3RRQA

Crystal structure of the extracellular domain of human pd-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
108
Chain Sequence
NPPTFSPALLVVTEGDNATFTCSFSNTSSFVLNWYRMSPSNQTDKLAAFPECRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKLQIKESLRAELRVTERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Crystal structure of the extracellular domain of human PD-1
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 108
sequence length 117
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rrqA00
5DJDA 2MCG1 4OV5A 3QUZD 1KTDA 3HPLA 4IOIA 3TA3D 2UVFA 2PW1B 5EORL 1ZS8B 1WJ3A 4JFFB 4KMQA 3GI8L 1M7XA 3GSNH 4KJYB 1X6LA 4IRZL 1OT2A 4XWGH 4HPOH 4NWTH 4PGCA 1YJDC 2YZ8A 2ADJB 3REVA 3D0VA 4ELMA 1EIBA 4LLQA 2I24N 1JGDA 4NRYB 2PYEB 4NHUB 2F54B 2IPKA 3BUYA 5D7JC 4RGOH 1BBDL 4X80L 3PABB 2DJUA 4YC2C 3QFJE 4KJQC 5B8CC 1RY7B 3CDFA 1P4LB 2N1KA 3RPIB 3TVMA 1A9BB 3BP7B 1MQKL 1HXMB 3GHEL 1HINL 2EDJA 1TENA 3FQWB 3QQNA 2P24A 1J87A 4RMWA 3JTTB 2AXFB 2H6PB 4HKZB 3WFBL 5E8OA 1G9NH 2YD7A 2BNRB 2DTML 1WCQA 1D5IH 5FF6A 4HIHB 1FRGH 3MLZH 3DLQR 4GAYA 3NABH 3C5SA 4U6VL 5KVEL 3PIQA 5EZOL 3U7AA 4PG2A 5JQHC 1FFOA 3L5WB 4MAUL 2HWZL 4HFWA 1H3PH 4HUWA 4WI3A 1DN0B 4L9DA 4Y5YC 4NT6B 4CAGA 2BXZA 1DEDA 2WNGA 4KH2A 1A6WL 2VXVH 2VXQL 1LO2L 3O8XC 1JNJA 5HGAB 1OHQA 1ORQB 4PGDA 1J0HA 3ZDXF 1A4KA 2PXYA 1DQTA 2AK1L 3PWLA 4MHHI 4PIRF 4YO0B 5E6YA 2ZUXA 1TZHA 2P48B 1OGAB 1P4IH 4LKCB 5IW1B 4AM0A 1RMFL 2A6IA 1IGFH 1KTRL 1MJJB 1WBXB 4HDIA 3IDUA 5JDSA 5IIEA 3FQUB 5BZDB 5C0CE 1MHCB 3BP6A 3MV8D 4XP6H 3HZVA 3W5NA 2E6QA 3EFFA 4WW2F 5BOZG 1U8JA 4Q9QH 2XA8L 4HUVB 1XGRB 5JDJA 3WN5C 5FK9B 5DJXB 5ANMA 5JW4R 1ULVA 5I30H 4C4KO 4N90E 1SY6H 1G7JA 4M6ML 3RU8H 3T4AA 2OP4L 2WW8A 3RNQB 1IAII 3VE0B 3ES6A 3U0PA 1EHLH 3JVGA 5F44A 3MRGA 3KYOB 1HIMH 4Z6AT 1YQ2A 1IEHA 4BSVB 3T0AA 4J4PA 1R3KA 5F7MC 4RISH 1FGNH 1CU4H 3HCVA 1KCVH 1J1PH 5GGVH 1UB6B 1T89C 4MQ7A 1NLBH 4KUZH 3Q6GL 5I1HH 1OGTB 4NQEB 1U58A 4OZ4B 4F9PA 1NC4A 2VLKD 3U6RB 3VXUE 2EE6A 1MCSA 2CGRH 3GMNB 4DAGH 5FYJL 1G7PA 2X7LA 1DE4A 1KLUA 2VDRH 4QXGL 2DMKA 3O3BA 4ZFFB 2DM7A 3LDBC 4XI5D 3O0RL 2HAZA 5BZWA 1RU9L 4PRAB 2MQ3A 2W0LA 1DQMH 3K0WA 4X83A 3QDME 5J1TC 2UZYB 1GOGA 2Z93A 3G08B 1KCUL 3VI3E 5IMOB 3FONA 3SGJC 2ADIB 2VSDA 1YDPA 4CN1A 4KK8C 4TPRH 3E8UL 3K2UH 5F6HJ 5L7XH 4F2MA 1F8TH 4LAJH 5INDA 3UTZA 4PRDA 5J11C 2JIXD 5D2NA 2Z4QA 3X14B 2FRGP 4MS8C 3SQBA 3S35H 3IFOA 4JG0L 5DK0A 2IPUK 4RAUA 3BQUD 5DQ9B 2BC4A 3D5OF 4ZPVA 2LU7A 1B0GA 4PRPD 4QRRD 4C56B 2CLRB 4LARL 1FZKB 5SV4A 3NIGE 1H0DA 1YEKH 4NQSB 4H5SA 4XNUL 1Q9KB 2E7LC 1DBAH 5J89A 1HHKA 2PTTB 4V1DD 1JF1A 4UT6L 2Z8RA 1OPGH 3GZKA 4LRIC 1B3JA 4BYHA 1C5DB 4JRYD 1RUAH 3LPWA 4ZD3L 1IBGL 3HR5B 3DVGA 3QH3A 4X6EA 5GHWH 3NN8B 1RURL 4NC0B 4FTVB 2ZJSH 2J2ZA 4AYFA 1ZANL 4FMFA 5DD6B 4OZIF 1LO0H 2MJWA 4NN6B 1U6AH 3TO4A 3UYRL 2VLMD 2DQUL 2VLME 1NPUA 3PGFL 4NHCL 4PS4H 2YSSB 4R3SA 2FJGA 5CGYD 1S9XA 5JLZA 4G80B 5J6GA 3SDDD 4QRUB 5HDBE 4ZSOB 3UPRB 4OGYL 5GJSH 4BUHA 3TNMA 1RZKH 1M4KA 2GFBB 1C16B 4ODTL 2VTFA 3JWDH 4IIQC 2YK1L 3MRQB 5F7YC 2PCPA 2CDEB 4XHJD 3BRDA 1KLGB 4XNQB 1AXTH 2AV7A 3VRJA 5F3HB 3WXWL 1KIQB 1VCAA 3ARBC 4P48A 2JCCA 1LO4H 2EXWD 4I2XA 3TA3A 3BOVA 3IDIA 4XBEL 4HEME 4JLRA 1V05A 3IRPX 1VSCA 5CP3H 4O02L 3T4YA 5EOTA 1Z9SA 2H9GA 5BRZB 5D93B 1F3DH 1BX2A 2C1PB 4LSTH 4XCNB 1JWUB 3L3HB 1XGUA 5ISZB 2XWBA 3TBVB 3O4LB 5MERA 2R0KH 4GW1A 1BF2A 3KPSB 1FNSH 1QFUL 3B3IB 4XC1H 1NCBL 4A6YB 3H42H 2DOCA 5F7EL 3EYFA 2VSCA 1B0RA 1PSKH 3D0LB 5GGQL 2V5TA 1X5JA 1CYGA 3EO0A 1DANU 1I1YB 4YHPB 4KHTL 4HAFA 5EU7C 4K8RH 1FH5L 5B3JF 2DQFB 4JG1L 4LSQH 3EO1B 4JFXA 4HJ0D 1QQDA 3KPQA 1C5BL 4LVEA 5LXGL 3WE6A 4MHHG 1KTLB 3EHBC 3CMOL 5E9DD 1CDJA 2V5YA 3SPVB 5HHXH 4OCWL 3FO9A 1KELH 5C0ND 3W39A 3HUJF 3IVKA 2PYFB 2DQDH 5D7IF 1M71A 5ESVA 5HD8C 3WLWC 1XH3B 5IT2H 2VABA 2RR3A 4ZOBA 2H3NA 1P7QB 1NCCL 1XF5A 2HMIC 2R9HD 1OCWH 3ZE2F 5F9AC 2ICES 2CR6A 3VWJD 4EUPH 1MJ8H 2AW2A 4GO6B 1Q1JL 4GUPA 4XHQA 1J12A 5TQ2L 3QA3B 3CDYA 1WEJL 4NGHL 4NYLB 1U8QB 3SDCA 1F4YH 5C0BB 1I1AA 4PJ8B 1YNKH 1OM3H 2F8XC 1GCFA 2CH8A 5E2VL 1KPUB 3GSWB 1TQBB 5EG6C 3VMPA 1BQHG 2PR4L 3LSOA 4PV8A 2EYTB 3SGJA 2W9EL 1IL1B 4QY8A 1CFQA 3HC0B 3ZKMC 4JANA 2VLRA 4YLQT 4C4KT 4GW5B 5HGHA 4RGMB 1UCTA 4O51B 3QCTH 5GRYA 4AIZB 1AHWC 4H88H 1SEBB 3GSRA 4Z7WB 1IQDB 2HJLB 2AJZA 4N0FB 1KGCE 2H32B 2PO6C 1NKRA 2Y36L 4XP1L 1OLZA 4OM0H 5E7BA 3P30H 4S1QL 3SDXB 1C1EL 2CR3A 4CL7A 3GMRB 1EMTL 1T2JA 1T6WA 3LKPB 1S3KL 1MNUH 4GRLB 2P47B 4KMLB 5AZ2H 1IKFH 1FFNB 3TJEL 1XF2A 4XX1E 1LILA 4JPKL 3CJJA 3WHXB 2ZG2A 1VFUA 1A4JA 3QEQB 1EZVX 5TDNA 1OTSD 3LKOA 3GO1H 1AO7D 2GTWB 3VGGA 2H2SD 1YJDH 2ZG3A 5BQ7A 5H94A 4FABH 1U2HA 4YH6A 3OZ9L 1WZMA 4P23D 4OFYD 4HUXA 1IAOA 1ONQA 4NUGH 1I4FA 2NY6D 3ARDD 3KAAA 1F4WL 1DQQB 3WS6C 4KROD 3C87A 5F6IB 2VDOH 4QHUB 3B5TA 3QUXA 3GMMA 4PD4J 1YMMD 1YMME 3T77A 1HXYA 1M6OA 4JFDE 5I1IH 5I71C 2Q76B 1RZFH 5I1EL 1YY8B 1F3JB 5LQBH 1AP2A 4P59H 2JIXA 1AGEB 4W68A 1XCQB 3AS3A 4QWWC 4TSCL 2BSRB 1U3HB 1G84A 3OAYH 2F9BT 3MRDB 4OLVH 4LVHB 5J6HB 4PRPA 4NZTH 5CJ5A 1BVKB 4JDTL 3G5XA 3BESR 3MUHL 1GGBL 3ROLB 4MLIA 4J8RA 1J05A 4L8DB 2DQEH 1S78D 4ZUUA 3HG1A 1P9MA 2WLYA 1OOAA 4YFDB 3AM8C 4OCSH 4CNIA 2VNCA 3VXNA 4KTEH 5J3HD 4OI9A 3QJHA 1JNLL 5EIVA 3MRPA 1KF9B 2L4OA 4XAWL 3K46A 4JRYA 2XQYK 5DWUL 1CD1A 1HQRA 4ONFH 5MEND 4DCQA 5F3BA 1OARL 3UMTA 1CL7L 5DJCA 5HVWA 2YA0A 2BERA 1KJ2H 3T3ME 4NNPH 2I9TA 1PD6A 1SMAA 4GRWB 4XCCL 1TQCB 5LAXB 2P8PA 5C6TL 4ZS6C 3BGFC 5D6DC 5D2LF 3MXWL 4PY8I 2X10A 5GGSB 1K8IB 3VFNB 1FN4A 4RWYH 3T08A 43CAB 2R1WA 1HHIA 5DUML 2I9LA 2V6HA 5FHBL 3UJJL 4JQVC 5JTWA 1E6JH 2YRPA 3SDDA 4ODSL 4YFLF 3WSQL 1QBML 5L9DL 4OLYL 3M1BA 5C0IB 3IDGA 5DEFB 3VFPB 4I5BB 3ZL4H 2DYPD 4RDQG 1I3GH 3RVTD 1U41A 3O3DA 1EERB 4CMMB 4Z7VA 2H1PH 1KCKA 3L7FA 4AT6A 4E42A 5I17A 1MWAB 3IDXL 1BZQK 2XZZA 4URTB 1CFVH 1J18A 4I48A 1EO7A 4PLJC 2DM2A 4FQ1H 1ZAGA 2AS5M 5IVXE 1IQWH 1FZMB 5E8NA 3KJ4C 4HWBH 4ODXB 1RIVL 4LASH 4MA1C 1WFOA 4XGZA 3VGEA 3D1MC 3JWNC 5DJZB 2R1YB 4CRPA 5F9JB 1FHGA 1IGJB 5EU5B 5J57B 4YZFE 1EEQA 1XT5A 1ZWIB 1ADQL 4R96B 2NY0C 3FRPA 4Z78A 4F7EA 4NJAL 4H20H 5F7KC 1CLYL 4Z95L 4YHKH 1QNZH 1GJIA 4AEHH 1C08B 1BVZA 4PJXE 1HWGB 1IGYA 5HDQH 4JHWL 2ZSVA 5IFAL 5TDPB 3MRHB 4MAYC 4XNYL 1QEWA 2YKLL 5FO8A 1KNOA 3QDAA 2A9NL 2VLJB 3S6CA 4PJ7B 3I3DA 4WWKB 4XP4H 3O11B 3WUWB 5DI8B 4K7PX 4AEIH 4A2MA 3WS3B 3PHQA 1MCWW 2COQA 1OSPH 2VN4A 2PW2A 4X6DF 4HKXA 3HPJA 5E9DA 2K3TA 1X4ZA 4JB9L 4MVBC 4U33A 1R5VB 3S3JA 4C57C 2BCKA 1CD9B 1WIUA 2AJYL 1LD9B 1MSPA 2AJSL 3BMVA 3VGHA 5KS9E 2YRZA 3H3PH 3VCLA 1UWGL 3G6JF 1QHPA 1GH7A 5F7DA 2HVKB 4O9HH 4TRPL 3ZO0A 4M48L 3MGOA 4JJ5B 5FV1L 5D72H 3BPCB 2OK0L 3L9RA 4OM1H 1XIWB 5IFJB 4NO3B 3TT1H 2X4OA 5EOCL 4L8SB 3SJVE 4MQXC 4DOHB 5BV7C 3GSVB 3V6ZA 1OAZL 4OLXL 1ZLWK 3WEXA 3CVHA 4KRNA 3QDJA 4WTZA 3QIBA 1A7BA 3NOIA 2NY3C 1Y0LB 3T1FB 1HEZA 1N8ZB 3ARFB 2Q86B 1T3FB 1OP9A 1T80A 4M6OL 5KSUB 1G7HA 3KLDA 3NIFE 1FL3B 5IROC 4DEPC 4YHIB 5KW9H 2QQKL 3V4VH 5H35A 4XH2A 1VFMA 4EI5D 1M7DB 1KXVC 5E8DL 3QAZB 5HI3C 2A6DB 2C3HA 3GSQA 1ZA3A 2XY2A 1RZGB 2J8UF 3G04A 5CIPA 5CBAB 5TDOB 5DZLA 4JFED 4TVPH 3MLWL 4PJEA 5AUMB 4ZUTB 4QGTA 2E5EA 3LKSA 1GZQA 1H15B 3QQ9C 3DGGA 5JHDE 1NJ9A 4GJTB 1NCAL 2P4AB 5K9JL 3WO3B 1BBJA 2R0LH 5GJTL 4YBHA 5HHQA 4OFVA 4ZAKB 1ZE3C 4NQTA 5DVNA 5CILL 5JXED 4LLVB 3GMLA 3MYZA 4QT5A 3P4NA 2WBJC 2DLFH 3C2AH 1N64H 2FYYB 5FGSA 5GS2H 3VXRD 2G5BB 1W0WB 2YR3A 1K3ZA 4HFUH 4Z5RB 3MRLA 1EHNA 1EO8H 3CFDA 3I9GH 5BVJB 3U9PH 1TPXC 4DN3L 5DMIH 3M07A 1AO7A 5FO7B 5BVPH 2NYYC 4OT1H 4XNXL 5I1LB 1BWMA 3D18A 1GHFL 3KPMB 4P23A 3B2VH 4LRNL 5BCAA 3W9EB 2EDHA 3TBWA 4ZTOL 5E2WL 3ARDA 3P73A 3GMQA 2X4TA 2DQCH 1T5XA 1T04B 5JW5B 3KNBA 4L8CA 2EYRB 1MY5A 3MFFB 4YDJB 1KENL 4R0LB 3MRCA 3RWJA 1YQVL 4OD2B 3WCYA 2P8LA 4S0SD 3BE1H 1HSBA 3P40A 2D4DA 5FKPB 4D0BA 4JDZA 3FT4B 3MRMA 5IBTH 3EGSA 5CLTA 3ZTNL 3NFSH 1A8JH 1JRHH 5GISH 2BRQA 3UEZA 3H7BA 3HE7D 3RJDA 3SE9H 5TE7H 5ACZA 2PUQT 5HVFB 1A6TB 1ACZA 1SBBA 4JY5L 1JFQL 4FQXA 4H25B 1F45A 4UTAL 4MJIE 2ITDB 3U0TA 5HYQB 1OTUC 3U1SH 4PLOB 3BEWB 3CFBA 1E4XL 4DVBB 4ZS7L 1T1YA 2NW3A 1MCRA 4U6YB 3N9GH 3WIIH 1LK2B 3NCFB 5GZOC 4GS7B 5C0AA 3UTSB 2CK0H 2ERJC 5IMMA 3C60B 2DM4A 4R4BB 2A6KB 2EH8H 3OR6B 3C8DA 4HEPG 4PJAA 4R26L 3TH2T 4PJFA 2R15A 2QEJA 2XRAL 4F7MB 1AIFA 1MAKA 2R69H 1NAKH 2DDQL 3RZCD 4JFOA 3A6OA 3Q5TA 3IXTB 3LB6C 2FO1A 4EN3D 3MCLH 1V3JA 3M17A 4H1LG 2GK0A 4M7LL 3D39D 4UV4L 2DYPA 5E2UH 5GRWA 2DKUA 5ERWB 5JA8B 4HF5L 5C07E 5C0JB 4F7PA 4S11A 5LGJA 3LD8B 15C8L 2Y5TA 3STZB 4G42A 1CXEA 1KJVA 4DVRL 1BOGA 2VZOA 4LCWB 3Q0HA 3BH8A 4Y16A 3HS0A 2IEPA 1M7IB 3DV4A 2AEQH 3VFGL 4X4MA 1LEIB 4RNRA 5DA4A 4BZYA 3KXFD 3P4OA 4G8GB 4OIBA 5T1LD 2CIKA 2EDXA 1R3HB 2B0SL 5EUOB 5GSRA 1I8IA 4PJ5D 4PJ5E 1HYSC 1Y18A 4MCYA 1VEOA 2XTJB 1Q38A 1U95B 5T1KD 4DZBA 1GIGH 4MCZA 1UWEH 1L9MA 1ZVSA 3CVHH 1CDCA 5D7KE 1EH9A 3JXAA 2KZ1B 5T1MB 1A1OB 3BWUC 4WHCA 1HI6B 1VA9A 4P5TD 5IP4A 4HIJA 4E5XB 4NQCD 4NQCE 3TIDB 1VGEL 4LKXB 1LE9A 1WSST 2LE9A 2FD6H 4UILL 5FYKL 4GG6F 3OKOB 2HJFB 4HK3N 4YHYC 5EU6B 5ANME 2V17L 5DEGA 5E6IB 4KZDH 3BRFA 5CIPH 3EKCA 5K9KB 2E6PA 1MIEL 4IMLB 4PJCE 1G6RA 2CLZB 5GS0D 2GY5A 4U1LA 3RWHA 4PREB 1I7RB 3QFJB 2Z92B 2NZIA 1UH3A 2D7MA 3I6GA 1AD9A 5JPMB 3O6FB 1IFHL 3P77B 5I1DA 2R29L 3NFNA 1FLRH 3A6CH 3RUGA 4KTDL 4K3EL 3G6AA 4XZUA 4HKJA 1XGTB 4P57B 4PTUA 4RAVB 5BXFA 1CCZA 5E8PA 4KWUA 4EOWH 3DO3A 4LQ1A 2H8PA 5ITFA 2DKSA 3W2DL 3LEVH 1T0PB 3QIUC 1GZPB 3GNMH 2DWDB 1RVFL 1DVFD 4NO5B 4BJLA 1K8DB 1VERA 2A9ML 3TBSB 1R5IA 2ITCB 4ISVA 5DTFA 5H2BA 3L95A 4NO0D 1NFKA 5HYJA 5HHOD 1YPZA 2D4FA 3O3EA 1KULA 3RGVB 1CD0A 3GMOA 1NC2B 1KN4L 3AAZB 1FG2B 5ESQB 1CFSB 4JO4L 4HWZA 1J11A 1MRDH 5DJAA 4X6BA 1VGKB 5FOBA 3P9LB 1T1ZA 4FFZL 3MOBL 4AZ8A 5HY9A 2HFEB 3QEUB 3HNSH 5GS1C 5GGTH 2AK4D 4DGYL 4O58L 3WIFB 4I8DA 2FHCA 5D2NE 3UP1A 3VFOB 4M7KH 1JWSB 5FUZH 4PB9L 5HYSG 2WMPA 3O6LL 1AKJB 3VFMB 4LLDB 1F00I 1RJYB 5DK2B 5C0CB 4C59B 3FRUB 5D1XB 2H26A 4N0YH 3P0VL 3LKNA 3L3KB 4IOFC 3FQRA 3KHQA 1URLA 2HN7A 4MJ5B 4WCYH 1BAFH 4PJBA 5IMLB 4K9EL 3TESA 1CE6B 3L5XH 5J12B 3T3PE 3V0VB 4RBPH 4JKKA 3K2MC 4M7LT 1RIUH 3H7LA 4YUEL 1VADB 2NY5C 4JHAH 4X6FA 2RIKA 3GKWL 2GT9B 5D7JD 2I27N 4KJQD 3ARVA 3SQOL 3WL9B 1LE5A 1V8HA 5DVKA 5DD1L 2AP2A 4H26A 3QG7H 3F12A 1WZKA 2ZUTA 3PV6B 2DD8L 4M5YL 2GUOA 2FBJH 2PF6A 2R23A 2XG4A 1RJLB 4O4YL 3GM8A 3DUUA 4JM2A 3VFTB 1TCRA 4HHAB 4HMCA 3MJ6A 2MCPL 3VXPA 1P4BH 3VXUB 3WIHH 1KB5B 3DURB 1LO3L 1P7KA 2Q7NA 1BEYH 4MA8L 4P2OB 1W0YT 1ZA6B 4M61A 3FOLB 1TFHA 2HT4C 4N0UE 2NY2C 3DRQA 4Y5XA 5ICYA 3WO4C 5E08L 3QDMB 4XBPB 5EZIH 3C09C 4K94H 5SWQB 32C2B 5SWSA 3CLFH 5GS3A 5JR1L 1NMAH 3TBYA 3IKCB 1D6EA 4HT1L 4ZXBB 2DM3A 2JCCE 4I2XE 3MRKA 3OKLA 2O61A 3AVEA 2Y9RT 3UTTD 3SOBH 1J1OL 3HHRB 4DZ8B 4YWGL 5HBBA 3BZFB 1ES0B 2FEEL 3BQUB 1FBIL 4YE4H 2Z91A 3DBXB 4LSRL 4YHZL 2WBWB 2DJ4A 1JGVL 3QDGD 5ID1A 3PE9A 3MUGB 1MUJB 3ARGC 3LRHA 1D5BA 3OKDA 2XKNA 1I85A 3MRIA 5DRXB 4JVUA 1CVSC 5LGKA 3GI8H 3RJQB 3AY4C 4IRZH 3ZKXB 3LMJL 3NCYS 3VMNA 3W81A 5CEXB 1NL0H 4U1SB 3FO1B 2P5WD 5ID0B 2YBRA 3JV6A 5IK3B 3CDGB 1PZUB 4U1NA 4OZGA 2KL6A 2NXYB 3GMPA 4X98B 1A7PL 4I18C 3NGBC 3QZWG 4Y4HC 1BBDH 4X80H 3B6SB 4Z0XB 4DFHA 3VI4F 2DBLL 2FIRT 3OGCB 3WKMH 5CJ8A 2BHUA 3LQZA 4XVTL 5CD3A 1MQKH 2B1AH 3GHEH 4K3JL 4YIQB 5F7WC 1HINH 1R3JB 3CU7A 3KWWB 1AXSA 4KUCF 4HQQL 5EU4A 4CVXA 1QUNA 4OAWB 1IKNA 4KAQL 3WFBH 3KS0H 4D8PA 1PY9A 1FFPB 4RZCA 1G6RH 1MRCL 4Y4FA 2DTMH 5IVZB 3T0WA 3FFDB 4JQXC 1BQHA 3OAZH 1OSZA 1XCTB 3OG4B 5FHAL 5KVEH 5EZOH 4D9QE 4ZFOL 4LCUA 5T1KA 5ETUB 4MAUH 3ORJA 2C4FT 4HGKC 2HWZH 2JTDA 2IBGA 4NKDA 1N6QH 3VRLE 4MDIA 3VWKC 1FVDA 1MHEA 4GLRH 4P5TA 4KK8D 4X5WA 4ZDHA 1A6WH 4GRMB 2VLRE 4MD4A 2ZSWA 5DRZA 5ALBL 4LPVA 1KBGH 4MS8D 5DRWB 2IH1A 5CD5C 2AK1H 4FQQB 2OTUB 2IC2A 3JV4B 3MRNA 4BZ1L 5KTEL 2W65A 2UUDK 3L3DB 4M4RA 2HT2D 4WGWB 5D6CB 3AS0A 1RMFH 2IQ9L 4Y4KA 2OI9B 5IQ9B 3QIWC 4NRZB 3BEVA 1G7LB 4ZUWA 5FO9A 1A0QL 1UYWL 1BFOA 4P2QB 1IZKA 5IB3B 4KKLC 5GZND 2XA8H 2GJ6B 4NKOA 1FFQA 2X4RB 1UZ8B 2FWOA 2JLLA 4O2CA 5I1AA 3SY0A 3UAJC 2I60L 2F19H 4M6MH 1UJ3A 2OP4H 5SX5K 4PJ8C 1DVFA 3BHBB 1A7NL 5JXAH 2OZ4A 8FABA 2C1OA 1AGDB 4WI4A 5C9JB 1RZJL 5KSAA 5HHOA 2IADA 1S7UB 3KPNB 1HZHH 3MV9D 4HGWB 4PRIE 4XWOC 1J8HD 6FABL 4WEUD 3O9WA 5ESAB 1CIDA 4X6CA 1U8MA 2BMKB 4PRBA 4HS3A 3Q6GH 2J6EL 4OLZL 1A47A 1SJVA 3I6KA 2XT1B 3C5JB 3ZE0F 2OBGA 4U1MA 2AK4A 1MFAL 5FYJH 4QXGH 1VACA 5F7NC 3FO0L 4EDWL 1MFCL 1A3LL 3ARBD 4FG6D 3O0RH 3ZTJG 1RU9H 1AGCB 1CR9L 4AEFA 2VISB 3ISWA 2VE6A 1QSVA 1S7QB 3MRFA 4GRLC 3T8XA 3PQYD 1KCUH 1YEHL 2C3GA 4R97C 4ZO9A 4QHLB 3E8UH 1FYTA 3HG1E 3REWA 3BXNA 1QACA 2FR4A 4GG8B 4L3CB 2XV6B 3MRBB 1AY1L 1WWAX 4JG0H 4FNLL 3BMWA 1JPFB 2A0LD 2NR6D 3HZMB 3KDMB 4P2YA 3TN0D 2OR9L 3TFKC 1RUML 1NBZB 3MCG1 4RMVA 4ZO6A 4LARH 4Y5VA 2V2WB 5GGUA 4PJGA 2EKSA 1KCLA 1CQYA 4XNUH 5EBWA 2CLVA 1CG9B 1I1FA 3MRJA 5EU7E 3Q6FB 4UT6H 3SCMC 4PRHE 4Z7UE 3V6OA 1L0XA 4XNMB 3B9DA 3CFCL 4I18A 4Q9RL 2X1WL 1F6LL 2XIDA 2BNQE 3T0XA 5IB4B 2RHEA 3P4MA 4ZD3H 1U3HC 4LDLB 5T3ZD 3T65A 3UTQA 5T3ZE 5IB1B 3RP1A 1RURH 3C5ZB 3S3PA 1N59A 2FECI 5HD8D 5FECA 5IOPB 1ZANH 2CUHA 1F2QA 4K55A 4E41A 4TULL 3UYRH 1NEZB 2DQUH 3B9VA 1G7QA 3HE6A 1CDUA 1HH9A 3PGFH 4NHCH 1S7XB 4JQXA 4WDIB 5AAMA 3VDBA 1EUTA 4JFDB 3GB7A 3OV6A 1P84K 3G5VA 1FNGA 1MCFA 2E27H 3UTTA 3HI1A 2DWEA 3KLAB 4ODTH 1W8OA 1UEYA 2MPAL 5C2BL 1JMXA 2YK1H 4OZFG 1W72L 1SYVB 3C9NB 3ARSA 1KB9J 4PBVC 3WXWH 1F4HA 2VQ1A 3U83A 3PWJB 2ICWB 2F53D 3RWEB 3OL2A 1TVHA 4XBEH 1T21A 4XPFL 3L5IA 4O02H 3WFCL 3EDEA 3TWCH 1WBYA 4F3FA 2BOCA 4YHNA 3PGCA 5EZJA 3C6LA 4HULB 2M26A 4S1DD 2VXSH 4APQC 1U92A 4RX4D 5HTSA 4KI5F 1QFUH 1BFVL 4NN5C 1HNGA 4JZJA 4JY6A 3M8OL 1NCBH 3SGDI 4KKBD 1WWBX 5FFLA 4FHBD 5F7EH 4JHBA 1IGTA 3LOWA 2GCYB 4TYUA 5E70A 4BH8B 5GGQH 4ZPTB 2GTZB 1N5AB 5D8JL 2JJTA 4XXCC 4JG1H 4JRXD 1E27A 3CNKA 1C5BH 4PJ9D 2XWJA 1F90H 4NUJA 3CMOH 3BWAA 3RL1B 3LHPL 2FL5B 1UQSA 5L2KA 2CRYA 4M93C 1PQZA 4OCWH 1CXHA 2G75B 3FQXA 3EYOB 1AGBA 3DX8B 4QOKD 5EOCJ 3BPNB 1CICA 3CFEB 4LPUA 2D2OA 2W60B 1FV1A 2ESVD 2Z31C 5EIQA 4Q6YA 1NCCH 1A5FL 4YGVB 1CVRA 1IAMA 3GSNB 3LN5A 3QWOB 5HHME 3KPLA 3F5WA 2EICA 4U1KB 2Q8BL 1P2CB 4JFQA 4I9WD 4ZQKB 3DSFL 4IMKC 1B4JH 3KHOA 2L0DA 2VZUA 5FCUL 5TQ2H 3RIAF 1J0ZA 4KQ3L 3N50A 2JJSC 3F7RA 4U6XA 3RWDB 5K9OB 1WEJH 2BVOB 2HT3C 3DYPA 4NGHH 4Y2OA 4PJEE 4HH9A 1N0LA 5E2VH 5IV2A 2IAMC 3DIFB 7CGTA 2PR4H 5I16B 4PJXB 3K4DA 3RIAK 2W9EH 1QSEB 4L1DA 2AI0L 5JORB 5CMAB 3MC0A 4L1HA 4U1JA 3PWUA 4LGPB 3Q2CA 1D7FA 5KSVB 1NFDE 4K3DL 1KEML 4YXLL 5MI0B 3WFHA 4MNHB 4EVNB 2Y36H 1QLRA 4JN1L 3GSOA 4FFVC 4S1QH 3ARFC 5GSVB 5KS9B 1C1EH 4KRPC 5D7LA 4M43L 1EMTH 2VL5A 2IWGA 2D31A 1NGXB 5T3XL 1G9ML 3DVNB 1S3KH 4U31A 3S4SB 1KPVA 3ILQC 3TNNB 7FABL 3V5KB 3QAZC 3TJEH 1MY7A 3MV9A 3ZYJA 5CEZD 4JPKH 1J8HA 4RGNE 4FFWC 3QB7C 1WISA 3OR7B 3SJVB 3ZDZE 3MYJB 2ZG1A 3QXVA 4K3HA 1NGWA 3BKYL 3F6LA 2JB5H 1ZKAA 4Q6IC 3B9KD 3LIZH 3NH7L 4L4VA 3OZ9H 2CDGA 3FB5A 2CRMA 2DLTA 3BKCL 4NN7C 5DHYB 2FO4A 3IJHB 5AEAA 2FIKA 5J0BA 1A6UH 1A6VL 1F4WH 5DSCA 4NPYA 1EPFA 4HXAL 3FQNA 5MEQB 3QNYA 4EI5B 2XQBL 1SHMA 1F58L 5LGHL 3GGWB 4X8JA 3DMMC 5KVDL 3PL6A 4HZLB 5I1EH 4GW4A 1FIGL 3FN0L 1KIRB 1XR9B 5EBLA 1G1YA 2YPLD 2NY0D 4HIEA 3PWPA 5JHDB 3C6SA 1R5WA 5E1AA 4TSCH 5IJKC 3MCKA 4CBPA 3D3VD 3TN0A 5GRVK 3U9UA 2AXHA 3OXRA 3ILPA 3ARED 2ICEA 4UIKL 1BP3B 4KRMB 3A0OA 5JOPD 1GGBH 1PYWA 1NLDL 4MAYD 1S7RA 3MOQA 3QUMA 1EAPB 4L29B 4Y1AE 4M1GH 2APXA 1R0AH 4WI9A 3INUL 5FGBC 1JNLH 4R0LC 2OR8A 4APQA 1Z9LA 3X3FL 4WNQB 4H1LA 5DURB 1JZ3A 2R39A 4PJAE 1UGNA 3TCLB 3R06A 2QADD 4XAWH 4IHOA 2Q8AL 5DWUH 1UM5L 4JFYB 4KKAD 3WJJC 3SDAB 4XPGH 4R4FL 3VRIA 5HHNB 1OARH 3F7YA 1CL7H 4P9HL 3QFDB 1Z2KA 3OHXA 3U46B 3FB8A 4X4ZA 1BMGA 4NWUL 2FX7L 4XCCH 5JOFA 5C6TH 1S7WB 1E4KA 5KBNC 3MXWH 5EU3A 3B4NA 4YDLC 4RFNC 4XXDA 5H37H 3MV7A 2HFGL 5DUMH 1LQSR 5FHBH 3UJJH 2J3SA 2K9UA 4JREB 1H3UA 2GSIA 4N1EA 4ODSH 3WSQH 1QBMH 1YEDB 4OLYH 4YEFA 5L9DH 1IM9D 2IGFL 4HPOL 2XWTB 3QXAB 4QRTB 2NY3D 1CGWA 1QFOA 3I3BA 3NIGF 3D85D 4L4TD 3LH2L 2UYLB 2NZ9C 4QRSA 5BS0D 2OXHA 4KJWC 4X4ME 5JQ6L 4TN9A 3ZHLA 1D3CA 2APTA 2ARJA 1ZGLB 3IDXH 1EZVY 3U36A 4GBXD 3TYFA 3WFDL 5HI3D 4ZUSA 2F53A 4MB3A 3H3KA 3ALWA 5IEHB 1RIVH 1DBKL 1Q9OB 5FYLD 4GQ9L 3IDNA 4K9EC 3HPLB 1YY9C 3E6FA 2IAMA 4MJIB 4X9GA 4WW2A 3RNKA 4F9LC 2WINA 5LKNA 1D5IL 3JTSA 1FPTL 2Y7QA 5DMYA 1ADQH 4HIIA 1FRGL 5FOJA 4FP8L 3IAQA 3V9FA 4NJAH 1BIIB 4Z95H 4X7FC 4UINL 3S98A 4JHWH 2WBJD 5IFAH 4MXQC 1WIOA 2GEEA 3GRWA 4ELMB 4NSKA 4XNYH 5D1QD 1J86A 2YKLH 5I1JL 3HZYA 3NZHL 4UIMA 5CHNA 1NUNB 3F8UB 2A9NH 5I75B 4KGJA 4FZEL 1CDYA 2IMMA 5B38A 2Z8VC 3DYOA 4JRXA 2VXVL 3RZCB 3TVMB 3G6DL 3IYLW 4XPTL 4Z7VF 2HTLD 3OG6B 4P46B 2NPLX 3PWVA 4JB9H 4QRPE 5E8OB 2AJYH 1MHHB 1YMHA 5F88A 2IAND 2VYRE 3E2HC 1FO0L 4LPWA 4R4ND 1UWGH 3LV3A 1XFPA 4WWID 4QOKA 4G6JL 4NBYB 5C07B 4TRPH 2AXJA 4M48H 4CVWA 4TVSa 4CJ1A 3IETA 2VQUA 3LKQB 4GAYB 2GSGB 4EQ2A 5E95B 2P49B 3C5SB 4JCMA 2OK0H 3OWEA 3RX5A 4IRSD 1ACYL 5HYJE 4Q6IA 1E6OH 1YPZE 1BD2D 4HFWB 4AG4H 1OAZH 4OLXH 5EC2B 3I75B 3RDTB 3RY6C 4OBSA 4BA8A 5HHVL 5IVNA 1A22B 4BKLA 5HYSA 4LEOB 3G5YB 2AVGA 5T1LB 4AIOA 4X4YA 1KTKE 5E6IC 2KUTA 2Z35A 4M6OH 2VL4A 4PJ5B 3UTPE 2ENYA 3RKDC 5C08D 1ZXQA 5SWZE 2QQKH 3KPPB 3DMMA 3VFRB 1YNTA 4U0RB 4PLNC 1I7TA 5E8DH 4AM0B 3ZYZA 3OF6D 2CKBL 4FQCL 5JDSB 3MLWH 1NLBL 1X5AA 3HZVB 1EFXD 3MV01 1OTUD 3QUYD 3EFFB 2F5BL 4G9DB 4WGVB 5IR1A 1PGRB 4X5XB 1JPTL 1NCAH 1I1RA 5GJTH 3EOAA 5ANMB 1NGZA 5GZOD 4P5KB 1QVOA 5FGBA 1W0VB 1G7JB 2X4QA 1K4DA 4LVOB 4PJCB 4RWHA 5KSBE 4LBEA 2VITA 1CLCA 1PZ5B 3ES6B 5E1HB 3U0PB 1QPPA 4EUPB 4LSDA 2WQRA 2OCFD 5IBLD 3Q3GA 1S7VB 1IMHC 1YUHA 3VXME 2E6JA 2W0FA 1K4CB 3LB6D 1F8TL 4DN3H 4HWUA 5FYJE 3OXSA 2UWEE 3HCVB 1QSFE 1Q72H 4RFEA 2Q3AA 1A1NB 4NQXA 4XNXH 1S7TA 4S0TD 1GHFH 2ARWA 3I6LE 4K7PY 4WW1A 4LRNH 3VG9B 3WV0A 5C0EA 1X7QA 4LPYA 1YEKL 5J1AB 2IQAA 5E2WH 3QYCA 3DVFA 1G7PB 1DE4B 1UXSA 5J13B 3O3BB 1QRNA 3AUVA 4JFFD 1KENH 5E5UB 3RBGA 2VUYA 5D5MF 4ZFGL 1YQVH 5E7FA 4PPTA 5JUEL 5SWSE 3QISA 2YPLA 1YDPB 5J12C 2PYED 3S7GA 2PYEE 1PKOA 4KVCL 3ZTNH 4F2MB 1NGQL 2F54D 4N9GA 4KMTL 3UTZB 1ZSDA 5D2NB 4NQVA 5BO1L 3IFOB 1PX3A 1EK3A 1L4IA 2QJDA 4RAUB 5DK0B 5FA4B 3SE3C 2EO9A 1ND0A 2ZKHL 2P5ED 2P5EE 3DI3B 1YC8A 4F33B 4MDJA 5IQ7H 3BO8B 4M9PA 3O2DA 4JY5H 3WHE0 5FYJU 1D5MB 1JFQH 4H5SB 4UTAH 2BNRD 2OM5A 4P2RA 3AU1B 5T1DH 4OF6A 4JPIB 1I3RA 1RZ7L 3QZWA 4XC3H 3HLAA 3CPLB 2WLZA 1H8NA 3VFUA 3QNZA 5D7JB 5B8CB 5GIRA 3MJ9A 4YC2B 5IW6B 1I8MB 1D9KC 1HE7A 4OCNC 4R26H 3QH3B 2C3XA 4X6EB 3D87B 5CZXC 3QULB 3TPKA 3GSXB 5D7IA 2XRAH 2EYSB 2V5MA 1JTTA 4TTGA 2DDQH 3TO4B 1U8IA 3P3YA 5CS7A 5INCA 1T7VA 5E6ZA 1G7MB 1MCHA 2Q6WA 1BM3L 5A2LH 2FJGB 4NBZB 4M7LH 3BN9C 4O00A 3TBTB 1OGAD 4ONHA 4E9LA 5BS0A 4HUKB 3T2NH 1FNSL 5DVOA 4HD9A 4NKQB 4HF5H 4XC1L 3LKRB 5DYOA 4U6HA 5F1OB 5AWNH 4N0UB 1PSKL 5CFHA 2WV3A 1LEGB 15C8H 3ELAT 3NTCL 2HKHL 1R3LA 4LL9A 4DVRH 3VRJB 5EULV 4XPAL 3BVNA 1A14H 5C0FB 4M1DL 2JCCB 3O8XB 4I2XB 3HZKB 3T3MF 3VFGH 1F13A 1OAUL 3LY6A 3IDIB 2O5YH 4G43A 2YD2A 3WUWG 4JLRB 1KJ2B 1KELL 4KDTC 1MCOH 4CUCA 4Y2DC 2B0SH 4F15C 4KKCC 3GUTA 4W6XB 2HLFC 4PJFF 4QTHA 4WV1A 2AKRA 4N0CC 2NXYC 2C7UA 4P2CG 2D0HA 1XGUB 2XWBB 4FZ8L 2HRPL 4HZAA 1VKXA 1CFNA 4M6NH 4ZUVB 3SBWC 5D1QA 5MERB 1FCCA 4UT7L 3WN5B 1VGEH 4Y88A 1B0RB 1JK8B 3DX7A 3K7UA 4UILH 3BYYA 5FYKH 2CDFB 4I0PA 4NQED 4M3JA 3EO0B 2J8HA 3E6HA 1B6UA 4PRNA 4TUOB 4JFXB 3IU3A 2V17H 3PGDB 5JIKA 2NNAB 1H5BA 5IVXF 2HVJA 1MIEH 3IFPA 2LU3A 3DI2B 4X7CC 3FO9B 5IB2B 3P4LA 1UXWB 1YYML 1IFHH 2R29H 3IVKB 2CIIA 1M71B 1F4AA 4IRSA 5ESVB 4KTDH 2JKXA 4YZFF 1U93B 1FCGA 1GGCH 4K3EH 5I15L 2ZCHL 4KJPD 4YBQC 1OW0A 1BD2A 5JW4Q 5EN2A 4MD5A 2XA3A 4PJXF 5EH1A 1U8PB 3HNVH 3W2DH 3I50L 2E8ZA 2XACC 5IWLC 4M3KB 1OTTD 1RVFH 4GUPB 5HI4C 3EJYD 5J56B 3V6FA 4C56D 4XNZB 2A9MH 1I75A 5C08A 2HT4D 1DQDL 2FEDC 3N1PC 3SDCB 1JPGA 1YA5A 1I1AB 1ZGLM 4J3SA 4U6TA 4I77L 1FVEA 4DUXA 1PW3A 5TGBB 4JO4H 3U0WL 1CFQB 4X7TA 1T03L 5L6YL 3MX0A 2VLRB 5KS9F 3ZHKA 1HK6A 3QUYA 5J11B 3N1FC 4FFZH 2EZ0C 2QQLL 2AGJL 3SE3A 4DGYH 2VZ1A 4O58H 2NW2A 1U8NA 2CO7B 2AJZB 4FTVD 4FTVE 3EJZC 2E9IA 4WFHD 3RUGF 3GIVB 1ORSA 3O6LH 4WUUE 5IEKB 5I1CL 2ID5A 3S36X 3D25B 4WFGD 2EEBA 1YC7A 5F21B 1X5ZA 1LNUA 5DD5L 5F1KC 4LLYB 3P0VH 2ZUVA 4BH7A 3MJ8B 1MCNA 2BHZA 2DB8A 1J5OL 4N68A 2VKWA 3FB7A 4PJHF 3H2WA 4KK9C 4AY0A 2WWKO 5E5RB 4YJZL 1S7SB 2EE2A 4K9EH 2A83B 4RMUA 4P4RB 3BH9A 3R8QA 4UNTA 4QCIA 2ENSA 2ZWLT 1A4JB 1G0DA 2GQHA 1T66C 4LHQB 1A02N 1HHJB 3GKWH 4Y4HD 4PJIF 2P1YA 3SQOH 1V3MA 3ARWA 1JHKH 5BQ7B 3QG6B 1CF8L 2PW1A 3H9YA 2E7BA 4HUXB 3ZDYE 2DD8H 5CZVL 4M5YH 4PRIB 1JPSL 1I4FB 4KJYA 3B2UC 1DL7L 4NO2A 4O4YH 3S5LB 5EO1B 5DQJA 1QZ1A 1PKQA 1UJTA 4ONFL 2ADJA 4OZFA 2IH3A 2MCPH 4LHUG 5ISZD 1M6OB 4NDMB 3NCEB 1LO3H 3O4LD 3O4LE 4IIQB 3KPSD 4NHUA 5T33L 4NNPL 4O2FB 4MA8H 2B4CH 1AP2B 1K9TA 5IF0A 1J0IA 3EYQC 3MNVB 1P4LA 1L0YA 4JFZH 3RPIA 3BP7A 1HXMA 5E08H 4GXVL 3FQWA 4OF3A 1ZT1B 3NAAL 5JR1H 3M45A 3JTTA 2AXFA 1ODAA 4HKZA 4HT1H 1S5HB 2DBJA 3HG1B 2BNRA 5CD5D 3VG0L 3EO9L 3WFEL 1J1OH 3QJHB 3KPRE 4YWGH 3R8BB 3ZL4L 2FJFB 3QO1B 3MRPB 3SE4A 4U0QB 4X6DA 1GAFL 1FBIH 3CFJB 1G9MC 2GJJA 4LSRH 3W0WA 4KK6D 1DDHB 4YHZH 4ENEC 5F3BB 3L5WA 1JGVH 2QSCL 1MFEL 3T0VA 4OLWL 1P7QD 4OGXH 5F70A 1B6DA 1BZ7B 1T2XA 1DN0A 4OZHE 1BZ9A 3MODL 2EDKA 3PP3K 2XZCH 3OKNB 3RTQC 1K6QL 1H9VA 1MPAL 4PRHB 3MREA 3LMJH 4Z7UB 3UAJD 4W4OC 1ED3A 2R1WB 4PV9B 4WHYH 1R3IL 4YO0A 5C0BD 2BNQB 2EECA 1T22B 4PJ8D 1ZLSH 1U36A 1AJ7H 3OQ3B 5F8QC 3UZVB 1OGAA 2X9WA 3M1BB 4LKCA 4LU5L 3B8YA 3UBXI 1BPVA 1BLNB 1A7PH 1MJJA 1U91A 4NZUL 3IDGB 1YEJL 5BZDA 1JZ7A 2DBLH 2DIJA 5CSZA 4XVTH 3O3DB 2WZPD 4OI7A 4QYOB 4AT6B 3UDWC 4E42B 2L7JA 4XWOD 3MLUL 4JN2B 3U4EB 2CRIA 1SJXA 4HQQH 2VERN 5IWLA 1W72A 4KAQH 5DC4B 4YDKL 3CD4A 1ZTXL 3OJ2C 5SX4I 1MRCH 2E9BA 5GRUL 3VFWA 4F7TB 3SO5A 1OB1A 4F7CB 3RNQA 2AEWA 5FHAH 4Q9CA 3K8KA 4M4PA 2VO5A 5DJ6B 1LP9E 2FJHA 3KYOA 5D1ZC 1EHAA 4GRLD 3JZ7A 4D0DB 4XAKD 43C9B 4FQLL 1T7XA 5GRVL 1QR4A 3TT1L 1IGYB 4MQTB 3WJLA 1I7UB 3O2VL 1QEWB 2W59A 5IHUH 1KNOB 1OGTA 4OTXL 4OZ4A 3V5HB 1JL8A 2JE8A 4P9HC 2PO6B 4AQ1B 4X4XA 3WNPA 4DWHA 2ED7A 4BZ1H 5KTEH 1P69B 3AXLA 3TFKD 4BM7A 2VQTA 4HKXB 4ZFFA 3HPJB 5EWIL 1MCPL 3V7AE 3BPNC 2IQ9H 4Z8FL 4LLMA 5FV2A 5KW9L 4PRAA 2BCKB 1WAAE 1A0QH 1OAXL 3G08A 2ZOLB 5D7LE 2NXZC 4TQEH 1L7TL 2ADIA 3R4DA 4IRJC 1JPST 4HS6B 5DLML 3MGOB 3MJ7A 1FL6B 4UBDC 1JZ2A 3DX6A 4S1SH 5F7LB 3UC0L 3X14A 2I60H 4WHTB 2KZWA 3STLB 3RKPA 1U3HD 5GQBA 1RHHA 2HRLA 5KG9B 3IAPA 4HBQA 1A7NH 3V6ZB 4C56A 2QKIB 2CLRA 3SKUD 3CVHB 1FJ1A 3WEXB 3QDJB 3QIBB 2DQHL 3OKYA 1K3IA 1RZJH 1N64L 1QA9A 3HC4L 1Q9KA 2D7NA 2KH2B 4YPGB 2IALA 1G7HB 2K7PA 1A7QH 1MI5E 1H3GA 5DR5L 5HHMB 4ETQB 4L4JA 4TNWF 1OY3B 6FABH 4V2CB 4JVWA 1JNHA 2R0WL 4UUJB 4BFEA 1EO8L 4FQ2L 1C5DA 3K74B 2J6EH 4OLZH 1EO5A 3GSQB 4PJCF 5CIPB 3ZE1F 4AMKL 3CSGA 3RI5F 1ZEAL 4PJEB 1MFAH 4TNWK 4R2GC 3NN8A 3FO0H 4EDWH 2X1OA 3DGGB 3PWPE 1A3LH 3VGBA 5DD6A 1CR9H 4MNGE 4OZFH 5TE4L 1FVCA 3RI5K 1RJZB 1DUZA 4LP4A 2YSSA 1JYVA 1L6XA 3OJDA 4UQ2B 1CK0L 3DXAE 3KJ6L 4LPTA 2VR4A 4HJJL 4QRUA 4FQHB 4WFED 4ZSOA 1YEIL 3UPRA 3FTGB 4MA3B 1AY1H 1H3WM 2GFBA 4P5MB 1Q9LB 2A6JB 4FNLH 4P3WA 1TJGL 5MHSD 3CFDB 2WM0A 2OR9H 3MRQA 3NFSL 1RUMH 4MWFB 5HYEA 1O5DT 1KLGA 4AQOA 4NQDD 4NQDE 4K07A 5F3HA 3BGFB 1KIQA 1NDMB 5I1GL 3HR6A 3BPLB 4QHNB 1K5NB 2H45A 4ACPA 4KDWA 3SE9L 2ED9A 5EBMA 2HP4A 1I8LC 1KPRB 4RGNB 2GJZB 1PG7W 5BRZA 5JZ7C 1TVDA 2C1PA 2D9CA 3V4UL 3GMQB 1T5XB 3KNBB 5HVHC 1UENA 3ARRA 3MV7E 3CFCH 4Q9RH 4WFFD 2X9XA 3LQMA 2NTFA 5ISZA 3EDJA 4HKBA 2OTPA 3MRCB 2F15A 2V5RA 4PR5B 2YA2A 5IMKB 3B3IA 3AGVA 4A6YA 3F7QA 1ZLWH 4JDZB 2X1QA 3BAEL 1X5IA 3MOAH 3EGSB 3BGAA 3VD3A 1ZHKB 1UG9A 4TULH 2X6MA 1I1YA 3ZDXE 4YHPA 3KJ4B 3CZFB 3H7BB 5C8JB 3D48R 4C55A 4WWKD 3EO1A 2QR0B 4MA1B 1DLHB 1AR1C 5A3ID 3DHMA 4W6WB 5AZEL 1CTNA 2BVPB 1NAML 3CDCA 4UAOC 3UBXG 2NY0B 4GKSA 2R56L 1CT8A 2MPAH 4FQXB 5C2BH 1JMZA 1NCUA 3RVUC 3TIEB 3OPZH 4RFOL 1W72H 5F96L 4PTTA 2BK8A 2KPNA 1DQLL 1XH3A 4YQXL 4MAYB 4MQSB 1JV5B 1T1YB 4NZRH 1XIWD 4QKXB 2B2XL 4Y1AB 1RZ8B 5B4MD 2BJMH 3KVQA 3VH8G 5C0AB 1JYXA 5IMMB 5MP6H 2AJUL 3FZUC 3WFCH 2ARJQ 2VR9A 3B8SA 4PJAB 4LSSH 2AJVH 3L3IA 2ICWI 1U8QA 3VXQA 3ARFD 5C0BA 4HUNB 5ACLA 1QFWI 3LN4A 1P5UA 3GSWA 4UTBL 4WVRA 1BFVH 1S8DA 3MBEC 3M8OH 3V6BR 4O2EB 3MUZ1 4KVNL 3HC0A 3ILQD 1YYLL 4GW5A 4O51A 1SEBA 4QHKJ 1KT2B 3QI9A 5D8JH 3VD9A 3RVVD 1WLHA 1CXKA 4Z7WA 1T83C 2HJLA 5BV7B 3EOTL 2ZPKL 4N0FA 5F71A 2Y5TB 2H32A 3LHPH 2NY3B 1W2KT 3I02A 3D85B 3BH8B 4G7YL 4ZAKD 3PHSA 5DUPL 3SDXA 2E9JA 3GK8H 5LWYL 4KZDL 3MRRB 5AG8A 3S88L 2LAGB 2APFA 3O4OC 4DEPB 1HOCA 5M94B 3ALPA 4DW2L 2CIKB 3WNOA 3FO2B 1A5FH 1JP5A 4DGIL 5HSFA 1I8IB 2JB6A 1FFNA 3OJMB 1FLRL 1M1SA 5ENWB 1VFBB 5FYKE 2Q8BH 4HUUB 3NFPA 1ZVSB 3DSFH 3QEQA 5FCUH 4EOWL 1MLBA 3BDXA 1PFCA 4KQ3H 1NDGB 3FQTB 2A73B 1T20A 1YEGL 3MGTB 1E28A 4EXKA 3D2UA 2W38A 4P4KA 2D03L 3LS4L 2X41A 2G60L 5L8JB 2CSPA 3ULVL 2WBJB 2AI0H 4NRXB 5DEGB 4WO4C 3WBDA 2DMBA 2M1KA 1WC7B 4PG2C 1FO0A 1G6RB 2VAAB 4P3CL 4K3DH 2AQ1A 1KEMH 5F7HA 5K9QI 1CGSL 4YXLH 3CSYA 3NCMA 1AD9B 1TPXB 5I9QB 5HYIA 4YXKL 5I1DB 3NFNB 4LVNC 1J88A 4G9FA 3WMSA 1J8KA 1AGEA 4QRPB 4OZIE 3G6AB 4XZUB 1BQSA 5FXCH 4HKJB 2BSRA 4HSQA 4JN1H 3MRDA 2FDBP 4YHLH 3RWCA 3VRLF 5J6HA 4M43H 4RMRA 1BVKA 2PXYC 5ITFB 3SE8L 3ROLA 5T3XH 1G9MH 3O41A 5FYKU 3RVWD 7FABH 4CADA 1R5IB 5L8LB 5H2BB 3TCXA 1HCFX 5DO2D 5L8KB 2UY7A 4JR9L 1T5WB 2YD5A 5E4IA 5HYJB 1U0QA 1YPZB 4Z77B 1QRNE 4XCYA 1S9WA 3BKYH 4ERSL 5DJAB 4X6BB 1WF5A 5FOBB 4ZOEA 3NH7H 3EOBB 3GJFK 2NX5E 3BKCH 3I84A 4OGAD 1U2CA 3UTSD 3C60D 5DJYB 4LVOC 5SWZB 1A6VH 2J12B 5GGSA 4HXAH 4PP2A 1K8IA 4QHMB 2XQBH 1F58H 43CAA 3N1QC 2OJEB 1M05A 5LGHH 4G8FA 4ZNEA 4D9RD 5KVDH 4D9RE 5D9SB 1YY9D 4YBLC 1FIGH 3EYVB 3FN0H 1DZBA 5C0IA 2EIZB 2H26B 2YD8A 4J4PC 3FQRB 1T1XA 3VFPA 3EZJB 3MLVL 4Q0XL 5ADOL 4GMTL 4J3XA 3ULUD 2HN7B 1HILA 4CMMA 4P2RE 1ZHLA 4F9PC 4PJBB 4XPBL 1MWAA 3VG9C 4MXQD 2ERJB 4V2BA 3S9DB 5KSBB 1NLDH 5TQ0L 5DVMA 5DFVC 3K8LA 1KG0B 3MFGB 4KI5D 4X6FB 4K94L 4XMKL 1A2YA 5TPWL 3INUH 4ODXA 1EDQA 1K2DA 3HAEA 4K7PL 2FGZA 4LCWD 3TZVA 3KYKL 3H9HB 2X4UB 3X3FH 2I07B 3VXMB 1LE5B 5DJZA 2R1YA 5CGTA 5F9JA 3L3GA 1IGJA 3HUJE 5EU5A 5FUCE 5JO5B 2Q8AH 1WT5A 3F12B 5ECJE 3V2AR 5D7IE 1UM5H 5HI5C 1DBJL 1DEEA 2GAZA 2UWEB 1ZWIA 2C4FU 4G8GD 1WWCA 4R4FH 2GUOB 4Q7DA 1QSFB 4EIZC 1C8PA 4HLZG 1F6AA 2Y07H 3RRQA 3DUUB 1C08A 3ZE2E 4GKZA 4NWUH 2FX7H 2XTJD 5TDPA 1F3DJ 1T83A 2GW5A 5DMJB 4J3UA 4Q2ZB 1PLGL 5IB5A 2VLJA 4PJ7A 3RIFF 3JV5A 1KXTB 2DLEA 3P0YL 2HFGH 5IG7B 4WWKA 4M61B 3O11A 3N1GC 3WUWA 2R2BB 1HSAA 2IGFH 1Y6MR 5C0GA 1NSNH 1NL0L 5SWSB 4QRQB 1ZVHA 2Y4SA 5EU6D 5EU6E 1D6EB 3RIFK 5E6ID 1T1WA 1LD9A 1KEGL 3FT2B 3LH2H 3VXOA 4R7NA 5JQ6H 1MJUL 2O61B 4YR6B 4TOYL 5DJ0B 3MJGX 4Y19E 1CDIA 3DV6B 1CE1L 3QFJD 5JMOC 1NGPH 4JJ5A 3WKML 4Z7UF 3BPCA 2B1AL 3O6FD 3WFDH 4X0KA 1XIWA 5IFJA 2P5EB 1EJ6A 3SO3C 3ZT7A 3L6FA 4L8SA 4PGBB 1DBKH 5DDHB 5DMGC 4GQ9H 1DQJA 1PY4A 4MNQA 3JWOL 3TO4C 1G6RL 2VDPL 1D5BB 3HMXL 2XKNB 3OKDB 4ALAL 4CMHB 2KDGA 1FPTH 4YHYB 1Y0LA 1IT9L 4FP8H 1N8ZA 1T3FA 4WO4A 3BX7C 1ZLVK 4UINH 4YHIA 3T0EA 3S37X 3BZ4B 2E3VA 2YRLA 4FOMA 2AQ2A 1M7DA 3RGVD 1VESA 4U1NB 1N6QL 5I1JH 2A6DA 3NZHH 1NC2D 4S2SB 3GMPB 3DWTA 4FZEH 1FGVL 5CBAA 3R0MA 5TDOA 1OVZA 1H8SA 3LEXB 3G6DH 5CD3B 4XPTH 4ZUTA 4ZODA 3TA3C 1KBGL 3CSBA 4LDOB 2AQ3A 4JKMA 5EU4B 4CVXB 3QIUB 1MAJA 1CDGA 3SN6N 1NEUA 4ZAKA 4D8PB 4NFBA 4RZCB 1FO0H 2OMBA 3WXVL 4S1RL 4G6JH 1AKJD 3U82B 2HFFB 1HHHB 5C0CD 2FYYA 3MNZA 5DD0L 1V3LA 5D1XD 5K9QG 3DRTB 4CN6A 5GPRA 5CGMA 1ACYH 1GYAA 1W0WA 2GI7A 4Z5RA 1X5LA 3MLSL 1Z0MA 5I6XC 3LRSA 1P84J 5BVJA 1ZHBA 4XTRD 4MDIB 1FL5B 3VXSA 4N90D 2F19L 5HHVH 5FO7A 4ZDHB 5GS1B 4HCRL 4I0KA 5I1LA 5EUKA 3SGKA 5GXBB 4OGZA 2GK2A 3KYNB 5JXAL 4DKFL 3W9EA 2FX9H 3TO2B 4BQCA 1T04A 1XAUA 2EYRA 4ODWA 3W9DA 1HZHL 5EIIA 3GJEA 3MFFA 4TTDC 2CKBH 4FQCH 3S4SG 1KJMB 3QEGH 4LSPH 4WTXA 4ZUWB 4KPHL 2F5BH 5FKPA 2VDNL 1A64A 3VXUD 5C0RL 2RQ8A 12E8L 1JPTH 5D2LE 4U1HB 3QPXL 4NKOB 3MLYL 2A74A 3V4PL 5J1SC 4P2OD 4XNZC 4WRLA 1D9KD 2HKFL 3SDCC 3QDMD 1I1AC 1BJ8A 5CZXD 5C2UB 3N85L 2FATL 3KYMB 2WSKA 1FC2D 1Q9WB 5I2IA 4BQ6A 1JF6A 2YC1B 5HDLA 3QUKB 4ZXBD 3PDDA 4LHUA 4C83A 3NCBB 5KSAB 1RV6X 1WVZA 3BIKA 2ITDA 3HRZB 3MNWB 2EO1A 2UV3A 3ROOB 4DGVH 2P46B 3QBTB 3BEWA 3UCRA 2VDML 2X4PB 1N6UA 3O9WB 3D69A 2CMRL 3HAEH 1PKQE 3O6KH 4U6YA 4R90L 5EPMB 1LK2A 3O2WL 3UTSA 3C60A 1NFDF 1FDLL 3I6KB 2A6KA 2NY2B 2WANA 3OR6A 2VAJA 1A1MB 3WO4B 4NCC1 3C09B 4PGEB 2ILLA 4R8WH 3FT3A 3IXTA 4ZFGH 3MRFB 1O7SA 5JUEH 2BOBB 1T7WA 3VA2C 1E0OB 5EZLA 5DS8A 3ULSA 5J7CC 3REWB 4KVCH 4N0CD 1NGQH 2NXYD 4J6RL 2DRUA 3NCJL 4KMTH 5ERWA 1UKTA 4WU5B 4X9BA 4QTIL 5BO1H 4WUUB 2XFXB 3KR3L 1AQKL 5C0JA 2R2HB 3BGMB 4OUUA 3ARGB 2ZKHH 3UX9B 3ARXA 4P0DA 2UUDH 3L7EB 3STZA 1OD9A 4PJGB 4XI5C 3IAGC 1JYWA 3AS2A 1HWHB 2L7UA 1KN2L 1P5VA 1LEIA 3G6JE 3QUXC 2CLVB 3FFCA 5JPNA 5D4QA 2E27L 3MRJB 1JZ5A 3QHZL 1RZ7H 3RVXD 4P49A 1R3HA 2D0FA 5EUOA 1JWMA 1IAIL 5GGRB 2D7QA 4EZMA 1DUYA 3O45A 3WLBB 4I18B 3NGBB 4GFTB 1U95A 1TNNA 4Y4HB 3CC5B 3P4MB 3N0PB 5A40E 3QUZA 5SX5H 1U8LB 5T1MA 1A1OA 2W1NA 1HI6A 1GGTA 3PWNA 4E5XA 5A2KH 3TIDA 4LKXA 1FYHB 2XZQL 3TWCL 3ZLQC 3CIQA 1P9MC 3OKOA 4OLEA 3V5DB 3HE6B 1BM3H 1CS6A 1P7HL 2VXSL 3GB7B 5HI4D 5I73B 3G5VB 1HNFA 5K9KA 5CKGA 4IMLA 2CLZA 2FEDD 2J8UE 4PREA 1I7RA 2DWEB 3QFJA 5E94B 1KC5L 2EXYD 4UQ3A 5JPMA 3O6FA 4P2QD 4P2QE 5F6HI 5IKCB 3VWKB 3P77A 3BKML 3NTCH 2HKHH 4IBLT 2GJ6D 2GJ6E 4F37F 4XPAH 2VQ1B 4M1DH 1F90L 5GS0L 2EZ0D 3CXHK 1OAUH 3TYGL 4Z7OF 1BVLB 2EDEA 1XZ0B 1PEWA 1IAKA 3KPRB 2DWDA 4F37K 3EOYG 1B88A 5CGYC 3X11A 3SDDC 4YHNB 3SKJL 2ZNXA 5C09E 4RMQA 5DHXB 1IC1A 2ITCA 5JNYB 3C6LB 1BQLL 3QIWB 4FZ8H 4U2ZA 2HRPH 2XICA 3RGVA 4Y89A 2YUZA 4OZHB 2EDTA 4NIKB 4XHJC 4JY6B 4NFCA 1FG2A 4UT7H 3JBG7 1IGTB 4LIQL 4E0RB 2OZ4L 4EBQH 1VGKA 2NLJA 2EIBA 3P9LA 1B4JL 2EXWC 3GFUA 4JHZA 4OLUH 2FHFA 1E4JA 2HFEA 3X12B 1T66D 2V2TA 1L0QA 4MMXC 3WIFA 2XWJB 3PF2A 4J3WA 4YK4C 1OWWA 1JWSA 5DJ8B 2Y6SC 1AKJA 3VFMA 4LLDA 1PQZB 2V2XB 3HB3C 3FQXB 4EDXA 3H9SE 5C0CA 3MV8A 1X5HA 3FRUA 1YYMH 4DN4H 1JBJA 4B5EA 5D1XA 2F5AL 4DKDC 2VC2L 3V8CA 3L3KA 3OB0K 1UCBL 1CICB 1ZLUK 1FV1B 3DPBA 3WNNA 5JHLH 5I15H 2ZCHH 4MJ5A 1DSFL 3SDYL 3IKKA 1KGCD 2B20A 4HC1L 5IMLA 4FMKA 3V0VA 3I50H 3VFVB 4JZOA 5B21A 4GKNB 4JFQB 1VADA 2XN9E 5KAQF 2GT9A 4U6XB 3T09A 3WL9A 1DQDH 1VFAA 4LSUL 5EC1A 5HHPB 1LP9B 1U8OA 5C0NC 4HH9B 2AV1A 2A38A 1WWWX 5ELIA 4I77H 5F9WB 4R97B 3PV6A 4PY7B 2W0KA 5D7SL 3U0WH 2ED8A 1NANH 4I4WA 1T03H 5L6YH 4EUPG 4G8EB 3VFTA 2R9HC 3IFLH 4HHAA 3RWGB 1JN6A 3U7WL 2VLKA 3VXUA 2QQLH 2AGJH 2JB5L 4OIAA 4LCCA 3VWJC 3LIZL 5T3XE 3C5ZD 5FM8A 4ENED 4BFGA 1ZA6A 2XOTA 5L2JA 3QIBC 5I1CH 4M8QB 4HMEA 1A6UL 1QLRB 4QXTA 1XF3B 3QDMA 4XBPA 5DD5H 3N1MC 1TIUA 2P42B 5D7LB 2VL5B 5HGBB 1HQ4B 4HV8B 2D31B 3IKCA 3SCMB 3W82A 4HX1B 1J5OH 4JFDD 5C3LD 4ZXBA 3RX7A 5AD0A 1KPVB 5DFTA 3FB6B 4LF3A 5I8OL 4B53A 1FLTX 4JDVA 4UU9B 4DZ8A 3BZFA 3UZEA 1ES0A 1ZT7A 3BQUA 4YHMH 4QRRA 1MFDL 5TJWK 3OB8A 1NGWB 5BW7A 3RA7L 4CGTA 2D3VA 3MUGA 1MUJA 2UY6A 1CF8H 2ZCLL 4L4VB 3FB5B 4M1GL 5DRXA 2WIMA 4FS0A 1FP5A 1R0AL 1MI5B 2FO4B 5CZVH 4GXUN 4V1DA 1JPSH 2D7PA 1JI2A 2FIKB 3UBXA 1DL7H 1L7IL 4IDJL 3FQNB 4WI7A 3QEHA 2G9HB 3HKFA 3MTRA 4OFIA 3ZMRA 5CEXA 4J7RA 3UPCA 4U1SA 1UH2A 4XPGL 3DO7B 1AGFB 5ID0A 2JELL 2JK5B 4XRCA 3CDGA 4U3CA 3PL6B 4B50A 2BNUA 4GW4B 3L3OB 1X3DA 5T33H 3ULVC 4HUMB 4X98A 5TF0A 3B6SA 4HIEB 5D1ZD 3PWPB 1QKZL 4Z0XA 3OGCA 1R5WB 3VH8A 4EKXA 1UM6L 3BPLC 1OQOA 4MNGB 4GG6E 3WNMA 4GXVH 3U9UB 4QF1A 3OXRB 3NAAH 4P23C 2UWEF 4OAWA 3OJVC 1PYWB 4QXUL 4RGNC 1LGVA 5F93C 1S7RB 3ARDC 3DXAB 1FFPA 2XZAL 2UZIL 4KXZI 4TSAL 5IVZA 4PLKC 3FFDA 3VG0H 1EHXA 3EO9H 1FAIL 3WFEH 4PG9A 2D7OA 4APQB 4KY1H 1TTFA 3S97C 2X70B 4IHOB 1GAFH 2EEDA 4NN5B 4WJ5B 4X9IA 2QSCH 1MFEH 4NQDB 4HW6A 3BJ91 5EO0A 5IVOA 4DQOL 2BXYA 4OLWH 3DARA 1MCLA 2P43B 1NBVH 1KACB 1QLFA 3OHXB 3FB8B 3MODH 1FNEB 3U30B 4EEEA 2X4SB 1Z5LB 4UBDD 1K6QH 3RQ3A 1Q94B 1MPAH 4GRMA 5EU3B 1FSKC 4FFYL 3WDJA 5ICZB 5K33A 2IF7A 1E4WL 1S78C 5J4MA 4XXDB 3MV7B 5DRWA 4M7ZB 4M93B 2OTUA 1R3IH 5J3HC 5DUBB 3KYAA 2OMNA 1A6ZB 4X99B 3IDJB 3L3DA 2GSIB 4FQXC 3QQ3A 5D6CA 4LU5H 2EDQA 3P2TA 4NZUH 3CH1B 1QSED 1QSEE 3BRGC 1YEJH 2Z31B 5IQ9A 4NRZA 1NAMA 1QRKA 4RAHA 1JRHI 1KJ3L 5FM4A 1NKOA 3WNLA 5IB3A 4YXHL 3MLUH 2X4RA 2HJKB 1UZ8A 2N7BA 3VDCA 4AJ0A 4YDKH 1ZTXH 4XCEB 3TYFB 2KBGA 1CFTA 5GRUH 4ZUSB 1RK0A 3ZSSA 1CDHA 2XXMB 3CVIL 3DTXB 2EH7L 3IDNB 2R2CA 4JZNB 3MROA 3VW3L 4QGYA 3QNXB 3BHBA 2IAMB 5KN5A 4HJGB 1IARB 2OJZL 3MA7A 4LGSB 3JTSB 4M03A 2X44D 3WYRA 4HIIB 4K94C 1BREA 5F1NB 1S7UA 3DECA 5C1MB 3BPOC 1WFUA 1EBAA 4LDEB 4FQLH 1EEZB 4GMSL 1WZLA 2YXMA 3SJVD 5ESAA 3B83A 3VWJA 4KC3B 1E6OL 2BMKA 2APWA 4AG4L 3O2VH 3ECBB 4OTXH 3HZYB 5CHNB 3GBML 1HCVA 1NBQA 5B38B 4BZ2L 4O5LH 5TF1L 1KSRA 4Y16C 1EEYA 4KRPB 1MREH 5DJ2A 5JIHA 5EWIH 1MCPH 1FAKT 3PWVB 3RWFB 5CAYB 4Z8FH 1AGCA 2X42A 3F62A 2VISA 1KIPB 1MIML 4CW1A 5F88B 1FNHA 1OAXH 1V3KA 1YECL 1L7TH 1T7ZA 1BECA 4QHLA 5EA0L 4UDUA 4L3EE 3ET9F 4PJDE 5DLMH 1U9KA 5CP7B 3GBNL 2N4IA 5ABDE 3IETB 4Z9KB 3VGAC 4L3CA 1JJUA 3UC0H 3MRBA 2P8MA 5JHDD 4YHOH 2FX8L 3QHTC 1I9RL 2BFVL 5D5MA 1JPFA 3HZMA 4Q6IB 2FH8A 1UC6A 3KDMA 1NBZA 4NKIL 4JPWL 4NN7B 4POUB 2V2WA 4BSJA 2YD1A 3IXAB 3MLXL 2DQHH 5HYSB 2SEBA 2WBKA 1SJHB 2RAMA 3HC4H 4M9OA 2Z35B 1CG9A 2FCBA 3Q6FA 5DR5H 1U3YA 3JWOC 5DURD 4UDTA 2QSTA 3DMMB 4XNMA 2R0WH 4OQTA 4FQ2H 1L9NA 3UJTL 3NIDF 1I7TB 5I9QC 3SDAD 5HPMB 3FCTB 4BSWB 4ODVL 3QUML 1JIBA 4ZNEE 5IB4A 1Q72L 4AMKH 1RUKL 1ZEAH 1INQA 2JJWA 3RVUD 4D0CA 3C5ZA 4OFYA 4DJMA 3EOAB 4N8CL 5EOQH 5TE4H 1NGZB 2J7LA 1S7XA 1YMMA 1AQDA 1IILE 1QVOB 2X4QB 3FZUD 3T04D 5T3ZL 2GY7B 1CK0H 3KJ6H 5FAAA 2VZVA 4HJJH 2ATKA 3EYSL 4LSVL 4NNYB 3W11C 1ZV5A 1YEIH 3PUCA 3LPGA 5KZCB 3KLAA 3S5LG 4OZIB 1TJGH 2W0FB 2ZUYA 1NGYA 2W92A 3MBED 2CK2A 3C9NA 1A7OL 1G9EA 5K59F 5I1GH 1F02I 4YDLB 1S7TB 2ICWA 3PWJA 4RFNB 2RFXB 4WI8A 3RWEA 5AAWA 4WW1B 4XPHL 5IQ7L 5C0EB 4MA7L 1X7QB 2IQAB 3V4UH 4NOFA 4MJID 5C71A 1RAMA 5SV3A 5T1DL 1QRNB 5MENA 5K93A 2MFNA 3BFOA 4JY4B 4XC3L 4P3DB 1GOFA 1B90A 1G7IB 3ETBF 2NX5B 3B5GA 4ELME 3CX2A 2GCYA 2B1HL 3S35X 3PP4L 3BAEH 4NC1C 4BH8A 2DIAA 4ZPTA 2EEAA 1OP5K 4N8VB 1P53A 5L88L 2GTZA 4G6AD 2IBZX 2ATPB 3RHWF 2PN5A 5F97E 3TVMD 2LVCA 4NC2B 5IHZA 4P46D 4ZOCA 1D5XB 3RL1A 5AZEH 2FL5A 3GRWL 1GRWA 1NAMH 3VFSB 3GSUB 3RHWK 2G75A 2R56H 1TZIA 4JEGB 1TDQA 4MNQE 2BP3A 5DT1L 3O3AA 1OF2A 4P2RB 4JM2C 3K4ZA 4RFOH 3T2NL 5F96H 3B9EA 5C07D 1DQLH 1S9KC 1I3RB 1A6PA 3KS0J 3QZWB 4YQXH 5AWNL 3G9AB 1OP3K 2OL3L 2MMXA 3QNZB 5IVXA 4G6FB 2B2XH 5LJYH 4JO2H 3MLTA 4MB4A 4U1KA 2YPKA 5GIRB 2AJUH 1A14L 3HE7C 4Y5XC 3RDTD 3HUJB 2WQ8A 2FZ3A 4B0MM 1PG7X 4KFZC 2O5YL 5D7IB 5K9OA 2BVOA 4BFBD 1MCOL 3E2HB 1NFIA 1AD0B 2J5LC 4UTBH 3DIFA 1NBYA 5I16A 3MLRL 4JFPB 4PJXA 1CLOL 3UTOA 2Q6WB 4PBWD 2O5ZL 5JORA 4KVNH 3QQ4B 4K8RD 4LCIH 4PYHA 5CMAA 1YYLH 4M6NL 5D7KD 5I0ZA 4DTGL 4UZGA 5KSVA 5LBSL 3P9MB 3ZE0E 4WY7L 3TEUA 1MCKA 3EOTH 2ZPKH 4EVNA 4MJ6A 1I85C 3JUZA 4CMHC 1R3LB 1WGOA 2DQGL 3FAWA 1NMCC 3BVNB 4G7YH 4JQIL 5DUPH 5GSVA 4DK6A 5KS9A 3TM6A 5LWYH 3H0TB 4NQUA 3S88H 1YN7B 1NGXA 4Y19B 3HMXA 2X1XR 4OCRL 3DVNA 4DW2H 3S4SA 1ETZB 3TNNA 3GUTB 4DGIH 5GGSY 3V5KA 4XMLL 1KLFA 2MKLC 1CI5A 5LCVL 1JZ4A 3AS1A 5KOVC 1GGCL 3OR7A 3SJVA 3MYJA 4CVUA 3DHJA 3MACL 1VKXB 3RWIA 2CXKA 4K7FB 4TSBL 1A3RL 1A21A 4U7KA 3HNVL 1YEGH 4L9LA 1IKNC 1IM3B 1B2WH 4HGMA 4PJHA 2EDLA 2ZUUA 2D03H 2ZOKB 5CEZL 3LS4H 4Y4FC 5DHYA 2G60H 4PRNB 3IJHA 1EAJA 3ULVH 2QLVB 2DQJH 4Z7WF 1X44A 3CUPB 4EI5A 4OKDA 5GRZA 1YN6A 2WWMD 5T5FH 4NJ9L 5JMRA 2HVJB 3GGWA 4PJIA 1KB9K 2LU4A 4P3CH 4J3VA 1CGSH 3DROA 4JFEA 5I76B 5HGGS 3SDXF 1SY6A 1KIRA 4NNXB 1XR9A 4YXKH 1UKSA 1Q0YL 1Z6JT 5JHDA 4P5TC 5IM7A 3FN9A 4G7VH 4ZFOB 1LK3L 1UZ6F 3UO1L 4U1GC 5BJTB 2RBLA 5EN2B 5JXEA 3SE8H 4MXWL 3Q1SL 4XP5L 2YD3A 2QSVA 1QD0A 1EAPA 4L29A 4FXGA 1DTUA 1MLCB 4HCRA 1KYOK 3GI9L 3OKKB 3VXRA 2HTKC 4RQQB 1TZGL 4Y4KC 4YAQA 5CCKL 4WNQA 1YEFL 4JR9H 3TCLA 4AENA 1J0KA 4B41A 5ICXA 2CQVA 2RGSA 4AL8L 2G2RB 4ERSH 2PKDA 2W07A 2Y06L 5F89A 1RK1B 3U46A 3DUSB 3O2DL 4WTWA 1EGJA 2YUXA 3QXDB 3WDIA 4DKAA 1UJ3C 1JHKL 4WI5A 1HKFA 1NCNA 1S9VB 1DVFC 3O6ML 5DRNA 3NPSB 1U3JA 3BD3A 3TO4D 5KSAC 1T2QL 1YEDA 3MJ9L 1LNUB 2XNAB 3NZ8A 4G8IA 4FXLA 2XWTA 3QXAA 1AR2A 3MLVH 4Q0XH 5D2LB 4GMTH 4NZJA 5ADOH 3O9WC 1MFBL 3CK0L 1BFTA 1VDGA 2WIIA 1UT9A 3FFCE 3BN3B 2B4CL 5EO9B 3SKOB 2QQNL 4XPBH 5C6WH 1D9KB 4HPYL 3BH9B 4G6KL 4JFZL 1QPXA 3HE7A 5TQ0H 4OUOA 1DFBL 3IDMA 5DVLA 4XMKH 1WK0A 5IEHA 1VENA 5TPWH 4K7PH 1JTOA 2JJUA 3Q48A 3KYKH 4N9OB 4S10A 3O8XD 3IRZA 4NM4L 2FLRT 4MJIA 1I8KA 4GRWF 1C5CL 1DBJH 4EI6B 5D70L 5A1AA 1U8HB 4NO2B 1BIIA 3V95A 5DQJB 1PKQB 5FYLL 4OZFB 2A1WL 2IH3B 1JGLL 4M8VA 1EJOL 1UB5A 2J1KA 4RA0C 4OGXL 5CKAA 1PLGH 4IM8A 3MR9A 5IF0B 2XZCL 2FB4H 3DX9B 4HK0B 4Y5VC 3P0YH 2XPGB 3RZCA 4P46A 4EN3A 1UM4L 1UKQA 1F4XL 4LCYB 1Y6KR 3HNTH 4Y2DB 1MHHA 3V6OC 3D39A 3EYUL 1ZLSL 4F15B 1KEGH 1AJ7L 1UACH 1UADC 1MJUH 2X9YA 4TOYH 5C07A 1CE1H 4ZTPL 2C3VB 3LKQA 2GSGA 3H6JA 5CP3A 4X6DB 4BELD 2R2EA 3IDYC 4TTDD 3W0WB 2P45B 2XI9A 2X09A 2VDQL 2FSEB 2EC9U 1GGIL 3BP5B 2X4NA 1HDMA 2QTEA 3HTLX 3JWOH 2VDPH 4NFDA 5EC2A 1GVIA 5IJVA 3I75A 3HMXH 4YNYB 4ZYKB 3RDTA 3AROA 4ALAH 1BZ9B 3G6JB 5MEPB 3HE6C 4LEOA 1IT9H 3KXFA 3G5YA 4XB8A 5T1LA 4D3CL 3MREB 4MXVF 1QLEL 3IJYA 5I73C 1ED3B 1BOYA 1KFAL 4PJ5A 3IF1B 4D9QD 4OI8A 5B39B 3IGAA 4PJ7F 3F58L 4WHDA 3KPPA 4D9LL 3SDCD 3VFRA 3IB4A 1I1AD 1TLKA 2BSED 4IDLA 4LPCA 2W0PA 1RZIA 1RHFA 1U91B 1KOAA 2EDBA 1FGVH 2AXGB 4NQCA 3SHSA 1A9EB 4Z7NF 2VLRD 3MV8E 5CSZB 3SKNB 2DICA 5IHUL 3C08L 1FORL 2OR7A 4G9DA 3RL2B 5ALCL 1A6AB 4X5XA 3PHOB 5I8CB 1W72B 5CJOL 1TJHL 5ILTL 5FB8B 2WP3T 3QCVL 4P5KA 3WXVH 4S1RH 4JO1L 1W0VA 3VFWB 4PJCA 3BDYL 3C6LC 2J8UB 1OB1B 1TNMA 2ZUQC 4OJFL 5DD0H 5E00A 1PZ5A 5DMKB 4EUPA 3R0NA 4HWEL 4TQEL 4XMPL 4JZJC 5DHVA 1S7VA 3CMGA 2FJHB 4LQFL 1BIHA 2OS7A 3MLSH 3K3QA 1X9QA 5KAQG 1K4CA 4S1SL 1I9IL 4GAGL 2JJTC 1ZOXA 2BX5A 5DQDL 1A1NA 1H3VA 2HLAB 4HCRH 4IS6A 2BVYA 1KUMA 4Z76A 2V7HB 2CPCA 4DKFH 3TLRA 5KVFL 5C09B 2VLKE 1MEXL 5J1AA 2VZ3A 4X4XB 3BD4A 4H0GA 4OCLC 4NO0A 3AFLA 3AXLB 1BGXL 3NMEA 5ITBL 4TVPD 1A3QA 4TVPE 2QSQA 2VLLB 1A7QL 1CICC 4PRID 4KZEL 4LLMB 1AE6L 5TFSL 1EGJH 3BP4B 4KPHH 3QUXD 2VDNH 5C0RH 3PP3H 12E8H 4N5EC 3U2SA 3QPXH 3MJ7B 3FAXA 3MLYH 3V4PH 3DX6B 1T0NA 1MELA 1SQ2N 2AABL 3ZYIA 3A67L 1MF2L 5GS2D 4HC1A 1VB9A 2HKFH 5FA4A 1RHHB 3H9SB 3N85H 3MZTA 2FATH 2HT2C 4PRPE 1MQ8A 5F9WC 4QRRE 4F33A 3BW9A 3BO8A 1FJ1B 1SBSL 4K71C 3MO1B 1D5MA 2XY1A 1WUNT 3HG1D 5C0DB 1QA9B 3AU1A 2IALB 4JPIA 3TPUB 4MZ3A 4V1DE 5GZNC 3WUZA 4J12A 2VDMH 4JM4H 3UROR 1JNHB 3CPLA 2CMRH 1JHTA 4JRYE 5FDWB 2XN9B 4R90H 2E7CA 5D7JA 3O2WH 4U49A 5B8CA 1I8MA 5IW6A 1FDLH 3QJFB 1DBML 2ZZUT 3L5HA 2RCSL 3QULA 2R4RL 2VH5L 3GSXA 1U8KB 4JO3L 4JJHA 2EYSA 4PRHD 2H2PC 1AH1A 4OB5L 3EHBD 5CWSA 3OKMB 1PG7H 4FQPA 1FVCB 1G7MA 1RUPL 1DUZB 2Q7YA 2YZ1A 4WENB 3OJDB 2BNQD 1P1ZB 3TBTA 1S5IH 3U4BH 1DLFL 1N3NA 2XKSA 3B9AA 4LLWA 3LVEA 4J6RH 3NCJH 4ZO7A 3KPOA 2MQ0A 1R24B 3WLWD 3LKRA 4QTIH 3KR3H 4N0UA 1AQKH 2HMID 4ZG1A 3MOAL 3CFKA 4Z7VE 2ORBL 1LEGA 3X13A 4GXUM 4QNPE 4Y5YA 5TE6L 1WCBA 1X4XA 3RTQB 3ARYA 4FG6C 5C0FA 4PB0L 1KN2H 3O8XA 3GEWB 3HZKA 4ELKB 5I0DA 1MCWM 5EBMB 1KJ2A 3QHZH 4ORGB 4TNVF 4M5ZL 4LEXL 3OBAA 3RAJL 4NKMA 3PL6C 2F8VA 1IAIH 1J10A 1RIHL 1IC7L 2R8SL 3OPZL 2Y6SD 3MA9L 2BVQB 1DBBL 4LGRB 2NTFB 3HB3D 3VXTA 3ZKMD 4HKBB 1MJ7L 3QDGA 4ZUVA 4TNVK 2X1PA 4NZRL 2A0LC 2NR6C 3TN0C 1T4KB 3PXJA 1AXIB 2BJML 3WN5A 5MP6L 2GITB 1JK8A 2XZQH 2F74B 3ULUF 3S96B 1F11B 4HIXL 2CDFA 4LSSL 4OFPA 4L8BA 2AJVL 5I8EB 1QR1B 2PO6D 2CXGA 2LQRA 4GAFB 3KG5A 4TUOA 2P5WA 1TVBA 4X7DC 3PGDA 1EVTC 3DOSA 2NNAA 3RPKA 3TP4A 4GSDL 1D5ZB 5E9DE 4OSUL 3HI5L 4JGJA 1H3XA 1F2XK 1UWXK 4X7SL 1JGUL 5I8KL 4GKSB 5D1ZB 1CT8B 5IB2A 1UXWA 1KC5H 4HWBA 4HXBH 4GG6B 3SKMB 3BKMH 4N1CA 4PTTB 3U30C 1I7ZA 2CUMA 1IEBB 1U93A 2NY5L 1T89A 1E4KC 4U05A 1AI1H 5EUOF 3Q5OA 5A16B 5JW3L 5GS0H 3QHFL 3TYGH 4HS8L 3R1GL 4M7ZC 2MHAB 1U8PA 1TTGA 3ABZA 1SEQL 5FKAA 5HGDB 4IJ3C 3GK8L 5DHVH 3SKJH 4ODUA 3L3IB 3QDJD 3QDJE 3S36L 3QIBD 2V7NB 4WU7B 1BQLH 4LFHG 1CL7I 3VXQB 2E7HA 3LN4B 1XF4B 4EJ1C 1WTGT 2NXZB 3WNKA 1S9YA 5HHMD 4F58H 1S8DB 2OSLB 2BVEA 1FNLA 5TGBA 1XGQB 4IRJB 4LIQH 2OZ4H 3CLEL 4BK5A 4ESKA 1GC1L 1LEKB 4NBXB 2YUWA 1RUQL 3QI9B 5J8OA 4PY8J 1IRAY 4QWWD 5IGXL 1QFHA 3GJFA 1O7VA 4WW2C 3RX8A 2FECL 3GIVA 4CDHA 5IEKA 1QO3A 1T0MB 4POYA 3D25A 3I02B 5D5ME 4S1DC 4KQ4L 2E7LA 2F5AH 4LLYA 4F57L 2VC2H 1UCBH 4HWNA 3MJ8A 3VD4A 3QXWA 1HOCB 1JGEA 3QO0B 1MH5B 4KKBC 4LHJB 4LRIA 1DSFH 1PAMA 2JB6B 3SDYH 1S7SA 2AJXL 4HC1H 2OQJB 4FXKA 2A83A 2DF3A 3UJIL 4J1UA 1EVUA 4P4RA 2NQCA 2F58L 4PJ9C 3ULVD 3QSKB 3ULVE 3NFPB 4R2GB 4TUJA 2EDFA 4YHLL 3OKEB 1MLBB 1HHJA 3BKJL 4ZS6D 4N1HB 1AO7E 1T20B 4LSUH 5FA3B 1JUFA 1E28B 4MSWA 3D2UB 3QG6A 4P4KB 1P6AB 3IFNL 4M1CC 4PRIA 5J9PB 1GPOL 4RGND 5D7SH 5IBUB 1H3TA 3NA9L 1MCIA 3NACH 3S5LA 4HAGA 5EO1A 3G5ZA 4PLKD 5E5MB 4CVZB 1RFDL 3A6BL 3U7WH 5L0QC 1FO0B 4NDMA 1IC5L 4X9HA 3VJ6B 4IIQA 4AEEA 3CSYB 4LMQE 4O2FA 5F1IA 3HN3A 4G9FB 1LDPL