNDA 5BNWA 4N2QA 4BT8A 4WAFA 3FEYA 2XCBA 1Z3XA 4HOUA 4N5CA 3AS4A 3JCKC 3FTVA 5ENNA 3U3WA 2WXKA 2AXVA 3MA5A 4C0EA 4DPRA 4DI3A 1E8YA 4PH4B 4OVUA 4ACLA 4GZCA 4U63A 3WXXA 3L6AA 4AIFA 4HORA 2BTDA 4ANUA 3PE3A 1B89A 3QNKA 3UPVA 1UN9A 3CHSA 5ANRA 3FTSA 5LOZA 1HG2A 2VGYA 3U4TA 5ANLA 2P58C 3ONLA 4NQ0A 5FQ8A 5FZQA 2XPIA 3SFZA 3OXLA 2DIWA 1HO8A 1YA0A 2IOLA 1N54A 3CK9A 5HI7A 5E75A 3ZIMA 3ZEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEU B;  3RRN B;  3PEV B;  3RRM B; 
#chains in the Genus database with same CATH topology
 3HXF A;  3ULY A;  4BX9 A;  2YNQ A;  5LCW J;  4CCA A;  3VLD A;  3P1U A;  4I2W A;  4E6H A;  2IU1 A;  2KZT B;  4PDX A;  2OOE A;  4K5B A;  4CYM D;  3CKC A;  4QQI A;  3Q7A A;  4EHM A;  4GZ3 A;  3MEK A;  4EBA A;  3Q73 A;  1N11 A;  3HG0 D;  3L13 A;  2ETA A;  3TXN A;  4HOT A;  4G8L A;  4KZC A;  2CFZ A;  3CVU A;  3ML9 A;  4GZ5 A;  4HVB A;  2IO3 C;  3FTY A;  2H6G A;  3JUI A;  5T3R A;  4FLB A;  2R59 A;  1PAQ A;  1Z6T A;  3SQV A;  4DX6 D;  3TWW A;  3EJN A;  3PZ3 A;  5G05 J;  4N3B A;  2R2L A;  1SQM A;  3KAE A;  1JPL A;  2IOS A;  5CRU A;  4EZK A;  2CFU A;  5ENQ D;  3MYV A;  3PEU B;  5BV1 A;  1H6P A;  4MS6 A;  4UI9 C;  3PNT B;  5KJN A;  2XEH A;  5ENR D;  4JHJ A;  3FUE A;  1KT1 A;  2OV8 A;  5G04 C;  4O6F A;  3G2U A;  3SNX A;  5AAR A;  3CVX A;  2MRI A;  4O1O A;  1RZ4 A;  3NF1 A;  4I17 A;  4JXT A;  4K5C A;  1OCR E;  5FQ7 A;  2V5Q C;  3TJP A;  4DUI A;  4UQY A;  3LPZ A;  4HRL A;  4U0S A;  1WM5 A;  3PVL A;  4HXI A;  4G2V A;  2J8S D;  2WXL A;  4GA1 A;  4RVB A;  4AP2 A;  3AU5 A;  3EUV A;  5B1A E;  2OEV A;  3T9K A;  2P9I G;  3ISM C;  2IF4 A;  1HH8 A;  2VSY A;  4C48 B;  4J8Y A;  3BG0 B;  3PE4 A;  4ATG A;  5BV0 A;  4URK A;  4NUR A;  4P29 A;  2J4D A;  1DC2 A;  3D9N A;  2E2E A;  2GRO B;  5CED B;  2GGF A;  4DRX E;  1IYG A;  4J7W A;  2C2L A;  3FTX A;  3L54 A;  3AS5 A;  1ELR A;  5BW8 C;  1NP7 A;  2CHX A;  3UKU G;  3DSX A;  3CK7 A;  4JHK A;  2FI7 A;  4HNA D;  4U7E B;  3EIJ A;  1QNF A;  3CIA A;  3U9W A;  5CEA A;  3ONK A;  1E90 A;  1BI7 B;  3UT4 A;  3VLF A;  2V5F A;  3MKR A;  3PRE A;  3C72 A;  1H6O A;  4FAD A;  4CEM A;  3ZXP A;  3SY2 A;  1EDU A;  3PDN A;  4B0Z A;  1OXJ A;  2VSX E;  4LNG A;  2PM6 A;  4YDW A;  1NZN A;  1OY3 D;  2RD0 A;  4N3A A;  2M63 A;  2ETB A;  3D9O A;  4FHJ A;  1WAO 1;  4RG9 A;  3FU5 A;  3HHM A;  3UTM A;  3RJV A;  1NI1 A;  2RFA A;  2J9Q A;  3QJZ A;  4GCO A;  3QAR A;  2PZI A;  3E4B A;  3RO2 A;  3C5R A;  5JHB A;  3KEA A;  3FU0 A;  3D9P A;  4YVQ C;  3LXU X;  4B89 A;  3AG4 E;  2Q7F A;  2XEN A;  3O4Z A;  4GPM A;  1X81 A;  2C0L A;  3AG2 E;  3R9A B;  1NA3 A;  3L17 A;  3RRN B;  1JCR A;  4OYS A;  1E8X A;  5CCL A;  1MX6 A;  2P9N G;  2WPV A;  3LVQ E;  3SFX A;  3MKQ B;  5HRY A;  1E7U A;  3PH0 C;  5DBK A;  3FH8 A;  3GZ2 A;  4WUY A;  3IEG A;  4R7L A;  3B7B A;  2FO1 E;  2XCC A;  3ABM E;  3HVE A;  4A55 A;  3Q4A B;  2OND A;  5EX3 A;  3BEE A;  4Q96 A;  3CVL A;  2OEW A;  2HM8 A;  1TNB A;  3QOU A;  4WWN A;  3Q75 A;  4IUL A;  3MV2 B;  3L16 A;  1QBQ A;  5KCM A;  4J8S A;  4PS7 A;  1O1S A;  4I2Z A;  3IBE A;  3S7F A;  4XE0 A;  5LCW C;  3AU4 A;  4L1B A;  3CVY A;  2WQH A;  2VGX B;  2QYJ A;  2QYU A;  2WXH A;  2VSN A;  2J09 A;  3EIQ C;  3L08 A;  1U2V G;  3DPY A;  2RFM A;  1SW6 A;  2EIL E;  4IN3 B;  1RW2 A;  3RSE G;  2I1J A;  3FU3 A;  5DIZ A;  3SBS A;  4LCT A;  3ASD A;  3QB2 A;  3FUF A;  3S7J A;  4U0U A;  2WXQ A;  3ASG A;  3LJ3 A;  4AXH A;  3DWL G;  4FHK A;  2UY1 B;  3JQ1 A;  4N3C A;  2EIN E;  2KC7 A;  2XRY A;  4HRM B;  3UQ3 A;  3LCA A;  3PZ4 A;  4A3V A;  1XGW A;  2CHW A;  3KSL A;  2P9K G;  3ASO E;  1H2U A;  2I6H A;  2HR2 A;  3ZYM A;  3UT8 A;  3CVP A;  4BT8 A;  1Z3X A;  4N5C A;  3JCK C;  3FTV A;  2AXV A;  4U63 A;  4HOR A;  3JXJ A;  2BTD A;  3PE3 A;  1UN9 A;  2DZO A;  1DCE A;  5LOZ A;  1HG2 A;  5ANL A;  5FZQ A;  2XPI A;  5EIL A;  3CK9 A;  2Y4T A;  5E75 A;  5CRV A;  3PZ2 A;  3Q9U C;  1TR4 A;  1N9A A;  1MHQ A;  1Y8M A;  4J8F A;  1U3D A;  3ULE G;  3C3R A;  4N39 A;  3I4G A;  1S63 A;  3MZL B;  4GTV A;  2P9S G;  3TWX A;  1QYM A;  5G2N A;  3Q79 A;  4MRU A;  4N2S A;  1FVH A;  2V8S E;  3HIZ A;  4BEP A;  1D8D A;  1NA0 A;  2LUH A;  5IY5 E;  3PUK A;  5D0O D;  3FTW A;  3FTU A;  3FUJ A;  1PC2 A;  4FJZ A;  3TWS A;  3KEZ A;  3QAQ A;  4U07 A;  3IXE A;  5BXO A;  2LSV A;  1OT8 A;  2V0P A;  1OWM A;  1ZU2 A;  5EX0 A;  3TL5 A;  2QY7 A;  5FQ4 A;  1TEZ A;  2IO2 C;  2WQ7 A;  2BED A;  5KNH D;  4AY5 A;  2ETC A;  4B93 B;  5FZS A;  1DNP A;  3CHM A;  3JXI A;  3Q7F A;  3Q78 A;  2LAH A;  1IQR A;  1HU3 A;  5HQ8 A;  3C98 A;  1NFI E;  3R7R A;  3ZRH A;  2J4B A;  2R02 A;  4N5Q A;  2CG3 A;  1FCH A;  4TXP A;  3EHR A;  3QWP A;  1JCS A;  4XI0 A;  2F8X K;  1GW6 A;  3CEQ A;  5AN8 A;  5CEC B;  4HI9 A;  3C3O A;  3D9L A;  2V4H C;  5D0Q D;  3R7Q A;  2JLB A;  1UG3 A;  3NB2 A;  5CER B;  3CGH A;  1H2V C;  4HI8 A;  5AQ9 A;  3FU6 A;  3DSV A;  1FPP A;  2OCC E;  2EQX A;  4OVV A;  1K1A A;  4I6J A;  3APF A;  4CDR A;  4DX7 D;  2I1K A;  3ZYL A;  2WVI A;  3IHY A;  4CT4 A;  1FT2 A;  4HS2 A;  3UT7 A;  4J8E A;  4XZ4 A;  3B7T A;  2LAI A;  3FHE A;  4F7A A;  4AY6 A;  3QWV A;  2X6J A;  3APD A;  4F53 A;  2FEZ A;  1KT0 A;  2VGX A;  2XGS A;  4A3T A;  3EU9 A;  3G2W A;  4I43 A;  2OVB A;  1OCZ E;  2BKG A;  4JEU A;  4WNF A;  3ASN E;  3IV0 A;  3JQ0 A;  5AIJ A;  2ZGG A;  4ABN A;  2LO6 A;  4G23 A;  3Q15 A;  4JPS A;  1IKN D;  2WMN A;  4EBA G;  5EDS A;  3AAA C;  3TGO A;  2XS8 A;  4U8V D;  4O1P A;  4K03 A;  4AEZ C;  1U3C A;  5ENO D;  2Y1L E;  1N4Q A;  3DSS A;  3QKY A;  3S7D A;  5AQ7 A;  3ESK A;  3ZVV A;  4KMO A;  3CVW A;  1E8Z A;  4IRU A;  1HZ4 A;  2EIM E;  2GRL A;  4F6R D;  4GCN A;  5C1D A;  1HE8 A;  3TWU A;  3NQP A;  2F0Y A;  1UJK A;  3NOG D;  2NC9 A;  4FU3 A;  4O60 A;  4ILI A;  3OXG A;  3MKQ A;  1TJF A;  3ZHE B;  3FUH A;  2QFC A;  5ENS D;  1FT1 A;  1KZO A;  1S70 B;  4BY6 A;  2AWI A;  4AM9 A;  2GRN B;  3DST A;  2I9C A;  3UM2 A;  4RSY A;  4JB8 P;  3ULQ A;  1O1R A;  3NZU A;  1LF8 A;  2V4L A;  4LEU A;  3O48 A;  4GTS A;  4LUN U;  1OCO E;  4RQI A;  4U0Z A;  3CVQ A;  3UM0 A;  3AJI A;  2P2C P;  3J5Q B;  1LTX A;  5FIN A;  4EEC A;  2JEK A;  1HXI A;  2CHZ A;  1JWF A;  2PL2 A;  4GYO A;  3U66 A;  3D9M A;  1IHG A;  3ABK E;  4DK5 A;  4HFG A;  4FP7 A;  1IQU A;  1X5B A;  2UY1 A;  5FJY A;  1YCS B;  3EU5 A;  1EYH A;  1MYO A;  1HFA A;  4UWL A;  3Q49 B;  5CMY A;  1TNZ A;  1OCC E;  4LRZ A;  5J90 A;  3F6Q A;  1JCQ A;  5A23 A;  1S0P A;  3PZD A;  4DX1 A;  4OAU C;  3JYS A;  1ELW A;  3Q5M A;  3UIO C;  1HS6 A;  3FUK A;  3JUE A;  1MX2 A;  1JWG A;  3KD7 A;  3X2Q E;  1MX4 A;  2FF4 A;  5KWD A;  1HF8 A;  4HOS A;  3MGB A;  2X6H A;  1KPS B;  4CGV A;  4I9E A;  4H7Y A;  4BER A;  4XKB A;  4BSZ B;  1TN7 A;  2Y69 E;  1TNO A;  5LP0 A;  5ENT D;  3K9I A;  2H6I A;  2BUG A;  4GYW A;  5AJL A;  4KZ0 A;  2ZXW E;  4WNG A;  4U8H A;  4G24 A;  3LS8 A;  1E96 B;  3TWQ A;  3FUL A;  3ZXS A;  3E30 A;  4GZD A;  1K1B A;  2XHE A;  1Z3Y A;  3FEX A;  1IXV A;  3I5P A;  2R17 C;  4LNB A;  4WND A;  2FBN A;  3DXK G;  4TUM A;  2LXM A;  3UIN C;  4PS8 A;  3L82 A;  2L0T B;  4MBG A;  1MJ0 A;  3FP3 A;  3QK0 A;  5KJM A;  4N2Q A;  4JZY A;  1EPU A;  3DEO A;  3UIP C;  3FEY A;  4HOU A;  4C0E A;  1BLX B;  4DPR A;  3UKR G;  1E8Y A;  4PH4 B;  4HQD A;  3WXX A;  4ANU A;  1B89 A;  4GTO A;  1UOH A;  3QNK A;  3CHS A;  2VGY A;  2RKK A;  3U4T A;  3WG7 E;  3SFZ A;  2DIW A;  1HO8 A;  1YA0 A;  2IOL A;  3ZEF A;  2R03 A;  3DBS A;  5EIB E;  3TG4 A;  2L6J A;  2EIJ E;  4B8C B;  2MOW A;  3QDN A;  3SZ7 A;  5EYP F;  2P9U G;  1UN8 A;  3P2B A;  4HLE A;  2KAT A;  4EQF A;  2HE0 A;  3RK6 A;  4J0U A;  4UWG A;  3BG1 B;  2X38 A;  1D8E A;  4BFR A;  3DPD A;  4A1S A;  4WNE A;  1K3Z D;  3MV3 B;  3G2S A;  2Y4U A;  4KBQ A;  5LX8 A;  3T8M A;  2KBX A;  1XNF A;  1NL4 A;  3B13 A;  1OWO A;  1LD7 A;  4AJW A;  3SD5 A;  4JA7 A;  5HKP A;  2ION A;  4GMJ A;  2YQ8 A;  1VDY A;  3HRA A;  3FUM A;  1A5E A;  3TG5 A;  2XPY A;  4KT6 B;  4ILH B;  4V3I A;  5A6C A;  1LD8 A;  4I6G A;  4IYP A;  3B95 A;  1H0A A;  4GU5 A;  4XIF A;  3SO8 A;  3B7R L;  5KJK A;  1YMP A;  3LY8 A;  5CCM A;  2IJG X;  1TNY A;  2NYJ A;  2DWZ A;  5BXU A;  3PRZ A;  2XQ0 A;  4FUL A;  4KYO B;  5LFA A;  2DYR E;  2A4Z A;  3CVV A;  1SA4 A;  4XEI G;  4B8A A;  4KVM A;  3OAW A;  4YDO A;  4FJY A;  3Q47 B;  4UWH A;  3ZHE A;  4U04 A;  2ZIS A;  4XI9 A;  2YHC A;  2KCV A;  2PQN A;  2F37 A;  4JW1 A;  5FT9 A;  2P9L G;  4L9P A;  2PQR A;  3UM3 A;  4ANX A;  2ZU6 B;  2WB2 A;  4J8D A;  4EPZ A;  4GB9 A;  2R5S A;  3EHM A;  1OWN A;  3NBN B;  5JMN D;  3ABL E;  3RO3 A;  5EN5 D;  3FDH A;  1L5J A;  4HLL A;  2WXG A;  2VJ8 A;  3ZFW A;  3LDZ A;  3UX4 A;  4HOQ A;  3EDT B;  2B0O E;  3MX3 A;  3NZS A;  5ARF A;  4NRH B;  3ZW3 A;  2WXO A;  4DI4 A;  3SBT B;  4CGW A;  3ZGQ A;  4G25 A;  4ZFH A;  1TN6 A;  2BF0 X;  2J07 A;  1OWP A;  4DLO A;  1AWC B;  4JA9 A;  3FWV A;  3LY7 A;  3SF4 A;  1JUQ A;  3RKV A;  3NOC D;  4AOF A;  3ZN3 A;  3IHV A;  5JJ7 A;  3HVE B;  2ZIR A;  5ENP D;  1ELK A;  4YDE A;  3TWT A;  4DLQ A;  3APC A;  5T4Y A;  2EIK E;  2X6F A;  2PNN A;  2Y3A A;  1N52 A;  4K5A B;  1H19 A;  3DRA A;  3FFL A;  4PS3 A;  2F8Y A;  2VGE A;  4WWP A;  3W9G A;  3TWV A;  4NIK A;  4D10 C;  4OAV B;  2GRP B;  3HXC A;  4TXQ A;  2A5U A;  4CDM A;  4F1S A;  2CG2 A;  2E0I A;  1FVF A;  3I3N A;  4F1P A;  4CT0 A;  4GTP A;  1V55 E;  4M7C A;  3CQG B;  3CKB A;  2HYZ A;  4L23 A;  2IEJ A;  4L2L A;  2L6B A;  4EZL A;  3EHN A;  2H6F A;  2DZN A;  4MLP A;  3GYZ A;  3D9J A;  4Q94 A;  2A5E A;  2JAB A;  3E34 A;  3DEP A;  1SVX A;  3E37 A;  5EKQ D;  4ATZ D;  4PUC A;  5JJT A;  4TXR A;  4FC8 A;  3PUJ A;  4JHR A;  3RRU A;  4YVO A;  4HBD A;  3PZ1 A;  4TRQ A;  4ILG A;  5KNG A;  4ACK A;  5AJD A;  5AEN A;  2GW1 A;  3LVR E;  4G11 A;  4I1M A;  4C0M A;  1E7V A;  4U95 D;  3ZPJ A;  2XPZ A;  3FTZ A;  4DX2 A;  3VLE A;  3T8K A;  2VYI A;  3KSQ A;  3TWR A;  1G3N B;  1H2T C;  3CV0 A;  4JL0 A;  3FUN A;  3UUX A;  3BQO A;  4GMR A;  3RRM B;  4UQX A;  5EYL A;  4Y6W A;  3QC1 A;  4ZHB A;  1PY1 A;  3B7U X;  4G1T A;  4GTQ A;  5AQB A;  1N95 A;  1WY6 A;  4K0R A;  3GZ1 A;  3UI2 A;  2QZA A;  4GZ6 A;  5JHA A;  3QWW A;  5M72 A;  4MKT A;  3DXM G;  3G2T A;  2DVW A;  3AG3 E;  3HDX A;  2DYS E;  4BWR A;  3CLJ A;  4DJA A;  4I9C A;  5JA4 D;  5AYW D;  2IY0 C;  5G55 A;  4NAC A;  5H7P A;  5KJL A;  1OUV A;  5BUZ A;  4CDN A;  2WMO A;  4E85 A;  3L9T A;  1Z5S C;  2KCL A;  4JC8 A;  1O5M A;  4BTB A;  3V31 A;  4H7X A;  4GML A;  3CST A;  1AP7 A;  2MYO A;  4A1G A;  1MQS A;  5HS0 A;  4YDY A;  4L2Y A;  1S64 A;  3LY9 A;  5BNW A;  3ASH A;  3D9I A;  4YND A;  4WAF A;  2LXL A;  2XCB A;  5ENN A;  3AS4 A;  3U3W A;  2WXK A;  4ACL A;  4GZC A;  3L6A A;  1N94 A;  5KBA A;  2XEE A;  5ANR A;  4GTT A;  4NQ0 A;  5FQ8 A;  5EID A;  5HI7 A;  3CSF A;  1QQE A;  3ZKJ A;  2QC9 A;  4B94 A;  1EF1 C;  4JVS A;  3D3M A;  4UWF A;  3FY4 A;  2VQ2 A;  2L9B A;  2XS1 A;  3J5P A;  2DCP A;  4BET A;  4APF A;  2VTB B;  3OXF A;  2NXP A;  5FTP A;  3T5X A;  2KZT A;  3UPV A;  3PEV B;  4F3V A;  4G26 A;  5CMW A;  3VTX A;  1TN8 A;  2XGO A;  3V30 A;  5AAO A;  3CK8 A;  3UXG A;  2AJA A;  5ITZ F;  5D66 A;  2GRR B;  5D2M C;  1K8K G;  3ML8 A;  1UJJ A;  2L0I A;  2IFU A;  3ZU7 B;  3BU8 A;  3PS6 A;  2XRZ A;  4TV3 A;  3HXE A;  5CBO A;  3ENE A;  4M3O A;  3FH7 A;  2X6K A;  4QFV A;  2J08 A;  4CRW A;  2AVP A;  4ANW A;  2GRQ B;  1OWL A;  4BTA A;  2AXZ A;  3CHR A;  2WXN A;  2XZT G;  2UWJ G;  4AVX A;  5G04 J;  3IKO B;  3ZNG A;  3C3Q A;  3FUD A;  3EHQ A;  1N4R A;  3R9M A;  3U64 A;  1DVP A;  3VTY A;  3DSU A;  4UUC A;  4TUU A;  4J6I A;  4BX8 A;  1W3B A;  2AXU A;  4BES A;  1BI8 B;  1SZ9 A;  4JD2 G;  4UWK A;  1N0Q A;  4I6E A;  5ARG A;  1HG5 A;  2FUL A;  1ZB1 A;  3CHP A;  5BT1 A;  1BD8 A;  5CHE E;  3MCX A;  1KLX A;  5T8I A;  5C2Y A;  3TAX A;  3I4R B;  4LSZ E;  4ME2 A;  3GZS A;  5B3S E;  1TJC A;  3FH5 A;  3OTN A;  2PM7 A;  2NSZ A;  1D9S A;  3ESL A;  4RLY A;  3SFY A;  3S2A A;  3URZ A;  3E32 A;  4UQZ A;  4I1O B;  2MHK A;  3N71 A;  4LG6 A;  2BKK B;  4FA6 A;  4FLH A;  3BUA A;  2XZD G;  4Z68 A;  4DX5 D;  3CQC B;  3SGH A;  4Y6C A;  1KZP A;  1TYQ G;  3AS8 A;  4C9B B;  2B6C A;  1BU9 A;  2DBA A;  4JEH A;  2XEV A;  3CVN A;  5J08 A;  2R05 A;  4WWO A;  4GTR A;  3PNL B;  4U96 D;  5E76 A;  1IHB A;  2VTB A;  2KCK A;  2YIN A;  1Y6I A;  3UM1 A;  4LER A;  3NAW A;  4KVO A;  3T5V A;  1SZA A;  1ZBP A;  4XKC A;  3TXM A;  3UMV A;  4BT9 A;  1N0R A;  4LNU D;  3CR3 A;  2WXM A;  3SHF A;  4AV7 A;  4U8Y D;  1YYH A;  5FZR A;  2KXP C;  5FWQ A;  1MZC A;  3Q9N C;  3V2X A;  2X3M A;  2WXR A;  1O1T A;  2XGM A;  4HRN A;  4GA2 A;  3LYA A;  5A7D B;  4A63 B;  1V54 E;  2P9P G;  4GTM A;  3ZUV B;  2VSO E;  2GRM A;  2WQ6 A;  1E8W A;  2I2O A;  2ILR A;  2WXI A;  3AG1 E;  2RG8 A;  2FO7 A;  1H6K A;  3HYM B;  3G2V A;  4W9R A;  1Q2Z A;  1DCQ A;  3HXB A;  5JJ6 A;  4GA0 A;  4CZ2 D;  2IQC A;  4Q69 A;  5AQA A;  3E33 A;  2HO1 A;  3MJW A;  4ANV A;  5FIO A;  3HXD A;  2WXP A;  2OVF A;  5B1B E;  3L22 A;  5BPP A;  2WXF A;  5G05 C;  3RAU A;  3CHO A;  5FQ6 A;  4UI9 J;  2H6H A;  3D9K A;  1INZ A;  5CBN A;  3SI5 A;  4KXK B;  2J49 A;  3DSW A;  3W9F A;  4BSX A;  2AW6 A;  4UI9 K;  2ZGD A;  4EZJ A;  1P5Q A;  4GYY A;  3B7S A;  3GW4 A;  3ASF A;  2WXJ A;  3S7B A;  3ZYQ A;  4GAA A;  3RIB A;  1QZ2 A;  2LSU A;  3V2O A;  1UW4 B;  1BPO A;  2YHE A;  3LJN A;  2WM9 A;  3LKU A;  3FUI A;  1N4S A;  4I1A A;  1WDY A;  3ZYK A;  2C0M A;  3CHQ A;  4GPK A;  1TNU A;  1WG0 A;  1HX8 A;  4L7T A;  2LNI A;  3D9H A;  1A17 A;  3KS2 A;  4APO A;  3LEW A;  4G8K A;  4XX5 A;  2X6I A;  4RG6 A;  4X8Q A;  4HB5 A;  3RU0 A;  2KM4 A;  3V79 K;  3MA5 A;  4DI3 A;  4OVU A;  4AIF A;  1N4P A;  3FTS A;  2P58 C;  3ONL A;  3OXL A;  2Y0B G;  1SA5 A;  1N54 A;  3ZIM A; 
#chains in the Genus database with same CATH homology
 4BX9 A;  2YNQ A;  3DBS A;  5LCW J;  3CSF A;  1QQE A;  4CCA A;  1MHQ A;  3TG4 A;  1Y8M A;  2L6J A;  4J8F A;  3VLD A;  1U3D A;  3P1U A;  4B94 A;  4I2W A;  1EF1 C;  4E6H A;  4JVS A;  4B8C B;  2MOW A;  2IU1 A;  2KZT B;  3D3M A;  2OOE A;  3I4G A;  3QDN A;  4N39 A;  4PDX A;  4UWF A;  3MZL B;  3CKC A;  2VQ2 A;  3FY4 A;  3SZ7 A;  2L9B A;  1UN8 A;  3P2B A;  5G2N A;  4HLE A;  2KAT A;  4GZ3 A;  4EQF A;  3RK6 A;  3MEK A;  4J0U A;  4MRU A;  4UWG A;  4EBA A;  4N2S A;  1FVH A;  2V8S E;  2DCP A;  3BG1 B;  3HIZ A;  2X38 A;  4APF A;  2VTB B;  1NA0 A;  3OXF A;  3L13 A;  2NXP A;  3PUK A;  5D0O D;  5FTP A;  2KZT A;  3T5X A;  3DPD A;  3TXN A;  3FTW A;  4A1S A;  4BFR A;  3PEV B;  4WNE A;  3FTU A;  3FUJ A;  4G26 A;  4F3V A;  3MV3 B;  1PC2 A;  4FJZ A;  3VTX A;  5CMW A;  3G2S A;  2Y4U A;  2CFZ A;  2XGO A;  3KEZ A;  4KBQ A;  4KZC A;  3CVU A;  5LX8 A;  3T8M A;  3QAQ A;  4U07 A;  1XNF A;  2LSV A;  3ML9 A;  3B13 A;  1OWO A;  3CK8 A;  4GZ5 A;  4AJW A;  2V0P A;  1OWM A;  1ZU2 A;  5EX0 A;  3TL5 A;  4HVB A;  3SD5 A;  3FTY A;  2QY7 A;  4JA7 A;  2ION A;  4GMJ A;  2YQ8 A;  3JUI A;  5FQ4 A;  1TEZ A;  1VDY A;  3FUM A;  3ML8 A;  1UJJ A;  5T3R A;  4FLB A;  2WQ7 A;  2R59 A;  1PAQ A;  2L0I A;  2Y4T A;  2XPY A;  2IFU A;  3TG5 A;  4KT6 B;  3PS6 A;  2XRZ A;  4ILH B;  4AY5 A;  4V3I A;  1Z6T A;  4TV3 A;  5A6C A;  3ENE A;  5FZS A;  4I6G A;  1DNP A;  3CHM A;  4IYP A;  4M3O A;  3EJN A;  5G05 J;  3FH7 A;  1H0A A;  4GU5 A;  4N3B A;  4XIF A;  2X6K A;  4QFV A;  3B7R L;  2LAH A;  5KJK A;  3LY8 A;  1IQR A;  1SQM A;  2IJG X;  2J08 A;  5CCM A;  1HU3 A;  3KAE A;  5HQ8 A;  3C98 A;  2AVP A;  4ANW A;  4CRW A;  1JPL A;  1OWL A;  3R7R A;  3ZRH A;  2J4B A;  2IOS A;  4BTA A;  3PRZ A;  2AXZ A;  2XQ0 A;  4FUL A;  4KYO B;  4EZK A;  2CFU A;  3CHR A;  3MYV A;  5LFA A;  2CG3 A;  1FCH A;  2WXN A;  3PEU B;  2A4Z A;  5BV1 A;  2UWJ G;  3QWP A;  4MS6 A;  4UI9 C;  3CVV A;  4XI0 A;  3PNT B;  4AVX A;  5KJN A;  1GW6 A;  3CEQ A;  4JHJ A;  5G04 J;  3IKO B;  4B8A A;  3D9L A;  3FUE A;  4KVM A;  5D0Q D;  3OAW A;  3R7Q A;  1KT1 A;  3FUD A;  2JLB A;  2OV8 A;  5G04 C;  4FJY A;  3Q47 B;  4UWH A;  4O6F A;  3G2U A;  3U64 A;  1UG3 A;  3ZHE A;  1DVP A;  3SNX A;  4U04 A;  3VTY A;  3CVX A;  2MRI A;  3CGH A;  1H2V C;  3NF1 A;  4I17 A;  4XI9 A;  4JXT A;  2YHC A;  4TUU A;  2KCV A;  2PQN A;  4J6I A;  4JW1 A;  5FT9 A;  1W3B A;  4BX8 A;  2AXU A;  3FU6 A;  1SZ9 A;  4UWK A;  4I6E A;  2PQR A;  5ARG A;  5FQ7 A;  1HG5 A;  4ANX A;  2ZU6 B;  2FUL A;  2EQX A;  2WB2 A;  3TJP A;  4OVV A;  4J8D A;  4UQY A;  4EPZ A;  3LPZ A;  4GB9 A;  3CHP A;  1WM5 A;  4U0S A;  2R5S A;  5BT1 A;  4I6J A;  3EHM A;  1OWN A;  3PVL A;  4HXI A;  5CHE E;  3APF A;  4CDR A;  3MCX A;  2I1K A;  3ZYL A;  1KLX A;  2WVI A;  3RO3 A;  3IHY A;  5T8I A;  4CT4 A;  3FDH A;  4G2V A;  2WXL A;  4HS2 A;  1L5J A;  5C2Y A;  2WXG A;  3TAX A;  3UT7 A;  3I4R B;  2VJ8 A;  4J8E A;  4GA1 A;  4RVB A;  3ZFW A;  3LDZ A;  3UX4 A;  4ME2 A;  4HOQ A;  3EDT B;  4AP2 A;  4XZ4 A;  3B7T A;  3GZS A;  3AU5 A;  3MX3 A;  1TJC A;  3NZS A;  5ARF A;  3FH5 A;  2LAI A;  2PM7 A;  3OTN A;  3FHE A;  4NRH B;  4F7A A;  2IF4 A;  2NSZ A;  3QWV A;  2WXO A;  2X6J A;  1HH8 A;  2VSY A;  3ZW3 A;  4DI4 A;  3APD A;  3ESL A;  3SBT B;  4F53 A;  2FEZ A;  4CGW A;  3ZGQ A;  1KT0 A;  3BG0 B;  3PE4 A;  2VGX A;  2XGS A;  4A3T A;  4HOT A;  4G25 A;  3S2A A;  3URZ A;  3G2W A;  4I43 A;  2BF0 X;  4ATG A;  2OVB A;  1OWP A;  2J07 A;  5BV0 A;  4URK A;  4JEU A;  4UQZ A;  4DLO A;  4JA9 A;  4I1O B;  3FWV A;  2MHK A;  3LY7 A;  4NUR A;  4P29 A;  2J4D A;  1JUQ A;  4WNF A;  3RKV A;  3SF4 A;  3IV0 A;  4AOF A;  3JQ0 A;  3N71 A;  5AIJ A;  4ABN A;  3ZN3 A;  3D9N A;  3IHV A;  2E2E A;  5JJ7 A;  3HVE B;  2LO6 A;  4G23 A;  3Q15 A;  4FLH A;  4FA6 A;  4JPS A;  1ELK A;  2GGF A;  1IYG A;  3CQC B;  2C2L A;  3FTX A;  3L54 A;  3SGH A;  4DLQ A;  3APC A;  5T4Y A;  3AS5 A;  4Y6C A;  2X6F A;  2Y3A A;  2WMN A;  1ELR A;  3AS8 A;  5BW8 C;  4EBA G;  1NP7 A;  1N52 A;  5EDS A;  2CHX A;  4C9B B;  1H19 A;  2DBA A;  4JEH A;  2XEV A;  3CK7 A;  3CVN A;  4JHK A;  2FI7 A;  5J08 A;  3TGO A;  3FFL A;  3EIJ A;  4WWO A;  1QNF A;  4PS3 A;  4AEZ C;  4K03 A;  3CIA A;  1U3C A;  3U9W A;  4WWP A;  3QKY A;  3S7D A;  3ONK A;  3PNL B;  4D10 C;  3ESK A;  1E90 A;  5E76 A;  3ZVV A;  4KMO A;  3UT4 A;  2VTB A;  2KCK A;  3VLF A;  3CVW A;  1E8Z A;  2YIN A;  2V5F A;  1Y6I A;  4IRU A;  4LER A;  1HZ4 A;  4KVO A;  2GRL A;  3MKR A;  3T5V A;  1SZA A;  3PRE A;  2A5U A;  4GCN A;  5C1D A;  4CDM A;  1HE8 A;  4F1S A;  2CG2 A;  4FAD A;  2E0I A;  1ZBP A;  3NQP A;  4XKC A;  3TXM A;  1FVF A;  4CEM A;  3UMV A;  1UJK A;  3I3N A;  4CT0 A;  1EDU A;  4BT9 A;  2NC9 A;  4FU3 A;  4ILI A;  3CQG B;  3OXG A;  3PDN A;  3CKB A;  3MKQ A;  3CR3 A;  2HYZ A;  2WXM A;  3SHF A;  4B0Z A;  1TJF A;  3ZHE B;  4L23 A;  4AV7 A;  2VSX E;  3FUH A;  4L2L A;  5FZR A;  2QFC A;  5FWQ A;  4EZL A;  2PM6 A;  3EHN A;  4BY6 A;  1NZN A;  4MLP A;  2AWI A;  3GYZ A;  4AM9 A;  3D9J A;  2RD0 A;  4N3A A;  2M63 A;  3D9O A;  4FHJ A;  2I9C A;  2X3M A;  1WAO 1;  4RSY A;  4Q94 A;  4RG9 A;  3FU5 A;  3ULQ A;  3HHM A;  2WXR A;  2XGM A;  3NZU A;  3RJV A;  4GA2 A;  2J9Q A;  3QJZ A;  1LF8 A;  3LYA A;  2V4L A;  4LEU A;  3O48 A;  4GCO A;  5A7D B;  3QAR A;  4LUN U;  2PZI A;  5EKQ D;  3E4B A;  3RO2 A;  4PUC A;  5JHB A;  2VSO E;  3CVQ A;  4U0Z A;  5JJT A;  3FU0 A;  3D9P A;  2GRM A;  2WQ6 A;  4YVQ C;  1E8W A;  2I2O A;  4FC8 A;  2ILR A;  3LXU X;  3PUJ A;  2WXI A;  2RG8 A;  4JHR A;  2FO7 A;  1H6K A;  3HYM B;  3G2V A;  4EEC A;  4W9R A;  2JEK A;  3RRU A;  4B89 A;  1HXI A;  2CHZ A;  1JWF A;  2Q7F A;  4YVO A;  3O4Z A;  4TRQ A;  4ILG A;  2PL2 A;  2C0L A;  4GYO A;  3R9A B;  4ACK A;  5AJD A;  5JJ6 A;  1NA3 A;  5AEN A;  3U66 A;  4GA0 A;  3L17 A;  2IQC A;  3RRN B;  3D9M A;  2GW1 A;  1IHG A;  4OYS A;  4DK5 A;  4HFG A;  4Q69 A;  2HO1 A;  4FP7 A;  1E8X A;  1IQU A;  1X5B A;  2UY1 A;  3LVR E;  5FJY A;  5CCL A;  4G11 A;  4I1M A;  4C0M A;  1E7V A;  3MJW A;  2WPV A;  3LVQ E;  1EYH A;  3ZPJ A;  2XPZ A;  3MKQ B;  1E7U A;  3PH0 C;  3FTZ A;  5DBK A;  4ANV A;  3VLE A;  3FH8 A;  2VYI A;  3GZ2 A;  2WXP A;  2OVF A;  4WUY A;  3IEG A;  1H2T C;  1HFA A;  3L22 A;  4UWL A;  3Q49 B;  5CMY A;  4AY6 A;  3CV0 A;  4R7L A;  4LRZ A;  5J90 A;  4JL0 A;  3FUN A;  2XCC A;  3UUX A;  2WXF A;  3HVE A;  4A55 A;  5BPP A;  3Q4A B;  5A23 A;  5G05 C;  2OND A;  1S0P A;  3PZD A;  3CHO A;  5EX3 A;  3BEE A;  5FQ6 A;  3RRM B;  3JYS A;  4UI9 J;  3D9K A;  1INZ A;  1ELW A;  3Q5M A;  4Q96 A;  1HS6 A;  3CVL A;  4UQX A;  3FUK A;  2HM8 A;  4WWN A;  3QOU A;  3SI5 A;  1JWG A;  4IUL A;  3KD7 A;  4KXK B;  3MV2 B;  4Y6W A;  3QC1 A;  2J49 A;  2FF4 A;  3L16 A;  4BSX A;  1HF8 A;  2AW6 A;  5KCM A;  3MGB A;  1PY1 A;  4J8S A;  4PS7 A;  4UI9 K;  4HOS A;  4EZJ A;  3B7U X;  4G1T A;  1P5Q A;  4I2Z A;  4GYY A;  3IBE A;  3S7F A;  4XE0 A;  2X6H A;  1WY6 A;  4K0R A;  5LCW C;  3B7S A;  3GW4 A;  3GZ1 A;  3AU4 A;  3ASF A;  2WXJ A;  4L1B A;  4CGV A;  4I9E A;  4H7Y A;  3S7B A;  4GZ6 A;  3ZYQ A;  5JHA A;  3QWW A;  3CVY A;  4XKB A;  4GAA A;  3RIB A;  1QZ2 A;  2WQH A;  2VGX B;  5M72 A;  4MKT A;  2WXH A;  2VSN A;  3G2T A;  2J09 A;  2LSU A;  5LP0 A;  3EIQ C;  1UW4 B;  3K9I A;  1BPO A;  3L08 A;  2YHE A;  2BUG A;  4GYW A;  5AJL A;  3HDX A;  4KZ0 A;  4WNG A;  4U8H A;  4G24 A;  4IN3 B;  4BWR A;  3LS8 A;  2WM9 A;  1E96 B;  3CLJ A;  3LKU A;  4DJA A;  4I9C A;  2I1J A;  3FU3 A;  5DIZ A;  3FUL A;  3FUI A;  3SBS A;  5AYW D;  3ZXS A;  5G55 A;  4GZD A;  4NAC A;  4LCT A;  2XHE A;  3ASD A;  5KJL A;  3QB2 A;  3FUF A;  3S7J A;  1Z3Y A;  3FEX A;  4I1A A;  2WXQ A;  4U0U A;  3ZYK A;  3ASG A;  1OUV A;  3LJ3 A;  4AXH A;  2C0M A;  4CDN A;  3CHQ A;  4FHK A;  5BUZ A;  2UY1 B;  3I5P A;  2R17 C;  3JQ1 A;  4N3C A;  4GPK A;  2WMO A;  4WND A;  2KC7 A;  4E85 A;  2XRY A;  2FBN A;  1HX8 A;  2KCL A;  4L7T A;  2LNI A;  4JC8 A;  4BTB A;  1A17 A;  3KS2 A;  4GML A;  4H7X A;  3UQ3 A;  3CST A;  3LCA A;  4A3V A;  4APO A;  4PS8 A;  3LEW A;  1XGW A;  4XX5 A;  2L0T B;  2CHW A;  2X6I A;  4A1G A;  1MQS A;  3FP3 A;  4RG6 A;  3QK0 A;  1H2U A;  4L2Y A;  2I6H A;  2HR2 A;  3LY9 A;  5KJM A;  3ZYM A;  3ASH A;  3D9I A;  3UT8 A;  4JZY A;  3RU0 A;  2KM4 A;  3CVP A;  1EPU A;  4YND A;  5BNW A;  4N2Q A;  4BT8 A;  4WAF A;  3FEY A;  2XCB A;  1Z3X A;  4HOU A;  4N5C A;  3AS4 A;  3JCK C;  3FTV A;  5ENN A;  3U3W A;  2WXK A;  2AXV A;  3MA5 A;  4C0E A;  4DPR A;  4DI3 A;  1E8Y A;  4PH4 B;  4OVU A;  4ACL A;  4GZC A;  4U63 A;  3WXX A;  3L6A A;  4AIF A;  4HOR A;  2BTD A;  4ANU A;  3PE3 A;  1B89 A;  3QNK A;  3UPV A;  1UN9 A;  3CHS A;  5ANR A;  3FTS A;  5LOZ A;  1HG2 A;  2VGY A;  3U4T A;  5ANL A;  2P58 C;  3ONL A;  4NQ0 A;  5FQ8 A;  5FZQ A;  2XPI A;  3SFZ A;  3OXL A;  2DIW A;  1HO8 A;  1YA0 A;  2IOL A;  1N54 A;  3CK9 A;  5HI7 A;  5E75 A;  3ZIM A;  3ZEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...