3RRQA

Crystal structure of the extracellular domain of human pd-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
108
Chain Sequence
NPPTFSPALLVVTEGDNATFTCSFSNTSSFVLNWYRMSPSNQTDKLAAFPECRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKLQIKESLRAELRVTERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Crystal structure of the extracellular domain of human PD-1
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 108
sequence length 117
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rrqA00
1JP5A 5B39G 4OSUL 43CAB 3LPWA 4OCRL 3ZT5A 3O4OC 1MIEL 5ALCH 1YEDB 2BFVH 3D0LA 3IRPX 5E6ZA 5IFHL 2X9YA 1XMWA 3HRZB 5DGQA 4U0RB 1MRCH 4FZ8H 1P7KB 4X7SH 4X83A 4NM4L 2MPAH 1FFPB 2D0FA 1YNLL 1L9MA 1T04A 2UZIH 1G7HA 2BNUA 4FQXA 4BZ2L 3SDYL 5EN2A 3FQUA 4DWHA 4TSAL 4Q9CA 3OKMA 3BPCB 5CSZA 5D7IE 2VNCA 3QHZH 3I50L 3B9DA 4UQ3B 5C0JB 1KT2A 4NRXB 3RWHB 3QPQC 4XX1E 5FGBA 5LG1A 2Z0BA 1EV2E 4K94L 4N9GA 1K5NA 4LVEA 2VXSH 1JYNA 2OP4L 5EC2A 4PUBL 4JJ5A 2R1WA 3O0RH 4DGIH 1WCBA 5IK3B 1YEGH 4MNHB 4G7YH 4LMQI 1JTOA 3NMEA 4XNQA 1N0XH 2BCKB 1Q38A 5B22A 2A9NL 4GQ9H 5JXED 3CSBA 1QO3B 5FHAH 2WUBH 1QG3A 5IM7B 5IFAH 1PG7W 1YN7B 1MH5B 2QQKL 3TWCH 4EN3C 2OS7A 2AV1B 1CQYA 3UTZB 1NGYB 1XF5A 3LQZB 1DLFL 5DJ0A 2HKFL 5E5MB 3V5DA 1MJ8H 4PG9A 1UCTA 3MNZA 2C9AA 4K3GA 4XPFL 4XXCC 4OZIE 1D5MB 5H37G 4EI6A 2Y06L 3C5ZB 2R29L 1ED3B 3OKEB 1JIBA 2X70B 3PWLB 3JSSA 3EOBB 2ZSVB 1UVQA 1KNOB 4OM0L 3MJ9L 1GIGL 2Y25A 4CW1B 4Z0XB 4J3UA 4HS6A 4UZGA 2NX5D 4OD3H 1SYSB 4WVRA 3L5WA 1WFTA 3AC0A 4YLQT 1TXKA 1RHFA 4AENA 3U2SB 4DGVH 2HP4A 1AD9B 3QISA 4I3GA 4O58H 5K9OA 1VHPA 1QPPA 2F54E 3OMZA 2L0DA 3IDNB 3DMMB 2EYSB 4XCYA 3OJ2C 4P3DA 4KTEL 3LKQB 1XGTA 2V2WA 4CVXA 5DUMH 1HINL 2IBBA 3FB7B 3MUHL 4BK5A 5ABDE 1T1ZA 2DQIH 3QEUB 2YXMA 4Z7VA 3FT4B 5A43C 4OCXL 4YHLH 1YEFH 1NLDL 5H94B 4KKAC 2IH3A 1SBSH 5BV7L 4I4WA 2WLZA 1D6VL 1T22A 2DTML 4H26A 4OFIA 4Z7UA 5DRWA 3I75A 5GGRB 5EFIB 3U79A 3QIWD 5T3ZD 3VA2C 1GPOL 3QQ3B 3BWAA 3BFOA 2VO5A 1S7VB 3QCTH 1S7WA 3EOTH 4KK6D 3IFPA 4WW1A 4PRHB 4ZNCD 4WJ5A 3ARQA 2ARJA 5F7FA 1NCUA 5I1HL 5IB5B 1QVOB 4OF3A 2A6KB 2BVQB 3TV3H 4Q9RH 2EXWC 1I8MB 3CD4A 3VXRA 1YEIL 3KLAB 4LCYA 3OX8A 4C54A 4POYA 1S9XA 3R8BB 2DRUA 5KVEH 3WNOA 5J0BA 4YE4H 2WIIA 4MVBC 5D2LE 1XR9A 4Y19E 5F72S 4KJWD 4U1NA 3TLRA 3FQWA 3L3JA 1MVUB 4K23H 1G9MH 3WS6A 5IW1B 1BZ9B 2OCFD 2EDBA 3K80A 3S5LB 5JMOC 2H6PB 2YOCA 3PGFL 2AXGA 1KB5B 3O4LE 4KC3B 4MWFB 4DW2L 3SN6N 4BFEA 3P4NB 4FQQB 1E6OH 2APWA 5MEPB 3SPVA 3PDGA 4UT9L 4NKOB 1VEOA 2F9BT 3RUGF 3EO9L 4AY0A 1VFAB 1FFNA 4PJXF 1CLZH 3STZB 3B9VA 5ERWB 1I8LA 4UB0L 3QEHA 1CK0L 4HUXB 3WN5A 1GVIA 4S1QH 3IKKA 4QHMA 1FVCA 4W4OA 5JHLL 4X5XB 4AYFA 4OLXH 3X13A 2V17L 1RJYB 1WC7A 2ADJB 2V5RA 3PP4L 4GUPA 4KFZC 4C58B 3PWVB 4Z7WF 1YEHH 3QO1B 4ZNEE 3RZCD 3NCJL 5IVXF 4JCMA 4OZ4A 4FOMA 3GB7B 3WIHH 3OKYA 1KIRB 1U8PB 3MBEA 1DN2A 1MCHA 4YXHH 1N6QH 3V4PH 3HS0A 5HDLA 2AJXL 3LOWA 4JFZL 1UM6L 1URLA 2GJ6E 1EEQA 5EIVA 3OF6A 1IBGH 1NDMA 4NHUB 4OUOA 1X5LA 43CAA 2J88L 5FKPB 4KK6C 4WHTB 4JPKL 1C16B 4M93C 3RAJL 1JN6A 1KTKE 2JCCE 3OGCA 3HRZA 4I18A 4JFFE 4ODUA 3S4SB 2ZUSA 3SDAC 3QUYB 4HUVB 3ARDD 1TJHH 4M1DH 3TNMB 1OAUH 3L9RB 4NOFA 5J4MA 4E0RA 5F7EL 2DI8A 3ARTA 2RQ8A 4PRAB 3NCYP 1CFVH 1EEZA 3O3EA 1MFEL 4YC2B 4EZMA 2I26N 2CK2A 4XVSH 1T0MA 2VE6A 3OBAA 2G60L 1MJ7H 5C0JA 1G7MA 4I48A 4NRXA 5FF6B 3TFKD 1JV5A 3TBVB 2XWJB 5C0AD 4E42B 3CLEL 3I6KB 3BDYL 4R90L 2X4UA 1QLEH 5AG8A 4YO0A 5C2UB 2UZXB 2W65A 3BZ4B 5IK3A 2HFEA 5HI4D 4HG4K 5I16B 4OZGB 1AGCB 1E6JL 3CLFH 3W81A 4UAOB 2XZQH 3F65A 3TJHD 2EH8L 3QA3A 4JKPH 4O5LH 3RI5F 5IEHB 1A47A 3RIFK 3RWGB 3T4AA 4HPYL 5IM7A 3IKCB 5F7DA 3GI8H 4UT6H 2AV1A 4QLRA 3VCLA 1NGYA 3LQZA 5HD8D 5DA0B 1JHLL 4KUCD 2R23A 3NCEB 3ZHDA 1N8ZA 4Z95H 2VDKH 2W9EH 3N1PC 4JVUA 1VFOA 4B0MM 5HGBB 2H2SD 1RIUL 5E9DD 3O9WB 3H3KA 4HFWB 1D5MA 3RZWA 2W92A 3C5ZA 4QXGH 1ED3A 5HVHC 3PWLA 3VW3L 2ZSVA 3MLRL 2VQTA 1KNOA 3MFGB 3DVFA 2BXYA 5KTEL 1WZLA 5F21B 4CW1A 1XEDA 1I3GL 5J11C 1J88A 1NFDF 3U30B 4R0LB 3TN0D 4KJQD 4IHOB 4Z7WE 5T3XH 1CXHA 4LSUH 5EOTB 4JR9H 1KENH 4TUJB 5C0IB 1YC8A 1NGZB 2HJLB 3DMMA 2EYSA 5DUPH 3BRDA 2AJSH 4XB7A 3KPRE 1R0AL 1KEGL 3BPLB 3LPGA 3X14B 3PHQA 3VWJB 2JJVA 5C92A 5MEOB 3FB7A 5E7FA 2D3VA 3KLDA 3HC4H 3DUUB 4GJTB 4HLZG 3QCUH 3VFUB 4DFIA 1NJ9A 4OUUB 2Q1EA 2DB8A 2VLJD 5H94A 4UNUA 3S96B 7FABL 3GSUB 3N9GH 4YHOL 1CGTA 1ZANL 3GSNB 5E7BA 4S1RL 3QFJB 3S35X 3FN0L 4HS3A 5EFIA 3HLAB 3RL1A 3L6FB 3EDFA 3JWDL 3IFLL 3RKDD 3LEVH 3OAUL 3QQ3A 3TJHC 5IWLA 4YHPB 2JIXB 5F8QC 2J8UB 4W68A 4NZDA 3TA3B 1MCOL 4YDVA 4DN4L 4FQXD 5KW9L 3ZLQC 3NIFE 1SM3L 3UTTB 4XNXL 5DRZA 5IB5A 1ULVA 5SWSB 4ZDHB 3E8UH 5F9OH 1I8MA 4RGMB 4TVPE 2G5BB 3KLAA 3GSVB 4LCWA 4AMKH 5FO9B 2IMNA 2E7CA 4O2FA 2H2SC 1O7VA 4KDVA 5CSBA 2FBJL 4EDWH 3LD8C 5HHOB 3LN4B 4X7FC 2JB6A 4JFEB 1TVDA 2FD6H 1SYVA 2AJVL 1QBML 2J5LB 3WDIA 1MVUA 2D9QB 4HSQA 1XGPB 5EUOB 1J8HD 2Q86B 5IW1A 3QHTC 4WI9A 4Q9QH 1BZ9A 1AI1H 5CJ8A 3DVGB 2APBA 3TN0C 4KJQC 1H3TA 2PR4L 2H6PA 5JR1L 4UU9A 4HWBA 2H32A 3AAZB 2I9LB 4MWFA 3X17A 1A7QH 3P4NA 4FQQA 5MEPA 3U0PB 4NKOA 4X99B 4W4NA 4HQQL 3QIBB 5F1NA 1LNUB 3STZA 4JCLA 5J6GB 5ERWA 2PTVA 4U4BA 4HIHA 4LP4A 2ZCHH 1O7SA 4X6FB 1UKTA 3E3QC 1KJ3L 3HUJB 1FNAA 3FO9B 4NN6C 1JMZA 4G8GE 1BD2D 3PGDB 1NCAH 1RJYA 4FFYL 5IBUB 2FEEL 4KRPD 1U8OB 5FO8A 1XF4A 4PGCB 4XWGH 4RIRB 3KPQB 1QLFB 3VXMD 1K4CB 3TF7C 4C56B 4X6CB 4N8PA 4W81A 2EXYD 2W9LA 3HNTH 3PWUA 5DJCB 1DBML 2Q8BH 3RKDC 3HTLX 1U6AH 4FMKA 3UC0L 2GSGB 3QUZA 5DSCA 2MSPA 3BN3B 1P4IH 4XBGB 3WFEH 4FQXC 3RHWK 3MRFA 3ULVE 2BOCB 1WBXB 1JPSL 4IMLB 1RUQH 4OCNC 1IARB 5LCVH 5E2TH 4P0DA 4Q2ZB 2J4WL 1T2JA 2UVFA 5T5FH 4X4MA 3S88L 1MI5B 5FGBC 3L9RA 5F7HA 2AXFA 4MMZC 1UKQA 3RWFA 4OV5B 4PRAA 2L7UA 1OW0A 2XA8L 2NCMA 3D25B 1DR9A 1P6AB 1EX0A 1MUJB 4Y5YB 3U4BH 2VSCA 4YJZL 3DV4A 3SKNB 3ZL4L 2W91A 1MFAH 4G80B 2VC2L 5FF6A 4KV5F 1A2YA 4HX1A 2NY2C 3MLUH 2VDQL 3GBNL 1G9MC 3SBWA 1GZQB 3I6KA 1H3PH 5DD0H 3GJFB 3QNXB 1GGUA 3DX8B 3BZ4A 4L4TD 5SWQB 1J7VR 1UEMA 5DD6A 1NUFA 3FQNB 4XB8A 5ACMA 4OZGA 4Z18A 1HQ4A 4XMPH 1AXTL 1IAIL 1KCUH 3H9HA 4NZTH 5IEHA 4XX1G 1AY1H 3UTSB 1S9YB 3QHFL 3RWGA 2BVOB 1KJVA 1BREA 1INDH 4P3CH 4MAUL 4GG6F 4IRJB 3KGRA 5B8CB 2A77H 4H1LG 4KHTL 3IGAB 1X5HA 4MJ5B 5DJXB 3QEQD 1MIML 2EIZB 1RIHL 3RVVC 3RX5A 1TDQA 5ACZA 4X6EB 4DKFH 1T1XB 3VDBA 2DQJL 5EZOL 4GAGL 1U8MB 3HC3L 4HWBH 3O9WA 2H32H 4HFWA 4MB5A 3R06A 2IEPA 3TZVD 4M9OA 2EXYC 1U2HA 5GRWA 3MV7D 4UIKH 1M7IB 4JN1L 3CFIC 2BSSB 5E56A 4U7KA 3W11D 5D8JH 1UZ8A 4WW2C 4XNUH 3O11B 1H3XA 1Q9WA 4R0LA 3F6LA 2XRAH 4IHOA 3CDYA 3LZFL 5EOTA 4JKMA 1MHEB 4LVHB 2CLZB 3A67H 1FVDB 4TUJA 1ZS8B 1NGZA 3IAPA 5EB9A 5T3XD 2ZKHL 2ZG2A 2YUZA 4JPWH 3DROA 3CC5B 3L5IA 1R3LB 1HKLL 4H88H 4DVRH 4F8TA 3CSGA 4WV1A 3HI5H 4OIIL 5DMKB 3VWJA 3MBXL 4YFLF 3C8KB 3IU3A 2BP3A 4JHWH 3GNMH 3MBED 4QRPB 4TNVK 4U1SA 3U0WL 4P99A 2DJUA 3BAEH 3DUUA 2NY7H 3HC0B 1G6RB 1HSAA 3HB3C 2EDKA 5KAQG 3B6SB 4MQTB 3QNYB 4OUUA 1BZQK 4KZEH 1J0KA 3PXHA 3C5SB 1R3KB 1SJXA 2KDGA 4KUZH 1GH7A 3GSNA 2C4FU 4RX4D 2GW5A 4LHQB 3O45B 5FXCH 3HMWL 2FB4L 4IDJH 32C2B 2BHUA 3L7EA 3ZE2E 3ZKXC 5TDNB 4YHPA 2J8UA 3ZO0A 1FE8L 1FORL 3TA3A 2R0LL 5A1AA 2X89D 5I6XB 2KKQA 1QLRB 1UXWB 1RK1A 2Z8VC 3MRDB 1TJGL 3RIAF 4N8VA 1OF2B 2MCPH 5I1JL 4J8RB 5SWSA 1EO8L 1KJ2B 1PQZB 3TVMA 4YIQA 4PJ5A 2ZJSH 2G5BA 4HF5H 3PNWB 3GSVA 5FO9A 3WS6C 3KYAA 1RV6X 2IMMA 3K4AA 5FHBH 3GRWL 2O61B 4HUNB 2VIRA 3VD5A 5HHOA 1JPTL 4JFEA 4AEFA 2ID5A 1U58A 3TH4T 5I18L 5EUOA 2Q86A 4PJEB 5ALBH 2QEJA 3DVGA 5AG9A 3LVEA 5SX4H 3P4MA 3CX2A 1R5VB 2X42A 4WI5A 1FAIL 5DEFB 4L3CB 1BWWA 5DDHB 1I8LC 3AAZA 4JFHE 1U95B 1U8KA 3WN5C 1RZFL 3V4UH 3RVXC 4W4OC 5J6HB 4F37F 5ID1B 3L3DB 4X99A 4PJFB 1I9IH 4PRPB 1Q1JH 4L3EB 4M9PA 3F7VB 5CJXA 1F8TH 4ENED 1R24B 2I27N 4BQBA 1TVBB 3MBEC 4WWKA 2VDLL 4X6FA 5I8EB 3D5OF 3HUJA 3MV9E 2X1XR 4XWOC 3D39B 4GMSL 3C5ZD 4HMDA 1KPRB 3PGDA 5C08B 1ZV5A 1A6UH 5HYSA 1B4JL 2EDRA 1HWHB 4LPXA 4PGCA 3KG5A 4K7FA 2BNRB 2E9WA 3EJYD 2FSEA 3DTXB 2IQAB 3G6AB 2Z31A 4X6CA 4LK4A 1J87A 3RWCB 1SBBA 2KUTA 5DZOA 1MNUH 5DJCA 2UV3A 1J12A 3GMQB 4I18C 3JWOH 3BWUC 3BIKA 3WXVL 4U0RC 1H9VA 2LAGB 5F1KC 3DMMD 3TYGL 1YPZE 4P2OB 1NDGB 1IFHL 1MCBA 1P6FA 3WNPA 4X8XA 5B4MD 1WAAE 2QQLL 3PE9A 2VR5A 1OM3L 4IMLA 2DQDH 1KIPA 3BQUB 5BMFH 4F7PB 1HXYB 2GYSA 4MJIB 3JV4B 4OFKA 4AQOA 4ESKA 2OL3B 4M7JL 2Z4QA 1MI5A 3RVUD 2A2QT 4N1CA 4OV5A 4YXKL 1RZJL 1TZHB 3E0GA 3D25A 5SX4I 5DURB 1F90L 1MUJA 4HC1L 3RRQA 1DEEB 3SKNA 1Z9SA 4JEGB 4UOJA 1YEJL 5L6YL 3VFMA 4ZTPH 5EUKB 2ZZUT 5EOCL 4NZJA 1N0LA 1CXFA 1GGCL 4ZFZB 4D9QE 4FNLL 1NFIB 1GZQA 3QNXA 4MD5A 4PRHD 4KQ3L 1KN4L 1RULH 4I3SH 1SEQL 4PJGF 3FQNA 1FBIH 3EDDA 4KDWA 5CD5C 4PGZA 3RWIB 1CTNA 4ONFH 3BRFA 2VR9A 3SHSA 1A6AB 1S9YA 5I9QC 4ENEC 5IUSA 2BVOA 3PHSA 5ETUA 1MAML 2EDFA 5FGCB 4BUGA 5EU3A 4D94A 1KCVL 3MLXH 3NIGF 5B8CA 3QNZB 1JNJA 2EE9A 3V52L 5HJ3A 4YDKH 4XCFH 2Q6WB 2ITDA 4U1HA 4WRLA 2OJZL 2FHFA 2YD9A 5D7LE 5IMKB 2P5WB 3TCXA 2W1NA 1QRNB 1U8MA 3OKOB 1NLBL 4I13B 3D9AH 5JMRA 4LPTA 5EZIH 2FWOB 3VGAC 1PLGL 4Y8AA 1TQBB 1ADQL 1M7IA 2NTSP 4ZXBB 3UCRA 3I9GH 1P4LA 3DMMC 4PJDF 1AKJA 1SVZA 2HG5B 1JNHA 1T4KB 3LV3B 4JREB 3O11A 2XKSA 4GW4B 4R7NB 3N1GC 3HMXA 5I2IB 3E6HB 3QUMH 2CLZA 5DK2A 1RURH 4PS4H 3G08B 5CILH 1UWXK 1RUKL 3TO4B 3VWKA 3CC5A 1R3LA 4ZS7H 3RVUC 1MELA 2PYFA 3BVNB 1I7TA 3C8KA 5TE7L 1AP2B 4QRPA 2HT2D 2LU3A 1CR9H 3HC0A 5DJ8B 1PYWB 4HWUA 5GS2D 1DQQB 3QNYA 2GY5A 1HCVA 1NGPL 1T7YA 5CP3H 3M45A 2WINB 4MD4B 5IWLC 1R3KA 4LVNB 5TQ2L 5I75B 1DLHB 4PJBA 4QCIA 1KPVB 2G2RB 1BQUA 5JPNA 4NQCB 5DT1H 4FP8H 1Q94B 4PBWD 32C2A 2YA1A 5TDNA 3FONB 1SJHB 5FOBA 5E8PA 5BOZG 3EZ8A 5K9QI 5KVFH 3QUYD 1FDLH 3DRQB 1QLRA 4AM0A 3B9AA 3WUWG 3MRDA 4RMVA 5BRZB 4HIIB 4J8RA 5TF1L 1KJ2A 1PQZA 2XFXA 4HWEL 1EO5A 3BT2L 3F7RA 3PNWA 3GIZL 2RCSL 3NFSL 1QQDB 4HPOL 1T3FB 4JY5H 1LK2B 4GW5B 2WUCH 1U36A 1U3ZA 3EYVB 1OP3K 4AJ0A 1DTUA 3SCMA 1WEJL 3WUZA 1U42A 1VFUA 1TITA 4U1JB 4HUWB 5DLMH 4JM2B 5EZJA 3HR6A 3MMEB 3VFNA 1Z9OA 1OARH 4UUJA 4ODTL 5T5NF 5I1GH 5DEFA 4OI7A 4XVTL 2YD3A 1V7NH 4NDMA 5JO5B 1U95A 3HZMA 4K3EH 3JUZA 3TH2T 5HYJA 3P11L 1AXSB 1OGAE 5ID1A 4D0CB 4O02H 1VERA 2AV7B 5L2KA 3ZDZF 1OQOA 5DJ2B 4L3EA 1H5BB 3ZHKA 1R24A 1W0VA 5GGRY 1CVRA 3O9WD 4M5ZH 4PJDE 2V7NB 2ED8A 1ODAA 2HT2C 4Y1AB 2J6EA 4ZUVB 1KPRA 1ZGLB 4LLDB 4XP6L 2AEQL 1EMTL 3H3BC 2BVPA 2HFFB 4N0UE 2VUOA 4NP4H 2BNRA 3G5YB 1PKQE 3HMXH 3IETB 3QUZC 5T1DH 1V7MH 4U0QB 4NHCL 3MV01 3WHXB 3RWCA 2Q7NA 4LSPL 2DKUA 1WLHA 4PJ7A 5EOQH 5CJBA 3LHPL 3O6MH 4WHDA 3ARWA 4HT1L 2X1OA 5IBTH 3NVQA 3LH2H 4G3YL 4L9LB 2AQ3A 5T3ZE 3QJHB 3VWJD 1OD9A 4HXBL 3MLSL 2V6HA 1QEWB 3DHJA 5TE6L 1BFOA 3DJ9A 2P8PB 3WIFB 2BDNH 1HXYA 3BISA 2OL3A 4DTGH 3G6DH 3FFDB 5CGYD 3HZYB 2BRRL 5ADOL 2WLYA 1OAYL 3QIUB 3CFBB 3SBWC 2I9TB 4MZ3A 1NL0H 1DEEA 2R0KH 4JO4H 3QFJD 4KXZH 4NO5A 1YEKL 4QRUA 3AM8A 1QFWH 2C3HA 3MRRA 4G7VH 2CGRL 3OJVC 4KQ4H 5D5MB 2JIXD 1G0XA 1NFIA 3TA3D 5J13C 5TF0A 2VKWA 2FGWL 3PHOA 1FYTB 2CR3A 1DQLL 1C5DA 3UTTD 3TJEL 1LK3H 5SWSD 3GMPB 3H3PH 4JO1L 1FRGL 3RWIA 3GSWB 4DOHB 4KUCF 2IF7A 5D96C 1B3JA 1Q0YL 2R4RH 5ISZE 1T7XA 2FEDD 1P7QB 1UG9A 4EQ2A 5EBWB 3NCMA 3OTTA 3O9WC 3ARGB 4OCWL 3HNVH 3W82A 1QSEB 5CJOH 5JA8B 5HHOD 2EC8A 1A22B 4JFED 2DQFB 2VZTA 1EDQA 2Y6SD 3DV6B 5IMKA 1KG0B 2P5WA 4M5YL 3FZUD 5T1KB 3CDGB 2XXMB 2OSLA 3U30C 3W5MA 4MZ2A 1Z0NA 3ZDZE 8CGTA 3J8F7 2R2CA 4LMQE 4LU5H 1RSFA 1I85C 1I3VA 3IFOB 4Y5VB 2EDJA 3FQRA 3T3PF 5TDPB 1H15A 3D0VB 3MV8A 4RMQA 4NWTH 2A6IA 2HG5A 4K7PH 3JWOC 1T4KA 4JFDA 2YA2A 2Z8RA 3LV3A 4HKJB 4CVZA 4YDJA 1DQDL 1NAKL 2P4AB 4GW4A 4R7NA 1KV3A 4WV1C 4YBQD 4OKVA 4XCNB 4UILL 5D72H 3QIBD 1L0QA 3E6HA 3VWJC 4G8FB 2J6EH 4PY7A 4G9DB 4EXKA 5HGAA 2K1MA 2BOBA 3G08A 3R1GL 5HTSA 3V4VL 2DIAA 3RPIA 4AEHL 3BO8B 1RZKL 5L7XL 5JLZA 1A9BB 1AP2A 4C56D 4XP9L 4JDTL 4A6YB 4JRXB 2DBJA 3CSYB 35C8L 4TRPL 5DJ8A 3V5KB 5I1LB 4X7TA 1IC4L 3WO3B 3LN5A 3MCG1 4QOKE 1PX3A 2M2DA 2QADC 4MD4A 3TT1L 4YHZH 3WHE0 5IKCB 4X0KA 1DLHA 1F00I 3LEYL 5C0CB 1WVZA 4P46A 1KPVA 4PV9B 2G2RA 5BV7B 4M3JA 1GOFA 3B2UC 5DO2C 4M4PA 3BZEB 5C0AE 4U2ZA 2VDNH 3TVMC 2ATPA 2CK0L 4RGMC 2NY4C 1SJHA 3QWOB 3CFKB 1PEWA 5D2NB 5JDJA 2FEDC 5DR5L 4H5SB 2CRMA 3OKLB 1MI5D 4NFDA 4XCCH 2X40A 3C2SA 2OR9H 2NYYD 1AGBB 1RIVL 3MYJB 4HIIA 2HRPL 4JKWA 4NGHL 4HKZB 5D93C 4NNYB 2AK4B 3QDGE 1FL3B 1HHJB 3IDJB 2V9TA 2LFGA 3FZUC 4GW1A 2A1WH 4GW5A 4N68A 2IAMB 4XC3H 1M6OB 2H1PH 5DA4A 5BOPA 5FA3B 5DRNB 4BQ9A 2BRQA 1MRCL 4U1JA 2JK5B 2MPAL 3RNKB 3MMEA 3RX8A 1S7UA 1D5IL 2UZIL 3RGVA 2YR3A 3NFPB 4LFHD 1ZMYA 4YBQC 5MERB 3X3GL 4I2XA 3P40A 5IMLA 3UTSD 4RAVB 2GTWB 1ETZB 2B1AH 5GGVY 4WWKC 4NJ9H 4HCRA 1JI1A 4IRJD 2H8PA 1AXSA 2IG2L 3T09A 2JTDA 4KTDL 3MXWH 4OZFB 2VLLB 4D0CA 3KXFB 4PFEA 4ELMA 2AV7A 3ARPA 1C12B 3NPZB 5DJ2A 4WCYL 4GAYA 2X5PA 4P2RA 4DKEL 4Y89A 3T3PE 2VXSL 3PV6A 3LS5L 2Z31C 4U49A 1G1YA 3FT3A 2HTLD 3O0RL 3GSOA 1XF2B 5GJSH 4J4PA 1VEMA 1IGYB 4G7YL 1MHCB 2FIKA 4PRDA 1I9RL 4UBDD 3G5YA 3GHBH 2P42B 4LVOB 5JORB 2WUBL 1XIWA 4OI9A 4OGYL 1A5FH 3WHXA 3H42H 3N06B 2VLJE 4G6AD 5F3HB 1CFSB 1TFHA 1PAMA 4PJ9B 5D1QB 2M8XA 1IEHA 4PYHA 4Y4KB 5EC1B 4U6VH 4Z7VF 1BM3H 1N26A 4L9LA 4NT6B 1FIGH 3EFDH 4HG4J 4JFPB 4QRPD 3BYTA 2RGSA 2P8PA 4ZO7A 4JHBA 2CDGB 1AC0A 1S7QB 4Z7UF 4F57H 3FFDA 1U8HB 5I19H 4O2EA 4OD3L 5DQDH 4QO1A 1C5CH 5MP6L 1QKZL 3WV0A 4DGYL 3LSOA 4ODHL 2QR0B 1JUFB 2FJFB 3MZGB 2O5YL 5GRUL 1VGEL 5IB1B 2ATKA 5CINH 4M7LT 2F8OA 2XWTB 4XCEA 4YWGH 2UWEF 4Y16C 2A6JB 5KVMC 1N59B 4F58L 2XQBH 3BIAX 3IJYB 3MFFB 5ICZA 4XP5H 4MJ4A 3KPSB 2DYPA 1CG9A 4M6OH 3FJTA 1Z6JT 4B7LA 2I24N 1CLOH 4N5ED 2R2EB 1J8HE 5MEQB 4OT1H 2DQIL 5B8CC 1NBZB 3GMPA 3ALWA 1KBGH 4KTYA 1YEFL 1KEML 1SBSL 4RGOL 1JNLH 3RA7L 4QNPF 2YWYA 4S1SL 5T33H 4YHKL 4QHUB 2PKDA 4PJHA 3NFNA 4TQEL 1S78D 3SKMB 4DVBA 3ETBF 1T0PB 1N64L 1JWUB 2DQFA 4UBDC 1F58L 3DV6A 4FFZL 5D1XA 3H9YA 3PF2A 4FQPA 4Y88A 3CDGA 4PGDA 4Y0GA 2CR6A 3PWJA 3A6BL 2O5ZH 1BD2E 3OXSB 4HCRH 4LIQH 5FYJD 2BNQB 2MNUA 2Y07H 1RD6A 3L5XH 3QXAA 4Y5VA 5K9KB 3BH8B 1K3ZA 3VXME 4HGMA 5TDPA 2CKNA 3HPJB 4X4XA 3KAAA 2B5IB 3VWKC 5D7JA 4FFWD 4NBXB 4PRPD 5DZLA 1RK0B 5KVEL 5CFHA 3MJ9A 4L3ED 3KS0J 3G5VB 4HJGA 1D3CA 4G9DA 4PP1C 3NIDF 2GAZA 4ZO6A 4BZ1H 3D39D 1DANU 2LV4A 2MKWA 2EIDA 3T2NH 5C08D 3BO8A 1YYMH 4PV8B 3WSQH 4MMXC 4R4BB 2JELL 2BNRD 2CMRL 1TCMA 4TULL 1K6QH 1MY5A 1YUHB 3B9KA 3UJIH 4JRXA 1ZLSH 2C5DC 3CSYA 4RBPH 4Z7VE 3V5KA 4OFPA 1E6OL 3CX5K 2ORBL 3S37H 3L3KA 2Q3ZA 4OCRH 3MRBA 4ODWA 5I6XC 4P2OD 5FGRA 1MIEH 5C0CA 3WFZA 3P9WB 4J23A 3S6CA 5IFHH 2MJWA 4MXWH 4DQOL 1OQXA 5BO1H 2GK2A 4L8DB 3RUGB 2H3NB 3GMMB 3PL6B 3BQUD 4ONGL 1YEHL 4PJXB 4LAQL 1T83C 4MJID 3CFKA 4GSDL 5D2NA 4C57C 3BP4B 1YNLH 2UWEE 3MRHB 4H5SA 4L4TE 4NJAL 3WIHL 3OKLA 4F9PA 3SDYH 2Y5TB 3EYFB 4P2QE 1S78C 4TSAH 5E6IB 3V4PL 3MYJA 1DJSA 1QFPA 2F74B 5DURD 1A7PH 3SCMC 4NNYA 4MDIB 4DUVA 5IVXB 1KCLA 1FL3A 3I50H 1HHJA 3IDJA 4UTBH 3EKCA 3N85H 3TBTB 3S8WA 4KRNA 2O5XL 4D9RD 4K94H 2ZOLA 1AC6A 1FJ1B 2IAMA 3QEQE 2FX8H 1V8HA 2OP4H 2BZDA 3VRJB 4P3WA 3AY4A 5HYQB 1U92A 5FA3A 1FNFA 1U8NA 5DRNA 2HWZH 3KR3L 4IIQC 1BFSA 2EC9U 3OJDB 3RNKA 1I3RB 3FTGA 4PBXA 4M1DL 4FFWC 1HK6A 1OAUL 3MV7E 2A9NH 3NFPA 4IS6B 3AREB 4NCDA 4JFYA 1GAFL 4I5BA 1ETZA 4QRQB 2QQKH 4XVSL 2DWDA 3CVHB 3Q5YA 2VLRA 5EZLB 4N1HB 1J1XH 1C5BL 4LOUC 4YR6B 4AH2B 1DLFH 1NMCC 4OZFA 1LO5B 3KXFA 2DKMA 2DKSA 1S5HB 2NPLX 2CH8A 2E7HA 2HKFH 5EPMB 2P5WD 1QRND 1OVZA 4EEEA 3MLWH 1O5DT 4LNVA 2Y06H 2J2ZA 2IPKA 1IGYA 1MHCA 4ZXBD 3UAJD 5LWYL 3MV8D 4OM0H 3MJ9H 4O5LL 2EDEA 1GIGH 3NIDE 2F53B 1BBJB 3FQXA 4TVPL 5FM5M 5GQBA 5JORA 1G1CA 1QBBA 1CFTA 5IIEB 1QSFA 4OGAD 5EU4A 5C0BA 4S11A 5F3HA 2Z93B 1I1RA 3H6JA 2VDKL 4BFGA 3TO4D 4LSRL 3LN9A 2DS4A 5EC1A 4HAFA 3P73B 4NT6A 1HINH 4OFYA 3V95A 1EK3A 2N1KA 2VLMD 1FHGA 3LB6D 4JFPA 4XAWL 5DJYB 3MJ6A 4H8WC 1AGDB 5EIIA 2CDGA 3F58L 1S7QA 3A6CH 3AM8C 4MNGB 1U8HA 3FFCB 1NLDH 1IGIL 1Y6MR 3GK8H 4XHQA 3L3OA 3VRIB 4LSUL 2FJFA 3KPLA 2XT1B 4JR9L 1D6VH 1KENL 5JPMB 2MHAB 5CCKL 2DTMH 3P9MA 4MXQC 3QQ9C 5EU7E 1FSKB 4XAKD 4NQCD 4YZFF 4JG1L 5DUPL 4IOIB 3IJYA 3K1DA 4U1GB 5IHBA 4V1DB 4H25B 5TQ0L 1I7RB 1ZA3B 3MNVB 3BPOC 2R2EA 4WGWB 5MEQA 5IP4A 3HAEA 5GGSB 5I1HH 1BX2B 5BRZD 4XRCB 5DWUL 5CS7A 3QCUL 3GSQB 4DEPB 4JZJB 3FO1B 1MFDL 1YEIH 3EO1B 4U3XA 1I1YB 1SMAA 1F97A 3H7LA 4PJAA 4QGTA 1QR1B 2EE2A 1KFAL 5FK9B 3L1OL 3D18B 5ESVA 4HUUB 4NO0B 3UAJC 3ULVL 4KWUA 4AZ8A 3MNWA 1HDMB 3W9EB 1LEGA 4M1CC 4JM2D 3X11A 3V0WL 3U4EA 2FHCA 3I3EA 1SEBA 2FZ3A 1TNMA 3EYSH 4DZ8B 3G5XB 1OSZB 3IJSA 5CBAB 4RISL 5CEXA 2VAJA 4JFOB 5LJYH 1ZWIB 4DW2H 5K9KA 3BH8A 4K55A 5F9OL 1UM5L 3DX9A 3VXUB 5T5NG 4UT9H 4J2XA 3UBXI 4LKXB 1UWEL 3EO9H 4Y5XB 3QSKB 2CIIB 4P5KB 4EDWL 3FN3A 1I4FB 3G5VA 5AEAA 5EBLB 2CIKB 4UB0H 3MRQB 3SDXA 3VXQB 3C6LC 4Y1AD 1MJJB 4J4PD 4OLZL 2WIMA 4M3KB 2DMCA 2B7DT 3MGTB 2V17H 3PP4H 3NCJH 1AI1L 3QQ4A 2JJUA 3IB4A 4YX2H 1NBVH 1C7SA 2NY3B 5FYKD 4WI6A 5I75C 3SO3B 3HCVA 5FA4B 4P46C 2C4XA 2SEBB 4OLUL 4C83B 2AJXH 4JFZH 1UM6H 1NCCL 4JPVH 4HV8B 1BMGA 1DQMH 4U7SA 4KRLB 5CKAA 4JPKH 1ZK9A 1IAMA 3DSNA 3RAJH 5FECB 4L8DA 4P5TA 1NCAL 1CE1H 3U0TB 3L3HB 4Y4HA 4BQ8A 2UY7A 4P57B 4R2GC 4PRHE 2VISA 3BP4A 1F6FB 2Y5TA 1P5VA 3V2AR 3WCYA 5F7EH 4ORGA 3EYFA 3QIUD 5EOCJ 1BLNB 1D7FA 5E6IA 3O8XA 1Z5LB 4LCUB 2N56A 2BHZA 4MDIA 4O00A 2G60H 1IQDB 1QFWM 3TBTA 2XQYG 3REWB 3MV11 1QSVA 1I7ZA 3OHXB 4OZGF 3DPBA 3T0EE 3WFEL 3RGVC 4PP2B 1FJ1A 3HAEH 3BDYH 2NXZB 3VRJA 4R90H 5HYQA 1RUQL 3MRMB 3BEVB 4J3TA 4WHYG 3ROLB 4ONHB 1FYTD 3WFDH 5E2TL 1ZGLP 3OJDA 1NBYB 1J0IA 5J1SC 1E6JH 1A1MB 4TSBL 4IS6A 2FJGB 3AREA 3PWPB 3ZE0F 1KPUA 1YYLL 1P7QD 2A83A 2VB5A 4HPYH 4QRQA 3ARGD 1ZVSA 2BSRB 3MRNB 4J4PC 5EZLA 1QSED 5BS0E 1MFAL 2LU7A 4YR6A 4AH2A 3DX7B 1JHLH 2PW1B 5A2KH 2QQNL 4NNPL 1S5HA 4G5ZL 2IALB 3DETD 5EPMA 1RIUH 4X8JB 5T1KD 4GKSB 5DD0L 5JXAL 1XIWC 4FRWA 2CUIA 4NCC1 5KBNC 4PIRF 5JNYB 4P23B 3JVGA 1VA9A 4XMPL 4XH2A 3GMLA 4XPAL 3VW3H 1I1FB 1Z2KA 3TO2B 3MLRH 7CGTA 4NSKB 5KTEH 3V5HB 1I3GH 4JE4B 2XG5A 2CLVB 3BUYA 4L9LC 3V8CA 1DSFL 4OLWL 2X4TA 1ZLUH 1CDGA 1T03L 4K07A 3BYYA 3JTSB 2R15A 4JY6B 2EDLA 2VH5L 3O3DA 4MX7A 2Z93A 4XBPB 5ICXB 2GTZB 3A6OA 1S7SA 2UZYB 4LLWA 3OXRB 3KHOA 2YUVA 4P48A 1KEGH 1EUUA 5FCSH 5HBBA 2PO6A 4G43A 1CXLA 2LAAA 1Y6KR 2NNAB 2X4NB 4L8BB 4UIKL 1FH5L 3U1SL 4KVNL 4JRXD 2ED9A 3U6RB 1ZTXH 3WD5L 3H7BA 4CDHA 5CEYB 3LIZH 4AIXA 4GQPH 1IJ9A 4PJIB 4LCCB 4X7DC 7FABH 3HE6C 1WZ1L 3IXTA 4LPCA 1ZANH 2J8UF 3A67L 5C0CD 5JPMA 4S1RH 1HI6B 4K94C 3FN0H 4XNZB 2GJZA 1XCTB 4IOIA 1U41A 5BVJB 3EGSB 3OAUH 4K71C 5C3TA 4V1DA 5BJTA 3BOVA 1KCSL 2ZUQB 4H25A 4ZOBA 3BJLA 1I7RA 1ZA3A 1PG7X 5B39A 1H8NA 4GT7A 4TUKH 5KW9H 1P7HL 1SM3H 4OZGE 5GGSA 1BX2A 3B4NA 5KOVC 3GSQA 3QB7C 4JZJA 1I1AB 3UPAA 1IC1A 2AK4D 5DVNA 3I2CL 3JTTB 3WDJA 4ZFOB 1B6DA 1ZVHA 4OIBA 4FHBD 5D1XC 2YSSB 1TPXB 3EO1A 1I1YA 5EUOF 1ROWA 2ZUVA 3WFHB 5FFLA 5IGXL 1QR1A 3NZHL 2VL5B 2IAMD 1G7PB 1J0YA 1FZJB 3ARBB 4WFED 1R3JB 3VXPB 3ZE0E 3QZWG 4HUUA 4YUEL 2AJVH 1QBMH 1S7XA 5TGBB 3HNSL 3W9EA 3AB0C 3C60A 5I8KL 4G6JL 4JFXB 5D7JC 2XN9B 2ZG3A 3O4OB 4HUMB 4LRNL 4HGWB 3CK0H 1OSZA 3H9SB 1UQSB 5JR1H 4JFOA 2MCPL 5C0NC 2BY2A 2LTQC 2YKLL 5CIPB 5IBLC 2ZJSL 4MB3A 4IJ3C 3KPPB 3HUJF 5IR1B 3VXUA 3CIQA 3KXFD 4LKXA 1CGSL 2EEDA 4Y5XA 2CIIA 4HQQH 5GRYA 3PQYA 2BC4B 4I9WD 4NC1E 4NKIH 1FV1B 3VXQA 5I17A 3B9KC 3DWTA 1KJ3H 4X6CF 4I3RH 3MGTA 2HVJB 4LBEB 4FFYH 3WFCL 3IT8D 4M8VA 2YN5A 4UIMA 3Q6FB 4YH6A 1BQHB 1P84K 5DFTA 1OAZL 3QFDB 1LHZA 4F7TA 4Z0BH 3T0BA 1T89A 4C83A 2XKNB 3VGEA 3MR9B 4ALAL 2YPKA 3UC0H 1OAXL 5D2NC 4PJ9D 5D1QD 5IROA 4GAFB 3QFJE 3HG1B 4Y4KD 3QXVA 4F9PC 5FECA 4EN3B 1OLLA 1GGIL 4ZS6D 2YUWA 1GGBL 1JPSH 2QJDA 1RUML 1YY9C 5LBSL 3U0TA 5F7KC 3WIIL 1BQSA 4DAGH 2ED7A 3L3HA 5DZNA 4P57A 2DTSA 3V6OA 2J4WH 3MRKB 3FCTA 3UTTE 2D4FA 5DRXB 3S88H 2AXHA 5SWSE 1I9JH 3HE7C 2IAMC 1ZSDB 1BLNA 2XA8H 5KSBB 3AUVA 2C3VA 3SDCB 5DD1L 4LCUA 1X6LA 3AY4C 2EICA 3ZL4H 1G84A 4Q0XL 1AR2A 1IQDA 1U93B 2OTUA 1LE5B 5IV2B 2HTKC 3OB8A 3I6LE 3OHXA 2VDQH 3GBNH 3DXAB 4FTVB 5C0EA 4PR5A 5HHOE 1CT8B 2LE9A 3IDYB 1CLCA 4JG0L 1RZIA 1QP1A 3KPSD 5FKAB 1NQBA 3VXNB 3K2UH 1JI2A 3O6LL 5F9JA 1DQTA 2WBJB 3GRWA 2E27L 4ONHA 5EUOE 3ROLA 2X4OA 3OKDB 1UA6H 2CSPA 3CPLA 4PJCE 2R56L 1AXTH 3E2HB 5C09A 4BYHA 1A21A 2IH1B 3U7YL 1JZ5A 2WV3A 2FEEI 3PWPA 4OZHA 1BAFH 3RY4A 3O41A 2EYTB 4GRMB 5EU6A 4G8EB 4Q6IB 1TLKA 2D7PA 1LP9B 3KYNB 5C0FB 3DARA 4MAUH 3J7HA 3OB0H 2BSRA 3Q48A 5GJTL 5GRXG 2OYPA 5KSUB 4KHTH 1G9EA 1F11A 1L7IL 1MIMH 3BMWA 5FUZL 1H3UA 1T6VN 1JRHH 3KYOB 1EHXA 5EZOH 1NGXB 2F5BL 4PLNC 3C9NA 3HC3H 4X8JA 5E5RB 4LVOC 3HUJE 5K9JH 1MWAL 2BNQD 4ODSH 4Y2DC 4Z7QE 4JN1H 2FATH 5JNYA 1XR8A 2EDNA 4P23A 4NO3B 3TO2A 5JW4Q 4C56E 2I60L 2QSQA 3QCVH 2PYEB 2CLVA 4D0DB 4PJGB 3LZFH 4L1HA 1ZGLM 4ZS6C 5L9DL 5FV1L 5DK0B 1OTUD 2DBLL 1WWBX 4M7ZC 5ICXA 3NTCH 4PY8I 2ZKHH 3QO0A 3K8MA 1U3HB 1HKLH 3REVA 3W0WA 1CU4L 2W59A 3D2UA 5HI3D 2GK0B 4OIIH 2PCPB 2NNAA 5I0ZA 3MBXH 2X4NA 4IRSA 3B2VL 4M6AA 1AO7B 1KLGB 5DHVB 3U0WH 1E0OB 5H37H 2AABL 4FMFA 3T8XB 3I9GL 3I84A 4K2UL 3U6RA 3IDGA 4Q7DA 1XFPA 2P5EB 3C08H 1J05B 4OI8A 1KGCD 5C71A 3EDJA 1IAII 4PJIA 4LCCA 3MREA 3V6FB 4X98A 2Z35B 4KJPD 2KBGA 2ICWJ 3QUML 4ELKB 4ZUUA 1RURL 4PS4L 1HI6A 1Z3GH 5E95B 5CILL 4AT6B 2V2TB 2LQRA 3QG7L 1LQSR 3UX9B 4QRRB 4HC1A 5I1AA 1FO0L 2FB4H 3HMWH 4MLIA 1CGYA 3EGSA 6CGTA 1T0NB 3PL6D 1N5YH 2VYRE 5GGQL 1T7ZA 5C0DA 1FE8H 1FORH 2R0LH 2QV2A 4MNQA 3AS2A 2HMID 3QEGH 1MFBL 3GSRA 2CDEB 1TJGH 5E6ID 2BY0A 1ZLWK 2ZUWA 4LRIA 4YHIA 2CDFB 1EO8H 2R2BB 3B3IB 1MAKA 3LKRB 1HQRB 3UTSE 1RVFL 5T1MA 4Q58C 2MFNA 4K3DL 1C08A 3ZTJH 4GS7C 4N0FB 1G0YR 3GRWH 2YS4A 1FZJA 3ARBA 3BHBB 3VXPA 5T3ZL 2WZPD 5FM4A 1J86A 2FNBA 1CXKA 5LQBL 3L3IA 4P2CG 3GJEB 3TP4A 5I18H 1FG2A 2NMSA 4QYOB 1FDLL 2XN9A 5D9SB 2R0ZL 3QRFM 4HGWA 3ARED 1UQSA 1FAIH 3F12A 1FAKT 2N7BA 3MLTA 3QXTA 4RGNC 5E8EB 5CIPA 5LGJB 1OTUC 3SDAB 1IGML 1RZFH 3OKKA 1ADQA 5IR1A 4WTWA 1JYVA 1MSPA 4OB5H 2YHGA 2J1KA 4R96B 2K3TA 3T2QA 5HI3C 5I71C 4Z77B 2CXKA 4LCIL 3QDJE 1WGOA 5DVMA 1FV1A 4GXVL 2Y4SA 1RY7B 4X6DE 2CRIA 2NZ9D 3QBTB 4GMSH 2FHBA 3CAFA 5DLML 4YPJA 2Z91B 4PJ7F 4BUHA 2E7LA 5KJRL 1B4JH 1A0QH 1R3HB 2UUDH 2ZNXA 3PABB 4BA8A 3GI9L 5FV2A 1F6LL 4QRPE 2F53D 3Q6FA 3ZSTA 1VFBA 1BQHA 4R97C 3ULUH 1V7NL 3QFDA 1X5XA 2EZ0C 4G8IB 3HRPA 4P5TC 4GRWE 2CJUH 3MR9A 2XQYK 4U1KA 3WXVH 2O93L 3EFFA 4Y4HC 5E0QA 1XGUB 2RFXA 3QH3B 4LAJH 3TYGH 1R6VA 3FB5B 3M07A 4HJ0C 1LO3L 4JHAL 2QQLH 1OM3H 5E6IC 1IKFH 3O8XC 2FGZA 1ZHLB 4MLSA 4NQDB 1LO2H 4P9HL 4QRSA 3I85A 4M7JH 1DBJL 1KB9J 1U8JB 5DC4B 5DRXA 2ICWB 3FFCD 1HIML 3HZKA 1GGTA 1FPTH 1RZJH 4YXKH 4ODVH 5F9WB 3SDCA 5EOQL 6FABL 4HC1H 4DFHA 2QL1A 3V6ZA 1JHTB 1IGFL 3IF1A 1V5JA 1YEJH 4M62H 1H3VA 5IBTL 1E27A 5IV2A 5J11B 3ARZA 1TZGH 3CGTA 3DXAA 1IZKA 3FRUB 3MOBL 1FZOA 1GGCH 4FTVA 4LHUB 1CT8A 4V1DD 3STLA 1HH9B 3AREC 4FNLH 4GG8B 3VFGL 1WZMA 4KQ3H 1KN4H 2WBJA 1SEQH 5C7XH 1M7XA 2BDNL 4PJEE 3OKDA 3G6DL 4WFFD 5FYJE 3VFTB 3EHBC 4JPIA 4XBEL 4BSJA 3C5JB 4LGSB 3VXSE 5C8JA 4Q6IA 5CUSH 1MAMH 4FFVC 1LP9A 4M1GL 2FO1A 3KYNA 5C0FA 3KJ4B 3N0PB 5FGSA 5FUCE 1KCVH 2E9IA 1IQWH 2VZSA 4PJFE 4PRPE 1D5ZB 5FO7B 2FRGP 4EOWL 3JVGC 4NO0D 4L29A 4HD9A 5FB8B 3PXJA 1KXTB 1NGXA 3IDXL 5FEBA 3BGMA 3BSZL 3S5LG 1NLBH 2BERA 4FQLH 3D39E 2COQA 2G5RA 5CIPH 5C08E 4Z7OE 4HMEA 5F3BB 4CJ1A 3FB8A 5GISH 1ADQH 1F6AB 5DJAA 1OTTD 3VI3E 3P4LA 2BNRE 4YQXL 4GKOA 2WQRA 4YPGB 3VXUD 2PYEA 1MPAH 2PO6C 4D0DA 4GKZB 3HNVL 3GKWL 4E9LA 5DK0A 4HHAB 5EG6C 3B5HA 2QKIB 1RUKH 1C1EL 4ZOAA 4XVUC 3QDME 4DK6A 5JIIA 1U3HA 1YY8B 1YNTB 3HI1B 4YEFA 2GK0A 2NY3D 2PCPA 2VQ1B 3ZKMD 5CWSB 1R5WB 4X5LA 3L5HA 4MJIE 1IAKB 4NYLB 2CO7B 3Q5TA 3DSFL 1ZT7B 3RJDA 2P5EA 4OD2B 4K7PL 4LEOB 1NGPH 4CMHC 4MQ7B 4U1GC 2ZCKL 3TN0B 5C1MB 2VAAB 4MXVF 4IOFD 1HH6A 3V0AC 5TQ2H 1LE9B 4BFBD 1FGVH 3MC0A 3QUKB 5DK3A 1BQLH 5GHWL 1NCNA 3S4SG 5DQ9A 5MENE 4RFOL 3NA9L 4QRRA 4DEPC 1T6WA 4D9RE 1T0NA 3F7YB 5E00A 5FAAA 1GL4B 2X2YA 1JZ8A 2ADFH 2XY2A 1MCLA 4BQCA 1H3GA 2IFFL 4EVNA 2CDEA 4O9HL 1GC1H 4NN6B 4ODXA 3IAQA 4GRLB 5TF1H 3B5TA 2CDFA 3B3IA 3EOYG 4NKMA 4HWEH 1CDHA 5HHPB 5JW5B 4HLZH 3GIZH 3C60C 2RCSH 5AD0B 4HPOH 5FGCE 4JM2F 2P8LB 5TH2B 3D0LB 4N0FA 5IHUL 1N6VA 2Q8AH 2NXZD 1WEJH 3BHBA 5KS9B 4X80L 2P5WE 1QRNE 4P4RB 3ZDYF 4JGJA 4C59B 4QYOA 2G75A 5D9SA 4WO4A 3LKOB 1G7HB 4XCCL 4Y5XC 4ODTH 3V79C 3PWPD 5EN2B 5IJKC 1F42A 2NLJA 3CX5J 4OM1L 1L6XA 4XVTH 4D8PB 5E8EA 5CSZB 1D5XB 3K3QA 1JHKL 3P11H 5CEZD 4KK5D 1WIPA 2E6QA 2I07A 1FC1A 4R96A 2YRPA 1KIQB 4N9GB 1A6WL 1K5NB 5D7IA 4N8CL 4U1MB 1CLYL 5K59E 5GGUA 4D3CL 4JJ5B 2R1WB 1WCBB 4GBXA 2DLHA 1T89C 1ZKAA 1B0RB 1SMOA 4P23D 4QY8A 4XP6H 1DCLA 2AEQH 1EMTH 2BVYA 2NY2B 4H1LA 2VLME 2CRYA 3MRGA 1NEZB 5IROC 3FRPG 4O4YL 5HYEA 4NHCH 5IF0B 3UJTH 1XT5A 4YFDB 4UDUA 1EA9C 4NJ9L 2AEPL 1F4XL 4G8IA 3MRLB 4NQVB 4B41A 1XF5B 2DL2A 2YD5A 1OCWH 3LHPH 5J8OA 3RWDA 1KN2L 1XGUA 1J1PL 3V6OC 3QH3A 1B90A 4LSQH 1XGRA 4G3YH 4NQCE 1H0DB 4HXBH 3MLSH 4AIOA 3OG4B 4MXVE 5TE6H 1OP3H 4DUWA 1MLCB 3DGCR 4LLUB 4ZD3L 4G6ML 1CFNB 3AMKA 3GHBL 5TPWL 2WANA 2ICWA 3LKSB 5BRZE 5ADOH 1OAYH 1L0XA 2DICA 5HI5C 2NXZC 4LARL 4WIQA 5BQ7A 1M05A 5K9OB 1JHTA 1BFVL 2HKHL 3EBAA 4I77H 2AJ3B 5BVPL 4EJ1C 4WW2B 1JE6A 2CGRH 1BM3L 3ARYA 2BVTA 4CVXB 1OPGL 1HH9A 3BIBX 3RWJB 2F54A 3EFDL 4GG8A 1MLBA 1MRFL 3SY0A 3GMOA 3AVEA 3FO2B 1G6VK 2FGWH 2ZUXA 1DQLH 5GGTL 1AD0B 1T1ZB 1HYSC 2EKSA 1CZ8L 4OBRA 1I1AD 4JO1H 2GFBA 1FRGH 3VFTA 3CJJA 4HWNA 3ZMRA 1Q0YH 3BD3A 3C5JA 5DC0A 3RX7A 2IH3B 4RFNC 1ERNA 1RJLB 4I1NB 1MQKL 1E28A 4JQIL 4HDIA 3S36L 3TBSA 4OCWH 2PF6A 4H26B 4Z7UB 3T08A 3ARBD 1KLUA 1D5ZA 1PW3A 5FO7A 1UH3A 3WUWB 4HAGA 1MOEA 4P23C 2X4QB 2EKJA 3IDMB 5FB8A 5GZOC 5E1AB 4M5YH 5K9QG 3ZTNL 2XN9D 4Y1AE 1NSNL 4M6OL 4WW1B 4RBPK 5CLTA 3H9SD 1CLOL 5F3BA 3QJFA 3ULUC 1KBGL 1YDPA 4WU5B 3VXRB 1YJDL 5FYKE 4YPGA 3TYFB 3OX8B 1S9XB 2XIDA 3RQ3A 3KPMA 1DQDH 1NAKH 5EWIL 4M7LH 4NKDA 4UILH 4K8RL 1HHHB 4IRSC 4PLOB 2WIIB 4XPTH 1CDJA 2VN7A 4WWID 4HHAA 3R1GH 2YXFA 4H1LH 3V4VH 5KANI 5IBUG 3TNNB 2UVEA 4AEHH 1QBAA 3QPQD 4LEXH 1RZKH 5L7XH 2DWEA 1YY8A 5EA0H 5D2LA 5F6IB 2KZ1B 4Y19A 5E6YA 2VQ1A 4LCCC 2W9DL 2MKLC 1AXIB 1R5WA 2C4FT 2AXGB 4XP9H 4U1LB 4JDTH 4NYLA 1RZJC 35C8H 4TRPH 2YEZA 3HFML 4R9HA 4XNZC 4E5XA 4U33A 4OD2A 3SPVB 4HH8A 3UJJL 4LEOA 2X44D 4MQ7A 1OT1A 3TT1H 1UM4L 3HG1D 3LEYH 4PREB 1RU9H 3QUKA 1DBKH 4EN3D 3GMRB 3C09C 2F15A 1FVCB 2ESVE 1IEBA 4PPTA 4CNIB 5E99H 4LRIC 2VDPH 3X13B 4YEEA 5D5ME 5TE4L 3F7YA 4R3SB 2CK0H 3WSQL 4XTRD 5LGHH 5HSFA 2FBOJ 2XZCL 1FYTE 3K8KA 4FXGA 1V3JA 5E70A 2BY1A 3UJIL 1ZLSL 3FT2A 3DO7A 4ZNEA 3UTOA 1RIVH 4GRLA 3SDCD 5SX5K 5E2WL 2OZ4L 3ARBC 4DOHE 4NGHH 2A9ML 1CIUA 5HHPA 5JW5A 1NDMB 3D69B 3N50A 5AD0A 1CL7I 2P8LA 4OLEA 1QSEE 1BP3B 3DXAD 4FTVD 5TH2A 4CU7A 1ZHNB 5I73C 1JN6B 2FECI 4MXWL 5BO1L 1AGFB 4I18B 3OGCB 4ODUB 5KS9A 2E7MA 2P24B 2XTJB 2JJWA 2P8MB 2WBJD 4P4RA 2VN4A 1IAIM 4L5FL 4LFHG 3WLWC 1JZ6A 1D5IH 3LKOA 2NTFA 4JFFA 2JCCA 4E0RB 3ZKQD 4LSSL 3X3GH 1JF5A 4C4KT 3UZQA 4D8PA 1EEZB 3O3EB 1WFNA 1X5YA 1A7PL 1D5XA 2A6DA 1T0MB 1MRDL 2VE6B 1QOKA 2IG2H 3MSPA 4UTBL 1G7MB 3N85L 4I48B 2VRAA 4KTDH 1JV5B 2E7LC 4R26L 2K9UA 1KIQA 4KKAD 1KTDA 4WCYH 5JOEA 1F4WL 2FX8L 4DKEH 3GBML 1IVLA 4J3OC 3LS5H 4U1MA 4HBCL 2X4UB 3N1QC 4YO0B 4D9LH 2X1PA 2W65B 2HWZL 2HFEB 1B0RA 1I9RH 1JF1A 1PFCA 5KSAB 4CADA 3IDUA 5AUMA 3QA3B 2ICWI 2DN7A 2V9RA 3RL2B 1NEZA 3LQMA 1CD1A 4OFVA 3T4AB 4DZBB 5IF0A 4OGYH 4N9OB 2PYED 4YBLC 5F7DB 3MRLA 4NQVA 1J1XL 1FGNL 1BPVA 3VCLB 4WEBL 4KROB 2EXWD 2R23B 3GO1H 1N8ZB 2NY5L 2C26A 2P46B 4XTRC 2B39A 3OAYH 2ERJB 3G6JE 5I9QB 4F33B 1U3HD 3MLWL 4KKLD 4PLKC 2YD7A 3PIQA 1H0DA 4MVBD 1FNGB 1AO7D 3SDCC 5F89B 1MLCA 4FQHA 2D7TH 4LLUA 4KI5E 4XMLL 1CFNA 1XCQB 2P5ED 2DM3A 1UZ6E 2GEEA 3LKSA 4YXLL 5B38B 3WO4C 1U8LA 2YD2A 5MP6H 3VGAB 3RBSA 3IDYC 1QKZH 4DGYH 4ODHH 2ICEA 1SY6L 2AK4E 2PXYC 3WIHA 5JW4R 2O5YH 5GRUH 1VGEH 2WBJC 1QPXA 4O2CB 4F2MB 4QRRD 2AJ3A 4F58H 4LGRB 4WW2A 1FNSL 3E2HC 2X4SA 3KLHC 3VFVA 4EI5A 4WFEE 3RWJA 3PHQB 3WNMA 1QNZL 1WK0A 4XNMB 3FO2A 4Q6IC 3RVWC 1AD0A 2P7TA 1LO4L 4X7EC 3A6CL 2Y9RT 4UINL 2R0WH 1NJ9B 3ET9F 1ZLVK 1KEMH 4RGOH 1RJLA 3IDIB 1MCDA 3GK8L 2ENSA 3RA7H 2NY6B 4S1SH 2DLIA 2CLRB 5IMOB 4YHKH 5I66A 4TQEH 4FABL 3SGEH 2AI0L 4HS3B 3RL1B 4OF7A 4P59L 1N64H 3WUWA 2X4QA 1HEZA 1F58H 3IDMA 4FFZH 4I9WE 1WUNT 5E1AA 3DO3A 1NH6A 1X5JA 4YDVB 4JY4A 1EEYA 3A6BH 5DRZB 3U9PH 5F8RC 3M8OL 2IANB 3SDAD 2XWBA 4WU5A 2EO1A 3SGKA 3TYFA 3WHE1 4LCWB 4O2FB 1U3HC 4KKLC 5GZND 1NC4B 5A40E 3DUHA 4CVWA 1QSZA 1HHHA 4D0BB 3ME0A 2JB6B 1SYVB 2V5SA 2ZWLT 3TNNA 3LQAL 1YC7A 5AZ2L 4J12A 5DMIL 4M7KL 1Q9KA 4Q9BA 1QBLL 2JELH 3EYSL 2CMRH 1YQVH 4TULH 1MFNA 1KCKA 4WUKH 4UU9B 2H32B 4U1LA 1MHHB 3WMSA 5F6HJ 1JFQH 2YRLA 4QHKI 4HIJB 2ORBH 3BKML 3ULSB 3RIFF 1WF5A 2VABB 5F1NB 3EYUL 4PREA 4HIHB 4QHLB 3GMRA 2GKIA 4Z78A 4DQOH 3NZ8A 2DQTH 4WUUE 3WE6A 4CNIA 2X4PA 3RKPA 4R3SA 4ONGH 5HPMA 5FO8B 4LAQH 3KPSE 1XF4B 4MD0A 4GSDH 4NQDD 4YX2L 1NBVL 2QHRH 4NJAH 4RMTA 5KN5A 3CH1A 4G8GA 1I75A 4PGJA 3K81A 2R1XA 3NACH 4DJMA 3PWUB 3S3SA 5HHMB 3RDTC 3EYQC 5E94B 4JPVL 2DDQL 3RU8L 1DQML 2JJSA 1K9TA 3D69A 5I1DA 3QUZB 5DSCB 2FDBP 1XGYL 2O5XH 4WO4C 4MAYB 1N2RB 3PG2A 4LHUD 1ZHNA 3MRFB 2ITCB 1BIIA 2F5AH 4MA8L 2E3VA 1WJ3A 1V3MA 2YMXL 1AGFA 3VD4A 2P24A 2W38A 4BFIB 1CE1L 2P8MA 1YPZB 2DM2A 2VL4A 3KR3H 4PB0L 1OD7A 3ESUF 3Q6GL 3DUSA 1P84J 2YD8A 2AJYH 1O0VA 1RZ7H 2BNQE 2AXFB 4Z5RA 5GZNC 3RWFB 3QXWA 1ZLUK 2QSCH 4WTXA 1LD9B 1GAFH 1T7WA 2DQHL 4OAWB 3BXNA 2OQJB 3MRPB 5KVDL 3DV4B 3VG0H 3VFSA 3QULB 4GBXC 1C5BH 1Z0MA 1A2YB 4HX1B 1B2WH 3FL7A 2XYCA 3RP1A 2YPLB 1G9NL 5FDWA 5E1HB 5HHVL 4IRZH 3NABL 1RZKC 2D4DA 5LAXB 5DEZA 3MO1B 3WFDL 2V7HB 5DD6B 1T1WA 4M61B 1HQ4B 3D87B 5KSAA 3BGFC 5LWYH 3H9HB 4W6XB 3TT3L 3RL2A 4JGMA 2R2HA 5BCAA 4TVPH 5J13B 4HJJL 4UV7L 4DZBA 1KJVB 2CKBH 2NXYB 1AR1C 4UNTA 1AQDB 4QT5B 3BKCL 1T5WA 3WNLA 4F7CA 2Z8SA 1JZ4A 4L4VE 5ACZB 4EXPX 5D96B 1PBYA 2D03H 3UROR 3P9LB 4F15C 2ADIA 4LSRH 1T80A 4F33A 2L4OA 5DD5H 3ZT6A 3R06B 5D6CB 4W6YB 3RUGE 5ID0B 1FNGA 5F9WC 5I1IL 3RBGA 4XAWH 3MCLL 4PJXE 5F89A 4I0CC 1DVFB 3F58H 1N3NA 5CKGA 1UZ8B 4MA3A 1XCQA 4M03A 1EVUA 5B38A 1Q9WB 1QFUL 3GSXA 1IGIH 1A3RL 3HA0A 5IVXE 4GLRH 5D71L 5CCKH 5L0QB 1F4YL 1S9WB 4O2CA 4F2MA 3BGAA 4JG1H 1EJOL 3DROB 4JQXA 3GEWB 4S10A 1TJIL 5IG7B 4WV1B 3BMVA 5TQ0H 3IU3B 4XNMA 2APFA 4U1SB 3KJ4C 4HKBB 3BD5A 4ZAKC 1OWRM 5I1EH 5DWUH 5GGVL 4GRLD 1HSAB 1ZTXL 1TTGA 4PJ8B 2NQCA 3VMNA 4JRYE 1MFDH 3LIZL 3IDIA 5FUOL 5ESQB 2CLRA 5IMOA 1Q9OB 2C7UB 4NOBA 4JN2A 2HFGL 1KFAH 3L1OH 5HYIA 1I8KA 1OP5H 3L7EB 2QLVB 3ULVH 2QADB 1KJMA 4KVCL 12E8L 5SWZE 3RHWF 2XI9A 3V0WH 4MQXC 1WFOA 1JF6A 4TUKL 1RK1B 4RISH 1ZHKA 4N8VB 25C8L 4HKXA 3B8SA 4XP1H 1X9QA 2IANA 1MWAB 2W0PA 3TVMB 2F53E 4PJ5B 4YIQB 2NY4B 3L3GB 1UM5H 3SJVE 3TBYB 2BVUA 1OLZA 4M8QB 1UWEH 1NC4A 2NY1B 1FCGA 4OF5A 4D0BA 1G7IB 2NZIA 2VIRB 4YGAB 5D93B 2BJML 2R9HC 3ZT7A 1NCWL 4ZFGL 1QA9A 1GHFL 2ZSWB 4OLZH 1U58B 1UJ3A 1A1NB 1AJ7L 1F3DJ 3GDBA 2NY2D 2CPCA 2YBRA 3CK0L 1IM9B 3P4MB 1ZA6A 4IMKC 2DD8L 5JZ7C 3MODL 1GXEA 1D9KA 1MHHA 3G5ZB 4N0RA 4MNGE 1U8KB 3T0WA 4ODBD 4HIJA 4OLUH 1AHWA 3FFCE 1AQKL 1NCCH 3ULSA 2IWGA 2X6MA 4LGPB 2VABA 1VFMA 3GJFK 1OGAB 4NKIL 4WWKB 4QHLA 3GGWB 3DI3B 1NFDE 5MI0C 2OI9B 3QUMB 4I3RL 4GRLC 3RVVD 5E08H 3DVIA 5HYSB 4G6FB 1SHMA 4K7FB 4NQEB 1EXUB 1B9ZA 1FO0B 1X6NA 2OTWA 5GS0L 2FSEB 4F80A 5IQ9B 5DJZB 2Z31B 3OB0K 3RTQA 3TH3T 4Z0BL 4N0UB 5B3NA 5E94A 1GOGA 1PKQB 1BOGA 3JBG7 1PZ5B 3BIKB 5J12B 3EIFA 3D3VE 1VGKA 5SV4A 1IGCL 1CDBA 4KJYB 4MAYA 1N2RA 3O2DL 3UPRB 2ITCA 2DQUL 3JV6A 1BFTA 5ICYA 1F3RB 1EH9A 4BFIA 1YPZA 3NAAL 4DAGL 1KIPB 4S1DC 1IGTB 4LQFH 1WAAA 2DMKA 1HXMB 2Z4QB 3RFZC 4TSBH 5TDOB 4TNVF 3GUTB 1I9JL 1LD9A 1U8IA 2DL9A 3BD4A 1YYLH 1FL6B 4OAWA 2PETA 2OQJA 3MRPA 1AH1A 1DBAL 4H0HB 3QULA 3HB3D 2FIRT 3VFMB 2X9XA 2QQNH 4NNPH 4G5ZH 3T65A 3QQNA 3HI6L 2CXGA 2YPLA 3MGAA 5T1LA 5JXAH 3UTQB 3U82B 4EIGB 4MD5B 3K2UL 5LAXA 2EEAA 1WQVT 1JGLL 3MO1A 4Z6AT 1DQJB 2V7HA 2C3GA 1UA6L 4Y16B 3NCYS 4M61A 4XPAH 3VXRD 1BAFL 4WY7L 5TFSH 1Q8MA 4L9DA 5ETUB 1EHNA 1AQDA 1DSFH 3F8UB 4QT5A 5EU3B 1FFOA 4OLWH 5MHSD 1CGUA 1T03H 2FL5B 5ISZB 2VJXA 2ZNWA 5HJ3B 3LMJL 2VH5H 5IESL 2ITDB 3JWNC 4U1HB 1JRHL 3P9LA 2XZAL 3BP7A 3FHAA 3SOBH 5KVGH 2WAHA 3BPNB 5K9JL 1UYWH 4KU1A 2VDOL 5D6CA 1CDCA 5ID0A 2B8OT 4PJIF 1EGJA 1F13A 4ODSL 1FH5H 1MY7A 5BW7A 3OAZK 2FATL 3U1SH 4KVNH 5CBEA 1RZGA 2EDOA 4JZNB 1OHQA 1DVFA 1P4LB 3B43A 1A3QA 3ZKNC 3WD5H 1AKJB 1JNHB 3UBXG 2UYLB 3QCVL 5HHNB 5FYLE 3MCKA 4EI5C 4PRIE 1WZ1H 4PTUA 1OP9A 5F7UA 1I85A 4N90E 5DK2B 43C9B 3QWQB 2R1YA 3NTCL 1S9WA 3RVXD 3C6SA 3VWKB 1II4E 1AGEA 1YMHA 4QHNB 3C2AL 5IG7A 5HGDA 5I1KH 5DQJB 3DX6A 2PYFB 1KCSH 3OR7A 1I7TB 4ZODA 2PW2B 2FLRT 3JV0A 2DLFL 4HKBA 1ND0A 4XWOD 1G6RL 4PJ8A 4PTTA 3C08L 2AP2A 3PWPE 3I2CH 3OF6D 2ZPKL 3L95A 5ESQA 4NWUL 4PJBB 4KGJA 4QCIB 4WFHD 5CHNB 5IGXH 3I02B 3KDMB 3NZHH 5CEZE 4KPHL 1Z3GL 1Q9OA 5INDB 2C7UA 1FIEA 4QOKB 5JPNB 4KY1L 3MA9L 3GFUA 1BJ1J 1H8OA 2UUDK 2XTJD 3L7FB 4YUEH 2BSED 1N5YL 2NY0C 3HNSH 3SGKC 5FOBB 5E8PB 1WBYA 1DUYA 5I8KH 4G6JH 2DAVA 3ULVD 4LRNH 2A73A 1QD0A 4AM0B 3QEGL 4KV5E 5INCA 4CL7A 1PEZA 2YKLH 1MWAA 2D9CA 2XFXB 1DANT 3L3GA 4UDTB 4OZFG 4J3SA 4KMTL 3TBYA 1CGVA 1IC5L 3GBLA 4M8QA 4P9ML 1CGSH 3AS1A 5F6IC 1F02I 4UOW0 2V5TA 5JXEA 4WI2A 4JFQA 1G7IA 3TCLA 5DVLA 3QDGB 2P44B 3SCMB 4EDXA 3SQOL 3IS0X 4JAMB 2ZSWA 4E41E 3CZJA 5CGMA 3W39B 5EZJB 2A0LC 4KMLB 2OR8A 4GG6E 3VFNB 3WFCH 1A1NA 5KSAD 4UUJB 1IM9A 1IC7H 1P1ZA 3SKUD 4K3HA 5FYJL 4FQCH 1RI8A 4TNWK 1A6VL 3WJJA 3QG6A 3RGHA 3G5ZA 1OAZH 4NDMB 2ZUYA 3HZMB 4IIQB 5HYJB 1QFOA 1G7QB 2GCYA 4DKAA 5CD5D 4KROD 4OB5L 1MCFA 4ALAH 3IRZA 3PJSB 5CJQL 5L2KB 1MVFA 1OAXH 5J1AA 1EGJH 4IDLA 1OGAA 1W0VB 4WHCA 3CUPB 1JPFB 3GGWA 1GGIH 3QUMA 1GGBH 1VADA 5KSBF 1RUMH 5LBSH 1NMCB 3VFOA 3WIIH 1GGYA 4QXWA 1A0QL 2IGFL 2BVPB 2JJSC 4N0YL 4NQEA 1EXUA 4TTGA 3KYMA 1FO0A 3MRJB 5I15H 5IQ9A 5DJZA 3ULUL 1PG7L 4O51A 5AZEL 4G9FE 4QTIL 4PJ7B 5DD1H 4N0UA 2G9HB 4XGZB 2VWEE 2CJUL 1PKQA 2XTJC 1PZ5A 1FCCA 2EC9T 4Q0XH 4G6KL 1A14H 1G7JA 4KAQL 4RA0C 1Y6NR 4LF3B 4KJYA 4NQUA 3ULVC 5CP3A 4CDGC 1CICB 5D1ZA 1VPOL 5D70L 2Q7YA 3UPRA 4JG0H 2IPTL 4DN3L 3QAZC 1NEUA 3P30L 1IKFL 5IJVB 3O6LH 1YA5A 3ALPA 1BFOB 2E27H 1LP9F 4ZPTB 4LPVA 1P4BH 2XN9E 1LO2L 1IGTA 3QIWA 1FLRL 2C3WA 2R56H 3H9SE 5HGHB 1HXMA 5BZDA 3U7YH 5F1IA 5TDOA 3Q3GB 3GUTA 1FPTL 3MXVL 3EYOA 4ODVL 4JQVA 2NY6D 1FL6A 3VRLF 5CAYB 4M00A 5A3ID 2VDML 4GH7B 4NO5B 2EDXA 4QRUB 5GJTH 3T3MF 4M62L 1L7IH 1SJEB 1UXSA 5FUZH 2B4CH 1GOHA 1TIUA 3MRRB 1TZGL 1MFCL 5KSAC 1NFKA 5HPOA 1HZHH 5DD3H 1J8KA 1VDGA 4R4ND 5IT2H 4HK3N 1XZ0A 2F5BH 4OTXH 5AYUL 2P49B 3UTQA 5F6HI 4HK0A 1MWAH 2W0KA 5IHZA 3PHOB 5C7XL 1C5DB 1DQJA 5I74B 4Y16A 3SE9L 1YEEH 5K93A 1YN6A 2IAND 4KROC 1JZ3A 4ZPVB 5L88H 3QZWB 2I60H 2ERJC 4LCWD 5GS1B 5CUSL 4HBQA 3BPOB 1NC4D 8FABB 2AQ2A 1K3IA 2WMPA 3QP3A 4KZDH 2P1YA 2HAZA 1IQWL 2KZWA 2FL5A 3BZDA 5ISZA 1HILB 5JIPA 4ZMAT 5L9DH 2DBLH 3MUJA 3GKZA 4YDIL 3HG1E 5F44A 1N6UA 4NC0B 4BELD 1REIA 5J57B 2OLDA 4TN9A 1CU4H 1CIDA 2OSLB 4FQLL 4NKQB 3B2VH 4FZEL 3VGHA 2JE8A 5GISL 3V6BR 1UENA 2AABH 2XXCB 2CRZA 4JZNA 4XPBL 3FQRB 1JBJA 3P0YL 1OAKL 1H15B 3MV8B 4K2UH 1DFBL 2A6IB 4NFCA 4AK1A 4JQXC 4JFDB 2UYLA 4CVZB 5HHNA 5KSBE 3RZCA 4F8QA 4YDJB 1MPAL 1ZE3C 4JFHD 4OKVB 2X1QA 1FZMA 3VH8B 4BSWB 5DYOB 4PY7B 5HGAB 1T2XA 4ZQKB 2BOBB 4CAGA 43C9A 2AK1L 3ZYIA 5E8NB 1CGWA 4F7MA 3QG7H 1FO0H 1ZHBB 3RPIB 3DXAE 2MMXA 4QHNA 1DL7L 1TENA 3AXLA 5I76A 5GGQH 5DQJA 3PWNB 5JLZB 3VU2A 5ANMB 2PW2A 5C86A 1NKRA 2NY6C 2VZ1A 2FLBT 3C6LB 1MFBH 5A3IC 4MCYB 1J11A 3VXTB 3VI4F 5HHMD 4X7TB 1BZ7A 4S0TD 3LN5B 1J1OH 3SE3A 3TIEA 1IILE 1RVFH 5FCUL 2YK1H 3BDBA 3DOSA 4K3DH 3K4DA 4R4NC 3QUZD 2VUYA 4X0KB 2AGJL 3ARDA 5ITFB 1FGVL 4MAYD 5CHNA 1N4XH 4P46B 3KDMA 3I02A 3VFRA 1BQLL 3FOLA 3MLZH 5INDA 4QOKA 4PGBA 1UWGL 5CZXD 3MUGB 4RQQA 5T3ZH 3L7FA 1IM3A 2ATPB 5LQBH 2HT3C 3DURB 3MROA 2ADFL 1T7VA 2GHWB 2R0ZH 1WWAX 2P48B 1JNNL 5C0AA 4LLVB 4ERSL 5C07B 1GC1L 5D7IF 4AQ1B 2EH7L 1IGMH 4UDTA 1T83A 1CF8L 4R2GB 4KHXL 5DMGD 1UJ3C 2PYEE 1IGJA 4NIKB 2J7LA 4GW1B 4PJGE 1UKSA 2KH2B 4U6HA 4BKLB 2YPLD 3F7QA 4WGVB 2K7PA 2Q8AL 3QDGA 4LCIH 2MOVA 4GXVH 2VR4A 1D9KC 3K8LA 4JAMA 2X4RA 1YZZA 3GM0A 5ADPH 3W39A 1AHWC 2VITA 3NIGE 4D9QD 5KJRH 1S7UB 3GIVB 3GI9H 3RGVB 1AO7E 4XPGH 4I2XB 5IMLB 4UV4H 2BMKA 2NXYD 3V7AG 4IIQA 1F3DH 2P5EE 5E8OA 4XNYL 2H8PB 3AS0A 1G7QA 1FVEB 2NX5E 3W9DB 1ZLWH 3ZE1F 3PJSA 1Z9LA 4ELMB 1I1CA 1L9NA 4WTZA 3OGOE 3FAWA 4GAYB 4P2RB 3TC9A 3PV6B 5D7SL 5TJWK 3SGDH 5DVKA 3FT3B 1LO3H 4DKDC 3CUPA 2EE3A 4JHAH 1JPFA 3GSOB 3RTQC 4X9IA 2WM0A 4Q6YA 1BVLB 2FIKB 1X5FA 1KUMA 4PRDB 1J9CT 3UMTA 1DVFD 4P9HH 3MRJA 4RMSA 2R8SL 1DBJH 3UJTL 1XIWB 1MAJA 1HIMH 4MAYC 3HZVB 5KAQF 6FABH 2G9HA 4XGZA 4XI5C 5CZXC 2MTPA 1OCWL 1IGFH 3D48R 5HHQA 1UFUA 4HGKC 4LF3A 4LSQL 1E4KA 4R8WL 1RZ8B 3VI4E 1CICA 3MOBH 2VLJA 1FN4B 3VFGH 2AJUH 3DVNB 3PGCB 5IJVA 5AYQA 2DI7A 4ZPTA 1YMMB 4M02A 4OGZA 2VXQL 4IBLT 5DMGC 4PJ8D 3MX0A 5HGHA 4O2EB 1PX4A 4XBEH 1LO0L 4FQ1L 3Q3GA 5DEGB 2GIYA 3LSOB 4ZUTB 2NW3A 4M1GH 3FO0L 2ATKB 1X3DA 4JGUA 4XCEB 1J0ZA 2B2XH 4TOYL 1SJEA 4I77L 1VSCA 4EOWH 2QADD 2YA0A 5ICZB 3HE6B 3WS3B 3IDXH 1GYAA 3BSZH 4L8SB 5GSRA 2DYPB 1CG9B 1INEL 2Y72A 1X5IA 2NXYC 1RUAH 3SGDI 3LKNB 3B2UD 5DO2D 3PDDA 4WHYH 4K71B 4YQXH 3TVMD 4PJ5D 4ZPVA 2NY4D 5CJ5A 4NUGH 1RHHB 4QTHB 3QZWA 5CZKA 1J8HA 1YECL 5GS1A 1BHGA 4U6YB 5DTFA 4CU6A 8FABA 5D2LF 2NY1D 4PJHB 3NFNB 4DVBB 3GKWH 1ZEAL 3O6KL 4WI8A 1HILA 5BW7C 1CI5A 2FH8A 3EW3B 5E8DL 3LPFA 3NBNA 4LLQB 1EERB 1DVFC 4ZSOE 5D1XB 1C1EH 5E2JA 1UB5B 2EIEA 5HY9B 4PGDB 4JJHA 1IM9D 1MF2H 3PWJB 4POZC 3ZDXF 3ZE1E 4RRPA 1FFRA 3MACL 3SE4A 4X5WB 4NQDE 1MCWW 3QXAB 4LASL 5L0QC 4GMTH 1EHLH 3DSFH 1JMXA 4X4XB 3AB0B 2HFTA 1BD2A 1BEYH 5D7JB 3T77B 2ZCKH 4M7LL 1KULA 4HJGB 4URTB 4XPTL 3VH8A 5DXWA 5DYOA 3VXMA 1E4WH 4BH8A 3IYLW 4BSWA 1OGAD 4UT7L 4WWKD 2LTQB 4ZQKA 3E6FB 5GHWH 5GRZA 5E8NA 2GAZB 4WU7A 4IJ3B 4RFOH 3NA9H 4KXZI 5BXFB 5KG9A 1LVEA 5JW4M 1ZHBA 4WEMB 4LEXL 1LDSA 4PJ8C 1HSBA 1ORQA 1PSKL 4G6FD 5EA0L 1QFWI 3PWNA 5JQ6L 4NQED 2GUOA 5ANMA 2Z31D 3R0NA 2IFFH 3C6LA 3B9KB 2R39A 5ECJE 1IT9L 4MCYA 4A6YL 4HIXL 4O9HH 3VXTA 4WENB 3L3KB 2BSTB 3T0AA 5KS9F 1F45A 5GGTA 3CU1A 4S2SA 2DIJA 5IFJB 3MRBB 4RAUB 4ODWB 3WNKA 1NKOA 2B4CC 5ITFA 1RU9L 3BP5A 1PDKA 1DBKL 5D1ZD 2WWMD 2JCCF 5IHUH 3ZTJG 1U3YA 3MUGA 5E99L 2VDPL 4X80H 4FXKB 1FNEA 5LGHL 3DURA 3DYOA 1QYGL 4CVUA 1TTUA 1BJ1H 3RWEA 3I6GB 1Q0XL 4LLVA 3ZYZA 3O2WL 1WTLA 2NY1C 3OPZL 5F7WC 4EUPB 5JXEC 5C07A 4OM1H 2J8HA 2AKRA 1U2CA 1JHKH 2XZZA 2UWEA 3OAYK 4L4TA 3ZZ1A 4FA8A 5C6TL 4P2QA 5F88A 2ZOLB 1A6WH 3HE7B 4BKLA 1JGUL 4N8CH 1CLYH 4D3CH 3WJJC 1U92B 4TSCH 1U8NB 3HPLB 1TETL 3T0EB 5E9DE 4Y16D 2OR7A 1W2KT 3QEQA 1EJ6A 3FTGB 4J6RH 3MRIA 2BXZA 4U7MA 3GIVA 1ZT4B 4U31A 4JFYB 4O4YH 1IEAA 4I5BB 5C0GA 1KB9K 4OJFL 5IW6A 2AEPH 3TBWA 3C8HA 1F4XH 1NAML 3TESA 2DWDB 3P77A 3TZVA 2FR4A 3OZ9L 2VLRB 2OI9C 3MV7A 1FVEA 3ZDXE 3W9DA 5ISZD 5J9PA 1HYRC 3T4YB 3ISWA 1KN2H 2DQEL 1A1OB 4MS8D 1J1PH 1UT9A 3U4AA 3FMGH 1FNHA 4YNYA 5BS0B 3CVIL 4ZOEA 4D9LL 5AAWA 1M71A 5LKNA 4JRWA 2KL6A 1BVLA 1EFQA 2IPKB 3AROA 5JHDB 4ZD3H 2MWCA 5J12C 4G6MH 5F7LB 4I0PB 4MYWB 3BN9D 1AKJD 5TPWH 3E3QE 3FQXB 4HWZA 5GRVK 1VKXA 4H20L 1CS6A 4WW2F 3ARSA 5D1ZC 3HZVA 2WWMC 2W0FA 1CFTB 3A0OA 4Y2DB 4LARH 3KYKL 1QSFB 4CN1A 4ZUWB 5EU4B 1BFVH 2HKHH 5C0BB 3GO1L 1DE4B 1P2CB 5EORL 2OZ4A 5BVPH 3VWKD 3QIWC 5JW3L 1X4ZA 1RZ8A 1W0WB 1OPGH 1FN4A 3BE1L 3INUL 5KS9E 1MRFH 3MA7B 3P2TA 3DVNA 4GFTB 3PGCA 4JQVC 1YEDA 4PP1D 2D7TL 1YMMA 4M7ZB 5GGTH 5KSVB 4RX4A 5EIIB 1CZ8H 3F7PC 1PZUB 1RMFL 1T2QL 1ES0B 2FO4B 2RB8A 3HKFA 5I1CL 5DEGA 1P7KA 1FFPA 1PGRB 2IBGA 4AIZB 3L3OB 1MQKH 2OJEB 2X89A 4ZUTA 3KPLB 4JQIH 3S36H 3P9MB 5D6DA 3AU1B 2AW2A 2X10A 4QOKD 2YC1B 1CBVH 1BVZA 3BPCA 4QRTB 1WBZB 4KJWC 3HE6A 3WS3A 1F4AA 4UQ3A 3TM6A 2DQCH 3RWHA 3ZTNH 3PUCA 4L8SA 1NSNH 3NIFF 5H2BB 3LKNA 3HAEB 4WDIB 4NFBA 1F5WA 3BJ91 1MCJA 3E1F1 2R0WL 3D6GA 3OL2A 1YJDH 3FN9A 1RHHA 4MNHA 4MS8C 4QTHA 4GXUM 3BPNC 4U6YA 4HULB 2BCKA 2PN5A 5L8KB 2PTUA 4PJAB 3OKNB 5EWIH 2H45A 5GRVL 1AE6L 4K8RH 4TUOB 2B1HL 1QO3A 3QDGD 3SCMD 1BJMA 5ESVB 1YN7A 5CMAB 1MH5A 4LLQA 1T5XB 4OD1L 3MUY1 3MNWB 2WWKT 1LEGB 3UTZA 1UB5A 4ZTOL 1LEIB 3BN9C 2EDDA 3X11B 3U4EB 2IBZY 5HY9A 1SEBB 2FZ3B 1BQHG 4GS7B 3RZCC 4P9HC 3IJSB 2W9DH 5CEXB 5E5MA 3U9PL 4X5WA 1C7TA 1BBDL 2C1OB 4OLVL 3HFMH 5HYJD 3DX9B 4BM7A 1CCZA 5I8OL 3T77A 3UJJH 3OKEA 2X70A 3EOBA 5L2KD 2YD6A 1UM4H 5F9DC 4WFGD 4Z0XA 4RGNB 5CSGA 2YPVL 3SDXB 1SYSA 3E6FA 4RFEB 2EDQA 1WISA 1HKFA 2LVEA 3U2SA 1SY6A 5BXFA 4LOUD 1AD9A 1BF8A 3T1WA 3W5NA 5TE4H 3LY6A 3SE3C 5IOPB 3CXDL 3QQ4B 3IDNA 3MJGX 5I71B 1YQVL 2YN3A 2XZCH 4CMMB 4WUKL 3ARDC 3LKQA 3JZ7A 3HCVB 1JFQL 1L7TL 5E2WH 2OZ4H 1VEPA 2A9MH 2BSTA 4WI3A 5HDQL 3ARFB 3QEUA 5IFJA 4RAUA 3IU4L 2D0GA 3FT4A 4R97B 3TFKC 2VZOA 4Z7UE 3VJ6B 1CICD 2H2PD 3ULVF 1KACB 1JCKA 4KKCD 2DQTL 2JF1A 4P5TB 2WK2A 4FXKA 2DIBA 4Y4HB 5GGRA 2EDTA 4D2NA 2QHRL 3MOAL 4L5FH 5HI4C 2VISB 2AAVA 3WJLA 1S7VA 3I6GA 4LSSH 4ZOCA 4EUPA 4ORGB 3NACL 5IB2B 3O8XB 4J1UB 3VXRE 4XPHH 4PRHA 5KZCB 3EJJX 3RI5K 1MRDH 5FIEA 3OSKA 1JGVL 1CWVA 1QVOA 5HD8C 2A6KA 2BVQA 4R26H 1I7ZB 4QXUL 3TPUB 1F2XK 5MHSE 2DQGL 5DC9B 3HE7A 1F4WH 4NN5B 3SO5A 3GBMH 2F5AL 4XVJL 2E9BA 3QI9B 4HBCH