3RRNB

S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
293
structure length
293
Chain Sequence
FDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 114
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rrnB00
3PEVB 3PEUB 3RRMB 3RRNB
chains in the Genus database with same CATH superfamily
4I1MA 2VSOE 3TXMA 3NF1A 4APOA 1QZ2A 5CBOA 2NYJA 3L16A 2X3MA 3CQGB 4EQFA 4KXKB 1H6PA 3HYMB 1UW4B 4LRZA 4JHRA 2ZXWE 3FH5A 2L6BA 4FHJA 4K5BA 4LCTA 4FADA 2KXPC 4J7WA 3AU5A 1W3BA 4TXPA 2X6IA 1D8DA 1H2UA 4JD2G 5HI7A 1FVFA 2C2LA 3UT4A 5AQ7A 1NI1A 5LOZA 5CMYA 2GRNB 3C72A 4XZ4A 5KCMA 1E7VA 3AJIA 4G25A 4AXHA 5LCWC 3HIZA 3TG4A 2VSXE 4WWNA 3MKRA 5CHEE 3U9WA 2R03A 5AQAA 2C0LA 2VGYA 2XS1A 3ML8A 2WXNA 4LSZE 3AG1E 3OAWA 4ATZD 1KT1A 1MHQA 3E4BA 1QBQA 4ACLA 4EBAG 1WDYA 3SFYA 3Q4AB 2WXIA 1IHGA 3IBEA 2CFUA 1IYGA 1DCQA 3SHFA 2JEKA 3QWWA 4K0RA 2PM7A 3RKVA 1PAQA 3HVEA 1L5JA 1D8EA 2R05A 1Z5SC 1SW6A 4BSXA 3DSTA 3LYAA 3CSTA 5AJDA 2B0OE 4ME2A 2V4LA 2XRZA 4EECA 3FUJA 3LKUA 3ULEG 3ZRHA 1JUQA 3FP3A 4DX5D 3KD7A 4A3VA 4DJAA 4JVSA 3QK0A 3SD5A 3SFXA 4E6HA 3WXXA 4N2QA 2DCPA 2Y69E 3FTVA 2WXJA 3L08A 4CT0A 1TNBA 3VTYA 2PQNA 3CHSA 3UINC 4ANWA 4U63A 1BLXB 3I4RB 3RO3A 4HOTA 3ONLA 5LCWJ 1KZOA 1N9AA 1OCRE 3S7DA 4HQDA 3ZGQA 1JPLA 1N54A 3ZYQA 3D9HA 4U8VD 4F6RD 1EF1C 2JLBA 4BT8A 4BFRA 4I2ZA 3ZYMA 4XI9A 1JCRA 2AXVA 3CLJA 1YCSB 3Q7FA 3TL5A 1TNUA 3UM1A 2C0MA 4GTMA 5ENOD 4F3VA 4TV3A 2OVFA 4YDYA 4YDWA 2VJ8A 4CT4A 2ZU6B 4B93B 2WMOA 4FLHA 1NL4A 4IYPA 2FI7A 2XRYA 2EIKE 2I2OA 3ASOE 5ENQD 1E96B 2Y4UA 4J8FA 2M63A 4DX7D 4UI9C 3I5PA 4I6GA 4HRNA 2AXZA 3RO2A 5J08A 2HO1A 2R17C 1FT2A 5FZQA 1JCQA 5B1BE 4J8DA 3RU0A 3TWVA 4Q69A 4ANXA 1IQRA 4GZ3A 3LXUX 3DXMG 3KS2A 4Q96A 2VGEA 3MV2B 5CCLA 3EIQC 1UG3A 2EIME 3FU6A 1DVPA 3E30A 4N39A 2GRQB 4J8EA 2CHXA 3AAAC 2WXOA 1H6OA 2UWJG 2A5UA 1MX4A 4XKBA 3E33A 1SQMA 3HXFA 3PE3A 4JL0A 5DIZA 3TWQA 1N94A 3AS8A 5G04C 4GZCA 1OCOE 2YQ8A 3PVLA 3EU9A 1IXVA 1O1RA 4UWLA 2L6JA 2IU1A 4DI3A 4GMRA 1Z6TA 2HM8A 3FUFA 2WXRA 4FHKA 3HHMA 1Z3YA 3ZYLA 3T5XA 4IN3B 5KNHD 3UQ3A 4TUUA 1N4RA 4H7XA 5KJNA 3RJVA 4WWPA 2P9IG 2XEHA 2XGMA 1P5QA 4YVOA 2I1KA 3T9KA 4WWOA 4ZHBA 1TN7A 3MKQA 2MYOA 1V55E 1N0RA 3V79K 3EHQA 2OEWA 4JZYA 5FQ4A 3HXEA 4YNDA 4CGWA 2ILRA 5BPPA 2WB2A 3W9FA 4EZJA 2WPVA 1DC2A 2BUGA 3G2WA 3E34A 5A6CA 3FHEA 4AM9A 4B94A 2IEJA 1LTXA 3J5PA 1PC2A 2VYIA 3RSEG 3T5VA 1OWPA 1H2TC 4QFVA 4U0UA 4KVOA 3L6AA 5E75A 1YA0A 3PZ1A 3L13A 2LAIA 3C3RA 3U64A 2QYJA 3GW4A 3HXCA 1N52A 3FU5A 3LPZA 2EILE 3D9LA 3PUKA 2VSYA 1S64A 4L9PA 4AY6A 4K5AB 1YMPA 5D66A 3APDA 3AG3E 1ZBPA 2EIJE 5CRUA 3LVRE 2XZTG 3Q79A 2DBAA 5FT9A 3GYZA 4F1SA 2WXPA 2XGSA 4GPKA 2DZNA 3TJPA 2GRLA 5G2NA 5B1AE 2YHEA 3I3NA 4YVQC 3ZIMA 4C0EA 2BTDA 3D9OA 1NZNA 4GCNA 3G2VA 3V30A 1XNFA 1O1SA 2J08A 3ZYKA 4MKTA 5ENPD 1U3DA 2X6JA 4MBGA 4N2SA 2GRRB 3IHVA 1HX8A 4G8LA 2FO7A 3ZXPA 1HZ4A 4UWFA 4GTPA 4AV7A 4WNEA 1E8ZA 4GYYA 4C48B 4CDRA 4O6FA 2ETBA 2DWZA 3MJWA 4N3BA 3Q15A 3MA5A 2BKKB 2QZAA 4I1AA 3ZEFA 5ARGA 2RFMA 3LY8A 1S63A 3QB2A 5AN8A 5A23A 4GZDA 1DNPA 3FU3A 4GMLA 4JC8A 4ATGA 3EJNA 4AOFA 4Y6CA 4OAVB 2H6FA 3C3OA 2IFUA 4FLBA 4G26A 2P9PG 3FTWA 4OVUA 4EZKA 5KJKA 2F0YA 2AW6A 4DLQA 1E90A 1U3CA 1H2VC 1BI8B 4BY6A 1XGWA 3CVPA 2WXHA 1OT8A 3SQVA 3B7TA 3TWTA 4L23A 3SY2A 4PH4B 4WNFA 2GGFA 5H7PA 2KZTB 2L9BA 2LSVA 4R7LA 4G23A 3GZ2A 5FTPA 4L2YA 2KZTA 4D10C 5ENRD 2A4ZA 3MKQB 3TAXA 3X2QE 3UTMA 2XPIA 5KJMA 5G05J 2KM4A 5KBAA 1FCHA 2VTBA 4ACKA 3S2AA 4CCAA 3JQ1A 3QJZA 2BF0X 1FT1A 4TXRA 5E76A 5D0QD 3RAUA 3I4GA 5CMWA 2HE0A 4JXTA 4ILGA 1Z3XA 3CVYA 2F8YA 1OWLA 2Y1LE 1LD7A 5HRYA 3DEPA 2VGXA 4PDXA 5CRVA 4ILIA 3MZLB 3ABLE 3KSLA 1JWFA 3FUEA 1OUVA 4X8QA 2AVPA 2P9NG 4UI9K 3PUJA 2XZDG 4BESA 3TWWA 2LAHA 5EIDA 5CECB 2CFZA 4FULA 3FTSA 5JA4D 1H0AA 3D9PA 3ZHEA 4HRMB 3MYVA 5BT1A 1INZA 4O1OA 5FINA 3HG0D 3DSVA 4N5CA 4FJZA 4DX1A 3FY4A 3ZXSA 4KYOB 3PEVB 4HXIA 2H6HA 5DBKA 2FULA 4GZ5A 3TGOA 3B7RL 3D9IA 2ZISA 3D3MA 4XIFA 3LCAA 3CQCB 4F53A 3Q9NC 2WXKA 2LUHA 2XPZA 3UPVA 2R2LA 2EQXA 1N4SA 3ZPJA 3UXGA 1OY3D 2YINA 1HG2A 5T3RA 1K3ZD 3SO8A 3FDHA 3LVQE 3PEUB 3JXJA 3NB2A 4WUYA 5EYLA 3QWVA 3BUAA 4HLLA 4O1PA 3CV0A 3RRNB 3GZ1A 2KCKA 2J49A 4MLPA 3ESLA 3JUIA 4HOQA 1WY6A 3R7QA 3SF4A 4CDNA 4OVVA 4E85A 3FTXA 4U0SA 3RRUA 1KPSB 2QFCA 3ABKE 2KBXA 2BEDA 3TWSA 4HFGA 2VSNA 4NIKA 1RZ4A 3VLDA 4HOSA 3UM3A 2P9LG 2CG2A 4HI9A 4EPZA 4GA2A 5EKQD 2ETAA 5ARFA 3PREA 2CG3A 4URKA 3UX4A 3C98A 4GB9A 3PS6A 2AWIA 5AENA 1TJCA 1O5MA 1TR4A 4EBAA 1LF8A 4UQZA 4ILHB 4Y6WA 3ZU7B 1NFIE 1ELRA 1MX2A 2PQRA 5T4YA 1IHBA 3QNKA 2DYSE 2E0IA 2Y3AA 5EX3A 4G1TA 2DIWA 4V3IA 2WVIA 1MX6A 5BW8C 5FQ8A 4L2LA 4N5QA 3T8KA 3JXIA 1MJ0A 5AJLA 3NAWA 3P1UA 4LG6A 3Q73A 2WXFA 3CHOA 1TN6A 5AYWD 1B89A 2IQCA 3G2UA 4G24A 3CKCA 1MYOA 2X6KA 2ZGGA 4GYOA 2OV8A 4CRWA 3LY9A 4KVMA 2X6FA 3B7BA 5FQ6A 5CBNA 1BD8A 3CVXA 1OWOA 4B8CB 1TNZA 2J9QA 2P58C 4F7AA 2LO6A 2CHZA 3Q75A 4K5CA 3FUIA 3LJNA 4GA0A 5HQ8A 4CZ2D 4CEMA 4GTOA 3AG2E 4J0UA 3Q47B 3Q5MA 3HXDA 3Q7AA 2ONDA 3ASNE 3RRMB 3TWRA 2P9KG 2J07A 4ANVA 5LP0A 1E8XA 4I6JA 3SBSA 3PRZA 3PZDA 3UKUG 1LD8A 1NA0A 5LX8A 4TXQA 2DZOA 3DBSA 2WM9A 4GU5A 2B6CA 4RG9A 3NOGD 2CHWA 5B3SE 3C5RA 2GRMA 3JCKC 4KZ0A 4NRHB 2KC7A 3ASGA 4MS6A 4ANUA 2QY7A 4NACA 3RK6A 2XHEA 2OVBA 4N3AA 4Q94A 3ONKA 1YYHA 3IEGA 3JUEA 4K03A 1TNYA 3DPYA 4BX8A 5HS0A 5JHAA 4XE0A 1OWNA 5FZRA 3EHMA 2NXPA 4A55A 5AARA 4DI4A 2J09A 3R9AB 5JJ6A 4CGVA 1HFAA 1U2VG 2XCBA 3S7FA 4FC8A 1SA5A 4HS2A 1IQUA 4QQIA 1BPOA 1NA3A 4XEIG 2RG8A 1UOHA 1X5BA 5A7DB 2OCCE 4UI9J 1FPPA 3CVQA 4GTTA 1A17A 3FEXA 1OWMA 4M7CA 5AQBA 3LEWA 2ZGDA 2Y4TA 1ZB1A 1MZCA 1OCZE 1IKND 4LNGA 4LUNU 2WXQA 3T8MA 3NBNB 5JJTA 3HXBA 4G11A 4KZCA 2F37A 4BTBA 5LFAA 4KT6B 4DX6D 4IULA 2H6GA 3IXEA 2NSZA 4DPRA 3FTZA 4G8KA 2A5EA 4O60A 1EYHA 4CDMA 1PY1A 5C2YA 3BQOA 4AJWA 4NURA 4BT9A 2LXMA 2XQ0A 4AP2A 2GRPB 3DRAA 3PNTB 3FH7A 1OXJA 2R59A 1D9SA 3MV3B 3ABME 4ABNA 5ANLA 5FQ7A 5C1DA 5BNWA 3ULYA 3CR3A 5HKPA 4A1SA 3APFA 3S7JA 3UKRG 3PH0C 3CEQA 4JHJA 3FTYA 3HRAA 4BWRA 2WXLA 2I6HA 4XI0A 4J8YA 3OTNA 3Q49B 3FU0A 5EYPF 3FULA 3DSUA 2XEEA 2LXLA 2FO1E 3CVUA 4BTAA 2RKKA 4XX5A 1BU9A 4IRUA 2IOSA 2H6IA 2Q7FA 4GCOA 1E8YA 1HH8A 3CHQA 3KAEA 4U7EB 5BXOA 3DXKG 3FUDA 1KLXA 3EIJA 3ISMC 2E2EA 2MHKA 4YDOA 1ZU2A 5KNGA 5EDSA 3PE4A 2WXMA 1X81A 4PS3A 3L54A 4U04A 2P2CP 3BG1B 3L82A 5M72A 3Q9UC 3NZSA 4A3TA 5J90A 1WG0A 2R5SA 4GYWA 3FWVA 1HU3A 2J8SD 2V5FA 3CHMA 5EN5D 2HR2A 2XCCA 2I9CA 4BEPA 2XEVA 3V2XA 4BSZB 3UIOC 2IONA 2KCLA 4HNAD 4HBDA 1N4PA 3CIAA 4AVXA 2V5QC 3O48A 4U8HA 4ZFHA 4AY5A 1WM5A 1UJJA 4HVBA 2FBNA 4GPMA 3LDZA 4FJYA 2QC9A 3UIPC 1SA4A 3MX3A 3TWXA 5FIOA 1H19A 2IOLA 4DLOA 3LJ3A 3VLEA 1VDYA 2XENA 4BX9A 3KSQA 2RD0A 2PL2A 2NC9A 4JHKA 1AP7A 5FWQA 3V31A 2FEZA 1JWGA 5CEAA 1ELWA 3DSWA 4GMJA 3UM0A 5JMND 4RG6A 3DEOA 3CVNA 3ZVVA 3EDTB 1A5EA 3AS4A 4F1PA 2BKGA 3VTXA 1SZAA 1SVXA 3UI2A 2ETCA 4JA9A 4GA1A 1TYQG 1DCEA 5ENTD 3CGHA 1KZPA 3IHYA 4UWGA 2UY1A 2Y0BG 1Y8MA 3CSFA 4TRQA 3K9IA 2DYRE 1HF8A 4DK5A 3PZ2A 1K8KG 2V0PA 5BV0A 3HVEB 3SNXA 3AU4A 3UT8A 3SGHA 3CK7A 1HE8A 3EU5A 3AS5A 4B8AA 3OXGA 4NQ0A 5FZSA 4B89A 4UUCA 4JEUA 1UN8A 4XKCA 3PZ3A 3LY7A 2PNNA 4OAUC 1NP7A 4A1GA 2LNIA 3ASHA 3FUKA 3R7RA 4GZ6A 4I43A 3D9JA 4H7YA 4RLYA 5JJ7A 2I1JA 2IO2C 4PS8A 1O1TA 3ZFWA 3ZNGA 3F6QA 4LNBA 3QARA 5EILA 4JW1A 3ZHEB 3LS8A 5KWDA 4HI8A 3TWUA 3EHRA 3URZA 4J8SA 4I2WA 3W9GA 4MRUA 5AQ9A 5G55A 2IY0C 3ZW3A 3GZSA 1TEZA 3EHNA 3D9KA 5BXUA 3RIBA 2AJAA 3U4TA 4G2VA 3NOCD 1N4QA 4GTSA 3IKOB 4GTQA 1N0QA 4U07A 2L0TB 3SZ7A 1N95A 3FTUA 4I1OB 3U66A 3TXNA 4KBQA 1E7UA 4LERA 1H6KA 4HORA 4GTVA 4UWHA 2WQHA 4RVBA 3CHPA 3BG0B 4FP7A 4HLEA 5CERB 3UT7A 3B13A 3VLFA 2ZIRA 3CVWA 5D0OD 3G2SA 2J4BA 1UN9A 4WNDA 1N11A 5CCMA 3ZKJA 3WG7E 2EINE 4UQXA 4I9CA 4A63B 3UUXA 3BU8A 3MCXA 2WQ6A 5AAOA 5BUZA 4RSYA 4P29A 4HOUA 4Z68A 4JB8P 4UWKA 3O4ZA 1S70B 2GW1A 3NZUA 3L17A 1HXIA 3KEAA 1EPUA 4U95D 4U0ZA 2LSUA 1GW6A 3V2OA 3EUVA 4DRXE 2X6HA 5D2MC 3ZN3A 4L7TA 3CKBA 3UM2A 3ESKA 3SI5A 3QC1A 1OCCE 2KATA 4YDEA 4L1BA 3B95A 5EIBE 3ML9A 5G04J 2PM6A 4GAAA 3TG5A 3DPDA 3OXLA 3G2TA 1G3NB 2L0IA 1V54E 5IY5E 2J4DA 3MEKA 3E37A 2RFAA 4U96D 1QNFA 3FUHA 3QAQA 1TJFA 3NQPA 2UY1B 3C3QA 4I6EA 1TNOA 3ASFA 4C9BB 4GTRA 3J5QB 5ENNA 2WMNA 3CK8A 3ULQA 2YHCA 1RW2A 3FEYA 4KMOA 1UJKA 4OYSA 3QOUA 3QWPA 2HYZA 3FUNA 2XS8A 1S0PA 2MOWA 4APFA 3CVVA 1HG5A 3PZ4A 3FFLA 3R9MA 4I9EA 4BERA 3HDXA 2IF4A 1JCSA 2IJGX 5JHBA 3AG4E 4FA6A 2AXUA 4WAFA 4HB5A 2V8SE 1MQSA 3JQ0A 3OXFA 3SFZA 2DVWA 3JYSA 5T8IA 4M3OA 4JPSA 1K1AA 3CVLA 1Q2ZA 4I17A 4C0MA 2FF4A 3U3WA 3APCA 3MGBA 3L22A 4HRLA 4N3CA 4WNGA 4PS7A 4BETA 3ENEA 3Q78A 2R02A 1K1BA 2MRIA 2JABA 4AEZC 3ZUVB 5G05C 2X38A 3SBTB 3P2BA 1Y6IA 3UMVA 2F8XK 1QQEA 2V4HC 4CYMD 4B0ZA 1KT0A 3PNLB 2OEVA 5ANRA 2IO3C 4EHMA 3FH8A 4PUCA 5ITZF 1HS6A 4U8YD 4W9RA 1WAO1 3PDNA 3BEEA 4JEHA 3KEZA 4DX2A 1ELKA 4UQYA 4J6IA 4EZLA 4DUIA 2VTBB 5BV1A 1TN8A 3QDNA 4JA7A 1EDUA 2P9SG 3CK9A 4RQIA 3B7SA 4LNUD 3DSXA 2P9UG 3QKYA 2WXGA 3D9NA 3S7BA 1FVHA 3FUMA 3ASDA 4FU3A 4TUMA 4AIFA 5FJYA 2VGXB 2WQ7A 2PZIA 5CEDB 2OOEA 2QYUA 1AWCB 3D9MA 3N71A 5KJLA 3CHRA 3B7UX 1HO8A 5AIJA 2XGOA 1SZ9A 4LEUA 3DWLG 3IV0A 5ENSD 1BI7B 2YNQA 2VQ2A 3L9TA 1QYMA 3DSSA 2XPYA 1E8WA 2KCVA 2GROB 3E32A 5EX0A
chains in the Genus database with same CATH topology
5AYWD 1YA0A 4I1MA 2VSOE 3L13A 1B89A 3CSFA 4TRQA 2IQCA 3K9IA 3TXMA 1HF8A 2LAIA 4DK5A 3NF1A 3G2UA 3U64A 4G24A 3CKCA 3GW4A 2V0PA 1QZ2A 4APOA 2X6KA 4GYOA 5BV0A 3HVEB 1N52A 2OV8A 3FU5A 3SNXA 4CRWA 3LPZA 3L16A 3D9LA 2X3MA 3AU4A 3LY9A 3UT8A 4KVMA 3CQGB 2X6FA 3CK7A 3SGHA 4EQFA 1HE8A 2VSYA 3PUKA 4KXKB 5FQ6A 3HYMB 1UW4B 3AS5A 3CVXA 4B8AA 4AY6A 3OXGA 1OWOA 4LRZA 4B8CB 4JHRA 3APDA 3FH5A 2J9QA 4NQ0A 2P58C 5FZSA 2LO6A 4F7AA 2CHZA 1ZBPA 4B89A 4FHJA 1UN8A 4JEUA 4XKCA 4LCTA 4FADA 3FUIA 3LVRE 3LY7A 3AU5A 1W3BA 2DBAA 4GA0A 5FT9A 5HQ8A 2X6IA 3GYZA 4F1SA 1NP7A 4A1GA 2WXPA 2XGSA 2LNIA 4CEMA 3ASHA 3FUKA 3R7RA 4J0UA 3Q47B 4GZ6A 1H2UA 4I43A 3Q5MA 4GPKA 5HI7A 3D9JA 2ONDA 1FVFA 2C2LA 4H7YA 3TJPA 3UT4A 2GRLA 5JJ7A 3RRMB 5G2NA 2YHEA 2I1JA 5LOZA 3I3NA 4PS8A 2J07A 4YVQC 3ZFWA 4ANVA 5LP0A 3ZIMA 5CMYA 4C0EA 2BTDA 1E8XA 3QARA 4XZ4A 4JW1A 3ZHEB 4I6JA 5KCMA 1E7VA 3SBSA 3PRZA 3D9OA 3LS8A 1NZNA 4G25A 4AXHA 5LCWC 3PZDA 3HIZA 3TG4A 4GCNA 2VSXE 4WWNA 1NA0A 3G2VA 3MKRA 5CHEE 3URZA 4J8SA 4I2WA 5LX8A 3U9WA 3DBSA 1XNFA 4MRUA 2WM9A 4GU5A 2J08A 4RG9A 2C0LA 5G55A 2VGYA 3ZW3A 3GZSA 3ML8A 3ZYKA 4MKTA 2CHWA 1TEZA 1U3DA 2GRMA 2X6JA 2WXNA 3EHNA 3JCKC 4KZ0A 4NRHB 2KC7A 3D9KA 4N2SA 3ASGA 4MS6A 3IHVA 3OAWA 3RIBA 4ANUA 2QY7A 1HX8A 4NACA 3RK6A 2FO7A 3U4TA 1KT1A 2OVBA 1MHQA 2XHEA 4G2VA 4N3AA 1HZ4A 4Q94A 4UWFA 3E4BA 3ONKA 3IEGA 4AV7A 4WNEA 1E8ZA 4K03A 4ACLA 4GYYA 4CDRA 4EBAG 4O6FA 3IKOB 4U07A 3MJWA 4N3BA 3Q4AB 4BX8A 2L0TB 3SZ7A 2WXIA 3Q15A 3MA5A 4I1AA 1IHGA 5JHAA 4XE0A 3FTUA 1OWNA 3IBEA 3ZEFA 4I1OB 2CFUA 3U66A 5FZRA 1IYGA 3EHMA 5ARGA 3TXNA 2NXPA 4A55A 3SHFA 3LY8A 2JEKA 3QB2A 4KBQA 5A23A 3QWWA 4GZDA 1E7UA 4K0RA 2PM7A 4LERA 3RKVA 1PAQA 3HVEA 1DNPA 1H6KA 1L5JA 3FU3A 4DI4A 2J09A 4GMLA 3R9AB 5JJ6A 4JC8A 4BSXA 4HORA 4CGVA 1HFAA 4UWHA 2XCBA 3LYAA 3CSTA 3S7FA 5AJDA 4FC8A 4ATGA 3EJNA 4ME2A 2WQHA 2V4LA 3CHPA 4HS2A 4RVBA 4AOFA 2XRZA 3BG0B 1IQUA 4FP7A 4Y6CA 4HLEA 4EECA 3FUJA 3LKUA 2IFUA 3ZRHA 1JUQA 3UT7A 3FP3A 3B13A 3VLFA 3KD7A 4A3VA 4FLBA 1BPOA 5D0OD 4DJAA 3G2SA 4JVSA 2J4BA 3QK0A 1NA3A 3CVWA 1UN9A 4WNDA 3SD5A 4G26A 2RG8A 3FTWA 4E6HA 4OVUA 1X5BA 4EZKA 5KJKA 3WXXA 2AW6A 5A7DB 5CCMA 4N2QA 2DCPA 4DLQA 4UI9J 3CVQA 1A17A 3FEXA 1E90A 1U3CA 1H2VC 2WXJA 3FTVA 3L08A 4CT0A 4BY6A 1OWMA 1XGWA 3CVPA 2WXHA 2PQNA 3CHSA 4I9CA 4UQXA 3VTYA 4ANWA 3UUXA 3B7TA 4U63A 3LEWA 4L23A 3I4RB 4PH4B 3MCXA 4WNFA 2WQ6A 5BUZA 3RO3A 2GGFA 4RSYA 2KZTB 2L9BA 2LSVA 4HOTA 4R7LA 4G23A 3ONLA 3GZ2A 4P29A 5LCWJ 4HOUA 5FTPA 4L2YA 2KZTA 3S7DA 4UWKA 4D10C 2Y4TA 3O4ZA 2A4ZA 3ZGQA 1JPLA 3MKQB 2GW1A 3TAXA 1N54A 3NZUA 3L17A 2XPIA 4LUNU 5KJMA 3ZYQA 1HXIA 2KM4A 2WXQA 5G05J 1FCHA 3T8MA 2VTBA 1EPUA 1EF1C 2JLBA 3S2AA 4ACKA 4KZCA 4G11A 4BT8A 4CCAA 5JJTA 4U0ZA 3JQ1A 2LSUA 1GW6A 4I2ZA 4IULA 4KT6B 4BTBA 4BFRA 5LFAA 2X6HA 3ZYMA 2NSZA 3QJZA 3ZN3A 2BF0X 3FTZA 4DPRA 4L7TA 3CKBA 5E76A 4XI9A 3ESKA 5D0QD 3SI5A 2AXVA 3QC1A 3CLJA 3I4GA 5CMWA 2KATA 4JXTA 4ILGA 3TL5A 4L1BA 1EYHA 4CDMA 1Z3XA 3ML9A 1PY1A 5G04J 3CVYA 5C2YA 1OWLA 4AJWA 2C0MA 2PM6A 4GAAA 4NURA 2VGXA 3TG5A 3DPDA 4BT9A 4PDXA 3OXLA 2XQ0A 4AP2A 3G2TA 4ILIA 2L0IA 4F3VA 4TV3A 2OVFA 3PNTB 3MZLB 3FH7A 2VJ8A 4CT4A 2ZU6B 2R59A 2J4DA 3MEKA 2WMOA 4FLHA 1JWFA 3FUEA 3MV3B 1OUVA 4ABNA 5ANLA 5FQ7A 5C1DA 2AVPA 5BNWA 4IYPA 2FI7A 2XRYA 4UI9K 3CR3A 3PUJA 4A1SA 3APFA 3S7JA 1QNFA 3FUHA 3PH0C 2I2OA 3QAQA 1TJFA 3NQPA 3CEQA 2UY1B 4JHJA 2LAHA 4I6EA 2CFZA 4FULA 3ASFA 3FTSA 1H0AA 3D9PA 3FTYA 1E96B 3ZHEA 4C9BB 2Y4UA 3MYVA 4J8FA 4BWRA 2M63A 2WXLA 4UI9C 5BT1A 1INZA 3I5PA 2I6HA 5ENNA 4XI0A 4I6GA 4N5CA 3OTNA 4FJZA 2WMNA 2AXZA 3CK8A 3ULQA 3FY4A 3Q49B 3ZXSA 3RO2A 2YHCA 5J08A 4KYOB 3PEVB 2HO1A 2R17C 3FU0A 3FEYA 4HXIA 4KMOA 1UJKA 4OYSA 5DBKA 5FZQA 2FULA 3FULA 4GZ5A 3TGOA 3B7RL 3D9IA 4J8DA 3RU0A 3QOUA 3QWPA 2HYZA 3D3MA 4XIFA 3LCAA 4Q69A 4ANXA 3CQCB 3FUNA 1IQRA 4GZ3A 4F53A 1S0PA 2MOWA 3LXUX 2WXKA 3KS2A 3CVUA 4Q96A 4BTAA 4XX5A 3MV2B 2XPZA 5CCLA 3UPVA 4IRUA 2IOSA 4APFA 3CVVA 1HG5A 3EIQC 2Q7FA 3FFLA 2EQXA 4GCOA 3ZPJA 1UG3A 2YINA 1E8YA 4I9EA 1HG2A 1HH8A 3FU6A 3CHQA 3KAEA 1DVPA 4N39A 5T3RA 3HDXA 2IF4A 4J8EA 3FDHA 3FUDA 1KLXA 2IJGX 3EIJA 2CHXA 3LVQE 5JHBA 2E2EA 2MHKA 3PEUB 4FA6A 5EDSA 1ZU2A 2AXUA 2WXOA 3PE4A 2WXMA 4WAFA 2UWJG 2A5UA 1MQSA 2V8SE 3JQ0A 4PS3A 4WUYA 3L54A 4U04A 3OXFA 4XKBA 3SFZA 3JYSA 3BG1B 5T8IA 3QWVA 4M3OA 1SQMA 4JPSA 5M72A 3CVLA 4I17A 3NZSA 4C0MA 4A3TA 2FF4A 3PE3A 4JL0A 3APCA 5DIZA 5J90A 3U3WA 2R5SA 3CV0A 3MGBA 3FWVA 4GYWA 3AS8A 5G04C 3GZ1A 3RRNB 4GZCA 1HU3A 2KCKA 3L22A 4N3CA 2YQ8A 2V5FA 3CHMA 3PVLA 2J49A 2HR2A 4MLPA 3ESLA 4PS7A 4UWLA 4WNGA 2L6JA 2IU1A 3JUIA 4HOQA 1WY6A 2XCCA 2I9CA 3R7QA 3SF4A 4DI3A 4CDNA 4OVVA 2XEVA 3ENEA 4E85A 3FTXA 4U0SA 1Z6TA 3RRUA 2HM8A 2QFCA 2IONA 2KCLA 3FUFA 2WXRA 4FHKA 3CIAA 4HFGA 2MRIA 4AVXA 3HHMA 1Z3YA 4AEZC 3ZYLA 5G05C 2VSNA 3T5XA 2X38A 3SBTB 3O48A 4U8HA 4IN3B 3P2BA 1Y6IA 3UQ3A 3UMVA 4TUUA 4H7XA 5KJNA 3RJVA 4AY5A 3VLDA 4WWPA 4HOSA 1WM5A 1UJJA 1QQEA 4HVBA 2XGMA 2FBNA 4B0ZA 1KT0A 2CG2A 1P5QA 3PNLB 5ANRA 4YVOA 2I1KA 4EPZA 4GA2A 5EKQD 4WWOA 3LDZA 3FH8A 4FJYA 4PUCA 1HS6A 3MKQA 5ARFA 3PREA 4W9RA 1WAO1 3PDNA 3BEEA 3MX3A 4JEHA 3KEZA 2CG3A 1ELKA 1H19A 4UQYA 4J6IA 2IOLA 4EZLA 4DLOA 3LJ3A 3VLEA 2VTBB 1VDYA 5BV1A 4URKA 4BX9A 3QDNA 4JA7A 3UX4A 1EDUA 3C98A 3CK9A 2RD0A 3B7SA 4GB9A 2PL2A 2NC9A 4JHKA 4JZYA 3PS6A 5FWQA 2AWIA 5FQ4A 5AENA 1TJCA 4YNDA 4CGWA 3QKYA 2ILRA 2WXGA 3D9NA 2FEZA 5BPPA 2WB2A 3S7BA 1JWGA 1FVHA 1ELWA 3FUMA 3ASDA 4EBAA 1LF8A 4FU3A 4GMJA 4EZJA 2WPVA 4UQZA 4AIFA 4ILHB 4Y6WA 4RG6A 5FJYA 2BUGA 2VGXB 3CVNA 3G2WA 3ZVVA 3EDTB 1ELRA 2WQ7A 2PZIA 2PQRA 5T4YA 3FHEA 5A6CA 3QNKA 2OOEA 4AM9A 4B94A 3AS4A 3D9MA 3VTXA 2E0IA 1SZAA 3N71A 2Y3AA 5KJLA 3CHRA 5EX3A 1PC2A 3B7UX 1HO8A 2VYIA 2DIWA 4G1TA 5AIJA 2XGOA 4V3IA 2WVIA 1SZ9A 4LEUA 3IV0A 3T5VA 5BW8C 5FQ8A 1OWPA 2YNQA 4JA9A 4L2LA 4GA1A 1H2TC 2VQ2A 4QFVA 4U0UA 3CGHA 2XPYA 5AJLA 3P1UA 1E8WA 3IHYA 2KCVA 4UWGA 2UY1A 4KVOA 2WXFA 3L6AA 3CHOA 5E75A 5EX0A 1Y8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEV B;  3PEU B;  3RRM B;  3RRN B; 
#chains in the Genus database with same CATH topology
 4I1M A;  2VSO E;  3TXM A;  3NF1 A;  4APO A;  1QZ2 A;  5CBO A;  2NYJ A;  3L16 A;  2X3M A;  3CQG B;  4EQF A;  4KXK B;  1H6P A;  3HYM B;  1UW4 B;  4LRZ A;  4JHR A;  2ZXW E;  3FH5 A;  2L6B A;  4FHJ A;  4K5B A;  4LCT A;  4FAD A;  2KXP C;  4J7W A;  3AU5 A;  1W3B A;  4TXP A;  2X6I A;  1D8D A;  1H2U A;  4JD2 G;  5HI7 A;  1FVF A;  2C2L A;  3UT4 A;  5AQ7 A;  1NI1 A;  5LOZ A;  5CMY A;  2GRN B;  3C72 A;  4XZ4 A;  5KCM A;  1E7V A;  3AJI A;  4G25 A;  4AXH A;  5LCW C;  3HIZ A;  3TG4 A;  2VSX E;  4WWN A;  3MKR A;  5CHE E;  3U9W A;  2R03 A;  5AQA A;  2C0L A;  2VGY A;  2XS1 A;  3ML8 A;  2WXN A;  4LSZ E;  3AG1 E;  3OAW A;  4ATZ D;  1KT1 A;  1MHQ A;  3E4B A;  1QBQ A;  4ACL A;  4EBA G;  1WDY A;  3SFY A;  3Q4A B;  2WXI A;  1IHG A;  3IBE A;  2CFU A;  1IYG A;  1DCQ A;  3SHF A;  2JEK A;  3QWW A;  4K0R A;  2PM7 A;  3RKV A;  1PAQ A;  3HVE A;  1L5J A;  1D8E A;  2R05 A;  1Z5S C;  1SW6 A;  4BSX A;  3DST A;  3LYA A;  3CST A;  5AJD A;  2B0O E;  4ME2 A;  2V4L A;  2XRZ A;  4EEC A;  3FUJ A;  3LKU A;  3ULE G;  3ZRH A;  1JUQ A;  3FP3 A;  4DX5 D;  3KD7 A;  4A3V A;  4DJA A;  4JVS A;  3QK0 A;  3SD5 A;  3SFX A;  4E6H A;  3WXX A;  4N2Q A;  2DCP A;  2Y69 E;  3FTV A;  2WXJ A;  3L08 A;  4CT0 A;  1TNB A;  3VTY A;  2PQN A;  3CHS A;  3UIN C;  4ANW A;  4U63 A;  1BLX B;  3I4R B;  3RO3 A;  4HOT A;  3ONL A;  5LCW J;  1KZO A;  1N9A A;  1OCR E;  3S7D A;  4HQD A;  3ZGQ A;  1JPL A;  1N54 A;  3ZYQ A;  3D9H A;  4U8V D;  4F6R D;  1EF1 C;  2JLB A;  4BT8 A;  4BFR A;  4I2Z A;  3ZYM A;  4XI9 A;  1JCR A;  2AXV A;  3CLJ A;  1YCS B;  3Q7F A;  3TL5 A;  1TNU A;  3UM1 A;  2C0M A;  4GTM A;  5ENO D;  4F3V A;  4TV3 A;  2OVF A;  4YDY A;  4YDW A;  2VJ8 A;  4CT4 A;  2ZU6 B;  4B93 B;  2WMO A;  4FLH A;  1NL4 A;  4IYP A;  2FI7 A;  2XRY A;  2EIK E;  2I2O A;  3ASO E;  5ENQ D;  1E96 B;  2Y4U A;  4J8F A;  2M63 A;  4DX7 D;  4UI9 C;  3I5P A;  4I6G A;  4HRN A;  2AXZ A;  3RO2 A;  5J08 A;  2HO1 A;  2R17 C;  1FT2 A;  5FZQ A;  1JCQ A;  5B1B E;  4J8D A;  3RU0 A;  3TWV A;  4Q69 A;  4ANX A;  1IQR A;  4GZ3 A;  3LXU X;  3DXM G;  3KS2 A;  4Q96 A;  2VGE A;  3MV2 B;  5CCL A;  3EIQ C;  1UG3 A;  2EIM E;  3FU6 A;  1DVP A;  3E30 A;  4N39 A;  2GRQ B;  4J8E A;  2CHX A;  3AAA C;  2WXO A;  1H6O A;  2UWJ G;  2A5U A;  1MX4 A;  4XKB A;  3E33 A;  1SQM A;  3HXF A;  3PE3 A;  4JL0 A;  5DIZ A;  3TWQ A;  1N94 A;  3AS8 A;  5G04 C;  4GZC A;  1OCO E;  2YQ8 A;  3PVL A;  3EU9 A;  1IXV A;  1O1R A;  4UWL A;  2L6J A;  2IU1 A;  4DI3 A;  4GMR A;  1Z6T A;  2HM8 A;  3FUF A;  2WXR A;  4FHK A;  3HHM A;  1Z3Y A;  3ZYL A;  3T5X A;  4IN3 B;  5KNH D;  3UQ3 A;  4TUU A;  1N4R A;  4H7X A;  5KJN A;  3RJV A;  4WWP A;  2P9I G;  2XEH A;  2XGM A;  1P5Q A;  4YVO A;  2I1K A;  3T9K A;  4WWO A;  4ZHB A;  1TN7 A;  3MKQ A;  2MYO A;  1V55 E;  1N0R A;  3V79 K;  3EHQ A;  2OEW A;  4JZY A;  5FQ4 A;  3HXE A;  4YND A;  4CGW A;  2ILR A;  5BPP A;  2WB2 A;  3W9F A;  4EZJ A;  2WPV A;  1DC2 A;  2BUG A;  3G2W A;  3E34 A;  5A6C A;  3FHE A;  4AM9 A;  4B94 A;  2IEJ A;  1LTX A;  3J5P A;  1PC2 A;  2VYI A;  3RSE G;  3T5V A;  1OWP A;  1H2T C;  4QFV A;  4U0U A;  4KVO A;  3L6A A;  5E75 A;  1YA0 A;  3PZ1 A;  3L13 A;  2LAI A;  3C3R A;  3U64 A;  2QYJ A;  3GW4 A;  3HXC A;  1N52 A;  3FU5 A;  3LPZ A;  2EIL E;  3D9L A;  3PUK A;  2VSY A;  1S64 A;  4L9P A;  4AY6 A;  4K5A B;  1YMP A;  5D66 A;  3APD A;  3AG3 E;  1ZBP A;  2EIJ E;  5CRU A;  3LVR E;  2XZT G;  3Q79 A;  2DBA A;  5FT9 A;  3GYZ A;  4F1S A;  2WXP A;  2XGS A;  4GPK A;  2DZN A;  3TJP A;  2GRL A;  5G2N A;  5B1A E;  2YHE A;  3I3N A;  4YVQ C;  3ZIM A;  4C0E A;  2BTD A;  3D9O A;  1NZN A;  4GCN A;  3G2V A;  3V30 A;  1XNF A;  1O1S A;  2J08 A;  3ZYK A;  4MKT A;  5ENP D;  1U3D A;  2X6J A;  4MBG A;  4N2S A;  2GRR B;  3IHV A;  1HX8 A;  4G8L A;  2FO7 A;  3ZXP A;  1HZ4 A;  4UWF A;  4GTP A;  4AV7 A;  4WNE A;  1E8Z A;  4GYY A;  4C48 B;  4CDR A;  4O6F A;  2ETB A;  2DWZ A;  3MJW A;  4N3B A;  3Q15 A;  3MA5 A;  2BKK B;  2QZA A;  4I1A A;  3ZEF A;  5ARG A;  2RFM A;  3LY8 A;  1S63 A;  3QB2 A;  5AN8 A;  5A23 A;  4GZD A;  1DNP A;  3FU3 A;  4GML A;  4JC8 A;  4ATG A;  3EJN A;  4AOF A;  4Y6C A;  4OAV B;  2H6F A;  3C3O A;  2IFU A;  4FLB A;  4G26 A;  2P9P G;  3FTW A;  4OVU A;  4EZK A;  5KJK A;  2F0Y A;  2AW6 A;  4DLQ A;  1E90 A;  1U3C A;  1H2V C;  1BI8 B;  4BY6 A;  1XGW A;  3CVP A;  2WXH A;  1OT8 A;  3SQV A;  3B7T A;  3TWT A;  4L23 A;  3SY2 A;  4PH4 B;  4WNF A;  2GGF A;  5H7P A;  2KZT B;  2L9B A;  2LSV A;  4R7L A;  4G23 A;  3GZ2 A;  5FTP A;  4L2Y A;  2KZT A;  4D10 C;  5ENR D;  2A4Z A;  3MKQ B;  3TAX A;  3X2Q E;  3UTM A;  2XPI A;  5KJM A;  5G05 J;  2KM4 A;  5KBA A;  1FCH A;  2VTB A;  4ACK A;  3S2A A;  4CCA A;  3JQ1 A;  3QJZ A;  2BF0 X;  1FT1 A;  4TXR A;  5E76 A;  5D0Q D;  3RAU A;  3I4G A;  5CMW A;  2HE0 A;  4JXT A;  4ILG A;  1Z3X A;  3CVY A;  2F8Y A;  1OWL A;  2Y1L E;  1LD7 A;  5HRY A;  3DEP A;  2VGX A;  4PDX A;  5CRV A;  4ILI A;  3MZL B;  3ABL E;  3KSL A;  1JWF A;  3FUE A;  1OUV A;  4X8Q A;  2AVP A;  2P9N G;  4UI9 K;  3PUJ A;  2XZD G;  4BES A;  3TWW A;  2LAH A;  5EID A;  5CEC B;  2CFZ A;  4FUL A;  3FTS A;  5JA4 D;  1H0A A;  3D9P A;  3ZHE A;  4HRM B;  3MYV A;  5BT1 A;  1INZ A;  4O1O A;  5FIN A;  3HG0 D;  3DSV A;  4N5C A;  4FJZ A;  4DX1 A;  3FY4 A;  3ZXS A;  4KYO B;  3PEV B;  4HXI A;  2H6H A;  5DBK A;  2FUL A;  4GZ5 A;  3TGO A;  3B7R L;  3D9I A;  2ZIS A;  3D3M A;  4XIF A;  3LCA A;  3CQC B;  4F53 A;  3Q9N C;  2WXK A;  2LUH A;  2XPZ A;  3UPV A;  2R2L A;  2EQX A;  1N4S A;  3ZPJ A;  3UXG A;  1OY3 D;  2YIN A;  1HG2 A;  5T3R A;  1K3Z D;  3SO8 A;  3FDH A;  3LVQ E;  3PEU B;  3JXJ A;  3NB2 A;  4WUY A;  5EYL A;  3QWV A;  3BUA A;  4HLL A;  4O1P A;  3CV0 A;  3RRN B;  3GZ1 A;  2KCK A;  2J49 A;  4MLP A;  3ESL A;  3JUI A;  4HOQ A;  1WY6 A;  3R7Q A;  3SF4 A;  4CDN A;  4OVV A;  4E85 A;  3FTX A;  4U0S A;  3RRU A;  1KPS B;  2QFC A;  3ABK E;  2KBX A;  2BED A;  3TWS A;  4HFG A;  2VSN A;  4NIK A;  1RZ4 A;  3VLD A;  4HOS A;  3UM3 A;  2P9L G;  2CG2 A;  4HI9 A;  4EPZ A;  4GA2 A;  5EKQ D;  2ETA A;  5ARF A;  3PRE A;  2CG3 A;  4URK A;  3UX4 A;  3C98 A;  4GB9 A;  3PS6 A;  2AWI A;  5AEN A;  1TJC A;  1O5M A;  1TR4 A;  4EBA A;  1LF8 A;  4UQZ A;  4ILH B;  4Y6W A;  3ZU7 B;  1NFI E;  1ELR A;  1MX2 A;  2PQR A;  5T4Y A;  1IHB A;  3QNK A;  2DYS E;  2E0I A;  2Y3A A;  5EX3 A;  4G1T A;  2DIW A;  4V3I A;  2WVI A;  1MX6 A;  5BW8 C;  5FQ8 A;  4L2L A;  4N5Q A;  3T8K A;  3JXI A;  1MJ0 A;  5AJL A;  3NAW A;  3P1U A;  4LG6 A;  3Q73 A;  2WXF A;  3CHO A;  1TN6 A;  5AYW D;  1B89 A;  2IQC A;  3G2U A;  4G24 A;  3CKC A;  1MYO A;  2X6K A;  2ZGG A;  4GYO A;  2OV8 A;  4CRW A;  3LY9 A;  4KVM A;  2X6F A;  3B7B A;  5FQ6 A;  5CBN A;  1BD8 A;  3CVX A;  1OWO A;  4B8C B;  1TNZ A;  2J9Q A;  2P58 C;  4F7A A;  2LO6 A;  2CHZ A;  3Q75 A;  4K5C A;  3FUI A;  3LJN A;  4GA0 A;  5HQ8 A;  4CZ2 D;  4CEM A;  4GTO A;  3AG2 E;  4J0U A;  3Q47 B;  3Q5M A;  3HXD A;  3Q7A A;  2OND A;  3ASN E;  3RRM B;  3TWR A;  2P9K G;  2J07 A;  4ANV A;  5LP0 A;  1E8X A;  4I6J A;  3SBS A;  3PRZ A;  3PZD A;  3UKU G;  1LD8 A;  1NA0 A;  5LX8 A;  4TXQ A;  2DZO A;  3DBS A;  2WM9 A;  4GU5 A;  2B6C A;  4RG9 A;  3NOG D;  2CHW A;  5B3S E;  3C5R A;  2GRM A;  3JCK C;  4KZ0 A;  4NRH B;  2KC7 A;  3ASG A;  4MS6 A;  4ANU A;  2QY7 A;  4NAC A;  3RK6 A;  2XHE A;  2OVB A;  4N3A A;  4Q94 A;  3ONK A;  1YYH A;  3IEG A;  3JUE A;  4K03 A;  1TNY A;  3DPY A;  4BX8 A;  5HS0 A;  5JHA A;  4XE0 A;  1OWN A;  5FZR A;  3EHM A;  2NXP A;  4A55 A;  5AAR A;  4DI4 A;  2J09 A;  3R9A B;  5JJ6 A;  4CGV A;  1HFA A;  1U2V G;  2XCB A;  3S7F A;  4FC8 A;  1SA5 A;  4HS2 A;  1IQU A;  4QQI A;  1BPO A;  1NA3 A;  4XEI G;  2RG8 A;  1UOH A;  1X5B A;  5A7D B;  2OCC E;  4UI9 J;  1FPP A;  3CVQ A;  4GTT A;  1A17 A;  3FEX A;  1OWM A;  4M7C A;  5AQB A;  3LEW A;  2ZGD A;  2Y4T A;  1ZB1 A;  1MZC A;  1OCZ E;  1IKN D;  4LNG A;  4LUN U;  2WXQ A;  3T8M A;  3NBN B;  5JJT A;  3HXB A;  4G11 A;  4KZC A;  2F37 A;  4BTB A;  5LFA A;  4KT6 B;  4DX6 D;  4IUL A;  2H6G A;  3IXE A;  2NSZ A;  4DPR A;  3FTZ A;  4G8K A;  2A5E A;  4O60 A;  1EYH A;  4CDM A;  1PY1 A;  5C2Y A;  3BQO A;  4AJW A;  4NUR A;  4BT9 A;  2LXM A;  2XQ0 A;  4AP2 A;  2GRP B;  3DRA A;  3PNT B;  3FH7 A;  1OXJ A;  2R59 A;  1D9S A;  3MV3 B;  3ABM E;  4ABN A;  5ANL A;  5FQ7 A;  5C1D A;  5BNW A;  3ULY A;  3CR3 A;  5HKP A;  4A1S A;  3APF A;  3S7J A;  3UKR G;  3PH0 C;  3CEQ A;  4JHJ A;  3FTY A;  3HRA A;  4BWR A;  2WXL A;  2I6H A;  4XI0 A;  4J8Y A;  3OTN A;  3Q49 B;  3FU0 A;  5EYP F;  3FUL A;  3DSU A;  2XEE A;  2LXL A;  2FO1 E;  3CVU A;  4BTA A;  2RKK A;  4XX5 A;  1BU9 A;  4IRU A;  2IOS A;  2H6I A;  2Q7F A;  4GCO A;  1E8Y A;  1HH8 A;  3CHQ A;  3KAE A;  4U7E B;  5BXO A;  3DXK G;  3FUD A;  1KLX A;  3EIJ A;  3ISM C;  2E2E A;  2MHK A;  4YDO A;  1ZU2 A;  5KNG A;  5EDS A;  3PE4 A;  2WXM A;  1X81 A;  4PS3 A;  3L54 A;  4U04 A;  2P2C P;  3BG1 B;  3L82 A;  5M72 A;  3Q9U C;  3NZS A;  4A3T A;  5J90 A;  1WG0 A;  2R5S A;  4GYW A;  3FWV A;  1HU3 A;  2J8S D;  2V5F A;  3CHM A;  5EN5 D;  2HR2 A;  2XCC A;  2I9C A;  4BEP A;  2XEV A;  3V2X A;  4BSZ B;  3UIO C;  2ION A;  2KCL A;  4HNA D;  4HBD A;  1N4P A;  3CIA A;  4AVX A;  2V5Q C;  3O48 A;  4U8H A;  4ZFH A;  4AY5 A;  1WM5 A;  1UJJ A;  4HVB A;  2FBN A;  4GPM A;  3LDZ A;  4FJY A;  2QC9 A;  3UIP C;  1SA4 A;  3MX3 A;  3TWX A;  5FIO A;  1H19 A;  2IOL A;  4DLO A;  3LJ3 A;  3VLE A;  1VDY A;  2XEN A;  4BX9 A;  3KSQ A;  2RD0 A;  2PL2 A;  2NC9 A;  4JHK A;  1AP7 A;  5FWQ A;  3V31 A;  2FEZ A;  1JWG A;  5CEA A;  1ELW A;  3DSW A;  4GMJ A;  3UM0 A;  5JMN D;  4RG6 A;  3DEO A;  3CVN A;  3ZVV A;  3EDT B;  1A5E A;  3AS4 A;  4F1P A;  2BKG A;  3VTX A;  1SZA A;  1SVX A;  3UI2 A;  2ETC A;  4JA9 A;  4GA1 A;  1TYQ G;  1DCE A;  5ENT D;  3CGH A;  1KZP A;  3IHY A;  4UWG A;  2UY1 A;  2Y0B G;  1Y8M A;  3CSF A;  4TRQ A;  3K9I A;  2DYR E;  1HF8 A;  4DK5 A;  3PZ2 A;  1K8K G;  2V0P A;  5BV0 A;  3HVE B;  3SNX A;  3AU4 A;  3UT8 A;  3SGH A;  3CK7 A;  1HE8 A;  3EU5 A;  3AS5 A;  4B8A A;  3OXG A;  4NQ0 A;  5FZS A;  4B89 A;  4UUC A;  4JEU A;  1UN8 A;  4XKC A;  3PZ3 A;  3LY7 A;  2PNN A;  4OAU C;  1NP7 A;  4A1G A;  2LNI A;  3ASH A;  3FUK A;  3R7R A;  4GZ6 A;  4I43 A;  3D9J A;  4H7Y A;  4RLY A;  5JJ7 A;  2I1J A;  2IO2 C;  4PS8 A;  1O1T A;  3ZFW A;  3ZNG A;  3F6Q A;  4LNB A;  3QAR A;  5EIL A;  4JW1 A;  3ZHE B;  3LS8 A;  5KWD A;  4HI8 A;  3TWU A;  3EHR A;  3URZ A;  4J8S A;  4I2W A;  3W9G A;  4MRU A;  5AQ9 A;  5G55 A;  2IY0 C;  3ZW3 A;  3GZS A;  1TEZ A;  3EHN A;  3D9K A;  5BXU A;  3RIB A;  2AJA A;  3U4T A;  4G2V A;  3NOC D;  1N4Q A;  4GTS A;  3IKO B;  4GTQ A;  1N0Q A;  4U07 A;  2L0T B;  3SZ7 A;  1N95 A;  3FTU A;  4I1O B;  3U66 A;  3TXN A;  4KBQ A;  1E7U A;  4LER A;  1H6K A;  4HOR A;  4GTV A;  4UWH A;  2WQH A;  4RVB A;  3CHP A;  3BG0 B;  4FP7 A;  4HLE A;  5CER B;  3UT7 A;  3B13 A;  3VLF A;  2ZIR A;  3CVW A;  5D0O D;  3G2S A;  2J4B A;  1UN9 A;  4WND A;  1N11 A;  5CCM A;  3ZKJ A;  3WG7 E;  2EIN E;  4UQX A;  4I9C A;  4A63 B;  3UUX A;  3BU8 A;  3MCX A;  2WQ6 A;  5AAO A;  5BUZ A;  4RSY A;  4P29 A;  4HOU A;  4Z68 A;  4JB8 P;  4UWK A;  3O4Z A;  1S70 B;  2GW1 A;  3NZU A;  3L17 A;  1HXI A;  3KEA A;  1EPU A;  4U95 D;  4U0Z A;  2LSU A;  1GW6 A;  3V2O A;  3EUV A;  4DRX E;  2X6H A;  5D2M C;  3ZN3 A;  4L7T A;  3CKB A;  3UM2 A;  3ESK A;  3SI5 A;  3QC1 A;  1OCC E;  2KAT A;  4YDE A;  4L1B A;  3B95 A;  5EIB E;  3ML9 A;  5G04 J;  2PM6 A;  4GAA A;  3TG5 A;  3DPD A;  3OXL A;  3G2T A;  1G3N B;  2L0I A;  1V54 E;  5IY5 E;  2J4D A;  3MEK A;  3E37 A;  2RFA A;  4U96 D;  1QNF A;  3FUH A;  3QAQ A;  1TJF A;  3NQP A;  2UY1 B;  3C3Q A;  4I6E A;  1TNO A;  3ASF A;  4C9B B;  4GTR A;  3J5Q B;  5ENN A;  2WMN A;  3CK8 A;  3ULQ A;  2YHC A;  1RW2 A;  3FEY A;  4KMO A;  1UJK A;  4OYS A;  3QOU A;  3QWP A;  2HYZ A;  3FUN A;  2XS8 A;  1S0P A;  2MOW A;  4APF A;  3CVV A;  1HG5 A;  3PZ4 A;  3FFL A;  3R9M A;  4I9E A;  4BER A;  3HDX A;  2IF4 A;  1JCS A;  2IJG X;  5JHB A;  3AG4 E;  4FA6 A;  2AXU A;  4WAF A;  4HB5 A;  2V8S E;  1MQS A;  3JQ0 A;  3OXF A;  3SFZ A;  2DVW A;  3JYS A;  5T8I A;  4M3O A;  4JPS A;  1K1A A;  3CVL A;  1Q2Z A;  4I17 A;  4C0M A;  2FF4 A;  3U3W A;  3APC A;  3MGB A;  3L22 A;  4HRL A;  4N3C A;  4WNG A;  4PS7 A;  4BET A;  3ENE A;  3Q78 A;  2R02 A;  1K1B A;  2MRI A;  2JAB A;  4AEZ C;  3ZUV B;  5G05 C;  2X38 A;  3SBT B;  3P2B A;  1Y6I A;  3UMV A;  2F8X K;  1QQE A;  2V4H C;  4CYM D;  4B0Z A;  1KT0 A;  3PNL B;  2OEV A;  5ANR A;  2IO3 C;  4EHM A;  3FH8 A;  4PUC A;  5ITZ F;  1HS6 A;  4U8Y D;  4W9R A;  1WAO 1;  3PDN A;  3BEE A;  4JEH A;  3KEZ A;  4DX2 A;  1ELK A;  4UQY A;  4J6I A;  4EZL A;  4DUI A;  2VTB B;  5BV1 A;  1TN8 A;  3QDN A;  4JA7 A;  1EDU A;  2P9S G;  3CK9 A;  4RQI A;  3B7S A;  4LNU D;  3DSX A;  2P9U G;  3QKY A;  2WXG A;  3D9N A;  3S7B A;  1FVH A;  3FUM A;  3ASD A;  4FU3 A;  4TUM A;  4AIF A;  5FJY A;  2VGX B;  2WQ7 A;  2PZI A;  5CED B;  2OOE A;  2QYU A;  1AWC B;  3D9M A;  3N71 A;  5KJL A;  3CHR A;  3B7U X;  1HO8 A;  5AIJ A;  2XGO A;  1SZ9 A;  4LEU A;  3DWL G;  3IV0 A;  5ENS D;  1BI7 B;  2YNQ A;  2VQ2 A;  3L9T A;  1QYM A;  3DSS A;  2XPY A;  1E8W A;  2KCV A;  2GRO B;  3E32 A;  5EX0 A; 
#chains in the Genus database with same CATH homology
 5AYW D;  1YA0 A;  4I1M A;  2VSO E;  3L13 A;  1B89 A;  3CSF A;  4TRQ A;  2IQC A;  3K9I A;  3TXM A;  1HF8 A;  2LAI A;  4DK5 A;  3NF1 A;  3G2U A;  3U64 A;  4G24 A;  3CKC A;  3GW4 A;  2V0P A;  1QZ2 A;  4APO A;  2X6K A;  4GYO A;  5BV0 A;  3HVE B;  1N52 A;  2OV8 A;  3FU5 A;  3SNX A;  4CRW A;  3LPZ A;  3L16 A;  3D9L A;  2X3M A;  3AU4 A;  3LY9 A;  3UT8 A;  4KVM A;  3CQG B;  2X6F A;  3CK7 A;  3SGH A;  4EQF A;  1HE8 A;  2VSY A;  3PUK A;  4KXK B;  5FQ6 A;  3HYM B;  1UW4 B;  3AS5 A;  3CVX A;  4B8A A;  4AY6 A;  3OXG A;  1OWO A;  4LRZ A;  4B8C B;  4JHR A;  3APD A;  3FH5 A;  2J9Q A;  4NQ0 A;  2P58 C;  5FZS A;  2LO6 A;  4F7A A;  2CHZ A;  1ZBP A;  4B89 A;  4FHJ A;  1UN8 A;  4JEU A;  4XKC A;  4LCT A;  4FAD A;  3FUI A;  3LVR E;  3LY7 A;  3AU5 A;  1W3B A;  2DBA A;  4GA0 A;  5FT9 A;  5HQ8 A;  2X6I A;  3GYZ A;  4F1S A;  1NP7 A;  4A1G A;  2WXP A;  2XGS A;  2LNI A;  4CEM A;  3ASH A;  3FUK A;  3R7R A;  4J0U A;  3Q47 B;  4GZ6 A;  1H2U A;  4I43 A;  3Q5M A;  4GPK A;  5HI7 A;  3D9J A;  2OND A;  1FVF A;  2C2L A;  4H7Y A;  3TJP A;  3UT4 A;  2GRL A;  5JJ7 A;  3RRM B;  5G2N A;  2YHE A;  2I1J A;  5LOZ A;  3I3N A;  4PS8 A;  2J07 A;  4YVQ C;  3ZFW A;  4ANV A;  5LP0 A;  3ZIM A;  5CMY A;  4C0E A;  2BTD A;  1E8X A;  3QAR A;  4XZ4 A;  4JW1 A;  3ZHE B;  4I6J A;  5KCM A;  1E7V A;  3SBS A;  3PRZ A;  3D9O A;  3LS8 A;  1NZN A;  4G25 A;  4AXH A;  5LCW C;  3PZD A;  3HIZ A;  3TG4 A;  4GCN A;  2VSX E;  4WWN A;  1NA0 A;  3G2V A;  3MKR A;  5CHE E;  3URZ A;  4J8S A;  4I2W A;  5LX8 A;  3U9W A;  3DBS A;  1XNF A;  4MRU A;  2WM9 A;  4GU5 A;  2J08 A;  4RG9 A;  2C0L A;  5G55 A;  2VGY A;  3ZW3 A;  3GZS A;  3ML8 A;  3ZYK A;  4MKT A;  2CHW A;  1TEZ A;  1U3D A;  2GRM A;  2X6J A;  2WXN A;  3EHN A;  3JCK C;  4KZ0 A;  4NRH B;  2KC7 A;  3D9K A;  4N2S A;  3ASG A;  4MS6 A;  3IHV A;  3OAW A;  3RIB A;  4ANU A;  2QY7 A;  1HX8 A;  4NAC A;  3RK6 A;  2FO7 A;  3U4T A;  1KT1 A;  2OVB A;  1MHQ A;  2XHE A;  4G2V A;  4N3A A;  1HZ4 A;  4Q94 A;  4UWF A;  3E4B A;  3ONK A;  3IEG A;  4AV7 A;  4WNE A;  1E8Z A;  4K03 A;  4ACL A;  4GYY A;  4CDR A;  4EBA G;  4O6F A;  3IKO B;  4U07 A;  3MJW A;  4N3B A;  3Q4A B;  4BX8 A;  2L0T B;  3SZ7 A;  2WXI A;  3Q15 A;  3MA5 A;  4I1A A;  1IHG A;  5JHA A;  4XE0 A;  3FTU A;  1OWN A;  3IBE A;  3ZEF A;  4I1O B;  2CFU A;  3U66 A;  5FZR A;  1IYG A;  3EHM A;  5ARG A;  3TXN A;  2NXP A;  4A55 A;  3SHF A;  3LY8 A;  2JEK A;  3QB2 A;  4KBQ A;  5A23 A;  3QWW A;  4GZD A;  1E7U A;  4K0R A;  2PM7 A;  4LER A;  3RKV A;  1PAQ A;  3HVE A;  1DNP A;  1H6K A;  1L5J A;  3FU3 A;  4DI4 A;  2J09 A;  4GML A;  3R9A B;  5JJ6 A;  4JC8 A;  4BSX A;  4HOR A;  4CGV A;  1HFA A;  4UWH A;  2XCB A;  3LYA A;  3CST A;  3S7F A;  5AJD A;  4FC8 A;  4ATG A;  3EJN A;  4ME2 A;  2WQH A;  2V4L A;  3CHP A;  4HS2 A;  4RVB A;  4AOF A;  2XRZ A;  3BG0 B;  1IQU A;  4FP7 A;  4Y6C A;  4HLE A;  4EEC A;  3FUJ A;  3LKU A;  2IFU A;  3ZRH A;  1JUQ A;  3UT7 A;  3FP3 A;  3B13 A;  3VLF A;  3KD7 A;  4A3V A;  4FLB A;  1BPO A;  5D0O D;  4DJA A;  3G2S A;  4JVS A;  2J4B A;  3QK0 A;  1NA3 A;  3CVW A;  1UN9 A;  4WND A;  3SD5 A;  4G26 A;  2RG8 A;  3FTW A;  4E6H A;  4OVU A;  1X5B A;  4EZK A;  5KJK A;  3WXX A;  2AW6 A;  5A7D B;  5CCM A;  4N2Q A;  2DCP A;  4DLQ A;  4UI9 J;  3CVQ A;  1A17 A;  3FEX A;  1E90 A;  1U3C A;  1H2V C;  2WXJ A;  3FTV A;  3L08 A;  4CT0 A;  4BY6 A;  1OWM A;  1XGW A;  3CVP A;  2WXH A;  2PQN A;  3CHS A;  4I9C A;  4UQX A;  3VTY A;  4ANW A;  3UUX A;  3B7T A;  4U63 A;  3LEW A;  4L23 A;  3I4R B;  4PH4 B;  3MCX A;  4WNF A;  2WQ6 A;  5BUZ A;  3RO3 A;  2GGF A;  4RSY A;  2KZT B;  2L9B A;  2LSV A;  4HOT A;  4R7L A;  4G23 A;  3ONL A;  3GZ2 A;  4P29 A;  5LCW J;  4HOU A;  5FTP A;  4L2Y A;  2KZT A;  3S7D A;  4UWK A;  4D10 C;  2Y4T A;  3O4Z A;  2A4Z A;  3ZGQ A;  1JPL A;  3MKQ B;  2GW1 A;  3TAX A;  1N54 A;  3NZU A;  3L17 A;  2XPI A;  4LUN U;  5KJM A;  3ZYQ A;  1HXI A;  2KM4 A;  2WXQ A;  5G05 J;  1FCH A;  3T8M A;  2VTB A;  1EPU A;  1EF1 C;  2JLB A;  3S2A A;  4ACK A;  4KZC A;  4G11 A;  4BT8 A;  4CCA A;  5JJT A;  4U0Z A;  3JQ1 A;  2LSU A;  1GW6 A;  4I2Z A;  4IUL A;  4KT6 B;  4BTB A;  4BFR A;  5LFA A;  2X6H A;  3ZYM A;  2NSZ A;  3QJZ A;  3ZN3 A;  2BF0 X;  3FTZ A;  4DPR A;  4L7T A;  3CKB A;  5E76 A;  4XI9 A;  3ESK A;  5D0Q D;  3SI5 A;  2AXV A;  3QC1 A;  3CLJ A;  3I4G A;  5CMW A;  2KAT A;  4JXT A;  4ILG A;  3TL5 A;  4L1B A;  1EYH A;  4CDM A;  1Z3X A;  3ML9 A;  1PY1 A;  5G04 J;  3CVY A;  5C2Y A;  1OWL A;  4AJW A;  2C0M A;  2PM6 A;  4GAA A;  4NUR A;  2VGX A;  3TG5 A;  3DPD A;  4BT9 A;  4PDX A;  3OXL A;  2XQ0 A;  4AP2 A;  3G2T A;  4ILI A;  2L0I A;  4F3V A;  4TV3 A;  2OVF A;  3PNT B;  3MZL B;  3FH7 A;  2VJ8 A;  4CT4 A;  2ZU6 B;  2R59 A;  2J4D A;  3MEK A;  2WMO A;  4FLH A;  1JWF A;  3FUE A;  3MV3 B;  1OUV A;  4ABN A;  5ANL A;  5FQ7 A;  5C1D A;  2AVP A;  5BNW A;  4IYP A;  2FI7 A;  2XRY A;  4UI9 K;  3CR3 A;  3PUJ A;  4A1S A;  3APF A;  3S7J A;  1QNF A;  3FUH A;  3PH0 C;  2I2O A;  3QAQ A;  1TJF A;  3NQP A;  3CEQ A;  2UY1 B;  4JHJ A;  2LAH A;  4I6E A;  2CFZ A;  4FUL A;  3ASF A;  3FTS A;  1H0A A;  3D9P A;  3FTY A;  1E96 B;  3ZHE A;  4C9B B;  2Y4U A;  3MYV A;  4J8F A;  4BWR A;  2M63 A;  2WXL A;  4UI9 C;  5BT1 A;  1INZ A;  3I5P A;  2I6H A;  5ENN A;  4XI0 A;  4I6G A;  4N5C A;  3OTN A;  4FJZ A;  2WMN A;  2AXZ A;  3CK8 A;  3ULQ A;  3FY4 A;  3Q49 B;  3ZXS A;  3RO2 A;  2YHC A;  5J08 A;  4KYO B;  3PEV B;  2HO1 A;  2R17 C;  3FU0 A;  3FEY A;  4HXI A;  4KMO A;  1UJK A;  4OYS A;  5DBK A;  5FZQ A;  2FUL A;  3FUL A;  4GZ5 A;  3TGO A;  3B7R L;  3D9I A;  4J8D A;  3RU0 A;  3QOU A;  3QWP A;  2HYZ A;  3D3M A;  4XIF A;  3LCA A;  4Q69 A;  4ANX A;  3CQC B;  3FUN A;  1IQR A;  4GZ3 A;  4F53 A;  1S0P A;  2MOW A;  3LXU X;  2WXK A;  3KS2 A;  3CVU A;  4Q96 A;  4BTA A;  4XX5 A;  3MV2 B;  2XPZ A;  5CCL A;  3UPV A;  4IRU A;  2IOS A;  4APF A;  3CVV A;  1HG5 A;  3EIQ C;  2Q7F A;  3FFL A;  2EQX A;  4GCO A;  3ZPJ A;  1UG3 A;  2YIN A;  1E8Y A;  4I9E A;  1HG2 A;  1HH8 A;  3FU6 A;  3CHQ A;  3KAE A;  1DVP A;  4N39 A;  5T3R A;  3HDX A;  2IF4 A;  4J8E A;  3FDH A;  3FUD A;  1KLX A;  2IJG X;  3EIJ A;  2CHX A;  3LVQ E;  5JHB A;  2E2E A;  2MHK A;  3PEU B;  4FA6 A;  5EDS A;  1ZU2 A;  2AXU A;  2WXO A;  3PE4 A;  2WXM A;  4WAF A;  2UWJ G;  2A5U A;  1MQS A;  2V8S E;  3JQ0 A;  4PS3 A;  4WUY A;  3L54 A;  4U04 A;  3OXF A;  4XKB A;  3SFZ A;  3JYS A;  3BG1 B;  5T8I A;  3QWV A;  4M3O A;  1SQM A;  4JPS A;  5M72 A;  3CVL A;  4I17 A;  3NZS A;  4C0M A;  4A3T A;  2FF4 A;  3PE3 A;  4JL0 A;  3APC A;  5DIZ A;  5J90 A;  3U3W A;  2R5S A;  3CV0 A;  3MGB A;  3FWV A;  4GYW A;  3AS8 A;  5G04 C;  3GZ1 A;  3RRN B;  4GZC A;  1HU3 A;  2KCK A;  3L22 A;  4N3C A;  2YQ8 A;  2V5F A;  3CHM A;  3PVL A;  2J49 A;  2HR2 A;  4MLP A;  3ESL A;  4PS7 A;  4UWL A;  4WNG A;  2L6J A;  2IU1 A;  3JUI A;  4HOQ A;  1WY6 A;  2XCC A;  2I9C A;  3R7Q A;  3SF4 A;  4DI3 A;  4CDN A;  4OVV A;  2XEV A;  3ENE A;  4E85 A;  3FTX A;  4U0S A;  1Z6T A;  3RRU A;  2HM8 A;  2QFC A;  2ION A;  2KCL A;  3FUF A;  2WXR A;  4FHK A;  3CIA A;  4HFG A;  2MRI A;  4AVX A;  3HHM A;  1Z3Y A;  4AEZ C;  3ZYL A;  5G05 C;  2VSN A;  3T5X A;  2X38 A;  3SBT B;  3O48 A;  4U8H A;  4IN3 B;  3P2B A;  1Y6I A;  3UQ3 A;  3UMV A;  4TUU A;  4H7X A;  5KJN A;  3RJV A;  4AY5 A;  3VLD A;  4WWP A;  4HOS A;  1WM5 A;  1UJJ A;  1QQE A;  4HVB A;  2XGM A;  2FBN A;  4B0Z A;  1KT0 A;  2CG2 A;  1P5Q A;  3PNL B;  5ANR A;  4YVO A;  2I1K A;  4EPZ A;  4GA2 A;  5EKQ D;  4WWO A;  3LDZ A;  3FH8 A;  4FJY A;  4PUC A;  1HS6 A;  3MKQ A;  5ARF A;  3PRE A;  4W9R A;  1WAO 1;  3PDN A;  3BEE A;  3MX3 A;  4JEH A;  3KEZ A;  2CG3 A;  1ELK A;  1H19 A;  4UQY A;  4J6I A;  2IOL A;  4EZL A;  4DLO A;  3LJ3 A;  3VLE A;  2VTB B;  1VDY A;  5BV1 A;  4URK A;  4BX9 A;  3QDN A;  4JA7 A;  3UX4 A;  1EDU A;  3C98 A;  3CK9 A;  2RD0 A;  3B7S A;  4GB9 A;  2PL2 A;  2NC9 A;  4JHK A;  4JZY A;  3PS6 A;  5FWQ A;  2AWI A;  5FQ4 A;  5AEN A;  1TJC A;  4YND A;  4CGW A;  3QKY A;  2ILR A;  2WXG A;  3D9N A;  2FEZ A;  5BPP A;  2WB2 A;  3S7B A;  1JWG A;  1FVH A;  1ELW A;  3FUM A;  3ASD A;  4EBA A;  1LF8 A;  4FU3 A;  4GMJ A;  4EZJ A;  2WPV A;  4UQZ A;  4AIF A;  4ILH B;  4Y6W A;  4RG6 A;  5FJY A;  2BUG A;  2VGX B;  3CVN A;  3G2W A;  3ZVV A;  3EDT B;  1ELR A;  2WQ7 A;  2PZI A;  2PQR A;  5T4Y A;  3FHE A;  5A6C A;  3QNK A;  2OOE A;  4AM9 A;  4B94 A;  3AS4 A;  3D9M A;  3VTX A;  2E0I A;  1SZA A;  3N71 A;  2Y3A A;  5KJL A;  3CHR A;  5EX3 A;  1PC2 A;  3B7U X;  1HO8 A;  2VYI A;  2DIW A;  4G1T A;  5AIJ A;  2XGO A;  4V3I A;  2WVI A;  1SZ9 A;  4LEU A;  3IV0 A;  3T5V A;  5BW8 C;  5FQ8 A;  1OWP A;  2YNQ A;  4JA9 A;  4L2L A;  4GA1 A;  1H2T C;  2VQ2 A;  4QFV A;  4U0U A;  3CGH A;  2XPY A;  5AJL A;  3P1U A;  1E8W A;  3IHY A;  2KCV A;  4UWG A;  2UY1 A;  4KVO A;  2WXF A;  3L6A A;  3CHO A;  5E75 A;  5EX0 A;  1Y8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...