3RS4A

H-ras soaked in 60% 1,6-hexanediol: 1 of 10 in mscs set
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 59
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rs4A00
1KI3A 5KOYA 1G19A 2IYXA 3KKMA 2QROA 1X8KA 4BUJA 1UAAA 3F5FA 3LQQA 4MQBA 1ZM3A 2O8EA 1G16A 2HCJB 3BOSA 2W6IA 2UZIR 2VSXA 3OIWA 2QMOA 4US0R 1P60A 3WNDA 1MT0A 4CT5A 5J4KA 1U81A 2ZSBA 3CKLA 3WYAA 3B78A 3BXZA 3GD7A 4L8GA 2HF9A 1COWA 3TLXA 2QTFA 4WZAE 3CNOA 3RRYA 3VKWA 1W36C 1E2MA 4QBIA 4TYYA 3LDAA 1KI7A 1IN4A 3I1FA 4LHWA 1KAOA 4AY2A 1ZRHA 3NEYA 5G40A 3GLIE 4TZ0A 1JR6A 3R9XA 3MG9A 2QPAA 5C1BA 1NF3A 4FD2A 2RGGA 4XD7A 1KSJA 1VPLA 1U0HC 3NBYC 3DVLA 1E9CA 2VP4A 2ZITA 3TNFA 4LJ6A 1F60A 3GLGB 3ND8A 3GJ0A 1RFLA 2VPPA 2WJGA 3BWDD 4Q03A 3AVTA 3T5GA 3QE0A 1CIPA 4EPWA 4FCWA 3AEZA 2IEZA 4DLWA 3R9WA 4MRSA 4DLXA 2H57A 4AKHA 1WA5A 4GOJA 1WBDA 1PVOA 1NBMD 3CH5A 4CVNA 3P4YA 1WCV1 2WM9B 1ODFA 1HE8B 3VU9B 3P4XA 4KBGA 3C5CA 1Z47A 2QP9X 3OZXA 4DLTA 1WE2A 2FPLA 4DUGD 1SZPA 1ZC3A 4NZYA 3SDZA 4PX9A 1VMAA 2FU5C 3L43A 3RDPA 1TF7A 3A1WA 5IHPA 3FGNA 2ZUBA 4MGYR 4HATA 2IUUA 4HAUA 2D7CA 1VCMA 2RGEA 3K70B 1NLZA 1NN1A 2ZI3A 3RHFA 3WXMA 1NY5A 4PXAA 5KNBA 4QM7A 4PHFA 2BC9A 1OXXK 2QP4A 3VKGA 2FSGA 2IS6A 1GKUB 1OXSC 3VHXA 1K5DA 1RKBA 4WZ6A 4EFNA 3AVUA 1N5KA 1F2UA 4JMPA 1UJ2A 1HQCA 2CXXA 2IYQA 2HDNB 2ZS8A 1LFDB 4CF7A 4HAYA 5HE9A 4Q7LA 3SYLA 4QBHA 1T3HA 2ORWA 4QHTA 1DEKA 1DARA 1ESNA 2ECKA 4IFEA 1KI4A 2FSIA 1L8QA 2VP0A 3LBHA 4CDGA 3TBKA 2BVNA 4NE2A 2UKDA 4CT4B 1SVLA 2ZE5A 1ONBA 3W5IA 4Q9JA 1I4DD 5KPDA 1E4VA 4DWJA 3B1YA 2CLSA 4MKGA 5JI2E 3NWJA 1CEEA 3FMOB 1NLFA 4RKEA 3OF5A 1WDTA 3QY0A 3IGFA 1R8SA 1S0UA 4HLCA 4RZ2A 4QNMA 2QI9C 3D3QA 1G4AE 2R6FA 4Q4AB 2CHGA 2C9YA 2GHIA 4HUQB 2KBEA 4MGKR 3GLHA 3NG1A 5JMTA 1OHHA 2GTPA 2R44A 3AF1A 1PLJA 3K9NA 3PITA 3KKOA 4GT1A 4IVQA 3G5UA 4MRNA 1KDRA 4D4MA 3PG5A 1G8YA 2ZRJA 4YXWD 1BIFA 3CF2A 2X2FA 3C4JA 1IOZA 4IOKA 1AQYA 3GJ5A 1Z6XA 2QNRA 5BWMA 4QNRA 3C8UA 3WMEA 1ESMA 1GIAA 5C2JB 1MRNA 3PIRA 4HDCA 2IK8A 3I92A 2EFHB 1RE0A 5JCPA 5M04A 3B9PA 1YZUA 4Q7KA 2ZE8A 2FGKA 4UJ3A 1W48A 3Q7QA 2C95A 4Q1DA 4DCVA 2Y8EA 4C0HA 3CZPA 4HLDA 2GCPA 2X8AA 1F3OA 1C1YA 2RAPA 5SZIA 2O8CA 5BN3A 4B6EA 5A0FA 4D26A 2CBZA 2XB4A 2OT3B 1G4UR 1N6LA 4UNQA 3TAUA 5EXSA 1WXQA 3R8FA 2P0EA 1Q3HA 1R10A 1D2MA 2HYIC 5KNCA 1QHYA 3Q8XB 1G7RA 1GZSA 2O0KA 2VP9A 4PSKA 2FE4A 5EXTA 2RCNA 3BD9A 1G5TA 2PT7A 5B57C 1NRJB 2ZSAA 2TMKA 4B3BA 4TT3D 2IYUA 4DDWA 2CVHA 2OLJA 2WJYA 1QHIA 1Z0IA 2NIPA 1EWRA 1P61B 2RHDA 5FOVA 4NU0A 5DHFA 3D31A 2OG2A 1RW4A 2QP3A 2ZRPA 2E1RA 2PZGA 1G3UA 2IBMA 3AGPA 1E2PA 1FUUA 4P4TA 2AK3A 3T1VA 3K1JA 1E2KA 3C5HA 4AG6A 5K8IA 4C0QC 1OFIA 2N42A 5JSZB 3L8YA 4RD4A 3X1XA 4R2HA 3TH5A 2GDJA 1OFUX 5FTLA 3K0AA 2DYKA 4GSYA 4A15A 1T8TA 1G8GA 2ZRCA 2B8WA 1ZVQA 4DLSA 1W49A 4LYAA 4ZKDA 1OH8A 2ZU6A 3H0KA 4H1VA 4GMDA 5BW8A 1TADA 2Z6VA 1KDTA 4F91B 1VKJA 2AXPA 2ZI5A 2ZM5A 1K8RA 1D5CA 1L4YA 4DLUA 3ADBA 1GOTA 1HTWA 3RLFA 2RH5A 1D2EA 1NVUQ 1OT3A 3AVWA 1NIPA 1KZGB 2W2TA 2VHJA 2ZYUX 2CL6X 3BORA 4LJAA 1YRBA 2YJTD 3LXXA 2IWRA 4A1FA 3FFBA 1AKEA 4JBYA 4DLZA 3CB4A 2O8DB 2R2AA 2NQ2C 2WMOB 2EU8A 4Q01A 4X8OA 2WKQA 1U90A 4HLUC 1A2BA 3KKNA 5IT5A 2GXAA 4LDJA 4A6PA 1E3MA 2ONKA 2V55B 1YU9A 3IBGA 1VIAA 3PVSA 2DFTA 4P4SB 4WOPA 2XJ4A 3JZMA 4HDOB 4V0LA 2BEKA 3BFVA 1SVKA 3A58B 2HT1A 1ZUNB 4B3FX 1KDOA 1KSGA 4BPBA 3FHOA 2VP5A 1X86B 1E2GA 4HI0E 3FKQA 2IYVA 3DM9B 3HU3A 4JL5A 4XH9B 1P7CA 4KHZA 2QUZA 4PC2A 1BKDR 3PEYA 4LJ4A 1XDBA 4E07A 1U0JA 2YINC 4TTQA 1Z06A 2C5LA 3AF3A 4A36A 2V6IA 1B23P 1P73A 3B60A 4HLQB 3A8TA 3WRXC 1W4AA 1VHTA 2EFEB 2ZR9A 1CR0A 3BH0A 2J9RA 2NPFA 1FTNA 2AR7A 2N1BA 3M0EA 3TAHA 2W6JD 5FTMA 2F43A 3LFUA 1AZTA 4AG5A 4YC7A 1F2TB 3FYHA 1SKQA 3V4FA 1EFHA 2VYFA 3QI2A 3W3ZB 3U6KA 2PL3A 3WMGA 2D7DA 3I62A 1DAGA 2DFKB 1XWIA 4KFRA 1NSTA 3U5ZB 3QXJA 4PANA 2O8BB 2O8FB 3SHFA 2DWPA 2FG5A 4E5UA 4IDOA 3TW4A 2GNOA 1ZM2A 4W5JA 4YMVA 4A0RA 3CR7A 2MMGA 2BIFA 4ZKEA 4MA4A 1OIWA 5EP2A 1CJMA 1UKEA 3REGA 3BBPA 4TSFA 2XNDA 4RFSB 2CJWB 4AYTA 4AYXA 4HAZA 1W0KD 2PCJA 4I1UA 3AB3A 3VR5A 2R62A 221PA 4NCKA 3GLIB 3QVUA 2QZ4A 1V5WA 1J2JA 5FTNA 4URWR 3PUZA 1ZYUA 4JYBA 4FCVA 3OE7A 2ZRIA 2DFLA 3T12A 3WYGA 2NPIA 1Z2AA 1G21E 1Q12A 4TLAA 4JBXA 4OI4A 4M9XA 3TVTA 2OXRA 2IT1A 3THYA 3LW7A 2OESA 1IN6A 5LB2A 4LJ5A 4D0GA 4QBFA 1XEWX 3K0AB 1I2MA 2Z83A 2ZI9A 4OYHA 3TE6A 1NNEA 2OUKA 4CYMA 1TUIA 5H1YA 2J7PA 4U5XA 4Q9LA 4A0HA 3L2OB 2Q3HA 1N6IA 2ZYVX 4D2IA 1OV4A 4OQFA 1ZD9A 3ZQJA 1G64A 3QG1A 3QF4A 1PV4A 2JJ1A 1G6OA 1QF9A 3Q85A 2HLDD 4BLSA 4M1WA 4A9AA 4UNSA 1LF5A 4O2RA 5SZKB 3FE2A 4RD1A 2MSEB 4I99A 3H4MA 2QEQA 4OI1A 2ZE7A 1XTRA 4IOLA 4BZXA 3FHCB 3I4LA 2ZAOA 4PO8A 3S1AA 2D62A 2ZJAA 3ZZTA 1IN7A 1NKSA 3REFA 3TR5A 4Q1AA 5EP4A 1XD8A 3I8XA 1VG9B 4CRWB 2JLQA 5LBIA 1JXMA 2HF8A 5IF9A 4JIMA 1SXJC 1SKYB 1YZTA 3ZGXA 3ZD7A 5IRCD 1G7TA 1XD2A 3AUXA 3MWYW 1HH4A 1Z6TA 5KPJA 4JSYA 1DVRA 1L2TA 4GZMA 4JJZA 1U99A 3I72A 4EUNA 3P32A 4CEIB 4BRWA 3TK1A 2A2ZA 1MO3A 4QOSA 2JATA 4NCJA 4Q1BA 2JLVA 4M53A 3TVDA 1R7RA 2FPKA 2QPOA 1Q1QA 2ERYA 3MFYA 1KI1A 1G5RA 4XSGA 1OPXA 2GAOA 5BN5A 1P5ZB 3H1TA 3TIFA 5KU1A 2NZJA 3C16C 2PEYA 4GP7A 4LBWA 2P6UA 1W36B 2ATXA 3EG5A 2A3RA 2IWHA 2YHSA 2CHVA 4AIIA 3CPEA 4KCGA 3E70C 4ZPXA 2O5VA 1GL6A 4L9WA 4YDSA 4WAUA 1ZJ6A 3TJZA 2CK3A 5K8LA 4DT1B 3TGPA 4DDUA 4URYR 1LVGA 4W5WA 4ZDJA 1SVSA 1FFHA 1US8A 2FSHA 4RKFA 3O47A 4B2LA 2HJGA 4C9BA 3MJRA 2PMDA 4BFVA 1OYWA 5H8WA 1KNXA 5J4HA 4D81A 1Q0UA 5FOSA 4Q00A 2GCOB 2QQ0A 1MABB 2IYTA 4LRWA 4A0FA 1XCMA 2QM7A 721PA 4RZUA 4P4UA 5CYOA 1VG8A 2D2FA 2VSOA 3EIEA 2IYSA 1G8FA 5CK4A 5CDFE 4NH0A 2Q9AA 1ANKA 2J0UA 4OJKA 4EJSB 4PSAA 4D82A 2IL1A 4HB2A 2QT0A 4B6FA 2O52A 4M9QA 4CEJA 3IUYA 1SXJD 1Y63A 5JJKA 2O0HA 1NKTA 1UEJA 3CM0A 3CX8A 1G5PA 1GRNA 4MYHA 1W44A 3IO3A 3TR0A 4A8JC 1S9HA 1KAGA 4QJ3A 3K70C 2FEOA 4DSNA 3JVVA 4LI0A 1ZCAA 1GRQA 2DBYA 2OFWA 5EXPA 2OFXA 2WSMA 1ZP6A 5TMPA 1SVMA 4FMBB 1V43A 1QDEA 2WAXA 3UKDA 2F1HA 1VECA 4RCZA 2D3WA 4TMXA 4PC3A 4NYIR 1XMVA 4L9SA 2XNSA 2C2HA 1LB1B 5FBVB 4UQOA 3A4NA 4W7SA 4ON9A 4C0KA 4TYWA 2HEIA 3KUDA 2WWHA 3AV0B 3ZIAD 1CJKC 1IJEA 2I3BA 2EYQA 3VNVA 5L3RA 2OBNA 1W5TA 5DI3A 4EPYA 4Q4AA 4MKHA 1Z22A 1OB5A 2F3TA 1HY3A 2DY1A 2RKOA 1QBKC 3W5JA 2EYUA 1BH2A 1NMZA 1XEXB 1I4LD 2NZ8A 4ARZB 1DO2A 3W34A 1ZM9A 2ANCA 3FB4A 2ZYTX 3MLEA 1YZLA 3QNUA 1AN0A 4PQRA 2GBLA 4R9UC 1JXOA 521PA 5KDOA 2OHFA 1ZW6A 1Z28A 2PJRA 2I4IA 2K5UA 1H8ED 1UBCA 3MCAA 5EE3A 1GSIA 3QKTA 1E2LA 3B9QA 4PZLA 4Z51A 5JHHB 4R7ZA 4PZZA 3ZZ0A 3C15C 2GF9A 4LV8B 5FPKA 4BLQA 1T6NA 2WKPA 3FKSA 4Y0VA 4UJ5A 1TX4B 4B75A 2IX3A 2H7VA 3K53A 2FA9A 3RWOA 1TNDA 5A4JA 4ERNA 2V7QD 4KXFB 3PR1A 4WW0A 1ZMXA 1DAFA 3QKUA 4KYUA 3CONA 5JBQA 1A4RA 2JEOA 1KO4A 2UZ3A 1JR3E 1MV5A 1KIMA 1M7BA 2ZTSA 4N0DA 4OQNA 3D7MA 1IN8A 1E0JA 1Z6GA 4HUQA 5TARA 2FNAA 4QC2A 3HR8A 1OIVA 4MKIA 1VTKA 2BBOA 4O25A 3LNCA 4BEBA 3SOPA 1KI9A 4LBZA 3SBDA 2C8VA 2ANBA 4JT2A 3VU9A 4GNKA 3KB1A 1KY3A 3UMSA 1YZQA 3UWKA 3NDPA 4B48A 1U8AA 4HZIA 1OJLA 2OM2A 4JL6A 2BEJA 2RMKA 3KQNA 2CVFA 3D8BA 2GAAA 5JECA 4PO9A 3CWQA 3GFPA 2ZJBA 3LX5A 4CIDA 4CEIA 4LY6A 3GFOA 3T1TA 4B44A 5EXXA 4TLBA 2QRNA 2R8RA 1BYIA 3FMPB 4A92A 1IHUA 2VIIA 1BOFA 4ESVA 4QGHA 1GVNB 2FV8A 2E9SA 1M1YE 4FMCF 1Q1BA 4B76A 4AKIA 3UATA 1NSFA 3WP1B 4KSCA 3VNUA 2HLDA 4ACAA 2BOVA 1XRJA 4DSTA 1TQ2A 1UEIA 5HPYB 1QRAA 2EWWA 3B6EA 3LRPA 5EE0A 5LDDC 4KFSA 2IXEA 3RS3A 2XXAA 4JL8A 4NYMQ 3AKCA 2OV2A 5C4MA 4EFMA 4IDNA 3IHWA 4URVR 3RS5A 4L15A 1NY6A 3HYRA 4TT3A 1M8PA 4M22A 2JDIA 3OFND 3LBNA 5SZJA 2GEDA 2IA5A 2P5TB 3F8TA 3NHBA 5J4VA 3QUSA 2GJAA 3AKEA 2ZJ2A 4DJTA 3MWLA 4A8JA 2B8TA 1PLKA 4JVNA 2F1RA 4IDHA 2BBSA 1QHHA 2YWFA 2OBLA 4G5SA 3BFXA 4DB2A 4Z8YA 4A2QA 4C2UA 2ZRHA 3KFVA 3AVQA 1T0HB 3CRVA 1R2QA 2WJVA 5EZ5A 2B6HA 3MSXA 2VHCA 3QXCA 1II9A 1R6BX 3CF6R 2AD5A 2RGAA 4C7OA 1N6RA 1YZKA 1O87A 1LS6A 2J41A 1NG9A 3LLUA 2PH1A 4LJYA 1GRRA 4XTRA 1SHKA 3GMTA 5EE1A 3QSYA 1UBFA 1F48A 2JLWA 4JLOA 1W2HA 3CH4B 4JLAA 4IVRA 4ACBA 1CTQA 3KKQA 4D6PA 4RFVA 4NYJR 4LBVA 3ZIAA 3G82C 3U6BA 2A5FA 4Q4JA 3BERA 1D6JA 3E1SA 4JZKA 3K0SA 4MITA 1ZNZA 4ASUA 4B33A 4DZZA 4GZLA 4E03A 1KTVA 2DPXA 1CJUC 4I1VA 2AXNA 4LJ9A 5FR1A 3R9IA 2BJVA 1KO7A 2ZR7A 3GEHA 4OQLA 621PA 4DIEA 2G83A 1NVVQ 2AK2A 5JLJA 2ZYWX 2FF7A 3V9PA 5HCNA 4EQ6B 1OH7A 2IYYA 2FFAA 3QIAA 3KJEA 1H65A 2HV8A 4UKDA 3N5CA 2QSYA 2CL7X 3L0OA 3ICEA 3HYTA 4YMTA 3QF7A 5CJ2A 2OO7A 4AURA 2P65A 1XMJA 4URZR 2C78A 3WRYC 2BM1A 2ZU0C 1ZD1A 1S1MA 1KMQA 4C3ZA 4ZCIA 5BQ5A 4HB3A 1DOAA 1TTTA 1E32A 3Q72A 4NDZA 3KQLA 1E9RA 2F9MA 4P0TA 1R5OA 2QM8A 1RZ3A 3NBFA 4IRUB 4BFWA 1NN0A 2IYLD 3LV8A 2KE5A 2QA5A 2WAYA 2ZI6A 1Q22A 1N6PA 2XEXA 1KHTA 4JLPA 5FFMA 3W6OA 2XZLA 1DTSA 2CLDX 4H9GA 4GDFA 3L0IB 5DSZA 4HB0A 1W0JA 1C4OA 2LWIA 1W5SA 4OJQA 2J3EA 1JPJA 4O2LA 5FI1B 5HE8A 3K9LA 5DI9A 2ZRNA 4Q5IA 4RCYA 1S1CA 5FTKA 4RZ3A 1E2EA 4LHXA 2EW1A 4WZBE 1AGPA 1XCGB 1IY1A 1OXUA 2YWGA 3JZAA 3WBKA 1E2HA 2AHOA 1Q21A 5DE3A 2AKAB 2OCAA 1SXJE 4P4SA 3A4MA 2D74A 5DGXA 3EAQA 3IIKA 3VX3A 3PXGA 1XTSA 2QY9A 1ZINA 3SHWA 2GVZC 1H8HA 3CRW1 3SR0A 4F4CA 4M1YA 5JS8A 2O8EB 1Z0KA 4Q66C 4BEJA 2C99A 1IQPA 3NC1C 4HAWA 1KKLA 5KNDA 1ZIPA 2ZUCA 3DKPA 5L8VA 1XPUA 4KU4A 4BFXA 3THOA 1AZSC 1P9NA 3LX8A 3SYNA 3AF0A 2ZRBA 3KUCA 3T06B 3RABA 1G41A 2V54A 2YC4C 2WSSD 1A5TA 3A1SA 4F4JA 4IDPA 4DBLC 1Z29A 1KDPA 5G53C 4B74A 2VBCA 1RIFA 4F38A 2IYWA 3H86A 5K8UA 3A36A 2JIZA 4PAOA 1FOEB 3OEEA 3TUJC 3T15A 2G3YA 4HDQB 2QPTA 2FH5B 3TMKA 1Q44A 4RY2A 1HYQA 2GRJA 4PR0A 4TYNA 1QHNA 5B2ZA 2ZRLA 5JHGB 3ZZUA 3KXIA 1SXJA 1GITA 3KZ1E 4RVCA 2R6CA 4EPVA 1FNMA 4V0NA 2XB2A 2HUPA 1EXMA 3WHKA 3ZVLA 4Q48A 5G3YA 1CJTC 2X77A 1R4AA 4B3DA 3CIOA 2CHQA 3MRSA 4Z1MD 1OXTA 2XSZA 3AKDA 5J5CA 1RRGA 1P62B 3KXKA 1OF1A 1HQYE 3FHTA 2BMDA 1H8HD 3AGQA 5AJWA 1Z0FA 2ODNA 3VAAA 3AF2A 1YVDA 3HR7A 4URXR 3CRRA 2C98A 4DXAA 4GP6A 1TQ4A 4NBSA 1ELOA 1F6BA 1EFRD 4PAMA 2G88A 3ZS8A 1KO1A 1ZAKA 5FUYA 2QL6A 1GTVA 4BFSA 1QHXA 1Z2CA 3NBXX 4UNNA 2CEAA 1ZU5A 5JEDA 3EX7C 4ZO4A 4HEJA 4A2WA 2XZOA 3FWYA 1W36D 3OAAA 1GL9B 3RANA 3HDTA 1WP9A 1PUIA 3EARA 1NLYA 3DPUA 1OH6A 3I32A 4QFMA 5HR5A 3K0FA 3ZD6A 5AUQA 1TEXA 5E7MA 1T5IA 3AM1A 3EZ2A 3TKLA 1TF5A 3MMPA 1E79A 3PJRA 3W6NA 4EJSC 5GADl 4OHXA 2DHRA 3GEEA 1VHLA 1M7GA 4NONA 1Z5ZA 2WHXA 4D0LB 4TTRA 3TUIC 3CX6A 4M21A 1KMHA 1AS0A 5CDFA 4GFDA 5B30A 4NYMR 5HZKA 4PTLA 3KQKA 2GESA 1Z07A 2D06A 2ZRFA 3B8HA 3AVPA 2CMKA 3P26A 5EUMA 4DKXA 4JVMA 3NXSA 3DKVA 1NJFA 3S1AB 2IS2A 2C96A 1SHZA 5FTJA 3RRNA 2W00A 2WBLC 4G5QA 2XAUA 4UXJA 4OK6A 3QENA 3OESA 1EFUA 3KJHA 4JT4A 3K0CC 4NCHA 5GVRA 3I73A 4BE7B 3IIMA 1FQKA 1OW3B 5G3ZA 1I2DA 5HKKD 2GETA 3NC0C 3ZH9B 2IHBA 2QRZA 1LF0A 1YZGA 5FBRB 1CP2A 5KTYA 4IHQA 4GRAA 3QPWA 1N6HA 4KO8A 1RRFA 3IQXA 4LZZA 1R5NA 3QKRA 4S35A 2QORA 4GOXA 3MJHA 3QBVA 1JI0A 4PAQA 1I4TD 3Q7PA 3UANA 4BFTA 3THYB 4DLRA 1TQ6A 4ZIRA 4QXAA 2E87A 4AYWA 1DG3A 1FW6A 1EESA 3IIJA 1KNQA 3BGWA 2P67A 2V1UA 5AWFC 4LHYA 2ATVA 1GG2A 3OEHA 1SVOA 4TL9A 3Q5EA 3X1DA 2O8FA 3AUYA 3LXRA 4TLDA 2N46A 2BJWA 2P2LA 1J8MF 2Q21A 4JS0A 4GL2A 3U44B 4W9MC 1NBME 1N0VC 4HZUB 3T61A 3L82B 3X2SA 4JKYA 1JALA 2Z4RA 3U4QA 5FOUA 2GA8A 3EASA 4BRUA 1G17A 1E2FA 2OBMA 2ODBA 4JLMA 3BS4A 4BWYA 1JPNA 2A5DA 1E69A 2WJHA 1Q3TA 5CITA 2V3CC 2XITA 1COWD 3QPVA 5DYIA 1R0YA 2B7BA 3W90A 1KJYA 2GJKA 3SE0A 1F5NA 1XF9A 1N25A 1TUEA 4KVAA 4BGDA 1KI8A 1AIPA 1RC8A 2OE2A 5BN4A 4G3XA 1G3MA 2OLKA 4CEJB 1AM4D 1SGWA 1W46A 1XEXA 3UMRA 4HUTA 3L0SA 1N6OA 3SNHA 1A2KC 1GKIA 1DPFA 5KHOC 4KSBA 1JEDA 1W4BA 2F1JA 1CXZA 4PPFA 4YQFA 3EPKA 2J0VA 4F92B 2QQEA 2JJ1D 1K6MA 2QU8A 1XB2A 1AQUA 2YV5A 3LY5A 4L4UA 4B3XA 1NG1A 1A7JA 1CR1A 2GK6A 2NTYC 2CCJA 2XTZA 2WWIA 2FJUA 2R65A 1HURA 5E3HA 2X2EA 5JS7A 4B43A 4C0AC 5IK2D 3AVYA 5L3SA 3E5HA 3I8SA 1UDXA 3N2IA 4C0SA 2CCKA 4QRHA 1WBBA 2OCYC 2ZI4A 2BHRA 2ZS7A 3SFZA 4IFBA 1L7VC 3RRZA 2ZSDA 2XOKA 4D80A 1QHGA 2J59A 1AS3A 2J46A 3RS4A 1KK2A 3LH5A 2VF7A 2ERXA 4G1UC 4MGZR 5FOTA 1TL7C 1EX6A 4QM6A 2G0NA 1MO5A 2RGNC 5IDVA 3L8ZA 1P4SA 2WWYA 3FOZA 2QMUA 3MGCA 2QAGB 1DAEA 3ASZA 4M1OA 2X1VA 4OHWA 3RSLA 1YR6A 1L4UA 3BJIC 1HA3A 3CZQA 1FMJA 2PT5A 3BB4A 4RZXA 5FI0B 1P9RA 5DI3B 5E7IA 1D9ZA 4MGIR 1GKYA 4PQFA 5CYPA 3KFXA 3CPJB 1RYHA 4FMDF 4LPSA 1LTQA 2H18A 2NG1A 1LNZA 2ZRAA 2IUTA 2VL7A 3CBQA 2H8KA 3KTAB 3K70D 2VEDA 4JKIA 3IKJA 3OIYA 4TWZA 3PUXA 3SJZA 2JJ2A 1BMFD 1R0ZA 2WPDD 3U7EB 4RD3A 1T8UA 2V4ZA 4I1SA 5J4YA 1AS2A 5JCZA 1TU3A 1XTIA 4UNPA 3FDIA 5TB5A 5JJLA 2ZIAA 2FOLA 2ONJA 1MR3F 5AR1A 1NJGA 5P21A 4NYIQ 4DEYA 4WXPA 4NKRA 2F3RA 4FCTA 1ZU4A 4V02A 3WMFA 4QHYA 2J7PD 3RVBA 2JLYA 4FW9A 3QF4B 3CNLA 3SQXA 2FX3A 3H84A 2WJIA 1W0JD 3K8YA 2G77B 5CLQA 3TSZA 1UPTA 5FL7D 4ILEA 1MO4A 2ZJZA 4LHZA 3T1OA 2KBFA 1E9AA 5AK0A 1YJ5A 5FOWA 3AVXA 3U60B 1ZBDA 4DCSA 1GAJA 1GFIA 4KFUA 5TDHA 3VKHA 1UFQA 5JWOA 1XMSA 2JDID 5EJEA 1RPZA 2BV3A 5E4FA 1E1RA 1IXZA 3LWNA 4WIAA 2QGNA 4G01B 3HU1A 4CZ2A 4JLDA 4QGAA 1G291 2IW3A 1E98A 4A2PA 5A5GA 2JA1A 4US2R 4M4SA 4XOIA 5KSOA 3VR3A 4AKEA 4IOJA 4FN5A 1DS6A 4V03A 1HEIA 2GJ8A 3SFVA 4DUGA 1EG7A 4LPKA 4DSUA 1PLLA 1ZM4A 4OL0A 5H68A 4UXHA 1S4QA 3X1WA 1U9IC 3A1UA 1G3RA 1XEFA 5AUOB 3IPYA 1IAQA 2XXAB 4N3NA 1FUKA 1SXJB 1UADA 1P2TA 4B3CA 4DB4A 2RB4A 4Q21A 5EUQB 1JQJC 2CNWD 1KY2A 1T91A 3IPXA 1SQ5A 4Q1CA 3W8RA 4BECA 1ZIOA 2HCBA 2FFHA 3U3KA 4M1TA 5KYKA 3HPQA 3BE4A 4IDQA 1M74A 5ANRB 4HAVA 4IJMA 2NMVA 2HYDA 3VMFA 3MWKA 4XWOA 3KJIA 1P75A 3NHAA 1G7SA 4JLNA 4BFUA 1YKSA 4LWZA 3THWB 4JLKA 3ZLJA 4Z8XA 4KVGA 3PENA 4F93B 3ONWA 1QHHB 1N5JA 5B64A 4Q9KA 2RHMA 2QAGA 4QJ4A 2QSZA 1P2SA 3D6TB 1MRSA 4IXNA 4TMVA 1ZC4A 1VDZA 4XSHA 1MH1A 1CULC 1XTKA 2VA8A 2R6AA 3THXA 3IEUA 1KKMA 4LUCA 2Q9CA 3WBJA 1IXSB 3UK6A 4DHEA 2A7QA 2ZSEA 2GXUA 3DEFA 1GNQA 5FH9A 1ZM7A 2Q3FA 2V9PA 1P6XA 3PEUA 3I61A 4XJXA 2REXB 2KI5A 3C7KA 4D4KA 3U7GA 4OQMA 2Z5FA 3CR8A 3W9YA 4LYFA 3GQBA 3EW9A 3U61B 4XVRA 5CIQA 4D4JA 2RGNA 3OFNA 2QAGC 4R2IA 4LV6A 3VR2A 2ZSFA 4DCTA 1F2TA 3KJGA 5H70A 3P1JA 4PZYA 4AC9A 4V0ME 4LGMA 1NN3A 1Z83A 3K9HA 1VYVA 2BCGY 1Q1EA 4F4IA 1XTJA 1J90A 1U0LA 2O8BA 1AKYA 3CO5A 1KYIA 4FWIB 5AJYA 1BYUA 5CM9C 4FXPA 2FGJA 4PC7A 4PPNA 1CKEA 4NP6A 3HU2A 3K09A 2WKRA 2QGZA 2PX3A 2ASEA 3QVVA 5JWRA 1ZUHA 2PBRA 4BASA 1XJCA 1OHHD 2JLSA 2Z43A 3BRWD 3OEED 4DRZA 4G5RA 3ADCA 4RFSA 4BLPA 2O0JA 4U02A 5EZ6B 4M9SA 4GPTA 2IHYA 1S3GA 2A78A 5EE5B 2WWXA 1XXHE 2SHKA 2ZUDA 3C14C 5E95A 4TZ6A 1U98A 1DAHA 3TRFA 5GJVC 4Q4HA 1KI6A 2WWFA 2GF0A 2ZRDA 3BFKA 5C18A 1CS4C 4S2EA 4DLYA 3GPLA 1NP6A 2C03A 5JI3E 3GLGE 1E1RD 3V4RA 2WICA 2IXFA 2CE7A 3A6PC 4F7WA 2XX3A 2VH5R 1DAKA 2AX4A 2BKUA 3CF0A 3T5DA 4Q4JB 4CEHB 4TMWA 4ITRC 2Q9BA 2ZAMA 4WXRA 4A4DA 1H8EA 2WMNB 5L3SB 4C30A 2QG6A 4XIGS 4MUAA 1KJZA 4PSVA 4Q47A 3IEVA 3NIBA 4A82A 2ZVPX 1SKYE 3LW8A 2O8DA 1UKVY 4Q9IA 2OFOA 2EVWX 2NO9A 3F0TA 1GWNA 1UBGA 1VG0B 5F9FA 1SVWA 3GLFA 2YKGA 1IN5A 3THWA 2ODEA 1OXVA 4DDVA 4BLOA 3UXMA 2CNWA 1G9XA 5B58C 1HT2E 1KSFX 3CRQA 4IEEA 4K8OA 4N1AA 2XJ9A 4HSEA 2WZQA 4WBSA 5GJCA 3EZ9A 2RGDA 3FPAA 4GMXA 3TQCA 4DLVA 1Z0JA 3M1IA 2IEYA 1XZPA 4PFSA 2Z4SA 5BYKA 2JLRA 4ZDWA 3KX2A 2NO0A 2QENA 3DL0A 4Z54A 4QBGB 4TTPA 1YQTA 5DN6A 4I81A 4Q7MB 3I5XA 4Q9HA 3U3RA 4OHZA 1Z8FA 3R7WB 1E2IA 2GEUA 2OILA 1GDDA 2AFHE 3I5YA 1XFAA 2VLIA 5E7JA 3ICQB 2VQSA 1C9KA 1SULA 2UVQA 4OHYA 2GXQA 2G6BA 1FX0A 4V0MA 3N70A 1U8YA 3MAAC 4I4LA 3LBIA 4MYUA 3LVRE 2I1QA 3IILA 3B2EA 821PA 3WHLA 1G3QA 1R5BA 2WWWA 3EC1A 4UNRA 3T35A 1NVVR 1N0WA 1PJRA 2IC5A 4I1OA 3PV0A 2X19A 2CCGA 2ZANA 1G3IA 3OAAD 4TL7A 2QT1A 3EIQA 3GLFB 2GILA 1WB9A 1S3SA 2YC2C 3HP1A 1DAIA 1UDWA 4NHOA 3LA6A 3ZS9A 4TLEA 2WIAA 2EFDB 4TQAA 1FPMA 1YR9A 3GFTA 2IXGA 1NMYA 4RD0A 1D8TA 4DSOA 1G1MA 5F2EA 3AVVA 2HXSA 2LKCA 3GCGA 3UG6A 3O8RA 2KB0A 1TEVA 3T34A 2WIBA 4B2IA 3AKYA 5C4GB 4KITB 1JR3D 5JJIA 3BB1A 1JECA 3Q3JB 1G7CA 1EFTA 1S9DA 1II8B 4RJLA 3IBYA 4BFZA 2OAP1 4OHVA 4DCNA 4OQXA 4XVUA 3B5JA 1VCOA 2W2XA 1YHNA 4KJZA 2H17A 1QHSA 5DO9A 2QMHA 5FUWA 4YLGA 3THXB 2YZ2A 1HE1C 1FL9A 2JIZD 3PUYA 5L3VA 3QOFA 5C46F 1TPZA 2GZHA 2A5GA 1XJQA 2W58A 3CW2A 5D3QA 3EIHA 4B34A 1CBUA 2CK3D 1KMHB 1MOZA 1IJFA 2FZ4A 3RS7A 1TF2A 4KBFA 4FMCB 4TN1A 3UMFA 4NCNA 2GEVA 1HUQA 1Q20A 4CGZA 1CRPA 1XCPA 2FPMA 1X6VA 1RRCA 2D4HA 1QG4A 2WTUA 3IO5A 4EKDA 1E0KA 4XD7D 4Q1FA 1DO0A 2QBYA 4EPRA 4DIDA 4LJ7A 4NL4H 4XWKA 1A82A 1X3SA 3OEHD 1QG2A 5FBQB 1OYYA 3W3AA 2WSSA 2ZETA 4EQ6A 1YZNA 4J0QA 5FPTA 1IBRA 1XNJA 4R71A 3EWSA 2PJZA 4EIWA 3M6AA 2OCBA 4M9ZA 5FPHA 3H2YA 4Q19A 4IW3B 4P32A 1AA9A 1P3JA 1Z6YA 1VCIA 5UKDA 2CE2X 5DH9A 4QHSA 2IS1A 2REBA 4DDTA 4MRVA 5LB4A 3ECCA 4M1SA 3CRMA 1JNYA 1XD2B 3QJYA 5EP3A 2XOKD 4II7A 2FMXA 4E22A 1DE0A 5CLLA 2ZJOA 1T9HA 1F2UB 4PC1A 3DMNA 1UBEA 4NPHA 1E2JA 1IY0A 3K09C 4V0OA 2QMEA 4AKGA 1T4GA 2HJVA 2QAJA 2QE7A 2AKYA 3DO6A 5IK2A 2MSDB 2VRWA 3I3SR 3SZRA 5JZVA 1W2GA 2J1LA 1P2UA 3R7WA 3PQCA 3B7GA 2G0TA 2H5EA 2B7CA 3NH9A 1KOFA 5KO2A 2W2VA 2ZJYA 3GJXC 2QE7D 2DR3A 1Z63A 3AP2A 3SC3A 2ORIA 3U7FB 3B1ZA 1B0UA 2ZEJA 1E9EA 1TQDA 3FMIA 3WYFA 2J0SA 4PHHA 3P27A 4ABYA 2OZEA 4US1R 1GL7A 1GP2A 2IF2A 3U3MA 5AUNB 4DCUA 1W47A 5CM8B 2YVUA 3ND9A 1DBSA 4L5BA 1CRQA 1KZ7B 5J47A 5KDDA 2CDNA 4M0LA 3PEVA 1KK3A 1VIYA 5K8TA 2CL0X 2D2EA 3CNNA 1E2DA 4EJSA 3HJNA 4B73A 4P33A 2F7SA 1CLUA 5CK5A 1K5GA 1EFCA 5KSPA 2FEMA 5FUVA 2DWQA 4D4LA 1E9FA 4FINA 1KJWA 1E0SA 4NCIA 3Q5DA 1G6HA 4R98A 5DN6D 2AWOA 5TY0A 2QN6A 3BH7A 2BM0A 3HWSA 4JSTA 3RRMA 1P72A 4LX0A 1II0A 1ZCBA 3EWAA 3X1YA 1M7HA 1PUJA 1XZQA 5KUTA 4K46A 5TVKA 3RS2A 2OXCA 4ZI2A 3VX4A 3ZJYA 3BH6A 3O8DA 4LOAA 3RYTC 3TUZC 2F6RA 1N3BA 1YR7A 1OKKD 2DWOA 1FP7A 5DISB 2RGCA 2KWIA 1XPRA 4ZCMA 1Z0AA 1E94E 2W6JA 3VFDA 3RC3A 5EP1A 4DC9A 4WVFA 1KO5A 2WJJA 5FPSA 3A1VA 3TSWA 4C0BA 3O8CA 121PA 3MUFA 4BQSA 2GVDC 2IF0A 2OSBA 3RC8A 2P5SA 2DCUA 1S96A 3L0PA 3AQ4A 4BZQA 3G0HA 2Z0MA 4FMDB 1OFHA 1T3LA 1DAMA 3B82A 2H1LA 1XEWY 4OI2A 4BLTA 2WWGA 3R8CA 2JAQA 1NL3A 2IYZA 3PEWA 1RVDA 1U9IA 1CR4A 2BMEA 2F9LA 2JLXA 2IUSA 5EE9A 5ELXA 4JJKA 1W7AA 4Q7JB 4TQUS 1E2NA 3SEAA 2ZJ5A 5EQTA 1PZNA 1JEEA 1T0JB 3SBEA 3R20A 2GJ9A 4TL6A 3ZVRA 2BWJA 3AP3A 4JLVA 4P3YA 3BK7A 1Z3IX 4LV5B 1GUAA 3NBZC 4Q02A 3RS0A 3B1WA 5BYJA 3J81k 2VP2A 3DMDA 1X1RA 5L3QB 5FBLB 3QKSA 5KSYA 4U00A 4LHVA 4GOKA 4YMSA 4EPTA 3FFAA 5KSZA 1JJVA 1XBTA 3V00A 4B35A 3DOEA 4LC1A 1KO8A 3RAPR 3QEOA 4KAXA 4B3GA 4G5OA 4LYJA 2F55A 2B92A 3ZQ6A 3NH6A 3N2EA 1UKYA 3U7HB 4TYPA 1IM2A 4MRRA 1YRAA 2GZAA 2Q0HA 3SJBA 5GVSA 2WV9A 1E96A 2PLFA 2PX0A 3GJ3A 4C0LA 1E0AA 2NOAA 1D9XA 3FTQA 4MUBA 1M2OB 4JLJA 1M6NA 3TW8B 3BAFA 3ETLA 4Q4LA 1BMFA 2WPDA 3SJCA 4KV9A 4QGGA 3PFIA 3JVUA 421PA 1UF9A 4TQ9A 1EX7A 4GBMA 3O8BA 4E09A 1S8FA 2BCJQ 2ZS9A 2XSZD 1OB2A 4OK3A 3GP8A 1M34E 2AWNA 1YR8A 4ZI3A 3KQHA 2J0UB 2PLRA 3GLIA 3QEJA 5JEEA 2JJ8A 3GLFE 2Q3MA 3A4LA 3AH8A 5D3MB 4TMTA 2H16A 2V1XA 5JSZA 3IQWA 4OI0A 2ZRKA 3SN6A 2A5JA 2ZE6A 2FFBA 3IDQA 1P2VA 4MYTA 4HLUA 2J0QA 4PQYA 3K0CA 3EA5A 3CPHA 1NI3A 1NN5A 2GWHA 5L3QA 1E9DA 1CR2A 2FFQA 3QBTA 2PCLA 3K0FB 2WOOA 3GJ7A 1E1QD 5AJVB 1X8LA 2MMCA 4FWTA 2G1JA 2C9OA 2REOA 4PHGA 1XD9A 4PHTA 2EFCB 4C7OB 3KL4A 1W4CA 1UM8A 4WA7A 4ZIRB 4DEXA 4X8MA 1FQJA 1G20E 3VR6A 2O8CB 1WRBA 4OBEA 5DIFA 3MD0A 3U3JA 2QTVB 4FIDA 1XPOA 1D2NA 1E9SA 2IS4A 4KLNA 4D25A 1DG1G 3AF4A 1XXHB 3DHWC 5J40A 1ZD8A 3RWMB 3GLGA 3GJ6A 1OSNA 2R6GA 1T5LA 4AI6A 2AFIE 4QG7A 1EGAA 2W83A 4QKQA 4B2PA 3LLMA 2FSFA 2ORVA 4C4PA 1HT1E 5HKKA 3ZVMA 3KQUA 1US8B 2OCPA 1OKKA 1GNPA 3A37A 3GJ4A 3VR4A 1XJ0A 2KJQA 1OH5A 2NO1A 4YXWA 4MKFA 5DNYB 4MDEA 1MKYA 1NBMA 1WF3A 3PUVA 3RNLA 5CB8A 3EPLA 1DELA 3LQRA 3WY9A 5LPNA 2BDTA 1ZNWA 3K0EA 3ADDA 1AGRA 3MWJA 4TYQA 3ASYA 3QPUA 2RGXA 3NTUA 4HAXA 5CIWA 4AWXA 3Q9LA 3LAWA 1U94A 1VYTA 3M4YA 2NGRA 4ZV4A 2GZDA 1W0KA 3EC2A 5LD2B 2G9NA 5FUXA 2PZFA 1AK2A 1GILA 3E2IA 4YDHB 3EXAA 4FI3C 4JVLA 2DFNA 3DDCA 3QQ5A 4M8NE 1BO6A 2VHQA 4LC0A 2JLZA 4EAQA 2P6RA 3EA0A 2ZR0A 1NVWQ 3TQFA 4LBYA 1Z0DA 4IOMA 2GCNA 2ZJ8A 3EZ6A 1SVIA 1LS1A 4OK5A 4M1KA 1CJVC 2EQBA 2R6DA 3BB3A 3FMFA 3LVQE 4KLZA 3DOFA 1X8JA 2ODWA 2EWVA 2C77A 2F43B 3GEIA 2QBYB 1J70A 1E79D 1S2MA 2J45A 4JYCA 2JASA 4LK2A 1J99A 2EFGA 3NKVA 1A1VA 3NVAA 1GNRA 3C41J 6Q21A 2ZRMA 2Q6TA 4LCBA 1JQLB 2XTMA 1II8A 3TSOA 2A9KA 4ARZA 5DYGA 3B13B 5AUPB 4JBWA 2ZROA 3LO5A 2AD1A 3P20A 3DZDA 3QXSA 2OEPA 4Q4HB 4A6XA 2XGJA 1LW7A 2VO1A 1EFRA 2BKEA 3X1ZA 1N0UA 1OE0A 1TMKA 1FP6A 4ZDKA 5F98A 4GI7A 1JAHA 3K9GA 2J87A 2VHTA 1IXRC 3QKSB 2YOGA 2R9VA 4QJ5A 4A0GA 3EZFA 4HYYA 1N6NA 2B21A 2YNMA 2ZI7A 2FZLA 4IVPA 4B32A 1ZNXA 4KYIB 4Z1MA 1XU4A 3RSOA 2ZXUA 2MSCB 5J4LA 5HTKA 4IKEA 5AJXA 1OLOA 3IHLA 1FTSA 2V8OA 2I1VB 1CF4A 1LY1A 4NTZA 4L16A 1R0WA 3F3YA 3GLHE 4C2TA 1Y3AA 2J7KA 1E1QA 4A8JB 3SQWA 4KFTA 4IXMA 4TL8A 1TU4A 1J8YF 4N0EA 2BBWA 4JLBA 2YOFA 2YYZA 3FKSD 5DHAA 5JWHA 5HZHA 2VTKA 3EZ7A 4YONB 5DLQC 3CWZA 2YOHA 4H1UA 2CLCX 3SU8A 5TXGA 5JFGA 1KGDA 2HT6A 4ZDIA 4Q18A 2YWEA 4MRPA 2JGNA 4YMUA 3VTKA 1G8PA 3CUEF 3FVQA 1KK0A 1O3YA 3DM5A 2W6ID 1FZQA 2VP6A 3ZDQA 1IONA 4MDFA 4URUR 4NYJQ 1E9BA 3QKRB 1VG1A 5TV2A 3T1QA 4B71A 2DB3A 1NVXQ 3SYKA 1KSHA 4BZPA 2GK7A 1MO6A 1VCNA 3LD9A 3KB2A 2C9CA 1LV7A 2C04A 2QTHA 4PC6A 3VQTA 2LCFA 2GJSA 3AP1A 1YE8A 2JJ2D 4G5GA 5AJZA 3OIVA 4AD8A 3B1XA 1TAGA 3UG7A 4XVQA 1IY2A 3NEJA 1CU1A 4QGFA 4V0KA 2W0SA 3BC1A 3OIUA 4O0MA 4CEHA 3VHLB 3UPUA 3W6PA 2OAQ1 4LJ8A 2PMKA 4D0NA 1Q57A 4EPXA 3U44A 5JRJA 2F1IA 4UXIA 4RD6A 4PO1A 5JRZA 1FMLA 1XP8A 1XXHA 5SZHB 3OE7D 3HPRA 3WNCA 4XTCS 5HCIA 2VF8A 5LD2C 2BBTA 3U4QB 2CJWA 1JB1A 4RSGA 3SJAA 2GCOA 3QG5A 5FOXA 2J5XA 1ETUA 2NO6A 4B47A 1WQ1R 3U3OA 1EK0A 2ZQ5A 3WNBA 4LYHA 3B85A 3GLHB 4PPGA 4PPQA 4TSFD 3WP0A 4EFLA 3VR1A 4O3MA 1E6CA 1JJ7A 3B1VA 5CJPA 5G41A 3UIEA 1ZNYA 1KI2A 1XTQA 2ZPTX 1E99A 2A30A 1XMIA 4XWAA 3KTAA 2WVJA 1VYUA 4DVGA 1KK1A 1KI6B 4CW7A 1E2QA 4TMZA 1OIXA 2PEZA 2HXYA 5BXQC 1WMSA 1N5LA 1E4YA 1RJ9B 2GKSA 2V7QA 1U2RA 4RD2A 2V6JA 3PCRB 1QZXA 1QVRA 4POAA 5CB6A 2PZEA 1N2CE 2AN9A 4MYCA 2BMFA 2P6NA 1NIJA 3KXLA 1J7KA 4TMKA 2FN4A 4U7DA 4M1MA 1G18A 8OHMA 2JCSA 5GJBA 4BLRA 1JBKA 1JR3A 2GBLC 2VHUA 1Q1ZA 4Q1EA 2W0MA 3QXHA 1FX0B 1GM5A 1JAIA 1Z08A 4ZCLA 3OHMA 1RYFA 3ZYCA 4ASUD 1X1SA 5KDLA 3NDBB 4DT1A 1AJEA 1MABA 2IYRA 1FNNA 1QVAA 3PUWA 3EPJA 4OKSA 1OFTA 3KKPA 3CX7A 4HB4A 1BS1A 5F3WB 4LSGA 4ESHA 1ZUIA 1N6KA 2L0XA 4X8HA 5GJWC 4NMMA 5D3MA 2RGBA 3UWOA 2VSFA 1XX6A 2FDCA 5F9HA 2KSQA 4EDHA 1Z6AA 2AL7A 4KI0A 4K81B 5FL7A 4JVSB 3ADKA 1R8QA 3AVOA 3U2QA 1HV8A 5FPYA 1NMXA 2G1KA 3DZ8A 3CLVA 1W4RA 3EPHA 4G0NA 4AK9A 2XNDD 4M2LA 4Y0AA 4P31A 4KODA 1RRPA 2NO7A 2GXSA 3SI7A 1UKZA 2A5YB 3QXXA 2FWRA 1T3SA 4YMWA 2ZRGA 2ZVQX 3BIFA 2ZREA 2YWHA 3SS8A 3A1TA 3W8NA 5FL3A 1RJ9A 5FR2A 1R0XA 2LKDA 1G8HA 4TLCA 2H92A 1DADA 4X8LA 2JLUA 4C0JA 2WOJA 1N5IA 1W1WA 5FBWB 4BFYA 1EWQA 3GJ8A 4MH0R 2P3SA 3KDSE 4IEIA 2XTNA 2XZPA 4W5HA 3ZVNA 2BMJA 4QL3A 4HZUA 1P9WA 1U8ZA
chains in the Genus database with same CATH superfamily
1KI3A 1CP3A 1G19A 2IYXA 3CISA 2IOQA 3KKMA 1IC6A 2FMKA 3D8RA 5CTAA 4BUJA 2CUZA 3NNDA 4HFMA 2J4DA 1WF6A 3M6FA 1QFZA 4X85A 4DMGA 3L7IA 3Q8KA 2UZIR 2PN1A 3OIWA 4US0R 5D85A 3WNDA 1USUA 3UF0A 1DPGA 1JQBA 4KWIA 4G8JA 3SLKA 3PFNA 5CUQA 5J4KA 1U81A 3CKLA 1YIDA 3H75A 3WYAA 2GUWA 2ZWIA 3NM5A 1MDFA 3QELB 7ADHA 4IIFA 1GTMA 3VKWA 1ABBA 1W36C 1VFPA 1E2MA 2I1WA 2XQIA 3NTVA 1WKBA 1GCAA 2GEBA 2HBYA 3KVYA 1G6Q1 2OV3A 1CRLA 4PW0A 1MRZA 3RUCA 1YCHA 1BW9A 3INTA 3Q40A 4Z86A 4EP1A 3GLIE 1RM3A 3CRZA 1KMNA 1VGQA 3JQAD 1EWVA 1RMQA 4WOCA 2FJPA 3RKRA 5LZ9A 2DX7A 2QPAA 4ED9A 4LS3A 1KZ4A 1NI4A 3AMVA 2C2XA 3G5MA 3EHDA 4FDVA 1KSJA 1IPEA 1GFWA 2ZITA 3S81A 2FDXA 4LJ6A 2JLCA 3ND8A 1XQVA 1BXKA 2WJGA 5F7OA 3AVTA 4Q03A 1F6WA 1VL2A 2HMAA 2YMLA 1FIUA 4FCWA 5AQEA 3AEZA 1U2GC 2WF9A 4LXXA 1JFFB 3FYUB 1FQWA 1X80B 3KZNA 1K9SA 4IH9A 2FUEA 4QM7A 3R9WA 2EBHX 3KT8A 4AKHA 2WD8A 3HCOA 2VNAA 4PG6A 1ISHA 3E1GA 1KDVA 1G55A 4KH1A 1ODFA 1HE8B 2NU7B 2O2GA 1JF8A 2QUKA 4KBGA 4OQ4A 5HKLA 4GYKA 4BJ3A 4D97A 1BSVA 4NLLA 1WE2A 1I3CA 3DB2A 4RQAA 4U7JA 3QFFA 4GMHA 3CLUC 4KACA 4NZYA 4AS1A 3OLYA 3L43A 2JCVA 4RX1A 1N2CB 3A1WA 4YO7A 4NARA 1H2BA 1UM9A 3STVA 1RRMA 4HATA 5IHPA 5CCDA 1KQNA 2D6FA 4BVLA 2ZBGA 1M3SA 2BE9A 2PK3A 4YCLA 1RZUA 3ZPXA 4UUPA 2FN3A 3AY6A 2Y66A 1IVNA 4PXAA 3WXMA 2EP7A 1K06A 1YRLA 2ZKLA 3D6HA 3DOOA 2C2WA 1NMSA 2BC9A 1OXXK 2P69A 1EMDA 1W29A 3KV1A 3RBZA 2FSGA 3VISA 2IS6A 4FZJA 4MR7B 1JILA 5DF1A 4YJFB 3AVUA 4JB0A 3PI6A 3MERA 1RIIA 2BGMA 2CXXA 3L4BA 3NTLA 1ORWA 2G28A 1LFDB 4CF7A 4YHBA 3STTA 5JZMA 1NSYA 3V2HA 4Q7LA 3SYLA 4NY1A 4QBHA 1T3HA 2GR9A 2ORWA 1RM4A 1DARA 2JHPA 4QTXA 3UFBA 4E08A 1ZEMA 4Y3UA 2G70A 3LBHA 4ZHQF 3SHTA 4NE2A 3OE1A 4UUAA 4MWTA 1EZZA 1QANA 2YX1A 3UJPA 2ZE5A 4EAAA 1EE1A 2FETA 1SK8A 4ETWA 4WKBA 4Q9JA 4HX5A 1BEEA 3X1KA 5KPDA 1E4VA 1XE3A 3ES9A 1CEEA 2YFYA 1NLFA 1XELA 2Y71A 4GBED 4YFVA 2VNIA 4FSXA 3V5NA 4RMIA 5BNFA 2AIRA 3DAHA 3ZHXA 1WDTA 3QY0A 1Y8RB 4F9TA 5BRJA 1S0UA 2V7PA 3LRXA 4HLCA 4DZRA 4K6GA 1C4XA 3NB0A 2RI6A 1J6UA 4X3CA 3L4BC 1G4AE 1KETA 1E7SA 1KR2A 3QWFA 2NTVA 3ZIUA 3VJRA 5JMTA 1O6ZA 2R6ZA 3UBMA 5JZBA 4IVQA 1HKUA 2R44A 5KREA 3NYRA 1K7CA 1M8JA 2CF5A 3A2MA 1NYLA 4RWZA 3PG5A 1G8YA 2A35A 2ZRJA 4HRVA 4B6RA 4AICA 2BM8A 4D3XA 1RZRA 2XE4A 3E61A 3GEDA 1YA6A 3W6UA 4JQZA 4LF6B 4BNXA 3ICCA 3C4JA 2ZXEA 3B6MA 4RDXA 3DW1X 3LT0A 1E60A 1VMEA 1M6YA 1VPEA 1KQFA 1IOLA 2HRDA 3O2QB 3PE6A 1TO2E 3ESZA 2IK8A 1Z8DA 3PIRA 4HDCA 3BL5A 2HREA 2J5KA 2DPLA 3MJ4A 3TINA 1LX7A 3TX6A 3ROXA 3PHCA 4NFSA 2H9AA 3DV9A 3BM5A 2G8LA 4UJ3A 2PSSA 2A9QA 2ACVA 2AQHA 2UZ1B 2NVOA 2P3QA 1L4BA 3BEDA 5ENZA 3WLEA 4CCYB 1M1YA 2IPOA 1DRKA 3CUYA 2X8AA 1E1MA 1I0IA 3FKJA 1MF7A 4E5SA 1S2NA 4H35A 4XSVA 3TCXB 3WZLA 3H1EA 2XB4A 2A88A 3VU8A 3AFGA 5E4YA 1JIXA 3R8FA 4LFAB 3GHYA 4YQEA 2HYIC 1W2WB 4BNWA 4EJ2A 1GZSA 1FDRA 4PSKA 1YF3A 4OAPA 2E82A 2V4UA 1MJ5A 2BISA 3UB2A 2EZUA 5B57C 5F78A 2ZSAA 4KB5A 4B3BA 2WDZA 4Z1OA 2ZYRA 1QO0D 1P19A 2DY0A 2BD0A 2QLTA 2XWPA 3R7AA 1GGHA 4C43A 3WIBA 3MC1A 4W7HA 1ODSA 1LQUA 2RHDA 3PU6A 1UBUS 2XXJA 1TUBB 1W6RA 3DPSA 4KXYA 2LDXA 3VI4B 4G1VA 4RDCA 5IZ4A 4LEIA 2QGFA 3E35A 4G1CA 1Z2OX 2JFXA 2ZRPA 3JVIA 4KQIA 2UZAA 3RRBA 4J75A 2QZSA 2B4QA 3BD8A 2YUTA 4J3JA 2AK3A 4P4TA 5DZSA 2B34A 2BTOA 3T1VA 2XUJA 3K1JA 3A6EA 1E2KA 3C5HA 3KM0A 2JVKA 3E5MA 4UEQA 3TSCA 2WB2A 4JXXA 2C2BA 4L4SA 3EMDA 1D4ZA 3L8YA 4IZ6A 1HFJA 2UUPA 4YJDA 4BO2A 1HNXB 1OASA 4M9CA 2JCBA 3K0AA 4QZVA 1HKHA 4XGKA 2B8WA 3RVPA 1C7IA 1VL1A 1TAUA 2FWBA 5IEJA 1XVTA 1SKMA 1YV9A 5BW8A 1SHJA 1TADA 3UAGA 1KDTA 1TVCA 4H7FA 4DR2B 2YWDA 4TZTA 2ZM5A 1K8RA 1LBSA 1D5CA 1N0IA 4OF4A 4RJJA 4C6TA 2QTAA 4K9KA 4FDTA 4MUMA 3RLFA 4NQRA 1D2EA 1A8QA 5LBTA 1NIPA 4PVCA 3S2EA 2JFFA 4D9GA 2VHJA 4PRYA 1UK8A 2WJPA 5F9MA 2FE1A 5CA0B 2NN3C 3DWFA 3JD1A 3MELA 4OJYA 5E0KB 3HXOA 2GEKA 3RFTA 4DDHA 2GHRA 1WHTA 1PWYE 1KBOA 2NQ2C 4EDFA 4IO1A 2EU8A 2DT5A 1I01A 4Q01A 4BC1A 4E0BA 4FFRA 1A2BA 3UW3A 2Q49A 4PHCA 1E3MA 1Y3DE 1U2PA 3MLAA 4P7JA 1EK5A 2V55B 5CVUA 3SMVA 3T7IA 3PVSA 2DFTA 4DA8A 2XCTB 1VE5A 1J5PA 2F00A 4KUEA 5K7SA 3F47A 1Z0UA 3JZMA 2P30A 4N18A 2BEKA 3BFVA 1GQOA 1GVHA 4K9PA 4FFSA 4TQGA 1XDSA 1GU1A 3KOOA 1GAXA 2HT1A 1IHPA 3OT1B 4B3FX 3CT6A 1A96A 1KSGA 4IS3A 3RKSA 4BPBA 3FHOA 4GRIA 3GA0A 4BDTA 5ALXA 4GPZA 1DQSA 4TUYA 2R7MA 1LDGA 1PBNA 3H6KA 5B7NA 1Q0SA 1Y37A 2QUZA 3B3QA 1BKDR 3T52A 1D4FA 3ELDA 5IJAA 1WTCA 3B3JA 3ETNA 1U0JA 2EZ9A 3ZBTA 2YINC 2PKEA 4TTQA 1ID8A 3CUTA 3N86A 3CLRD 1VI5A 4C3OB 1R4ZA 4YBRA 1CR0A 2H9IA 3BH0A 3W04A 4CCYA 3QHPA 5EIEA 3GCXA 4QEZA 2HTEA 2W93A 3CLUD 2NPFA 1XQXA 5CBKA 1I6MA 2F43A 2OWDA 3GZTB 4CCAA 2OP1A 1MO2A 2X3UA 5ERYA 1DB3A 1JKIA 4KE6A 1GTZA 4L51A 4R1SA 1AU9A 1RQ2A 4FEYA 1F2TB 1JBQA 1SB8A 4LGVA 3V4FA 3U6KA 1A95A 1D2HA 2D7DA 2PL3A 4NJEB 1T9DA 3DOJA 1NSTA 1RJFA 3K8QA 2PGOA 3QXJA 4E5DA 3SHFA 2FG5A 3EXFA 3T3NA 5J1SB 3GJQA 1A72A 3F98A 4GQIA 4IG9A 4X90A 2QVXX 3UQZA 3W2IA 1Z17A 2D8AA 1XDZA 1AHHA 4Z9YA 2D7JA 1N2HA 2MMGA 3CXUA 4RM3A 3WWDA 1AQJA 3WNZA 4GLJA 2CXOA 4ZKEA 1ISJA 1V71A 2HK7A 1P9LA 1CJMA 2AN1A 2PL1A 1NW8A 3UMBA 1UKEA 4NS1A 2FPPB 2XNDA 3IP3A 3L9WA 4I1UA 2P6MA 5AK4A 4AZ0B 1R8YA 2Q5LA 1NU6A 3GLIB 5JXIA 4I19A 5TS3A 3LPLA 4URWR 2BFWA 2DQSA 4FCVA 5H5JA 3OE7A 3TFQA 2DFLA 3WYGA 3L05A 2OVBA 3AOGA 1NVMB 2NPIA 4S24A 1JLSA 3I2KA 3CC8A 3ZJTA 1Y8QA 2R6R1 4M9XA 3TVTA 4AY5A 4I4CA 3THYA 5FKJA 3AK4A 4D0GA 1DKRA 4JFRA 4MV7A 3OZWA 1XEWX 3K0AB 1GGKA 4OBWA 1G5FA 4GXNA 4OYHA 3HBLA 4UCWA 2QTVA 4D9HA 4CIYA 2IQ5A 3GPBA 3PQ4A 3TIVA 1VBMA 1LI4A 4GR5A 3RCBA 4MKRA 3TRHA 3TYXA 5C8YB 3RAFC 3DMFA 2OHOA 4JP1A 4ZODA 4YAGA 4U5XA 1U3UA 3Q7RA 1M2OA 4S05A 3B51X 4EJFA 2C5GA 4KV7A 1RS0A 1KAMA 4IHJA 2HPZA 3ZQJA 2D0DA 4EY7A 3HBNA 5BYAA 3DCJA 1G64A 1G6OA 2O2JA 4O1MA 4ZREA 5LZ7A 3RSCA 4A9AA 4HTFA 2XADA 4O2RA 1P8JA 2WQ7A 2MSEB 4I99A 2BPOA 4CM1A 4JD5A 3H4MA 2H65A 3KZMA 3N0RA 3P8ZA 3WWEA 1Y6FA 5INTA 3H9EO 5IKXA 1JQAA 4BP8A 2YS6A 3FROA 4UTXA 4PO8A 3OTGA 1V25A 3KHUA 5DT2A 1VHQA 2D62A 2F8MA 4LFCB 3S1AA 5AW1A 5KX5B 1PJCA 3GRZA 3CVXA 4QGSA 1NKSA 2WT4A 3REFA 5CNKA 4KKVA 4Q1AA 3VO9A 1RTTA 3R75A 1XD8A 2AZ4A 1VG9B 3S99A 1E18A 2JLQA 4HWPA 2HF8A 2HSEA 2W9XA 3GLUA 3HY6A 3UENA 3ZGXA 4TMFA 1XA0A 4YWJA 4W5NA 1PNQA 1QS0A 4TWBA 3OD1A 2GRAA 2ZWVA 2XCRB 2AUTA 3E7PA 3PCTA 4MXDA 2BH2A 4MS1B 1DVRA 1L2TA 1NUTA 2MOKA 3GOQA 4BAZA 1NDUA 2KPOA 3C45A 3QTLA 3P32A 5ALMA 3P52A 2NUTB 5KVQA 3HC7A 4BIMA 5AI6A 4CTOA 2HA7A 5TPZD 2OSVA 2JATA 4Q1BA 4LC9A 3WSTA 1Q0QA 2P1RA 1Q1QA 2ERYA 1FRZA 1CUIA 1XLVA 2QZ9A 2ZR8A 1V7QA 1ZN8A 1G2QA 1QR6A 2X40A 2CW5A 2GAOA 5BN5A 3P9QA 2VDWB 2XCOA 5CT9A 3OM0A 2NZJA 3C16C 4MPDA 3RUAA 1VHDA 3U4DA 2P6UA 1Z34A 2XUQA 2RHGB 5BMVF 4BTVA 1W36B 3FSRA 2XH8A 4XGIA 1O97D 2CHVA 1EUDA 3FNHA 4H4DA 1L9KA 5DNUA 4KCGA 1Q15A 4YLEA 4YDSA 1ZJ6A 2CK3A 1I0LA 2Q4BA 4KPGA 5IBPA 3P97A 2C4WA 3TGPA 1KWGA 2P2YA 4YRAA 3RTDA 1H9AA 1FFHA 1US8A 2FSHA 4UD6A 3O0TA 2G4VA 5MN5A 3O47A 4G0UA 1QJ4A 1UAYA 2PRIA 4BJHB 1VYHA 4XPIA 1MQSA 4B2LA 1N8SA 1IUOA 2PMDA 3C6MA 3MJRA 2JIQA 4EO9A 4L6AA 3E22A 5KQLA 2J3IA 3FPKA 1PWHA 3EGCA 1Q0UA 2AS0A 5AKYA 3HXTA 5FOSA 2WG2A 4LRWA 2AG0A 3F5MA 3CCBA 4P4UA 1Y4UA 1G8FA 2IYSA 1XV5A 3IP6A 3KEFA 3NWBA 4LWQA 4UREA 3SBXA 2Q9AA 1AKNA 4PQEA 3DBIA 2X8JA 2ZUWA 3EN0A 4K0KB 1T2DA 2IL1A 2QT0A 4ZJZA 1ZOIA 1Y9ZA 2O52A 3DZFA 3I6ZA 5B4TA 4FKZA 1F2VA 1UEJA 3DL7A 4JP5A 3ZEIA 2C4NA 1G5PA 1IQRA 4F4FA 1W44A 3IO3A 3TR0A 1WXEA 5C8DA 4HFNA 3S2SA 4A8JC 2Y0BA 3I9OA 1BCRB 1CG6A 2XYRA 2CHUA 3HJUA 3PQ8A 4YEDA 2HQRA 1QNLA 3DO5A 2DBYA 1H5NA 1A8SA 1CDZA 1FLVA 1TVEA 2OCIA 2POCA 1PW7A 3N8NA 5ALLA 3RVRA 2WSMA 5TMPA 1SVMA 4FD3A 1QDEA 1V43A 1VP9A 3UKDA 4JV5B 1GRVA 2R7LA 2F1HA 5DRTA 3U4AA 4RCZA 1U3WA 2D3WA 4IFIA 2ZT6A 1G38A 1OXKB 2NACA 4MVJF 4L9SA 4NYIR 4RZQA 5CH8A 3JARA 1N7IA 4I50F 4UQOA 5FBVB 3A4NA 3DMHA 4W7SA 1NJSA 3SEFA 3WTBA 4C0KA 2ZGVA 3MGAA 2NU7A 3S7TA 4FC7A 1K0FA 3KUDA 2ARKA 4HEQA 4Q6BA 4NBUA 4XVCA 5KYUB 2MYUA 2VRNA 2YN4A 3ZWCA 2FPGA 2EYQA 2I3BA 3L0YA 4GPBA 2H2WA 5K1ZA 1EGQA 1HRDA 1W5TA 2O07A 2Y0EA 1R4MA 4L78A 4Q4AA 4MKHA 4YXFA 3NTXA 2BGUA 3IMCA 4J4HA 2VDKB 3V8NA 3P2EA 5IWCA 1MUUA 3G8DA 2YQ5A 3TSAA 4WESB 2G76A 5G02A 1SUDA 3K9WA 3RG2A 1KZ6A 5T57A 4JI5B 2R11A 2IE0A 4LXQA 2FLVA 4YV0A 1J07A 2OCXA 3W4IA 2BHSA 4KO2S 1HG1A 3DOCA 3H6GA 3FB4A 5I01A 4HNSA 4XYBA 1SCUA 3UNXA 2FPIB 1F5SA 1XRMA 2NSHA 2NSJA 2XGGA 3QNUA 4J16A 4O4JA 5AM5A 3G68A 3TXYA 4BZQA 5FUMA 1G42A 2QL9A 4JMLA 2P0YA 4B85A 2YWBA 3HKDA 5B3KA 5KDOA 4CMKA 1FFCA 1XQ9A 4D46A 4D74A 2K5UA 5EI5A 1XLWA 2XUFA 1UBCA 3MCAA 5EE3A 3QKTA 4YRIA 4Z7JA 1V37A 1I80A 4WECA 4Z51A 4R7ZA 4UOZA 5KJFA 2RCYA 3ZE2B 5KSWB 1EUYA 3AZOA 1QIHA 1X7YB 1ZN2A 3FSGD 2WKPA 3FKSA 3PC3A 3VTZA 4UJ5A 3JQAA 3RKUA 3LFHA 2YJ4A 3RWOA 2FA9A 4ERNA 2A1UA 4N03A 3PR1A 2W4MA 3C8MA 3JYHA 3F7OA 3L04A 4YQYA 5DYNA 1FK8A 2WF7A 1U3VA 2NT3A 1ISPA 3KQPA 1VKRA 4MUEA 4CI9A 5ADUS 5BUZA 2X5JO 2AI3A 3JRXA 5MHTA 5TQJA 1WL8A 3V2IA 1D1PA 4UE2A 3GAMA 1IULA 1JXQA 1NAIA 2QRPA 1E0JA 1PV1A 3SM3A 4BY9E 1JFFA 3FYUA 1U6JA 2EFYA 4HUQA 5BNIA 1VTKA 2XB6A 2OAGA 4O25A 1X7GA 8AT1A 3MWDA 4BEBA 2QRLA 1KI9A 5KCMA 1RHMA 2C8VA 4UNIA 2VATA 4WFQA 5HMMA 4PYOA 3VU9A 1O96A 1ODKA 1TC2A 5HRUA 3NOXA 1E4EA 4ENTA 4HZIA 1OJLA 2ORYA 1BEZA 3ZZ1A 2QSJA 2VHEA 4O2BA 3R9XB 1BE0A 3I3OA 3UICA 2GAAA 5DW3A 3V46A 2PGAA 2PQ2A 1TDJA 3CWQA 3QLVC 5ALPA 1CEQA 1N92A 4FKBA 3LX5A 3VOTA 2ZJ6A 3HB5X 3GFOA 4LMAA 5EXXA 4AM8A 4WOBA 4DPLA 4U2KA 1RZRD 2XGMA 1BYIA 4RS4A 2AZMA 2ZPAA 4K8RB 4BP9A 3TTXA 1BOFA 3U1VA 2ZCVA 4EW3A 4EL0A 1GVNB 2FV8A 3KLNA 4LISA 1NBIA 1M1YE 3COJA 1EFAA 1U9ZA 1MA3A 1WQ3A 3F7MA 1NSFA 3WP1B 3VNUA 5F2KA 1JLMA 3DO8A 4ACAA 4G5HA 1TQ2A 2PTGA 4NV0A 1SUIA 1L7BA 1L3BA 4XJTA 5CDSA 4OREX 3COSA 3KXPA 5HPYB 4Y18A 5EE0A 2QIPA 2XXAA 3L6RA 4L3WA 5CNJA 1ACJA 2OV2A 5IULC 2ID7A 4DIOA 4IDNA 3VVBA 3IHWA 3CNBA 4ZICA 4L15A 4PZUA 3HYRA 1GQ2A 1M8PA 1Z6ZA 1CV2A 3E8MA 3LBNA 4Z3DA 4B4WA 5I7UA 2A1UB 2IA5A 4K6CA 3JARB 1VL0A 3NAQA 4IYRA 4JY7A 2B99A 3DEHA 2XMCA 1MEOA 2YQZA 3T1NA 1AC5A 1BAPA 2AXEA 2ZJ2A 3QMPA 5HMLA 2XKKA 3MWLA 1W87A 1EA7A 2HA4A 2KX7A 2B8TA 4QQKA 1PLKA 1I5OA 2PLAA 2QAIA 3H4IA 1YD7A 2BBSA 3LUFA 4HGZA 4IDHA 3STYA 3V1LA 3QYJA 4BNZA 1QR2A 2OBLA 2YS7A 3OUTA 1H2RS 4DB2A 4P5DA 1F1JA 2BJHA 3PQDA 4W1QA 4F6CA 1G0OA 1WOYA 3CRVA 5EZ5A 16PKA 4MQLA 5A62A 3QXCA 1RWOA 1CQPA 4IXTA 1R6BX 4P4NA 3CF6R 1TYDE 1N6RA 1QO7A 2COEA 2XXBA 1MB9A 2QU7A 3DUFB 3I9V6 4XFKA 2O9JA 4P80A 4UPEA 2QR5A 4BQEA 4QUJA 3LLUA 3T1YB 4EQZA 1X1DA 3GMTA 3MSCA 4EI9A 1UBFA 3VU3A 2JLWA 4DBZA 1AGYA 3BSFA 4ACBA 5KYYB 1FSZA 4PS1A 3ZIAA 4H18A 3U6BA 5CDYA 1Z8NA 4NRDA 1D6JA 5H59A 3TQSA 1E5TA 1T15A 1FFDA 1RAIA 1ZNZA 4IH1A 4LVCA 1C1XA 4GZLA 4HEHA 4E03A 4EHNA 4B3SB 3MOSA 3W8DA 4JH0A 1N4DA 3OZBA 4LJ9A 5FR1A 1BXRB 3BGDA 1GGJA 3Q2KA 4QDKA 2G83A 2BFAA 1SBCA 4FR2A 3OBBA 5I4IA 1RXYA 5HCNA 3RLIA 1GPWB 1S8NA 3FVRA 3JYLA 4EQ6B 2IYYA 2FFAA 3QIAA 1OH7A 1PR2A 5CLHA 3HCEA 1WSDA 3M4JA 5J1TB 3L0OA 3GBVA 2BFOA 4I9NA 4EG7A 4FFMA 3HYTA 3UHFA 5CFNA 2NV6A 5CJ2A 3OCZA 5EJAA 1ZHOA 1LPBB 1GLGA 1LK5A 1XHEA 2HGSA 4GC9A 3V34A 1S1MA 4IGFA 4CHGA 4BWFB 3LHSA 4HB3A 1DOAA 2QD5A 3ISJA 2JANA 4MB0A 4RSRA 2QDXA 1EM8A 1S2GA 1GFZA 1Y82A 1Z16A 4D4HA 2ZYDA 1PDVA 3HY3A 4BFWA 2VNSA 3IODA 1NBHA 1RI2A 2JFBA 3SF8B 3FLMA 3T9CA 5JWHA 5H16A 3F3SA 4YACA 2WA1A 3INRA 2RAVA 1JSZA 1RAAA 2HK6A 3V1KA 2PSHA 2XOXA 3ZXIA 3FOEC 5U4XA 4G1FA 3W6OA 3PD1A 1NX6A 2CLDX 1XZIA 2E4YA 1O94D 2XF8A 1YK1A 4HB0A 4WKOA 3D0QA 1MOSA 2LWIA 3P9IA 3S0JA 4AJNA 1CVIA 2J3EA 1F0YA 1XF1A 1FLDA 3Q41A 2ETVA 4NZNA 3N7UA 4I5DA 1K1EA 4UM9B 3KR9A 4WZBB 3ZCTA 4OUKX 1I33A 4MQFB 1HYHA 1BNCA 1UWCA 2PWYA 2WHPA 3FR8A 4Q3CA 4QTTB 4TXNA 4DLAA 1IXYA 2YWGA 3E48A 3WBKA 1E2HA 5DE3A 1Q21A 2YN2A 3I12A 3COWA 1HTTA 2OCAA 1PWEA 1SXJE 1NP3A 4OFXA 4HTFB 3BD6A 4M9RA 3TE7A 5DGXA 2CNOA 4GBJA 5DVZA 4OB8A 1XC7A 4ZC8A 5LQNA 3PXGA 2QY9A 1TK3A 3BJMA 1RWKA 4M54A 4Y0NA 1C80A 1GA1A 1H8HA 2VDVE 4PS0A 2Y93A 1Z26A 3M6MD 1PT5A 4ZI7F 5JS8A 5BV8A 2IBTA 1DIHA 3A1CA 3NC1C 4HAWA 3W1WA 3GYGA 3I2GA 4TXLA 4DXHA 1MMFB 3FCCA 4ZK6A 4FCCA 1UKCA 4QU0A 4Y2HA 4KU4A 4I46A 5F76A 4O1HA 5ECDA 4HJXA 1P9NA 2YJGA 1DKMA 2P2SA 1JG2A 4PSDA 3THOA 1KP9A 1KJNA 3KUCA 4OHOA 1G41A 2V54A 5E8JA 1GPUA 1A5TA 3WGYA 3QWBA 4JITA 1YNSA 2JZNA 4G63A 2WF8A 5G53C 4B74A 1YVEI 1VRVA 2ZYIA 3H86A 3LGXA 3A36A 4R9NA 4HXEB 5K8UA 2RHLA 1HPLA 2DJ5A 3OEEA 1M2FA 2Q3LA 5FPQA 1P7WA 1X7WB 3TUJC 5KINB 4AY4A 5EZYF 3WJAA 1V39A 4F11A 4YV1A 2H7XA 5CU7A 1HYQA 4PR0A 2O5RA 4Z5XA 3PFGA 5L4LA 3N8IA 2HGZA 2ZRLA 3QX9A 1EBUA 5JHGB 1NONA 2FP3A 3QUTA 4OXYA 3ZZUA 2PMBA 1C30A 1EK1A 1OWLA 1Z4PX 3PYMA 4RVCA 3RIMA 5ENDA 4IG4A 4CTMA 1G21A 1YB4A 2HMVA 2VNKA 4XYEA 5ESDA 4EVRA 3WHKA 1HXHA 3ZVLA 3CG0A 3HCCA 2OA0A 1POWA 2J09A 4CODB 5HF6A 4J6FA 4UVEA 1OXTA 2XSZA 1LTHR 4C4RA 1GLVA 3T3HA 1HOTA 1NWCA 5G1PA 3AR5A 3CZ4A 2WJZB 3OTQA 1D07A 1RRGA 3KXKA 1OF1A 1AZWA 3GPCA 4R40A 4BZZA 2BYTA 5AJWA 1CZRA 3B6IA 4G1EB 3AF2A 1R6XA 4EKEA 3CRRA 3ZWOA 4QFCA 2FZKA 2NZXA 4NBSA 3D6UA 1ELOA 3FAKA 4KDFA 1QX3A 2H1WA 3V33A 4AJEA 2G88A 4G9GA 4F60A 5B7QA 1ZAKA 5FUYA 1L4EA 1SUSA 3D3WA 3NBKA 1GTVA 2LZ0A 2H07A 5F5LA 5K4GA 3OWOA 1N77A 3IP9A 2PV0A 2RH4A 3NNNA 3L93A 1IK6A 4YMHA 4ND3A 5FNZA 3EX7C 4II3A 1YFLA 2Q6OA 4HEJA 4EECA 3LHIA 4M86A 3FDJA 3FWYA 4RACA 5JTUA 3QLJA 2ZSUA 2PVPA 1PR3A 2JGEA 3D4OA 4R05A 1T1JA 1FDOA 1H0SA 1X42A 4RKWA 4AN1A 4MVJM 5IX8A 3LU1A 3NOQA 2ZBVA 4O4LA 3WKBA 1OH6A 1O6BA 5HR5A 3K0FA 3P2MA 1I3NA 5FEMA 1F9EA 4QO7A 5AUQA 3WLFA 3CE9A 1W5AA 2E6UX 2IJGX 1EP3B 3FYTA 5TVGA 5HOEA 2I4LA 1T5IA 1FS6A 3EDQA 4BXOB 2A0FA 5IYZB 4HSGA 3MMPA 1EJ2A 2OO3A 4RJIA 4I1IA 4NR0A 4X7MA 1FRFS 1USKA 2DHRA 4G8BA 1VJRA 3QFRA 3A6FA 5DN9A 1UOOA 4NONA 4MLDA 3ANLA 3TUIC 3CX6A 5DNWA 1KMHA 1V8DA 3AW8A 3BJEA 2HPAA 4MDHA 4U8GA 5HZKA 2D06A 3AYXB 1C30B 1Z5UA 2CMKA 2VG8A 3AVPA 3SNKA 1RBMA 1IM8A 2ZIXA 3RJ9A 2JPDA 3GVPA 3RVJA 3H8SA 2W2KB 3LL7A 4FQ5A 2W6ZA 2C96A 1PI3A 3K20A 3RRNA 1WXDA 2FUG1 2WBLC 2W00A 2X8WA 2XAUA 3N3BC 4G5QA 4LE1A 5HK8A 1EFUA 3KJHA 2PKRA 4V2UA 4DMRA 2C4HA 1QZZA 4GVXA 2Q6IA 1FQKA 2N47A 3SXPA 5FYQA 4ISBA 2PS3A 5GONF 2JGKA 2G82A 1DRVA 4CLHA 3DNFA 6GPBA 3Q15C 2HF7A 2WRZA 1JIIA 3S8MA 3ZH9B 2I80A 5FBRB 3O1HB 1CP2A 3HGTA 4HGPA 4MR9B 2VYVD 2WEKA 3FTEA 2JAXA 4G6ZA 4XA8A 2FZCA 3PUKA 5H3CA 4R01A 1J33A 4GVLA 4IY1A 5EJ8A 4WPGA 2YJZA 4Z7NB 2IOFK 1V3VA 4XYGA 2QORA 2AKEA 3QBVA 1GPDG 2HDWA 4BNJA 1RCFA 4RKYA 3NV7A 1AO3A 4BCDA 4ZIRA 3JW8A 4JVOA 2E87A 4KR9A 4MPTA 1IZ8A 3DCYA 1TM1E 3SSAA 1MVLA 2BHTA 3WDLA 2V1UA 5AWFC 3WLRA 2QUAA 2BMVA 4PBTA 2PFSA 2ID8A 3R3SA 4XLTA 4ZYXA 1WKVA 5JAUA 3HL0A 1PZXA 4J1SA 5EJ9A 1G8KA 5J2UF 3OEHA 2GZ3A 5TJ9A 4PLPA 1NJ2A 5HXAA 4CF3A 1UXJA 4TLDA 2N46A 2CLEB 1B3BA 1ZITA 3UA4A 1FP4B 4BQNA 4L3OA 4BO8A 5I4BA 1SZJG 3A2KA 3I09A 3HUUA 4HH0A 3JQ8B 3T61A 5AW6A 3L82B 1N3YA 4JKYA 3X2SA 4BNYA 5ARDA 5DTQA 3MFQA 3C6ZA 1UMDB 4YP7A 4BRUA 1G17A 1E2FA 4O0LA 4MJLA 3K94A 4RC9A 1E69A 2WJHA 3T7TA 4G97A 3DVRX 3KETA 2L69A 2XITA 1COWD 3W2HA 4CFSA 1KJYA 2GJKA 1TD1A 1F5NA 3EVBA 2QLBA 2XEDA 1AG9A 1N25A 2PH7A 1TJ5A 2V45A 5G4KA 5BN4A 5AVZA 4U0KA 1XEXA 4YJHB 2DC1A 1WMAA 3L0SA 3ME5A 5CM2Z 3SNHA 3D59A 4YP9A 3U9SA 4ARSA 1OLUB 2UZ1A 4FYYA 2F1JA 1CXZA 1CYDA 3NDJA 3PPYA 5KYTA 1C29B 3ADPA 1J0AA 1A9SA 3K5WA 1L1FA 2VJMA 1DX4A 1PJLA 1SCUB 3T3DA 1IG3A 4F3TA 4R8KA 1MH9A 1P6UA 3ADOA 4K1XA 2P1DA 4NE9A 3LY5A 4HY3A 3WL3A 2NTYC 2GK6A 2JD0A 4LDZA 1GAEO 3FZQA 2CCJA 1T5TA 2ZYHA 1IEWA 1CY2A 3H5AA 1P77A 4JC5A 4NOMA 1O6FA 5E3HA 5JS7A 2P6OA 2Q46A 5A71A 4B79A 2AOUB 1ZSYA 2PT6A 5IW8A 1BXRA 2BKLA 3UMGA 1KDYA 1EP1B 2OCYC 3UM9A 3BK2A 1L7VC 4Y9TA 4ENWA 1XEAA 3MWEA 4KWTA 3C2QA 2AXQA 1CFJA 1S8AA 3LL4A 3ZTTA 2J46A 3W2GA 3K73O 3OM8A 1Z5NA 5IT0A 4QT4A 3G2MA 4RSHA 4Q3OA 4BQFA 1C3JA 2E85A 3L5KA 4B40A 2X14A 1M1NA 3OWXA 4PPYA 5IDVA 3FG9A 1T1RA 3I04A 5JTTA 4CNBA 1YA4A 3LKZA 2FW8A 5K6AC 1M8FA 5C53B 3V4ZA 3T1HB 2C2YA 2VPQA 4OHWA 3HCRA 4RVFA 5EPUA 3RSLA 1F7VA 2XV1A 4QGBA 2C5AA 2O4UX 1L4UA 3BJIC 1HA3A 3FW1A 4JI1B 4KUHA 4UQLA 2VBIA 1DL5A 3KTOA 4JOBA 5LVAA 5FI0B 4ZEWA 1FLNA 2FOXA 1G6KA 2QRQA 4ZQCB 1C0LA 2G9VA 3MMSA 3NR2A 4Y2YA 4C7VA 2QMYA 2QOEA 3KFXA 1QQAA 2C9BA 4TMYA 4LPSA 4TTTS 1LTQA 1DGQA 2ZIUB 5JAZA 5ULLA 1LRKA 1U5AA 3BGSA 5J2UA 3LIIA 4OU5A 4JKIA 2H11A 3CS3A 3FTDA 3IKJA 4EPVA 4ND8B 2PGDA 3SJZA 1TKAA 2JJ2A 3CSDA 1EBBA 3M33A 1RD4A 3UT0A 2E5LB 4BNDB 2ENWA 4WL0A 4YJ2F 3ABRB 4PAWA 1C7JA 1SKBA 5CA0A 3G0OA 4F9EA 5TB5A 2ZIAA 3GO4A 3WAKA 1SWWA 2IDZA 3OY2A 3WL5A 4NKRA 3VTFA 3S70A 1HLDA 4A0QA 3CT4A 4QHYA 3WMFA 3NGMA 1V1RB 2J7PD 4KXQA 4FW9A 3OY7A 1KL7A 1K4KA 1PF7E 2CXQA 2FX3A 1X87A 5K8VA 2VTEA 4PLYA 3OE4A 2G77B 1BN6A 5CLQA 4YI5A 3ZVKA 2Q29A 3B2QA 1MO4A 1L7DA 4IIYA 5ALFA 4BE9A 3PGJA 5IUNC 5IM4A 4LHZA 3T1OA 2BAGA 2KBFA 1E9AA 1AF7A 2YXEA 3AVXA 1UJCA 5FLEX 1FSGA 1ZBDA 1ULHA 3DLPX 1TYZA 1NF9A 5CJJA 4DCSA 3A7EA 1B15A 2Z9BA 4FOTA 5TDHA 3R3UA 5A4AA 1UFQA 1QO0A 1TJ3A 5EJEA 4JGBA 3PNSA 2C29D 4RCVA 3DZGA 5C5DA 5E4FA 1E1RA 1IXZA 5JRDS 4GOOD 1RJGA 3DTVD 3IE1A 3DOHA 2IH5A 1VE7A 1W75A 3KQMA 1I3KA 2AFRA 2IY9A 1T1EA 2O3JA 2XMGA 3DE3X 1E98A 4MR7A 1QRSA 3C3PA 2G6TA 4K9OA 2MR5A 4X7PA 5BMVA 1OBOA 4L02A 1J23A 1A9YA 1LBQA 3G13A 4AJ1A 4EB6A 4FZVA 3GG2A 2GBIA 3BMCB 2JCGA 4U6NA 4DQUA 2CLLB 2IYAA 3AI3A 4IDCA 3SG0A 2IKQA 3N58A 3UAWA 3VSDA 4DSUA 2B2XA 1ZM4A 1BGWA 4GWGA 4LN1A 4UXHA 5I9MA 1B4DA 3L7AA 1G3RA 3IPYA 1IAQA 3GIWA 4FTWA 2JIOA 4IIUA 3GW8A 4TN5A 4YBZA 3EBPA 3UMCA 3WE7A 1UADA 3M1AA 3BIWA 2PGLA 1EJBA 4WLEA 4Q21A 4EG6A 1AHIA 1R6TA 2I33A 1T91A 2IDJA 3GNSA 5BW4A 3IEXA 3IR5A 5EIHA 4CEJB 3H7AA 5EUBA 3FLBA 2W98A 3JQAB 1SJ9A 3G8YA 3NBMA 4F1JA 4IDQA 1P1RA 3MGKA 5ANRB 1USWA 2BR5A 2WUEA 2ZIVB 4ER3A 3D02A 3PXUA 4JLNA 4LWZA 3BN3A 4OA8A 1P5RA 1YR3A 3CNHA 4Z8XA 4LIPD 3PENA 1TJYA 2O2ZA 1UXOA 1DV1A 1QHHB 3PI7A 1L1EA 1RHKA 3VR6D 4RYDA 5KWIA 1W88A 3IC5A 3TJRA 4QJ4A 3V9AA 1BQ3A 4K6MA 1OI2A 3DTTA 5AESA 4YALA 1J20A 1FVFA 3TJMA 3UJCA 1ZC4A 4DCGA 1XVUA 5KOIA 1CULC 4X6YA 3KSRA 1BW9B 3W1VA 1DUSA 2XDQB 2VA8A 3KWFA 5KU7A 1BU8A 4BP3A 1UT8A 2R6AA 2HLNA 3THXA 3IEUA 1KKMA 3NHLA