3RS9A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p3-di(adenosine-5') triphosphate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 178
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rs9A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rs9A02
3UQEA 4O1GA 3I3YA 4KALA 2AX3A 4LC4A 4C5NA 5TRWA 4E8YA 2I6AA 3RPZA 2RBCA 3RO4A 1KYHA 3RREA 1YGKA 3N1CA 1LHPA 4B8SA 3MBHA 1EKQA 3CQDA 3BGKA 3NBWA 5C3YA 3RS9A 3RTDA 5F11A 2DCNA 1UB0A 4C5JA 1GQTA 3K5WA 3RS8A 3NBVA 4X8FA 1VI9A 3RRFA 1YGJA 2C49A 2QHPA 3IN1A 3JULA 3LHXA 4WJMA 3HPDA 5C41A 4O1LA 1GC5A 2DDMA 3LJSA 4XDAA 3RQQA 2VARA 3DRWA 2PKKA 3IBQA 2YXUA 3NL2A 1TZ6A 2FV7A 4DU5A 3ROXA 1V1SA 3RNOA 2A9ZA 2ABQA 2V78A 5TQIA 3NCAA 2A9YA 3BF5A 3PZSA 2AWDA 3KTNA 3OTXA 3ZS7A 3RTEA 2F02A 2O8NA 4E3AA 1RKAA 1JXHA 3Q92A 2AJPA 5CGEA 4K8KA 3UQDA 3GO6A 5COJA 1UA4A 3UMOA 3RM5A 2PKNA 3B3LA 3NL3A 1V1AA 3PL2A 4S1MA 3RQ2A 4K8CA 2QCVA 1U2XA 3K9EA 4XCKA 1YHJA 3NC2A 4LBGA 4LCAA 4C5KA 1WYEA 1RKSA 3Q1YA 4YL5A 3W4SA 5F0ZA 5EYNA 4C5MA 2AB8A 1TYYA 2I5BA 2JG5A 3UQ9A 3NL6A 5CM5A 2HQQA 3RPHA 1LIOA 3RY7A 1TZ3A 2XTBA 3ROZA 2I6BA 2C4EA 4S1IA 5C40A 2YXTA 3RU2A 3RRBA 2AJRA 3B1OA 3RTGA 3KZHA 4XF6A 3RSQA 1ESJA 2AA0A 2F7KA 3RSFA 1ESQA 3EWMA 3FHYA 3RQ8A 2PKFA 3LKIA 3LOOA 5BYCA 1LIKA 1RFUA 3QAIA 5BYEA 3FHXA 2DDWA 3IQ0A 3H49A 4K9IA 4PVVA 3RSSA 2R3BA 5BYDA 4LBXA 3HICA 3RQ6A 1LHRA 3RSGA 1RKDA 3NL5A 4EN4A 1V19A 2DG2A 2Q5RA 1EKKA 4E69A 4EOHA 3UQ6A 2ABSA 2PKMA 3NM1A 3RTBA 1RFTA 4KBEA 3B1PA 4S1IB 4DC3A 3NM3A 3UBOA 2JGVA 3NC9A 4EUMA 5C3ZA 4K93A 3RU3A 2NWHA 3B1NA 1C3QA 3RT7A 1LIIA 1RFVA 1RK2A 4B8RA 4E8WA 4YWRA 2HLZA 3H74A 3ROGA 3IH0A 3KEUA 4K8PA 4C5LA 3IKHA 1JZTA 1VM7A 4N09A 3GBUA 3GO7A 4KADA 3RO7A 2AFBA 4GM6A 5BYFA 2HW1A 4K8TA 3RTAA 3D3KA 1VK4A 4S1HA 2DDOA 3MBJA 4XF7A 4KAHA 5EY7A 3VAQA 4E8ZA 1V1BA 5B6AA 5CGAA 3IE7A 4JKUA 4N08A 3ROEA 3RTCA 1BX4A 1LIJA 3KD6A 3RQ5A 1JXIA 3RQXA 3RRJA 4K9CA 3DZVA 1L2LA 3UMPA 3QA2A 3B1RA 4JKSA 1DGMA 4E84A 2JG1A 3D3JA 4EBUA 3VASA 4KANA 4UBEA 3HYOA 3B1QA 4U7XA 2R3EA 4JJPA 3RT9A 1TD2A 3RQHA
chains in the Genus database with same CATH superfamily
5JS8A 2V9ZA 2QUZA 3HNOA 2H2GA 1Y7TA 4E11A 2PXHA 3U9SA 1J21A 1FW8A 2XB6A 4HGQA 3IVMA 5CJPA 3SEQA 2QAGC 1I1QB 2QVLA 3WE7A 2XVZA 3TBHA 4DEXA 5FV7A 2H7VA 2E55A 2I6AA 3KSBC 2W58A 2ZYHA 2A59A 4V0RA 5L3QB 3HKDA 5FLEX 1UBEA 1ZGBA 4OAOA 4CMBA 4DIKA 3T9AA 2JHFA 2H65A 5AUPB 3UYKA 5JH7B 4DV0B 4YMIA 4HSGA 1RRKA 1R5OA 2N9UA 4AULA 2UDPA 5LD2C 3JQAB 1ZNXA 4PU0A 4BQSA 1YNOA 3F6PA 5FBWB 1E6WA 5AK4A 4JC0A 1BDHA 3STYA 4DCJA 5FWNA 1FSFA 1Z0JA 2ZJOA 3D9QX 2X0IA 1A4UA 2QX7A 5HZMA 3COJA 3L77A 3U3XA 5HUQA 1BNCA 1OXXK 5AKKA 821PA 4EATA 3FZEA 4AT1A 1OW3B 4YMSA 5CPFA 1XCJA 3BCSA 1ENOA 3CBQA 4JA2A 3VI3B 4JSRA 3EVTA 3TTWA 1PEYA 4J6FA 4MKRA 1XMXA 4MOWA 3N8NA 1JRLA 2WHXA 3HXTA 4I19A 4D9NA 2GKGA 1NXPA 1SBTA 2WPNA 3AFNA 4Y1GA 1RU3A 3IMGA 3PQ7A 3OFKA 4LI3X 4IUBS 4C4TA 4YL5A 1KEEB 2VPQA 3DC7A 4Q4HB 1PVOA 5ERGB 3QG1A 4DILA 2I5BA 4N8SA 5ALYA 1V37A 4TM7A 4JEIA 5AVQA 4NE9A 3PTAA 1NMXA 1J99A 4ZXFA 2XUHA 3S1SA 4RZ2A 4B4UA 2HF9A 2WTUA 3RUFA 2X14A 3NVMB 1XV5A 1M1NB 2WW8A 1X1CA 4NHEA 1MFPA 3R9WA 1LTKA 1TIPA 2CEAA 4R31A 4IIJB 1VKNA 1BKSB 3CCBA 2TMGA 5ARDA 4RJTA 1XTQA 1YRBA 3M9LA 4JYCA 1SA0B 3KEOA 3SZGA 3OC0A 4QHYA 2FY8A 3HBAA 5JD4A 5KYGA 3B3JA 1VL6A 3AYXB 1KA9H 2A2ZA 2BKAA 1SVIA 5G41A 3TZKA 3HBFA 1BN7A 3M3PA 1NWHA 2AXNA 1LWOA 3H2GA 3KT3A 4U2GA 3WP0A 2OCBA 1BQEA 4HTFB 4J0FA 1ZPDA 3L02A 5KHOC 3NHJA 5DNUA 1BXRB 1I3NA 1XEFA 2JGKA 4R8VA 4HH4A 1XZBA 5HUHA 3AM3A 2O2DA 2YDYA 4YI5A 3HM2A 2NV0A 2XRFA 2LIPA 1JA0A 1DEKA 4XUCA 1J2JA 1LBQA 3WGZA 3NO4A 3W5UA 3AKZA 3GL9A 3LPNA 1COWA 4MVXA 3SC6A 3ZM5A 5JFGA 4I4LA 4LZWA 4BJ1A 4DRYA 3FNEA 4RK7A 2O2GA 4LYFA 3OU2A 4C5NA 3EFOA 4IG4A 4KQ9A 2FR8C 1OFGA 2IYNA 3EZLA 3LRPA 3PENA 5EQTA 1T1SA 4OM8A 3KVRA 1D4OA 5SYMA 5T4HA 1CQWA 3AONB 3HZRA 5ILGA 1ID8A 1G2IA 5FD8A 4MGKR 2BGTA 3A36A 3NP7A 1YZVA 3I0NA 1YD7A 3WWCA 4CN9A 4J07A 5F11A 3HJAA 5D86A 4AJOA 2C7GA 3EA0A 1GCIA 2RHLA 3K0KA 4ZOBA 1ONOA 4FGLA 4XIIA 1JEJA 4BNJA 2VSYA 1JQBA 4WJMA 3HG7A 1BA2A 3BVPA 1UM8A 3KYBA 4C87A 5I4CA 5IG2A 3ESBA 3WBFA 4DUGD 4YACA 1E2HA 2WAAA 4CT5A 3L40A 2NVWA 1DUSA 2BEWB 3Q7PA 5FOVA 1Z5GA 2OSBA 4ZVPA 4QO7A 4BO8A 3V1KA 4BBZA 3DJYA 4R51A 4H1WA 4U2DA 1SXHA 1D4FA 1I3LA 4PZUA 5KEIA 3SK0A 2GT1A 3ZV3A 3GLTA 2J0VA 1SFRA 3P2EA 4QAQA 4F3KA 4P83A 4HEHA 1QP7A 1GR0A 5CFNA 4XUGB 1ESNA 2B2CA 3HJGA 1PKXA 2VP4A 4OJTA 4OMFG 3O8CA 1X8LA 2FZ5A 3CNQS 3LVQE 2BEUA 3A14A 4F5DA 1TCCA 2JHCA 2ZVQX 3QXJA 4P93A 1V8ZA 2QPTA 4CZ2A 2V7VA 4O8ZA 3UHFA 3EXHC 4C3VA 2FSVC 3GJZA 1CDOA 4ZCQA 3RSLA 2ZRAA 4BO9A 4MVWA 5FWXA 4HGNA 3LHDA 4L57A 2ZT6A 4YRTA 1F20A 2Y0CA 4LBGA 4PPFA 3RVJA 2OHHA 5B55A 5C4MA 4I5GA 4Y9TA 2I6XA 3MWGA 3SEZA 4OXNA 5TMBA 1HUQA 3QVSA 3VR3D 4G63A 3T15A 3KQPA 3H9BA 3ICCA 2ZZMA 1AGXA 4UCWA 4COKA 3WAJA 4Q6BA 2YXBA 4RNDB 5E2AA 3VPGA 2WUFA 1FYVA 4MQEB 3SS9X 4YROA 1X7WA 3BILA 4ZO9A 1L5SA 4EVRA 3NP9A 3WY9A 2VC2B 2XI4A 2OV2A 2DPHA 2C82A 3PQ8A 3RUEA 4WACA 2Z6AA 3ZX4A 5HDQA 4Z1MD 1Z28A 2ISQA 2PGIA 5A6VA 2WIDA 4MA0A 4KWHA 5J2UF 4KW7A 1ZJ5A 1TLLA 2XSZD 3EQ6A 4IS2A 4WXRA 2ZKLA 5DLDA 3VX3A 2FN9A 1TIBA 3W5JA 4UDYX 4BBPA 2R3BA 3KHKA 2V7QA 3CRZA 1SQSA 2FJ0A 2QRVA 1P7CA 3FR7A 4PLWA 1JAYA 3DZBA 4ZV7A 1ISPA 1V3VA 3T5TA 4H6PA 3ZHBA 2OCAA 3ZIDA 4HNVA 2BUBA 1P5JA 1WZ2A 1QIDA 4HBZA 3IV7A 1QQAA 5DNCA 2I4MA 2HUPA 4HYEA 4CUZA 3UATA 3C8HA 5F9FA 4E5VA 1N5MA 1NJ8A 2ADOA 1EA7A 2YWRA 3SE7A 1DVRA 3FWHA 3QLVA 3KBBA 4CMIA 4TYNA 3G5AA 4DV7B 2YFYA 4JT2A 1EK5A 3GRUA 1EE1A 2Q0HA 1KH2A 2UAGA 2ZRCA 4KU4A 4RXUA 5K6AA 2PJRA 5IT9A 2P4QA 1Z26A 2Q50A 3MWLA 1USKA 2P41A 4C3ZA 3PGJA 4ECEA 4Q6WA 1PDOA 2DBZA 4FBMA 3I2JA 3VU8A 3AIKA 3G3EA 1KK0A 1OZFA 3GMTA 2J9FA 1L5OA 4JB3A 4RW0A 2KI5A 2QV7A 1CIJA 1U3GA 3S8YA 1I7PA 2Z2IA 2EGUA 3RROA 1TIKA 3QLVC 1A98A 4S24A 2HCRA 1W35A 1NMZA 2VP3A 4K8OA 2A3RA 5KYUA 2A5DA 2VJOA 4C5AA 2QL7A 2YWBA 4CMHA 1PFKA 1IIRA 5HS4A 3NWEA 3TUZC 2OBNA 3L1HA 3BD9A 4Z4IA 5T4BA 1A9RA 4D9FA 4CHTA 1C3VA 3MERA 1GNSA 2NZJA 3ZHTA 3ACDA 4WVFA 2RE8A 4K6GA 4L75A 3PUZA 2DFPA 4PIMA 5LZ8A 5D1NA 3ZK8A 4JJ4A 2FFRA 1WDMA 3H6HA 3QEAZ 3M6XA 3O5AA 1A69A 4NYMQ 2QDKA 1EXMA 3O4FA 4MV8A 1VYTA 2VDNB 1YS2X 3OTIA 1P91A 3FOAA 3RODA 1F5SA 1SCKA 4RF5A 4MPDA 4RGVA 5DSXA 1I4WA 4AM8A 2BSAA 1USWA 4KFUA 4F12A 5HILA 3DFFA 1Y5IA 4Y2JA 4MYDA 4J2OA 4RVOA 1PX2A 4C4OA 1NUSA 1IG3A 4Z9YA 2PPVA 5TDHA 2QPAA 3FI9A 2YH2A 5L95A 3HJTA 2C9YA 1RXEA 3P9ZA 5DFAA 3F5SA 1C30B 2PMBA 3CE9A 3G9QA 4CMCA 3HV0A 3A3NA 2C9OA 4W1RA 2MYUA 1S6YA 1ID1A 2J3IA 3KKLA 5KYVA 3QQPA 4NCAA 3W4SA 3OD5A 4LDAA 4DVJA 1YBFA 2GNAA 3EMVA 4LA4A 1BE6A 2DOKA 4V03A 2E4AA 1C2TA 1JR3D 4L4YA 2H59A 3PE6A 3P96A 4ZANA 4CDGA 2GPSA 3L06A 5EWMB 4DMRA 4ZHSA 2IYRA 2SCUA 1XIVA 2J33A 4EJ2A 4WDRA 3TCNA 3UT0A 5CFRA 5HRCA 3AIMA 2IX3A 3VV2A 4DCVA 1U3UA 4DB2A 1K6IA 3IO3A 3IEPA 4BFXA 3E7PA 5B1YA 5IABA 3IDOA 1TCAA 1IEVA 1RABA 2IJGX 5DHSA 4WVLA 3FHYA 3JPYA 4FONA 5I8ZA 4GMKA 4EJ0A 5BT9A 2XADA 2XUDA 2VK2A 3W9YA 3C3CA 2DQSA 1AXGA 5C4IA 1D4ZA 4MW9A 4X1YB 3WAKA 4BO3A 5BW6B 4BP8A 5I3CA 3AV3A 2QBYA 1LY1A 3F4LA 5K0FA 5LC1A 4K6HA 1GTG1 2C2GA 3DKKA 1LRKA 3JWHA 1LW6E 3X1JA 4TZ6A 3GGJA 3WLSA 4W5QA 1B43A 1YFKA 5DYYA 3IP9A 3DQPA 3SX4A 4ZYLA 1LNSA 1L7OA 2H63A 2CLEB 3M6IA 4M60A 4MWCA 4TMFA 1D03A 3KVOA 4BMCA 1ZX1A 2J9RA 2DFNA 2QAGB 2WD7A 1P1RA 3G2IA 1JALA 2G40A 1JTVA 3U0BA 3KUUA 1IHPA 3I32A 4FJ2A 1FA9A 3ODPA 4DR7B 5CUQA 4CODB 4OBXA 2PZBA 7ADHA 1RXUA 5JBNA 1Y6GA 1K2VN 1GN8A 2QRVB 1QCZA 4D92A 3K0SA 2GLXA 2JJMA 1E2GA 1TM5E 4B1FA 4PXAA 1ZOIA 4Z2YA 1AQIA 1XWWA 1A9PA 1W0KD 3D5TA 3MT9A 3MS7A 4AK9A 3OOEA 4TUYF 3QNWA 4K6KA 2AQ8A 4GM0A 2ZSBA 5JTTA 3B1VA 5CM9C 8GPBA 4PAQA 2ZJYA 3H65A 3ILHA 1U0LA 4CLRB 4ZI7F 3OQMA 2YHIA 3RK4A 5ENDA 3IP5A 3LCVB 2PSHA 3GEGA 1ZK2A 5IW8A 1WKCA 1WTCA 2HO5A 1KZ9A 3IYLW 3PKIA 4HK4A 8ABPA 1F6DA 2JLCA 3QUBA 1N6NA 1M1YA 8MHTA 5AW4A 3GDOA 3ZLUA 4LS3A 1VMAA 1O08A 2G7MC 4EY3A 1IUKA 4U7TB 5EKUA 2EZUA 2QUBA 5GIOE 3UMBA 3LBFA 4IDCA 2C9BA 1KNXA 1QZZA 2VHYA 3WSVA 4P0QB 3H3FA 5I5GA 1O54A 1PGQA 1XTSA 1FP2A 2FCRA 3D8SA 4QVKA 4XTRA 2W6OA 2CJFA 4QYIB 5FOSA 1UDRA 5C46F 1NXWA 1BXRA 3AG6A 3N2GB 1W4BA 3IILA 5CB0A 1I7DA 4C12A 3W5AA 1CY2A 3OHMA 3M34A 1RXIA 5EHNA 2ZTHA 1G8HA 3VZCA 1C8VB 3N3BC 2FHSA 1M7BA 1O77A 1IXYA 2PSSA 5DW3A 2C7OA 1VCNA 2HJVA 4KQKA 4BJ5A 3J80A 4BBAA 3KQOA 3ZPXA 1RM3A 3I1IA 2AUNA 3QBVA 2C0QA 2JEZA 5JO0A 2BFEA 1LBIA 3CTPA 2HWYA 1ZY2A 3G9TA 4ZCPA 3RUHA 3AY3A 5C18A 3UAGA 4F6LA 4BNIA 5CFQA 3PL2A 1P4SA 2R87A 2H1HA 5F2NA 1G5IA 3DXXA 4KK4A 3VO9A 4EENA 4H3KB 3GT0A 3G2HA 4EK9A 3KJZA 3B6EA 2ZIXB 2SICE 3TAHA 3ENNA 4Z86A 1KAQA 1UMBA 5MHTA 2PEYA 3UZUA 3K8OE 4G07A 3VR5H 3ETLA 2BGLA 2BFCB 1JR3E 1OWNA 1YJQA 2YZMA 3F98A 4GI2A 4HRYA 4J0GA 5HMLA 1QHGA 4EBFA 3K2BA 1Q1AA 2WEKA 4J0CA 1Q1QA 3IS3A 5KOJA 3N7TA 3BAZA 4KPFC 2B82A 2I3GA 3OY2A 4MXDA 1WZIA 3QBEA 4PWZA 1TYEB 3ROZA 3RVKA 4OP2A 4AWAA 2BFBA 1WDKA 3LPDA 3X1YA 3WLJA 3BWVA 3FAZA 5IKMA 3DB2A 4CF4A 3U16A 3BMQA 3AUFA 3C14C 1HMYA 1KDOA 3FCOA 3U62A 4QU0A 2IYPA 3KQUA 4DTCA 2GHRA 5I7SA 4KLZA 1ISGA 1PNRA 3HYRA 3OI7A 1US8A 4L72A 3U4IA 2FH5B 1N1DA 2OFXA 1O96A 1JMKC 3A27A 3C6XA 1NI4A 1RBZA 1Q0QA 2PWZA 2QAJA 4BEVA 3JZMA 1AN9A 4DB4A 2ZIEA 3MMNA 2EBHX 5EZYF 4CKYA 4TKVA 4KYVA 3R5KA 2ZG6A 1XTIA 1CY4A 3R5XA 4KQXA 5TRTA 5JANA 2ATIA 2NXCA 4ZVNA 2I67A 3GA5A 2CHVA 3OIYA 3TTUA 5JROA 3QUQA 4K9SA 1RKQA 1L5GB 4MIYA 1UBKS 3OECA 2QU7A 1AE1A 1UOQA 2HXSA 2AC7A 4IL5A 2YW2A 4YJKA 2JHGA 4GLLA 4OYRA 3IHWA 4RHYA 4YRNA 3AI1A 2YN2A 1Z5WA 1Z0SA 3OPVA 3B36A 1CQJA 4RABA 3AO0B 3IULA 3RTCA 5AOBA 1KJZA 3UOGA 4B85A 4PG8A 5BWCA 1XZCA 4PYKA 1PQYA 3AHGA 2G8LA 2GPYA 3O94A 1E9RA 1K27A 1FJ2A 2GPTA 4JLBA 3STHA 1J90A 1SVUA 1M34A 1IK4A 2A94A 4ZT5A 4TL7A 1TJ3A 3GAAA 1EP2B 3I9V6 4HAYA 2G1PA 4DPMA 3P9NA 4DNXA 3N53A 5DCYA 4G4JA 3QKSB 3L8DA 4O2AB 5KQGA 1Q74A 5TGTA 5AKIA 1QE5A 4IXMA 1ZGGA 3TJRA 4FC7A 1UP4A 4BVBA 1X7YA 1X9HA 5DK4A 4H6WA 2PKRA 1H3EA 5EHZA 1U7WA 3AESB 4M7RA 4NS1A 1YGJA 3GMIA 5BMOA 4JIMA 1DO2A 1TVKA 3NBYC 1GZ4A 1XHLA 1YHZA 4Y6QA 3JVVA 1LJLA 3ZCPA 5B5SA 3DRWA 2QVZX 1E63A 4L0MA 4AP5A 3DEAA 5JCZA 4ZO4A 1CP3A 2HA0A 4G0VA 3I39X 3A6EA 3BRQA 1PAUA 1PR4A 5KYWA 3HXOA 2OECA 4LYEA 3EHDA 3I2HA 2W2QA 1RDFA 3MFQA 4GX2A 4G1CA 4X6UA 4YUWA 5KTTA 4HEJA 1MIOB 2ZBPA 3NBQA 1NP3A 4D41A 1DU4A 3AIOA 3B12A 1F0NA 4ZVTA 1D1PA 3O6VA 1QKIA 1SUSA 1X77A 4RY2A 4X1YA 2NXEA 3WGNA 4B75A 3RQ2A 3BT7A 1C9MA 3L8YA 2X23A 4D6YA 2PKYX 1Q7EA 3AEQA 5HXAA 3ZE9A 1NV9A 3DOFA 4QL3A 4YAGA 4D25A 1A1SA 3N05A 1FLDA 3BL8A 3CR8A 2TS1A 3DYVA 4QPDA 4A8JC 4AJ9A 3DZCA 2O54A 2RC6A 4LJ5A 4RPKA 1C1DB 2I2XB 1LS6A 3NC1C 3FKSD 3JYPA 2OV3A 3EC2A 4YP0A 2PUJA 4Y98A 3D5EA 4K0KB 2QT9A 1AKMA 3IAM6 2F1JA 1CS4C 4A36A 5EMJA 2FPLA 2ZWMA 3EXIB 1CDEA 4HFRA 4BASA 3CZCA 3B53X 2JHAA 4BCDA 4AKGA 2ECOA 2OGSA 2OWEA 1VRCA 4M22A 1L7PA 1SRQA 2C4MA 4NMMA 2C2HA 1QGAA 1CWUA 1U1EA 3M70A 4IXTA 3V2HA 4XVRA 5A02A 4WFKA 3IRUA 3H49A 4LY6A 3BWMA 5IAJA 3QIAA 1JWLA 1OGYA 1EM8A 1T4CA 2VWQA 3NDRA 1ZVVA 4D4KA 4OI1A 1A4RA 3BN3A 3CRVA 1UCFA 4I8IA 4A6XA 1IL0A 3KWFA 4H7JA 5GTDA 4JI6B 4CKWA 1LLUA 3IP1A 3PQFA 2BFFB 1RAIA 5LIPA 2JGVA 3PXCX 1Z6ZA 5B57C 1LXCA 1IM5A 3QKIA 5DI3A 4GT1A 5KOHB 4CIXA 4B76A 3C43A 2ZSAA 5BSFA 3CW8X 3KJIA 2OYCA 4E6PA 2WAMA 2PIDA 3AZOA 4KN5A 3B9BA 2A67A 1XLUA 1RKVA 4QT4A 3BEDA 4TWAA 2DY1A 3EOAI 1XDGA 4QDJA 4G1BA 6REQB 2E6KA 1NNEA 5HMMA 2UUAB 2JLAA 3J7TA 3QX9A 2Z5VA 1Y7IA 3LWNA 4HV4A 4EECA 1CG6A 3AKEA 4FOPA 1DGMA 3V8VA 1YZQA 3UYLA 1JFTA 4UXIA 4HYTA 5AVTA 3FCXA 2ZIWB 3W2FA 1DNPA 1EEXB 3O7WA 3MINB 1FRFS 2C3OA 3RQHA 4DR6B 4MQLA 3QXGA 2QE6A 3FROA 3HY6A 4DNPA 4UZEA 4TOIA 4JASB 4NFHA 3B5EA 4XCQA 3AFIA 2VWPA 2YMLA 5E2BA 3U3OA 3INYA 4GYYA 3K9CA 1EQAA 4TS1A 1GA1A 2IPXA 2NUBA 4MQFA 5HF8A 4LDQA 4JITA 4ZI5A 2QUKA 1XU7A 1NMQA 4WESB 5EMHA 1G19A 5CD9A 2G1JA 3D8RA 3D3NA 2HADA 3TR5A 1QFSA 1VI6A 4DCOA 4X93A 1RWXA 2G5CA 2O3QA 1K8QA 5JPCA 2HFJA 3SIPA 4BKUA 2AG5A 2QNIA 5L6LB 1DIOB 5JAUA 4C1BA 4EGCB 3CH7A 2E4YA 4IIJF 1NBME 2UYGA 3AJDA 3TLCA 3OD1A 1UPCA 1B0AA 1NWCA 2QTVA 1GTJ1 3HO6A 1A7UA 3N2NA 4OLJA 1GA4A 1Z2EA 1VM6A 4LE0A 1TTHA 5A4MS 3IEUA 1RW4A 4Y6PA 1XKLA 1GDHA 2FSIA 3KWJA 2AX4A 3CNLA 3C6ZA 3AH8A 3MMPA 4C0KA 5GZ3A 5AW5A 2ODEA 3PJFA 4TN1A 1H23A 1A95A 1ZW1A 1TVKB 3E53A 4PGFA 4B34A 4EM6A 1Z6QA 3AUKA 3NTOA 4YRFA 1MB3A 3F9IA 1L5KA 3ZUGA 1UFQA 3AKYA 3O38A 4RYDA 1I7QB 4F86A 2NZVG 3AC0A 5JU6A 1DV2A 1V41E 4Q12A 4B09A 3BB4A 5FHQA 4I9HA 4H16A 5K2OA 1VIDA 1FTNA 1CZUA 1OWPA 1RYFA 1TZJA 2HDWA 3PKJA 5HJ2A 1SBZA 1CE8A 2ZTMA 3ECAA 4ZJZA 2AB8A 1SIOA 2G67A 5ADVA 2I6TA 4CLEA 2IIPA 2ODQA 4KDEA 5JD3A 3ROKA 2O52A 3X2FA 1AC5A 2Y1XA 3X1DA 5BYAA 3OEHD 5J4HA 2ZJ4A 2GZ1A 4LQ4A 4M9XA 2AI1A 4HGYA 4P98A 3RKUA 5BVGA 1G3IA 3EIQA 4OXIA 4LRQA 1I4TD 2A1TR 3V80A 3GIWA 2QX8A 1ISIA 2CJPA 1HA3A 1F9AA 1G64A 4UD6A 4Y9SA 4FGSA 4ZVVA 3RUPA 2FP4B 2B98A 2G72A 2WJHA 3PCRB 4FMCB 3MHTA 2XOEA 1U0HC 5D2CA 1O0SA 1XMOB 4LBXA 4G56A 3DOHA 4LSZA 4BNYA 2ZIZA 1Q5PA 2XUGA 2BFEB 4U0KA 3VR2D 1G7TA 1JSRA 1KAMA 3D43A 4IBOA 3H4IA 4F6RA 1ND6A 3TSYA 3DLHA 2HXYA 1AUPA 4KGZA 1J00A 4YRBA 2AI2A 5FWYB 3MSXA 4BNTA 2E49A 2XMPA 2VZ8A 2VJYA 1GQYA 1W75A 3T52A 1U4OA 1L3IA 1HORA 4BOYA 1YR9A 1K7XB 2CFRA 1GLVA 2RI6A 5A5GA 2R4QA 5JVDB 3RG8A 3CZ9A 2ZJ0A 1PEDA 2Z8YM 2D2EA 3B5IA 3TWOA 3C4JA 3E23A 3FNHA 1NJGA 5ILOA 4XWTA 4KITB 3DZVA 2VDRB 1ZW6A 3GDHA 3O83A 3OPQA 3X1XA 5MF6A 3C5HA 3Q7TA 5BORA 2O8FB 4BQNA 1QH8A 3FLEA 4TQAA 5BN5A 1YT5A 1EK6A 1RTKA 1HEYA 3WLTA 1P80A 2ZB2A 3JAWA 3O4IA 4P7JA 3RVQA 3WMXA 4C2BA 4CV2A 3THYB 3KB1A 1L7AA 1Q91A 1SD1A 5EXSA 5BNTA 4RK6A 3ZI7A 1B23P 1A5AB 3DFUA 2VHWA 5IM5A 3REFA 1VPVA 1RYDA 1LRJA 1HX7A 1BGVA 2JFUA 1WR8A 1R88A 2DRIA 1SCBA 1U28A 4NX2A 4LRUA 1WLYA 5C2JB 4OX9B 1YDGA 2HI0A 3D4BA 4JJ8A 5JVDF 2O8DA 1R9MA 1Z25A 4DC9A 3RBXA 4ZQGA 5KU7A 1M2OB 1HOTA 4ZT7A 4F9GA 4R1TA 4URYR 5B36A 2F8TA 1ABEA 2EQAA 4GE0A 1TZ6A 1PSDA 1V1MA 2Y6UA 2B9EA 3BL6A 3K0AB 3RNOA 1PQPA 3BCUA 3KQSA 4MGZR 1XA0A 3BJEA 4IVQA 2LXNA 4N5MA 4JYMA 1DXQA 4BIMA 3Q8KA 3LLUA 1Z4QA 1KJJA 3K0BA 2PNJA 3TGLA 3JVIA 4B71A 3OCCA 1VYUA 1OLXA 2ASVA 4RETA 4WLVA 4DLSA 4MUFA 4ZICA 3PC8C 3WS7A 1Z12A 3TE6A 1QLWA 2DAPA 3LP6A 1DCMA 3E2MA 2JG3A 1YZUA 3JQFA 3LT1A 3OMXA 3V4VB 4JYBA 2C2OA 3I12A 4Z9FA 3ZU5A 4NE7A 2Z2JA 3QVTA 3OEWA 2I4OA 4OHOA 4YGYA 4O4LF 3R7LA 3TD9A 1I5EA 4W8OA 2D0OB 1EZ4A 1UPBA 3THOA 3VYSB 1E5VA 1GUFA 3DMDA 3ODGA 4WDQA 3GLFB 2PVPA 4MR7A 3QE3A 2JAOA 3GLHE 1M2NA 1CUYA 1QNFA 4NICA 2WICA 4LMPA 3MUNA 4WTOA 2V65A 3B3FA 3OURA 4BFCA 3CH4B 4IEEA 4BNUA 5CT8A 1N3BA 4W7HA 2ZITA 4U7HA 4Q1BA 5CYFA 3DCYA 3PUVA 4KRXA 1JTEA 4U7GA 2QRJA 5CPBA 4XPIB 2N1MA 1JPUA 3R0JA 4JJIA 4MRMA 5IYZF 1YA6A 3VUFA 3RK0A 5BYCA 4I0WB 3H16A 1WOYA 3ABIA 3S2IA 1NBMD 2PWAA 4YECA 2ACEA 4B0PA 1VKZA 3GGDA 1V5FA 3BULA 4YEDA 1E6CA 5FJIA 3ZW9A 2IS1A 3KAJA 2V1UA 4MJLA 4IV0A 3TVTA 4HCJA 3VH3A 5ICSA 1TQ2A 3PFKA 5JXJA 4WK6A 2AIRA 1N2OA 2XMZA 5ED0A 2IHZA 4HJRA 4MB0A 1ZGCA 4MEAA 5LA6B 3UCXA 4BPBA 5K0JA 1L5RA 2HL6A 2WZQA 3DMTA 5DNDA 5K8TA 4IWXA 4TQGA 3WDLA 2HRBA 1T9HA 2J7KA 3EWNA 3F2VA 3FD8A 4UVHA 1WUYA 4WXMA 4ZYYA 5IJ9B 4KIWA 3H7AA 1REQA 5A4KA 2GERA 1NDQA 4QJ3A 2REQB 3C1TA 2N0SA 3FX2A 3IEKA 4MDHA 2AD1A 2ZYGA 3ESDA 3L0OA 4MA4A 1OUMA 2OZLB 1L5YA 2WT9A 3IALA 3OZUA 3E15A 4P35A 4X1KB 1E94E 5DGIA 2A9FA 3U81A 2EOAA 4R16A 4D3YA 4TKUB 2J08A 3L0YA 4KO8A 4J6EA 5B3LA 3TJZA 2R3EA 4Q4DA 2WHPB 1GQOA 4DM7A 2HIMA 5SY9A 5DT2A 4F85A 1TNDA 1SQFA 3EQ9A 4L4XA 1FYWA 1VBNA 4XWYA 2Z5GA 3LUDA 1SVLA 3TE7A 3CVWA 5BSUA 2BDUA 2XDWA 4N0QA 4YH1A 4NYJQ 3GLQA 4IEIA 4J7CA 2OCYC 2A3NA 3DW1X 4KZPA 5AUQA 2OXTA 2LDXA 4CKBA 2H29A 2X5XA 3FGNA 3H9CA 3CQDA 1BG6A 1Q17A 4F3YA 5JASA 3ICPA 4RPHA 4UUOA 2QUJA 3SZRA 4DSUA 2NOAA 3PC6A 3H6KA 3FMFA 1U98A 3JD3A 4EKYA 2IXFA 2X8WA 3HABA 1QH0A 2P62A 4FKZA 5I7RA 4FYMA 1NSYA 1SG0A 1DBIA 1G60A 2B5WA 2O05A 1NDUA 4CW7A 2Y1DA 1W5BA 3A0UA 3AI7A 4MV1A 3HDYA 1WXQA 3HACA 2RBGA 5DCUA 1UFOA 3AFGA 3WMGA 4NZZA 1PT5A 2EJBA 4IXNA 2VNAA 4BJ3A 1C7JA 2WG1A 3JQEA 2BM1A 2Y1EA 2ZSJA 1T8SA 3UC5A 3RC2A 4KR2A 2X5KO 3HP7A 2JJ1A 3ZDBA 2A88A 2QLMA 5DLPA 1OF1A 2V6GA 1YIOA 4Q3NA 2FWIA 1GRCA 4ZA2A 4DM4A 5FAKA 1A4IA 4WRRA 2ZXFA 3VPBA 3MZ0A 3KXPA 6AT1A 3NLLA 3TTTA 4EMUA 2AXPA 3IAM1 3U44B 5HP4A 3C3BA 1VDMA 3BIWA 4FX2A 2AFIB 2CFOA 1EHIA 1Q12A 4GXQA 3AEYA 2CFIA 1FX0B 3H9GA 3OOJA 4PINA 5A3VA 5LA6A 3RAPR 8AT1A 2JAPA 4XFJA 3TTVA 5C1OA 3DMGA 2ERXA 1T34A 2ZI5A 4C6RA 2V8BA 3ZZ1A 2OCPA 3A26A 4HH1A 4KTVE 4B6SA 5AM4A 1O1YA 3GPBA 3EH2A 1KO5A 1JEYA 1PNOA 5KSWB 4IWYA 1P1BA 4TTJA 1FUEA 4OKIA 3FCCA 3T3PB 4EUKA 4Q48A 4KXVA 1HLGA 2C96A 3ZCSA 2QVBA 3NCTA 3K4PA 3LY5A 2GVNA 1RIFA 2VYVA 2QD4A 4OK3A 2O48X 4RVGA 2ET6A 2HWKA 4U7PB 4D0NA 1N2EA 3EWSA 4JT4A 1A2KC 1U7UA 2OFOA 3RS4A 1KOJA 2IYVA 1RJDA 1U7HA 2B34A 4H1TA 2A4KA 2E0IA 1IVYA 3H9UA 1P77A 2X9QA 3INNA 1PWEA 1NAIA 4XEHA 1G21E 3B1NA 1H6CA 4YBZA 1FYFA 2C4UA 2GF9A 1EFVA 4MRMB 1VIYA 2IU4A 1XAIA 2OA0A 1YQXA 1Q6YA 1RZ3A 2J5XA 3M4JA 3NBXX 2ZRQA 3NOVA 5H59A 3R9KA 1JDVA 3KEFA 3VH2A 1D8AA 1C3OA 2ZRDA 3ZXSA 4ENUA 2DHRA 4I9UA 4GD3Q 4FE4A 5IUJC 3T0GA 2XQFA 4U6SA 1U2DC 4JY7A 2QZ4A 3FHOA 1TF7A 2W83A 2GI4A 1HR0B 3UMPA 4PHTA 3WZ2A 3WIDA 4LHZA 3Q5GA 2XIQA 1OHHA 3HKCA 3EGDA 4HAOA 1GGMA 2HLDD 5JPDA 1C0IA 1NI4B 1WSAA 1MIOA 3PYMA 1GEEA 3QFSA 2IU0A 1H2FA 1I1HA 2FPOA 1R00A 2A58A 3BHNA 3CJTA 3ETNA 3GCDA 3PR2B 1YCFA 2OESA 1ULAA 2N75A 4I7EA 1RTTA 2QMUA 5IDXA 4KALA 3PYZA 5KNBH 4TV8B 2ZI3A 1NSTA 1PHRA 3DDZX 3ITKA 3X43A 3INTA 1YB2A 5KQMA 2R6CA 2AR0A 3NOXA 3QBDA 5F3RA 2QWXA 4O4IB 3BGKA 1RWVA 5TEWA 3U9LA 1JBWA 2OR3A 3E9MA 1G8JA 4C5JA 3LS2A 2ACWA 1G9SA 4BKOA 3HVRA 4IIYA 2ZLBA 4PYNA 1I14A 2R68A 4P3NA 3HU3A 1ZJWA 3D7RA 4HPXB 5KDOA 1JFRA 1ADJA 1HZZA 1Y8RB 2L69A 3IAUA 1SXJE 3LLMA 5IZ4A 4G5XA 2CZCA 2HBQA 1EP9A 1ESCA 3NM5A 1QRAA 1HXHA 4E21A 1GUDA 1CUXA 1PWZA 4PNPA 2Z3ZA 3E3OA 4DCMA 1CJUC 1OE0A 1Z2DA 2JIBA 4RA6B 3N8KA 3C3PA 1N2CB 1ODCA 1JIIA 2VVTA 3KFVA 4GE3A 4AP9A 3IB3A 2Q4OA 3CLSD 2EDAA 2J6BA 4MQ5A 5CGEA 3MJDA 2X4GA 2Y68A 3LSYA 5TPZA 5CVDA 1M34B 3CKYA 4FEEA 4KN8A 3G8DA 4ZTBA 1NDHA 3NAGA 1T6ZA 4J7AA 1OXVA 1ZN9A 2Z83A 1NQVA 4P3YA 1VKHA 1GHTA 2B35A 4KXMA 5FOQA 3THYA 2OGZA 1ZM9A 3I23A 2QG4A 1ULUA 1FFYA 1NNLA 4YT4A 2P78A 3SQXA 1FLVA 2BEKA 3GMSA 2YNMD 1G8FA 3P19A 2A9OA 2P2DA 3DNFA 4TLCA 3ZWMA 2VEDA 1RBYA 1M6NA 2IIBA 3C39A 4PLCA 1OZGA 3FCUB 3JD2A 3HKEA 3ISVA 1NX9A 4QNNA 1TA4A 1M2JA 1VMDA 3JQGB 2QT1A 2IHVA 4E03A 3CMCO 3ROPA 3KZKA 2WNSA 1TJYA 3ND5A 1T4MA 1OA1A 4K87A 1YBMA 4GPEA 5CFOA 4AQ7A 3C6BA 3HXLA 2VDPB 3IMCA 4NQZA 4YIKA 3W7AA 2B4AA 3L6OO 3OTOB 2O7QA 4IFTA 4LJ7A 2GPJA 1NF8A 2ZATA 3EHEA 3TSWA 2FW9A 4BGEA 2K7FA 4MYHA 1ZD2P 1MDFA 1E60A 3AP3A 3F49S 1TM4E 3OO1A 5DP2A 4ZZ2A 3RUDA 4ZEVA 3RUAA 2B8TA 3G5MA 2GK4A 4KVGA 1SU4A 2GCOA 2GA9A 3C16C 3I5YA 1D0VA 1I0LA 1DKQA 5CVJA 4Q3BA 4E5UA 1MGOA 1XMJA 3HCOA 2W2TA 3WLKX 3A2LA 4DSAA 3BCHA 3PNPA 2XMCA 4V0OA 4KB5A 1KI3A 4JU9A 3LUGA 1NXVA 3T3NA 4EUNA 1CUAA 3IKHA 5BOSB 1J5XA 1BA3A 3V6MA 2JGJA 1G5TA 2P67A 3HB0A 4MYCA 4RACA 2FDRA 4KH0A 3ZK9A 4F04A 5CLGA 4IX1A 4ZVKA 5EERA 1P29A 3F3SA 1CF2O 5AHRA 1A7KA 4A91A 3IESA 2ZTSA 4Q9HA 1Z5UA 3ETEA 5AP9A 4MWZA 3WKEA 1W9HA 3ONNA 2FMFA 4U0JA 2A9QA 1JKXA 4A0RA 2XUJA 2AF4C 2PWBA 3M89A 2IITA 1KVRA 3QXHA 3NT2A 2LW7A 3DO5A 5CDFA 4EW3A 5C8DA 4EP1A 3FVQA 3O1JC 4BFVA 1WW2A 1ZGHA 2BFFA 3F74A 1T9GR 3OFNA 2XWQA 2Z95A 1J2YA 4C2TA 5EJ8A 3PITA 3M1AA 2XTAA 2RBCA 2E4WA 3NNDA 3U40A 2C54A 4B9EA 2ZJZA 2BHTA 3Q3EA 4Y2RA 5D6NA 3GLGB 5JC8A 4B8SA 3G68A 5CT5A 2UYHA 1TW2A 2PX5A 1LS1A 1H1LB 1OFUX 4GZ6A 4PPQA 4EPXA 3N07A 1BHSA 2DCNA 2JBAA 2XHZA 2XY4A 5K1ZA 3R7WA 2EWVA 2QTNA 2ZXEA 3CRQA 3DL7A 3ETHA 3H05A 3FUXA 4FOTA 3OEED 3A9SA 2I4IA 4DY6A 3GRZA 4H35A 4HH0A 3HCEA 4FWBA 4MRAA 1AU9A 3NL2A 3LO5A 1YGYA 4E70A 1LI4A 1YK1A 4X8MA 3JATA 4CG0A 3JR3A 4GPAA 1TL7C 2SCUB 5HNKA 4P5EA 4R9NA 1UBJS 4CMEA 2AUMA 4EB6B 2FMXA 1KZ4A 5KX5F 3ZXIA 3L7KA 2R1UA 3N2EA 2P0YA 3FYUB 4PZDA 3UT5A 4J0HA 4FT4A 2D1YA 2QIPA 4OM7A 1JJFA 3F0TA 2ILVA 5DYGA 1GVHA 1M5TA 1P4RA 1PBTA 1CTQA 5KQRA 2BI7A 4RH1A 4CGYA 4WN9B 2GASA 2VT7A 2O2IA 1W48A 4F84A 4WZBE 1ZM2A 2CF6A 3MWYW 5L3QA 4GWLA 5EWJA 4UE3S 3KQYA 4KRFA 3PA6A 5JXGA 4LBYA 1HKUA 3ML1A 4ZYUA 1O89A 4IZHA 4XQGA 4QGSA 4I5EA 3S68A 3V9PA 5DRYA 3HA3A 4CKWB 4ALMA 2PUAA 1N9GA 4Q4JA 4AECA 1CIPA 4NH4A 1T2NA 3GRPA 2PV0A 3H2KA 1TW3A 2D0DA 4K9OA 4Y8VA 3IIJA 1SQ5A 3C3JA 4ICIA 4YMHA 2VT3A 4C6TB 2QQ5A 3LQ1A 3MCZA 1TQ4A 3S8MA 1IZ8A 3CVJA 2D54A 5L8VA 1DC5A 3OEHA 5HJ5A 1R0KA 3KXIA 1P7VA 3JAKB 1A8QA 2PUWA 1YOVB 1W88A 2X0RA 4BO1A 1XTJA 2W6CX 4BJHB 3Q7SA 4PXSA 2XYVA 3KTDA 1RBQA 4RJLA 3NM3A 2Q3JA 2RGUA 2XKJE 1XUOA 3MTIA 4RFLA 3NC9A 3HLKA 1FDWA 2UZIR 1GYQA 2RH8A 3P9KA 5CDYA 1RK2A 4DCGA 2I3BA 4E8WA 1PG0A 3HFSA 1JQ5A 1G8PA 1OYYA 1XVLA 2GNPA 3Q41A 2YIVX 4EPVA 1U5BB 2DSTA 4EJSC 5C3MA 3RYCB 2P4HX 1HYHA 2ZFUA 1ULHA 4JJ6A 2JH8A 4PPGA 3SQOA 4TMZA 1EKXA 5EE5B 3WV4A 1R8YA 2J48A 3ET4A 3PKZA 4JZKA 4GM1A 4RDHA 1PGPA 4B7ZA 3MBJA 4XF7A 3KG2A 4X5OA 1I32A 3MWEA 4XIGS 3HS3A 5JE8A 4YRMA 2BWJA 1C7IA 2E1PA 3DWFA 4YJ3A 3PIIA 1HURA 2QA5A 2WTZA 2J87A 4G8DA 1XNJA 3GJ5A 4A10A 4DIBA 1X86B 3WGUA 1PUIA 3DS8A 4Q9JA 4DOMA 7YASA 3DE3X 2NV6A 1VJTA 4EHNA 4EY4A 4O1GA 2OZLA 1IULA 4WBSA 2QY6A 1Q1BA 1W73A 4L8WB 1X39A 2AH5A 1NXSA 1NMSA 3TLYA 3DMHA 3VYUB 1MORA 1WVGA 2QOEA 5GV8A 1EJ6A 4JROA 1QGUA 2H92A 3AI2A 4I1PA 1Z0AA 4A2CA 1P9OA 4K9MA 4D6PA 4Q00A 3PDJA 4QVIA 1ZJZA 1KQPA 1Z5OA 2CNDA 1L8QA 4J0JA 2CNWA 4OTZA 5TS3A 5B1EA 3F2IA 3VKGA 2JDID 5A5VA 2QRUA 2FPWA 1CU1A 3O8LA 5CH3A 3UV6A 1C3LA 1P5RA 3AERA 3VOAA 4E32A 1JKFA 5FWDA 5MFZA 5KAMA 4ID3A 1FVHA 4PYMA 1KBQA 4WCFB 4FW8A 5HCNA 3ZU2A 3SIWA 2OORA 1TZBA 3DVAB 3FYSA 3O26A 4NXMB 3RQIA 4L5CA 4E5KA 3ACCA 2O1SA 1T3HA 1T36A 2WP8J 1G21B 1OA0A 3T4XA 2UUBB 4BHTA 1V26A 5TF4A 1RP7A 5HIJA 2ZRNA 1JDJA 4J4TA 1L7DA 4EPRA 1AKRA 2P4EA 3GJYA 4U5QA 1UXKA 5FA8A 3BXFA 2ZIXA 4CF5A 4LDNA 2ZAGA 4G36A 2HZ7A 3KEQA 4NH0A 3JVUA 1KXZA 4X7RA 5FNZA 5K9ZA 3M82A 4V3CA 2NIPA 1W4ZA 4GMHA 2B21A 5FNVA 4QYXA 2PS3A 2R84A 3EGIA 3OQIB 3N2IA 3SLRA 1FCJA 3HCFA 4D42A 4EB0A 1EXVA 3PXXA 4UUMA 4HNGA 4WY8A 3VO8A 4B87A 2CF5A 2AQKA 3WGVA 1JT2A 3DC2A 3KZ1E 1OAAA 3OCVA 2X5NA 1UEJA 1WSDA 2D0IA 1Z39A 2LZ0A 3C1OA 1XX6A 2VS1A 2GYVA 4ZYXA 1ZESA 3TZBA 1IVNA 2YINC 3HVJA 1V6CA 2H57A 1ZH8A 1G55A 1LBSA 1K7FB 2WUEA 2ZAOA 1JG3A 5HZHA 4YQFA 2XW6A 4QBKA 4R1PA 1ESDA 5CLLA 3O74A 1O96B 1ORRA 3S99A 2JIOA 3ANXA 4OG2A 1WPQA 4HGZA 4QICA 4Z1OA 4MQEA 3VNVA 3TD2A 5ICMA 2FX3A 1Q6ZA 4GX5A 4G3XA 2CXNA 4CG2A 3IV9A 1H4VB 4DAOA 1UAYA 2HLNA 1PFVA 1QRDA 2FN8A 1SN7A 2HEIA 4XOUA 5FOUA 4Z6KA 2GK7A 4R8LA 2FPGB 2QTWB 4PO8A 3F1KA 3UJ9A 4D57A 2PWPA 1Z37A 4YALA 3A05A 3O4VA 4INOA 4BC1A 1PR9A 4FLMA 2JASA 5ENZA 1GVNB 1AUXA 1CZLA 3JRWA 1QYRA 3FMVA 4RX1A 5HZGA 3LPCA 5KNLA 1YK0A 4LTMA 4XA8A 3H5OA 1CY8A 3CNOA 3DLIA 3KKQA 1F7VA 2B8WA 5A06A 3TO5A 3NNNA 1QDEA 1T15A 5KJEA 1T1GA 3W1VA 2R6JA 1DXYA 2R62A 3P9XA 5AK5A 1IUNA 1YS7A 1IE3A 3LMKA 2QTFA 3EXAA 2AM2A 3AR4A 1MEJA 3HKEB 3N6XA 4FFVA 4H7KA 4WLUA 1QH1A 3D64A 5IDWA 3K8YA 2HIHA 1G59A 2QXYA 3I8XA 1DRJA 3DH0A 3RKRA 4IZ6A 4YRDA 4KWIA 1K6JA 3SZLA 3X1KA 1NG9A 2W6QA 3QY9A 3TEMA 3MVEA 4BWGA 3BREA 2QMQA 1JLKA 2AYYA 2ZR0A 2YZ7A 3NR2A 4BL5A 4DUPA 2WFLB 2XEDA 4Y6GB 3IHTA 3S2ZA 3TBFA 5HOEA 3HCPA 4XSGA 3DEKA 3FG9A 5E4FA 4ZEXA 5FNVF 4RFSA 3UK1A 4B83A 5F2OA 5ELLA 2ODPA 2VYQA 1PZXA 1Y3AA 1JHRA 1Z35A 2DTDA 2HR1A 2Q6LA 1QTNA 3EUEA 5HJ7A 1N0VC 3QKWA 4F56A 3EGWA 3ZXYA 2WFMA 3R23A 1EFKA 1A5ZA 1DKOA 1G0OA 1VI9A 5FX2A 5CT4A 3DWIA 4ZVQA 2JLSA 4XM0A 1A5BB 3NCHA 4BFZA 5I01A 2IOFK 3LGAA 3DXZA 1UBLS 1E5TA 4L9WA 3PXGA 3WGGA 1CZOA 3FDIA 1IXRC 2YIJA 1G38A 1UM9B 3IE1A 4DMGA 1BCRB 5B1IA 1CJTC 1ZFNA 2BFOA 2YXNA 5LDGA 3F6BX 3OTXA 2Q1SA 3SU8A 4BLVA 1NULA 1H4TA 2FQYA 3CLVA 3DHYA 1JXHA 1R74A 2Q5LA 1E4OA 2J32A 4TGLA 1T3ZA 1KP9A 1PJ2A 1U7DA 3AM5A 4FTWA 5EI5A 5KMGB 4OJMX 2JLXA 1NPTO 1XO1A 3M4ZA 1ZKDA 3DPIA 3I64A 3QVLA 1YRLA 2O3UA 2JB9A 3OIFA 2GBGA 1Y7HA 3F96A 3U5TA 3SBXA 4BCCA 2GHTA 2WP0A 1JQJC 2EKQA 1SEVA 1OXSC 2D7CA 2WZBA 4KC0A 1NVWQ 4OHCA 4A0FA 3HXMA 1GQQA 4BAGA 5F0ZA 4Z9AA 1SR8A 1YNSA 4Q7EA 4QE3A 4CL2A 4OQEA 2B30A 1UJ5A 3I52A 3L4BA 3Q87B 1Z5VA 4IH4A 5AXAA 3V55A 1LFAA 2MSCB 4TL6A 1NVVQ 3AHIA 1SXIA 4BDSA 2J5BA 4QOHA 4BMDA 5K6AC 4DJJA 2ZM6B 2JG5A 2PPLA 4A1OA 1USVA 2H7YA 1YZFA 1RAAA 2GOYA 4Z9XA 3QWHA 3GHHA 3LLSA 1GPH1 3HLTA 3RYFA 4Z49A 3OTHA 1TKBA 3A6HA 1STOA 1EM8B 2BMVA 5EL0A 1D2CA 1SC1A 4KO2S 3JW8A 4PLTA 4QGHA 5DM60 1EFVB 5BN1A 3GEPA 3AVWA 4WNAB 1ZUHA 4HPJB 4BEWA 2FXVA 3GU3A 1P0CA 3HCDA 5DK6A 3CX7A 4EVIA 5BYDA 4AROA 1TJNA 2MR5A 3EGXB 4TYMA 2A7QA 4ZJUA 2LCFA 5JZVA 3FYUA 1TDJA 2P11A 3ICWA 4I14A 1JG1A 4IMJB 1UFVA 5A71A 4LWPA 2VNKA 2M6KA 4JEMA 3UMJA 4Z51A 5FV4A 2WVGA 1DBQA 1GYRA 1Z88A 1Y5LA 4NATA 4RVFA 1R8SA 1TTPB 3D8NA 3DE5X 4NMLA 4M1EA 1JBQA 3ZWPA 3OZVA 1ONBA 2MJLA 4BN4A 1T3SA 2H4JA 5EIWA 3P0FA 4EIWA 1QFJA 1QGUB 4LKOA 2PEZA 1IN5A 1T0BA 1BE0A 2Q6TA 1KSJA 4KR0A 4M0DA 2JCBA 1NUAA 4C88A 2ZUWA 3MXTA 1W0JA 2ODTX 1N25A 4BXOA 1K5HA 1R9JA 3OPYI 1A71A 4GKAA 4Q7KA 4RKEA 1M10A 3L8FA 3UGTA 3DUWA 1I6WA 3HWSA 4Q9IA 2H8GA 2Y93A 3LZDA 1X7ZB 1YDMA 2IPMA 1TUGA 3EDYA 3KYDB 3HVUA 4JLMA 2HZBA 3ZV6A 3ZN2A 3JXEA 1EUDB 4ON9A 1GNVA 2GKSA 3I2YX 1EPUA 4JP3A 3ICOA 3K72B 2J0EA 4MW4A 5U1PA 4UZFA 3RV3A 1DG9A 1H6DA 3H7IA 3EPHA 2KE5A 4DA7A 1J9ZA 3TKAA 2B99A 2HFKA 2WIJA 3AF0A 3DEJA 2WMOB 3D4NA 4BNHA 4WK0B 5CVTA 1FEZA 1RQRA 4N3GA 2HMVA 4PSCA 3VNBA 4DLLA 2IDMA 5JADA 2HA4A 2AJTA 1FNDA 2HMTA 1X92A 3DP7A 4D8TA 5E4TA 3OZRA 5EXDA 3NVKI 1JJAA 5LXTF 4MJ7A 3SPXA 4BO7A 3VPCA 3IKJA 3HPDA 1I24A 3X3HA 1OSNA 1HQCA 3D3EA 2RAFA 4XIYA 4DQDA 3ZU6A 3PPIA 3KQHA 1U4SA 4GM4A 2P9QA 4O02B 1EYZA 1JXMA 1BMFA 1K5PA 5JNRA 4IDFA 1WVMA 2IU6A 5TLSA 1KPHA 5FFNA 1QV6A 4LE1A 4OJKA 4Q05A 5HG0A 4U39A 5FBQB 1N3LA 4C20A 5E95A 4R81A 2JJ1D 1QCDA 4RPJA 3VAYA 2XZLA 3KJFA 1RM4A 2QTAA 4MVJD 1DAEA 1DTSA 3LBNA 4GI3A 3MCUA 2VAVA 5FPSA 5F1OA 4YWHA 3OCWA 2YQ4A 3QF4A 2AKAB 3GUYA 4H2DA 4P36A 4B2IA 5ED4A 2P6NA 2D2XA 4ZYVA 4K8CA 1KRHA 3HKBB 3T9EA 5BSMA 2K2WA 2FSUA 5L6MB 4J1SA 3I5XA 2COEA 4NE2A 4Y9UA 3HDHA 3NS7A 3W4IA 4DAEA 1WYEA 5DRTA 5SICE 2D0PB 1VZ3A 2WU8A 4L0DA 4NZYA 4AKEA 1N36B 2F1KA 2H85A 3QEOA 3H83A 1Z75A 4C30A 3UQ9A 1KEPA 4LHSA 4M9UA 3WYBA 1GU0A 4QXOA 3T7AA 3A1WA 1PS8A 2H08A 2HQRA 3RRBA 3RTGA 4C4AA 1LIOA 4NONA 5H83A 4HXFB 4AJIA 1OX4A 4B80A 1TD9A 1UXHA 4JP8A 3IJ5A 1IBCA 3PPVA 2AE2A 3FHXA 2NT3A 1UJCA 3FPCA 3HDTA 3WRYA 2GN1A 1IMJA 3BMQB 3LNTA 4M1TA 2IYZA 3CG4A 4O2BF 4C4SA 1RFGE 2ZI4A 2Q1XA 3C2QA 3IBSA 3RUCA 2KW5A 1QB7A 3GLRA 3SX2A 4RH3A 1HK7A 3FNGA 2WI8A 3L41A 1EX7A 2R8EA 4HN4B 3MGBA 3I9KA 1V8PA 4G65A 4V1CI 2VAWA 2DLCX 3H6GA 3TSCA 3SMVA 5B58C 4FGKA 3N0RA 2BZSA 2PBRA 3A8TA 4J7UA 2Z08A 4KIUA 4RYLA 1CZKA 4FHCA 2GBIA 1SG9A 4MR8A 1V8BA 4FFPA 1VHJA 4FD2A 4KWTA 4YCLA 3KVNA 2DHCA 4UMFA 5LNK6 3FF4A 3KB2A 1ZC3A 5KOJB 1JR4A 1ZWLA 2EX1A 4H15A 4DLNA 1GPMA 1C4WA 1VA4A 2C95A 4FYHA 1UDBA 4ND5A 3EJ6A 2C77A 2SKCA 2A9VA 2BEWA 3MTBA 4OH1A 1EDZA 5KYTA 1E2JA 2FPIA 4QGAA 3FYTA 3KQQA 4JP5A 4HDOB 5ALZA 4DYHA 4X00A 3SC2B 4M9SA 3LT0A 2GJ4A 1U3WA 3L01A 3EQ8A 1I1NA 3TLGA 1ZVMA 2ZJAA 3GGGA 4L27A 2PT9A 2CXTA 2HU8A 3I04A 4HXGA 4MZXA 3O31A 3O9MA 4WK2B 2VNSA 5TNXA 4YP9A 3F3KA 4IIUA 2VF2A 2JI9A 3NTLA 3O4GA 5GONF 4ACBA 1XDZA 5BV2P 3UICA 2GZRA 4HG2A 5GGXA 4DR5B 3TNFA 4IRXA 1DDOA 4DG8A 3B2QA 4MCAA 4I1RA 4DANA 3G2MA 1R5NA 1XJCA 3M5CA 4F2GA 4R71A 4I4NA 2QY9A 3AF1A 4XDAA 1OLSA 1SZDA 3HR4A 2DCUA 3KSDO 3D1LA 3LA8A 2ERCA 4P84A 3BTVA 1DJLA 2ZJ8A 1NVTA 5ALPA 1QTQA 1C7ZA 2WVHA 2PUVA 1Y4SA 1C1HA 2NYAA 3DZKA 3ZTTA 5JWOA 4MVJE 2P7IA 1TAUA 5IEBA 1UL1X 5H4HA 4DDKA 2R2AA 1J8MF 2QN1A 3BM5A 4ZI2A 4XJTA 4E5MA 3FVVA 5E38A 2ZBFA 3H42B 3L8CA 1HE1C 3FZQA 2ZJ3A 2IHNA 3FIUA 1V11A 4ZPXA 2FV8A 3NDPA 3ZZTA 3EXEB 4MVJA 3EGXA 1MAAA 2BMAA 4GGMX 3PDWA 3NDJA 4C4RA 1KI8A 1JH8A 2AEEA 4BX3A 2ZWVA 2HDOA 5HQJA 1AQUA 3U7IA 4DE5A 1A88A 2BDEA 4C01A 2HMYB 5A3SA 4F7DA 4M49A 1H1TA 3G02A 2C57A 1Y3CE 3GXBA 1CEEA 1HF3A 3PGA1 3QELB 4G1UC 3OM0A 4LHWA 5CM5A 1AQYA 4FM9A 1NQOA 2EEPA 2QX9A 1KIMA 3KXLA 4Q7JB 4L3VA 5AVZA 1Y3IA 3K7EA 3AF6A 2VYCA 3LK6A 4JC5A 9LDTA 3A9RA 2L18A 3V1LA 1AT1A 4BKQA 4TXLA 3NEAA 2WG2A 4GOOD 5KSPA 3QAIA 3RG2A 3NRBA 3ADCA 1THMA 3DBIA 3QOYA 4MW2A 3UB3A 1A0OA 4NFYA 1WKBA 2IV3A 2Q2QA 1QKKA 5DLYA 2NYVA 5M7EA 4QUIA 2EFEB 5ITWA 2XXAA 2HMWA 1CZHA 1R4AA 2MMGA 2QN6A 5A05A 1U2GC 1ITZA 4RZUA 2ACKA 2JGLA 3QFTA 1JQDA 2R00A 1OGIA 3EF0A 4MQ6A 1Y6FA 1YR3A 4GPD1 3ZHYA 3TXXA 1OH8A 2Z9DA 4LFCB 4ND2A 1MHTA 5LZ2A 3H1TA 5G4LA 4ZI7A 5IFLA 3F4BA 3PU6A 4G5OA 1AKNA 1GUYA 2JS7A 2ZRKA 3AR2A 3FKQA 5EWLA 4ZARA 1U2ZA 3RTAA 1FP6A 1MJGA 3ZKWB 2AJ8A 3TINA 5T64A 2O5VA 4JJZA 4A0GA 3A9UA 1KFEB 2G77B 2JPDA 5DTRA 5G2OA 2P79A 3ZEAA 2IW3A 3LBAA 1L5QA 2IYQA 2PL3A 3NVDA 4HWGA 1CRQA 4XM2A 3WWYA 1GM5A 4CV0A 1IPEA 3SHWA 2LD4A 4J4BA 3NHRA 4N39A 5K0LA 4B0OA 4CDRA 5JCPA 3A1TA 1EK1A 5EUMA 5ALQA 1OB5A 4PG6A 1YJBA 3I3YA 1YQQA 1XZLA 3T54A 1CUDA 1WCIB 3ZGVA 4GPTA 2OQVA 2IXTA 2UYYA 2H48A 3H2BA 4JVOA 4YDRA 4UDXX 4DMMA 1SCUA 4KNYA 5D51S 1OXBB 5HTKA 2I71A 4UXJA 2WM2A 4MW1A 2W2VA 4N41A 1SK9A 3WRXC 3V8PA 3WB2A 3NASA 5LBUA 4F3TA 4IO0A 5A9TA 2XNJA 1GFZA 2WE8A 1XRNA 2YNMA 1SHZA 3JQAD 3GOQA 2F3QA 1SD2A 5AVXA 2DR2A 3A6PC 4EG8A 3OZDA 3KZOA 1MH9A 3PJGA 1W4RA 2VAXA 2D5BA 3K1AA 4RXMA 2O3SA 3T38A 1WVIA 2QVYX 2CLSA 5CW2A 2OVBA 4F3RA 5K3FB 5TARA 1Z4JA 4L51A 4BTVA 3G0DA 1WW8A 4TWBA 1ZYUA 3ZU3A 4UQOA 4I1YA 3HCWA 5CNIA 4EG0A 5M29A 1PJCA 3T3OA 2W2KA 3BRWA 4OHRA 4TKLA 5J5AA 4WBNF 1JR6A 3T4UA 2CHQA 3KOYA 1Z2AA 1OLUA 4BECA 2QN3A 1ENYA 3PC2A 4O2BB 1HE3A 1FX0A 1ML3A 2UVPB 1V1RB 2XT6A 5A6SB 4BP3A 3ICQB 2C61A 3F3MA 4CXMA 3Q6MA 4EYOA 3A3YA 4KMOA 4DR1B 2PT7A 3QYJA 2WHYA 3L1UA 2WF8A 2R7MA 5DX8A 3H4MA 3KYCA 1GAWA 1UQRA 1G7SA 1VBKA 3IBFA 2JCXA 2AUTA 3GQVA 4FYPA 2NUPB 4OJNA 1PJRA 1ZI8A 3NHYA 2Y9PB 5LZ9A 2XDYA 3V4SA 1GAEO 3G6WA 3Q1KA 4OSEA 3AWDA 5THXA 3ZZMA 5BW4A 5CTAA 4R68A 1U0FA 2XZPA 2TSYB 4BVHA 5KNDD 1PHPA 1T5TA 3KQMA 3N8DA 5DE3A 1C9EA 1E1QD 2J5QA 2H1SA 3DQQA 2JCSA 3JYLA 4PLGA 2HSZA 3LXXA 3UOAB 5J47A 4U2CA 4DCCA 2OLKA 2R8RA 4EY6A 2I7DA 4PWYA 1CVIA 1ES9A 5DBGA 1O87A 5CG1A 2JAXA 1XG5A 3E0XA 1GTMA 3D1VA 1O97D 3DB1A 3DOUA 1U3FA 4IDHA 2Q7OE 3MUOA 4BNZA 4GQBA 2OE2A 4WW0A 1AKEA 5EG5A 2R8OA 1DBRA 2YJ3A 4H18A 1WABA 1V3TA 3IJEB 3TEFA 4F06A 2RGNC 4DF3A 4J9UE 3OTWA 3QZUA 4RC9A 1PG2A 1E1RD 3C1UA 4G37A 1QMPA 3ZQUA 1O58A 1WY7A 2V4MA 2B25A 4D8WA 3EASA 3DV0B 3SJAA 3QPBA 3VC2A 3VAAA 2ZRIA 1X7DA 2AHRA 2WV7A 4ARBA 2J9FB 3BXXA 4F8YA 1FP4B 2X5OA 3D81A 4FILA 3QA2A 1M72A 3PX7A 4HI0E 5ALVA 4BXOB 5DN9A 1C0LA 3DE6X 5AD1A 3BAFA 4ZOCA 1KQNA 2XE7A 4K0RA 2Q07A 1Q7TA 4BNDA 1E58A 1LTHR 3V8EA 4EW1A 1L4LA 1N6OA 5KVAA 2FA9A 3ZH9B 1U2SA 2NU6B 3IUEA 5E1DA 3UMVA 4H7IA 3EEQA 4AO8A 1U6IA 3WGQA 2CGEA 2DTXA 1X9IA 3P5SA 1N34B 2IH4A 1ZITA 2P9HA 3GYBA 3BQ9A 1JV2B 5E1BA 2BFDB 4EHDA 4TLMB 1XJQA 1YL5A 1H42A 1N3IA 3BWDD 2L82A 3FWYA 4JGGA 4U5XA 3HM9A 1CJBA 4DU5A 2ZBGA 5FO0A 3ASYA 1JNYA 3ESAA 1JXQA 2FX5A 3W4KA 3RHTA 4CCSA 2F4VB 3EEBA 2B3TA 3A1SA 3H87A 3ICVA 1T9KA 4HQLA 5JNLA 1GU1A 4MGYR 3IKLA 2O8DB 2FRDC 3EC1A 2N3ZA 1U63A 2VQDA 3F6EX 1DINA 1WLSA 4JFAA 1MC4A 5EUBA 4DG9A 3DE1X 5LQNA 3K70B 1RI5A 1ZMOA 3TM4A 4DY4A 1UA4A 3JQ9A 1IDN1 4ITUA 2YV2A 2BGNA 5AM0A 2Q0SA 1OT3A 2GSWA 1H05A 2QM3A 2ZDGA 3BKWA 3TNLA 3IT1A 1A97A 3O9VA 4IJWA 3T0FA 3GEBA 3NWPA 1JILA 4G89A 2QW8A 3NKLA 3W90A 4J9VA 2XTZA 3IAHA 1K7YA 2KLBA 3JVDA 2IZ0A 4B6FA 4C13A 3OWOA 3CWCA 4ASUD 4LZOA 4YFYA 1LZLA 1XK6A 3VSCA 2CDAA 1NPYA 2FZCA 3HUTA 3OESA 4OEHA 5LB2A 3JZIA 1YE8A 4MKZA 4ILKA 5L40A 2VJKA 1AKWA 4OHPA 4C4PA 1RKBA 1X1RA 2XQVA 1SBIA 2GPWA 2I66A 2XBLA 1OLSB 1B2RA 2LTAA 2WT8A 1SA0A 2WKRA 2G8NA 4D3SA 3WXBA 1XP8A 2QN7A 1Y9JA 4BX0A 1P17A 3KDPA 3BZWA 1Q7CA 4MV5A 1XD8A 3JU3A 3ZXUB 3EYWA 3AVTA 1YUBA 1AXRA 1EM6A 4KIFA 1IATA 4PZ9A 4YASA 1E9AA 1NU6A 2HB6A 2MWMA 4LPKA 4DLPA 1K06A 1ZMTA 2GB4A 3QSGA 2QGNA 1FYDA 1OBFO 1TJ5A 2R5NA 3JRXA 4K1LA 3ES9A 2CLLB 1E0DA 2CLMB 4JH0A 4DJTA 5IHXA 1MAHA 3DXYA 5CDUA 2RIRA 2HQBA 2QMZA 4N6OA 3OOSA 1NN3A 1QQ6A 4RY0A 4AICA 2J3DA 3B1XA 3E81A 2QL5A 4JIGA 4O8CA 3BH0A 3IURA 4U2KA 2O5RA 1NC1A 1Y5NA 2V74B 3DUFB 5TPWB 1LKZA 4WQMA 4AJJA 2DDOA 3OA2A 2DECA 5GPBA 4I1OA 4ZP1A 5EQFA 2CNOA 2R8YA 3IBCA 4CLRA 4IWNA 1JXIA 5J58A 3LKZA 1VCMA 2DUNA 2WJ4A 2PH5A 1NJ6A 3GT3A 4PTYA 4A5OA 1G6Q1 2Z2ZA 2C9CA 2QHXA 1SOWA 2QJWA 3CKKA 3OZ7A 1K6MA 2XE8A 3SEAA 2I7XA 3WWEA 4O1HA 5A62A 1BTOA 1L4UA 2C00A 2X41A 2K7ZA 1KO8A 2ROQA 3QH4A 1NVVR 2I2BA 3CIFA 3LOQA 3TQRA 1YB1A 3EOZA 4IV8A 1YTUA 3IO5A 1E5XA 4US1R 4MWGA 4R2LA 4G84A 1TAGA 4LQCA 3A70A 1Q0UA 4YV1A 4HNTA 1R6UA 5EIAA 3QVMA 4ZAWA 1EVIA 3TLGB 5AKYA 4J0QA 4KSBA 5FWYA 5HE8A 1E5LA 3DLCA 1FIUA 2PGNA 2XB4A 5KS2A 1F17A 1UAGA 3TMKA 4ETIA 5I7AA 5HQ3A 2I6UA 1DZ3A 3TDMA 3NT5A 2CBXA 5LQSA 3WO0A 3RT1A 1MB0A 4WASA 1O9GA 2A9YA 2BVNA 2LUOA 4WMLA 3VSBA 2NO7A 3Q3GE 4KREA 3ORSA 2WIBA 1EVJA 1YKFA 4ZCSA 3ZE7A 1U2GA 1M75A 5TV2A 3GFVA 3E2PA 4JI8B 3ZI4A 3RIHA 5MGNA 3GT7A 1P9RA 4BGVA 4IQ0A 5CXQA 1ZXLA 5JCOC 1OCEA 2O3RA 4NOMA 2V0CA 3OQOA 2DBVO 3COZA 1UKZA 5JRJA 1U2QA 2ODAA 4RK0A 3U31A 1MG0A 3K9EA 5JALA 1QIJA 3TTXA 1TGYA 2Y0DA 5J5CA 4C7JA 4EYSA 4JYPA 4UZSA 3TQFA 2VI5A 1W5EA 3Q3HA 3V4FA 4JXKA 3TNDA 3OSZA 3ZV4A 1R4NA 2FG6C 2VPWA 2R6AA 5KYXB 2JLWA 2ST1A 4POAA 1KE1A 1FS6A 3HA5A 4FLEA 3AEKB 3DV2A 4M9CA 4NBTA 5AKGA 1ECJA 2YZKA 1NW5A 4IQ4A 1LEHA 2DKFA 4QKQA 3NHLA 1Z22A 3TLJA 4ALJA 4AZSA 1TMKA 1Z08A 1E66A 2OOKA 4P22A 3TNJA 2EJUA 4JN6B 2CLKB 1NJ5A 4K9DA 3VR6H 1H4QA 1Z4KA 1E3MA 1M2GA 3DAOA 2UVDA 2BI8A 3OJEA 4CTOA 3GNLA 4HUTA 1MXHA 3NYIA 5JRDS 2WWRA 3CLTC 3KQTA 3VJKA 4C9BA 2NQTA 4IGIA 1NFFA 5K0SA 5AJWA 5DOZA 3RQ6A 4PLZA 3WV5A 1LHRA 4YRGA 1YGPA 2HRZA 2WSSD 4TV9A 3IJPA 3R5SA 4G0NA 4TL8A 2GHIA 1L8LA 1QE3A 4W7SA 3W8NA 4ARSA 4CIWA 2PU5A 1U8YA 1PL0A 4GXTA 3SIRA 3TOZA 3WL4A 4BV8A 2C2KA 1JF8A 3EVGA 4PO3X 1RQNA 4BV2A 3NHWA 1SB9A 4AL4A 3ZX5A 3SICE 4ETMA 2AC2A 1NUUA 3ELUA 1E9BA 4TS3A 1GPUA 3TMYA 4MS4A 4DMLA 5JTUA 3FTFA 4B8RA 3VJRA 1ZM4A 5C7OO 1CRWG 1UXIA 2FW7A 2ZE6A 3LLVA 3NAQA 1KP3A 3MMZA 4TWJA 2JIZD 1YUNA 2RGAA 4TYPA 1DWPA 1RXSA 3L1JA 3FRJA 1IH8A 3WJ7A 1YXMA 1QIGA 2HCFA 2YVAA 4QPZA 1P74A 1SBCA 3V1NA 1NVEA 2QDXA 3U61B 5FB3A 4EHBA 1HY3A 3LVRE 4MMZB 4F4FA 4QDOA 5LMCA 4KANA 1EJ2A 1JJIA 2VRCA 3FA2A 3LKDA 4QTXA 3A4IA 4YJGA 4IH9A 2O7VA 4CFYA 4GDMA 2CFTA 5IH3A 2Q8NA 2PZGA 4FGWA 4PHCA 3MTAA 2WZDA 1C30A 2M2IA 2VDOB 3OJCA 3GFQA 1IB6A 4OXRA 1XP5A 2HJWA 2PCJA 3VZRA 2JRCA 4F6RB 4GVXA 1DQSA 3BTUA 3SC3A 2JIRA 4WY2A 1WQ1R 4DBLE 2CY0A 4RPIA 1IJKA 1VLHA 2UVQA 1U7ZA 5ER6A 3NDBB 1QYVA 2BELA 1YA8A 1E4YA 1W4AA 1E7WA 2C7RA 1R9GA 3PNKA 3HGQA 1NJFA 3PWZA 2QE7D 2ZRJA 4PVDA 2YV3A 1H66A 5B7QA 3JQ8A 2YVUA 4FQ8A 5IJ9A 1G5FA 1C3OB 2G63A 1JG2A 2P9ZA 2R00C 5CIQA 4D0SA 4IFIA 4WZBA 5AJYA 3BOSA 3VQTA 3WOHA 4D46A 5C5IA 2P6UA 3B1WA 1YQDA 5MGBA 1V1SA 2RJ3A 4K28A 2BAGA 4NCNA 4N1AA 5ESDA 2XNKA 3BF5A 4RHTA 2P2ZA 3ZZ0A 3OZBA 4EHJA 2BGUA 1GZHB 2W4MA 4HLQB 1BYIA 1QG2A 1RM0A 2PUTA 3NTQA 3I61A 1JAIA 5ES4B 4PTZA 4AZ0B 2ZBRA 1UPXA 3PT9A 4ZDJA 2LCQA 1LPOA 2Q3FA 4TRNA 4JHXA 4UVIA 2VUUA 3V46A 3OZTA 4DLUA 3I1JA 5ICEA 1MOQA 3EXHB 5F9HA 2DUWA 2JFGA 1NXTA 3RW9A 1Q3HA 3SM3A 4YMLA 2OD7A 4RKQA 3ANTA 3W34A 4R2IA 3WWPA 3O75A 1E7YA 2KB0A 5JARA 1AGNA 1Z3IX 1Z83A 5THKA 2I2AA 1CRPA 3H8SA 3T7CA 1LLDA 3FUCA 4C4ZA 1MA0A 2E7ZA 4ENTA 5E3JA 3IVXA 2WJIA 3M6AA 4JELA 3NC4A 2YXTA 2E9SA 2JGEA 3P97A 4OHUA 5FR1A 1W1IA 3TZEA 1KR5A 3CXRA 1PLKA 1DXHA 3EGOA 4MV3A 5DEOA 3DMRA 1CYEA 3W6ZA 3ZWBA 1P81A 5CDFE 3W6PA 4CMEC 2LIVA 1QMGA 2PR2A 3SR3A 3JASB 3CUTA 4B3DA 3FY4A 5EIXA 1W85A 3RTBA 3L0BA 5DP1A 1E5QA 2YR0A 1X7XA 3UBOA 3U7GA 1GGVA 1LPBB 1SC9A 1QS0A 3U7HB 3ER6A 3RU3A 1K8YB 3TLEA 4KVFA 2NXWA 4HWOA 3R76A 2EW1A 1G4AE 3K5IA 1CUEA 2CL7X 2P3OA 3GLKA 4FFBA 2VHUA 1UWCA 4E30A 4BVEA 5LBTA 3NV7A 4HUJA 4GM6A 3GP8A 1LDNA 1S8AA 5KSYA 1A1VA 1A96A 2DSNA 3I2GA 1THGA 2VCYA 3G5TA 3VKWA 4YT2A 1XD9A 2LWIA 2J9XB 3K9FC 2GXAA 1H2ZA 1UKEA 3IUNA 3VC7A 3K5PA 1PCXA 1F2UA 1RRVA 3UJPA 1NVFA 2Q46A 3EIWA 3PQDA 1T4DA 4WKNA 3UANA 4KBYA 5I9LA 1PYOA 3KP1A 1WHSB 1UPAA 1N6PA 1QIHA 2NQ2C 4US0R 5EAIA 3JWJA 1XMQB 2E4UA 1R6AA 1XKXA 2Z4TA 1ZEMA 1YQGA 2B83A 2P2NA 4FS3A 1WXHA 2E87A 1J56A 4HHEA 3VDQA 1NOIA 4D3DA 3EMDA 1JAXA 3ZI0A 4HTFA 2GCOB 1YR6A 2ZRHA 3GNSA 4BLWA 4M76B 3CX4A 4DSOA 4FFWA 5I4KA 5AO9A 1GZDA 4RD6A 3K94A 3KSUA 4II3A 1GQTA 4JOCA 5IXYA 1KIFA 5TQ2A 4LWZA 2Z5FA 4K05A 3TTSA 3DFMA 4D3XA 4YV0A 1FSSA 1UZAA 4WWHA 3VZBA 3W3ZB 1QTIA 2W71A 4KG7A 4EFDA 3C74A 4UHDA 3WYNA 3T1OA 3E22B 4EG6A 1DDIA 4HZIA 4PSVA 4WINA 2BBWA 3LC2O 5FBKA 4C29A 5BN4A 1PZMA 3S2SA 1QZ3A 4FWIB 3K6RA 4HVAA 4EELA 5KNDA 1F0KA 2PRYA 3CSDA 4PZAA 2X9NA 3PTZA 2AOXA 2GZ3A 4CEHB 1E3LA 2XZOA 4KKXB 1LRLA 4ARIA 2ZSIA 4FFSA 4FNAA 2RJNA 4MB6A 1BRMA 1FFWA 1TOAA 3QA9A 2N1BA 4JLWA 4PZPA 1ZMBA 1FF9A 2ZI9A 5E6RA 1OFHA 3QE9Y 3B2EA 5TVKA 3ZY4A 1YHJA 2D2FA 3CFYA 4RHCA 3P9IA 4KIJA 1M1YB 1Q50A 1U5BA 3PPXA 3ETGA 4J0IA 5EVCA 1SXJA 3ZY6A 5D5QA 1W6UA 1FXWA 3B6JA 1RYNA 1WHTA 2EJCA 1K3UB 3C8UA 4LPSA 4YJFA 2QN8A 2BGRA 2BI4A 1PR6A 4URUR 4GU5A 4NDZA 5A9SA 1QZTA 5IJ0A 4ZVUA 3UWOA 1A7AA 2NTYC 5AW9A 3AOEC 4PE5B 3ENZA 4RMGA 4WFJA 1V8FA 4MP6A 3U48A 3T7SA 4TWZA 3TL3A 1QHFA 1P2UA 3SQDA 2XVMA 3TLMA 5JD6A 4D26A 1QGOA 2C2ZA 3O2SB 1M7GA 2DU8A 2WUGA 4K8RB 1L7XA 3E9RA 4KMRA 3ZJYA 5IM4A 1RKDA 1ECBA 5LQUA 2CFCA 1H22A 3KE8A 1ZWKA 1NURA 3WIEA 1SKQA 2BKLA 1F6WA 2O07A 2O6LA 2XT0A 4MIKA 4PFJA 3GA0A 3GYGA 3USZA 4DC3A 5EOVA 4JKYA 3FCEA 4PIVA 4LQLA 4ZREA 5H68A 3WHKA 4QBFA 4YR7A 2VJMA 3U7JA 5D7NA 3KBOA 4B48A 4LOJA 2W6IA 2YHSA 3RQSA 5L9AA 1OX4B 1R15A 3QENA 3GGPA 1NE7A 2IEBA 4MS3B 4KDRA 2BP7A 3VR4D 1PR0A 1R50A 3WVNA 1IIBA 2POQX 3F7TA 1J0AA 4G81A 3ZD8A 2BTEA 4LJAA 2BFMA 3IPRA 1CR4A 4Y2HA 3MBKA 1FMFA 4V2UA 1HE8B 2XOKA 3BJIC 3D6UA 2HHJA 3NHMA 3F78A 3GRAA 4U8GA 2OV6A 5AOVA 2V7XA 5IT5A 5TQ2B 1PWHA 1G21A 4INPA 2QTVB 4IQ8A 4L4ZA 3LHIA 1T6NA 2GJAA 2DC1A 4O2RA 4PG4A 3WL6A 1ZIOA 2WMYA 3Q85A 4ESEA 2I2DA 1JQAA 2FUKA 3DVRX 4PQEA 3QXSA 4N65A 1TI7A 3Q6NA 4RTNA 4CGZA 1Z0UA 1NXOA 2J3EA 5AQEA 4FU0A 2QM8A 4JLVA 4OHZA 2PVSA 5TF0A 2GN4A 3NIBA 4HLUA 5E9QA 4PQFA 6NULA 3P2KA 5F77A 1N6IA 2O19A 2QNRA 3CRNA 2C5HA 2XE6A 4NZNA 2MSLA 3RPZA 4TS4A 2RJOA 3PHBE 3CEAA 1U8CB 1T8UA 1UBTS 4ID9A 4OQ4A 2IEIA 2OK8A 3VPFA 2DM6A 3LXUX 4R0VA 1T0JB 4MARA 2Q28A 4P80A 4LSGA 5FL7D 4EKDA 3B6MA 3NAMA 3PJEA 3V42A 1Y4ZA 3SQLA 4C0SA 2FF5A 3HYLA 1NZDA 4YLEA 4JP2A 1HG0A 4IZIA 3JQCA 4RSMA 1GUAA 2O20A 4MINA 3U7RA 5DHFA 5EXPA 1AZWA 4BZQA 1OX5A 2PSJA 2XCQA 4HX5A 5T8KA 1VE3A 3K20A 1P7YA 2PFSA 1P9NA 2OV4A 3M2PA 1XQWA 2C5BA 3KZXA 4AKTA 4FXOA 5C1BA 4EW2A 4AF6A 5IYZA 2PUFA 3HA7A 2OC9A 2V6IA 5G0SA 1U8UA 1YKGA 3TKLA 1J5EB 3HCRA 5BV7A 1YR1A 2J3LA 4MCHA 2JI7A 4GRIA 1DRUA 1TT5A 1Y1TA 2HSDA 4QUJA 5AVRA 1L5FA 4EA6A 3PNVA 3N6RA 4UM5A 3IIMA 2RKBA 5DTIA 3KRTA 4W1SA 2WMDA 1LPMA 4R6WA 1KO4A 2O14A 4GL2A 3NKVA 4JHLA 4XR4A 1A4XA 1CJSA 3K0CA 3B60A 121PA 5JW6A 4DUYB 4Q3CA 3HDJA 3IDQA 4MRPA 3CLTD 3GJ7A 2PZ8A 3IIKA 3RIMA 4M8LA 3CUEF 1SVWA 3LT5A 4PG5A 3CMMA 2GO1A 4XPIA 3ABSB 1IHUA 5EFZA 1GZUA 3QBJA 3W2HA 1PE0A 1KXJA 1E7MA 4DPKA 5DWQA 2J30A 3QYPA 4FGUA 4DWOA 3DMTC 5IULC 2ANBA 4GGPA 1TFUA 3A4NA 4EB8A 4RQBA 3GRRA 4AIIA 3O92A 4ENRA 5C4GB 5CXXA 1RFUA 2EC5A 3ZD9A 4UTOA 4X1IA 2CB0A 1V19A 2AI3A 2P91A 4EABA 1JIQA 5H1YA 2QYHA 1MVLA 2OHGA 4KMSA 4WOKA 1Y37A 4F1WA 2XTJA 5EZ5A 2HV8A 4F4CA 4RZIA 4BB6A 3LDHA 3CKLA 3LQ4A 3GCGA 5H3LA 1OIWA 2ECKA 1E1RA 1KC1A 3MJTA 5D3QA 4JVMA 3UH1A 4TPKA 1PP4A 1T0IA 2XLBA 6REQA 4MB2A 4RM3A 3PQCA 2IZOA 4CL0A 4TV9F 3DR3A 5AM1A 4DLAA 3T9FA 2JBHA 1F38A 3KYDA 3OJ0A 4G0ZA 1SK8A 1RLOA 4FDVA 2JJ8A 1DEXA 2G9VA 3EW9A 4W1QA 4ZKDA 2WIFA 4J03A 3IE7A 3W06A 3A6GA 1U6JA 1UWVA 1ADFA 1O6CA 4C21A 2CXRA 4NCJA 4S0ZA 5CB6A 5JBIA 1RCUA 3RVRA 1Z63A 1PT7A 2Q2OA 2VXBA 4WFIA 2R1VB 1W6RA 3M9WA 5GADl 5DISB 1FMJA 3GFPA 3P0JA 5F35A 1C8KA 2VHZA 4UOQA 1E7QA 2RCYA 3LYHA 4UMEA 4YAKA 1X38A 4HAVA 4ZZ0A 3QY0A 1MC5A 3GNTA 4LYAA 4UJ3A 5CMLA 2WYHA 4ACAA 1OI3A 3N1CA 1F6BA 1T2VA 3IDAA 4FOSA 1C0PA 1OTHA 3PFFA 4TROA 4OHWA 3EQ2A 3BXPA 5J2TF 1Z2OX 1ANKA 3E61A 3V34A 1D5WA 4HDAA 3A4TA 3BDVA 1P72A 2A57A 3Q12A 3VMFA 1NUQA 3OICA 3GLHA 4NARA 5AKHA 4OP1A 3TQIA 4GSLA 2QR3A 5BQPA 4EAQA 2DWOA 2H06A 3DLBA 3RQQA 1V16B 4BRZA 1WNFA 1TX4B 3IA7A 4IM7A 3UC9A 3VHLB 1QJ4A 2VSXA 4C78A 2W6NA 4UM7A 3V4OA 4E14A 1PEKE 2RH5A 3IQGX 2CVFA 2YWXA 5DTJA 1L7QA 2F02A 1SVOA 3TPZA 3PNOA 1FFXB 1WSBA 1TO6A 2QLFA 4YCDA 5FA6A 4M37A 2AMFA 1MO5A 2QRNA 4N40A 3EIOA 3QYAA 5FQNA 1ZKMA 1N0HA 2WE7A 1T91A 3HXKA 1VLLA 3SZMA 2R8ZA 1PL7A 4ZZIA 1U0RA 3ZHCA 4A6DA 4OQMA 4MPTA 3PG5A 1GLGA 1E0JA 2EF1A 4RLHA 4DCPA 3CUWA 3AOGA 1LSSA 1USGA 3Q6IA 4R4JA 3H1FA 1NF3A 3OKAA 2V0NA 1BVUA 3PHHA 4S1PA 1E7SA 1M8GA 3CT6A 3L4BC 4H7EA 4NYIR 2DKNA 3JQBA 3K0FA 4ZU1X 4BE7B 1E1MA 1UIR