3RS9A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p3-di(adenosine-5') triphosphate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
490
structure length
490
Chain Sequence
b'HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Lyase
source organism Thermotoga maritima
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
total genus 178
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rs9A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rs9A02
3RTGA 4U7XA 3RTBA 3PZSA 1RK2A 4KAHA 5COJA 1V1BA 3NBWA 3NL6A 4LBXA 3RQ8A 2RBCA 4K93A 1GQTA 3IH0A 1ESJA 5TQIA 5CM5A 5EY7A 2I6AA 1KYHA 4C5NA 3RSSA 4PVVA 3KEUA 3D3KA 3MBHA 5C3ZA 3RS9A 2DDWA 2QHPA 4K8CA 5C3YA 3ROGA 2I6BA 4E8ZA 2DG2A 3DRWA 3RQ5A 4O1LA 4B8SA 4GM6A 1V1SA 1LIIA 2AB8A 1C3QA 3PL2A 3ROZA 3RSGA 3GO7A 3VAQA 3RU3A 1V19A 3B1PA 4E8YA 3RT7A 3RM5A 1JXIA 4K8KA 1LHPA 4X8FA 5CGAA 3GO6A 3I3YA 4EUMA 4N08A 3IN1A 4XCKA 5B6AA 3BF5A 1VM7A 2HQQA 4N09A 3RTAA 4E84A 1JZTA 3OTXA 3RO7A 1YGJA 3CQDA 3FHXA 3NC9A 4S1MA 1EKKA 4E3AA 3RO4A 3D3JA 1LIOA 2HW1A 3RPZA 4E69A 4JKUA 4XDAA 4JJPA 4K8TA 1LHRA 3LHXA 3LKIA 3NL3A 2A9YA 1VK4A 3RPHA 4DC3A 5BYEA 2JG1A 3Q1YA 2R3EA 4K8PA 3UQ6A 3LJSA 5F11A 4KADA 4DU5A 1L2LA 4UBEA 2O8NA 3B1NA 3KTNA 4C5JA 2AJRA 2AA0A 2AJPA 5TRWA 3RTEA 2V78A 3EWMA 3UMOA 2JG5A 2YXUA 4YWRA 1V1AA 3RQQA 3B1RA 3JULA 3FHYA 1UA4A 2QCVA 1TD2A 2AWDA 3H74A 3IQ0A 3UQDA 3LOOA 2Q5RA 1RKSA 1UB0A 2PKFA 1DGMA 2YXTA 3HICA 2XTBA 2ABQA 2DDOA 4K9IA 1WYEA 2NWHA 4LBGA 3RRBA 4XF6A 2AX3A 3ROXA 4S1IB 3GBUA 2PKMA 1U2XA 4EOHA 3BGKA 3HYOA 1EKQA 2I5BA 4EBUA 1YHJA 5C41A 3RNOA 3RT9A 1JXHA 1LIKA 1TZ6A 3H49A 2DCNA 4C5KA 3NL2A 5BYCA 3NM3A 3ZS7A 1RKAA 3RQ2A 3W4SA 4S1IA 3UBOA 3N1CA 1TZ3A 1YGKA 3KD6A 2C4EA 3KZHA 1LIJA 3NC2A 4EN4A 2R3BA 1RFUA 1RKDA 2ABSA 3K5WA 4LC4A 2FV7A 3NCAA 1RFVA 3B3LA 5F0ZA 4C5LA 3RU2A 3QA2A 4XF7A 3IBQA 3RTCA 1BX4A 3NL5A 4JKSA 4LCAA 2A9ZA 3NBVA 3NM1A 3IKHA 3RSFA 2F7KA 2JGVA 3ROEA 2HLZA 5BYDA 3UMPA 1GC5A 3RY7A 2AFBA 3B1QA 4WJMA 5CGEA 3RRFA 3IE7A 3HPDA 2DDMA 4B8RA 3K9EA 3RS8A 3MBJA 1VI9A 3VASA 2PKKA 4KANA 3RQ6A 4YL5A 3RSQA 5BYFA 4S1HA 2PKNA 2F02A 3Q92A 4KBEA 3RQHA 3UQ9A 4K9CA 3RREA 3UQEA 4O1GA 1ESQA 2VARA 5EYNA 2C49A 3RQXA 3RRJA 3B1OA 3RTDA 3QAIA 3DZVA 4C5MA 1RFTA 1TYYA 5C40A 4E8WA 4KALA
chains in the Genus database with same CATH superfamily
4R98A 1XTBA 2UXDB 4ZZ1A 1BKDR 1QHHB 2E48A 2XCLA 3FIUA 3GJ3A 3O4JA 3TIVA 1GDTA 2R3SA 2PYDA 3N74A 3RWOA 1RCFA 2WD7A 4LTDA 1K9SA 2YS6A 1YIAA 4KV9A 1SFRA 4PCUA 3NBMA 3SZ3A 3U39A 1IBSA 2D74A 4GM6A 1G5FA 2E9SA 1Y3HA 2EZ4A 2ZIUB 3IBCA 4X94A 3TD2A 5ALJA 3GJ4A 2WU3A 4ZI5A 3PUZA 2JIQA 4DFDA 4DWOA 2AB8A 3DEFA 3HUEA 1B8OA 2WSBA 4O0MA 2BI4A 2VT2A 4HDSB 4RTSA 1Y8CA 3DEHA 1KH3A 2A35A 2IH4A 3UM9A 1TDJA 4R6XA 1XO1A 3IN1A 3I58A 2J9RA 4TOIA 3KVRA 1E2MA 1NP7A 1QAQA 2ECFA 2B36A 3LP8A 2QMQA 4ZHQB 3EA0A 2W2OA 5LXTB 1YTLA 2ST1A 5I9SA 4HNUA 2V4UA 3V2IA 2YJ6A 5C1PA 1E7WA 1U3WA 1Z5WA 5FQOA 4L8LA 4BNHA 1HKHA 1W1IA 2XCQA 2XT6A 4LRYA 4D57A 4IHKA 4EB8A 3ZDCA 1CF4A 2DULA 3H1TA 4PM4A 5K4AA 5A3RA 1V2HE 4RY8A 4BNGA 2FWAA 2Y1WA 3FZNA 4LTNA 3TTSA 3V1TC 1ODTC 1U0GA 2ZATA 4TN1A 2FDCA 1VP9A 3NKLA 2JK1A 2V5VA 4KLZA 4BBAA 4D8UA 1UAAA 1DJMA 4MV5A 1K8QA 1GG8A 2UYQA 5BUSA 2W2LA 4R3NA 2G0AA 3C87A 3EVZA 4N3GA 3WLRA 4QQNA 4DSOA 5CYGA 3QELB 4OTZA 5LLSA 2FSSA 2QCVA 5AT1A 1NVXQ 1MIHA 1J0CA 3V7WA 3D8BA 3UK2A 1VHDA 5CB4B 3OECA 5EIHA 1EM8A 2H1OA 1N5OX 3ZY2A 4IUCS 3QKTA 1IHXA 2QLMA 5FPKA 1F7UA 2ZB2A 3F3YA 4AXXA 4QM6A 1H2YA 1ZQ1A 2HO5A 2IYNA 5EIBD 1UPFA 4GC5A 1G8JA 4FGJA 4ZC1A 4FT2A 5JYBA 1NA5A 1ISMA 2Q2NA 2V8BA 3K4HA 2VVTA 4RDCA 4XA8A 5GOZA 1TQ4A 2BE9A 3PWZA 5EJAA 1XZAA 3TDKA 2XMGA 5JH7F 1CJBA 4XUEA 3RF7A 1NUHA 4PC2A 2H2DA 2ZZNA 1QB8A 2Q46A 1K6JA 1D1TA 4W9RA 1XZIA 3CW9A 1Q0QA 3OSUA 3UW1A 3ZQ4A 3VDMA 5I8WA 3AONB 4H6VA 4H3VA 2B1QA 3R7FA 3MT0A 1VTKA 4GR9A 4U7FA 3H17A 1OHHA 3BMCB 1NE7A 4HQOA 4MCIA 4R05A 5DISB 5BQ3A 3EXHB 5IT5A 4M7OA 1W30A 2IDMA 2NAPA 3F1LA 3ML1A 3MJCA 2CLEB 1HT3A 3GVXA 4Y18A 2PDAA 2QTVA 1QU2A 3WG9A 4DSTA 3JXEA 3L6CA 4BX0A 3V7FA 4CTMA 1Y3BE 3P9CA 2O4UX 2E5LB 2Q8PA 2HPVA 3EXFB 2ZS8A 3F71A 4YRBA 5JCJD 3UMYA 1KRWA 2PA3A 1T15A 2Q29A 1R4MB 3PJGA 1T3HA 4HQNA 2WA1A 4B9AA 5KREA 5LB2A 1ODCA 3QKRB 4Z9XA 1NVGA 2RGWA 2JZNA 3FWYA 1V39A 2EERA 3NOQA 4NJOA 4RELA 3WSVA 2BY4A 2VCYA 1HM5A 3L8HA 3N2YA 3RNLA 2QKYA 3GT3A 3ZLTA 3QZUA 3VZQA 4NBUA 1TZMA 2YYYA 4L51A 4WK0B 1PJCA 5ALWA 4JLAA 1IDOA 2NYAA 4FZ5A 5FLEX 5B6PA 1GAWA 2I99A 1WXHA 3CNLA 4V24A 5KX5F 2XUFA 3MS2A 3QMWA 1B8PA 4NL4H 4YONB 4TTIA 2JLWA 2CVFA 3NDPA 4JT8A 4KVZA 5GZ6A 1ST3A 4EPYA 5KTMA 3W90A 4BXOA 2PHZA 5AFSA 1YZTA 1ISHA 1DSSG 2O48X 2CW5A 4DNFA 3CWQA 5EJ6A 5JNRA 1TYZA 3R6DA 3VV2A 4CV0A 3D1VA 2O8CB 3GPCA 3CSUA 2B0JA 3G1TA 3FI9A 2DBVO 2E21A 3PLNA 4LX0A 5E1BA 3VC3A 3IE0A 1ZISA 1IFXA 4AF7A 5CGAA 3BSFA 3FWKA 4Q9IA 3M3PA 4R51A 4H35A 5BVGB 3I3YA 1JQDA 1UJMA 4H7HA 2Q7DA 2P2YA 5AM5A 1IPEA 4RW0A 5CT8A 1DEOA 1M2OA 5LPNA 2UUOA 5GTDA 1BA2A 3EZ2A 3QJ5A 3G2QA 2P62A 3EMDA 1CZLA 4O02B 4WN9B 3QVWA 4S1MA 4DM4A 2WSYB 2JI4A 2OHIA 2GM4A 4RXUA 4WK2B 5GY7A 4X8MA 2HHCA 1JILA 4JV5B 5FPPA 1NY5A 4KQJA 4NY1A 2WTMA 4TTSA 3VR1A 3BCUA 1E69A 3C3KA 4UATA 2W6QA 4HYYA 1NVVR 1YS4A 3UKDA 3CF6R 5LZ8A 1F8UA 4XJSA 1ZHHA 2O8NA 3AV3A 3ETNA 3EPRA 3CLSC 4J4HA 5TXGA 3WMGA 2VWQA 1SD5A 4C0JA 4JVNA 3WAJA 2AJRA 1SZJG 3OWHA 2R84A 1G63A 3L82B 1JBVA 4IYJA 4EY4A 3G2NA 4YBZA 4KZKA 4UFPA 2HNAA 1HL7A 2J31A 4PBRA 4FDTA 1X1DA 2Z8YA 4CMEC 1NQUA 4HT3B 4ISBA 1HLPA 2NT4A 4XTRA 1JAXA 2J45A 4LZZA 5AW0A 4COKA 5A2GA 4RMHA 1PR4A 2R2GA 2NU8A 5FYQA 3AVWA 2BGTA 2CNKA 1NMSA 5ALZA 1T1IA 4LWQA 4XR9A 4B83A 2P2GA 3EVBA 3HCOA 5B3JA 3TWOA 2FUEA 3D8TA 3N9IA 1XXHE 2AQIA 5IJAA 3RHZA 4D44A 3C1UA 1T35A 3TGWA 4EARA 4MTCA 4PVCA 1BEZA 1N7HA 4P82A 4CQLA 1X19A 2A8YA 1S96A 1FPMA 5FWYB 1PBTA 1Z9BA 2RB5A 2ZYAA 3OT1B 4BLSA 5B53A 1EK0A 2YWEA 4Q9LA 1G98A 1RKUA 4QRIA 3ZHTA 2XPCA 5D3QA 4MCAA 1TYDE 4QNMA 5AM1A 2JAOA 3KUCA 1WIWA 2R1VB 5TB5A 1X8KA 2CCJA 4LECA 5JXIA 4GGOA 1T8SA 2CHEA 1TVEA 2A14A 1AGPA 4YI3A 1SK9A 1Q1QA 1U80A 3ZWMA 2CLLB 3PC8A 4EO9A 3QWAA 3CMCO 3N0VA 4OEHA 3KKEA 4KDCA 5I51A 2RH5A 1RM4A 1PVDA 3GLGE 4EG7A 5CW2A 5LP6A 3PEYA 2GASA 1W5AA 4EQ6A 3VH1A 2COKA 1D03A 3F8SA 1QGYA 4F4JA 1NW3A 1BX3A 1HK7A 4ED9A 2EQAA 2GXAA 1WXEA 3RQHA 1PFVA 2DP4E 2GF2A 4GE3A 3U17A 4W1SA 1CR0A 5DHAA 3TINA 4NOKA 1LXCA 1SPXA 1V4VA 2CUZA 1YJAA 3DWGA 1J2EA 3K0BA 1WULS 1KMNA 1CEQA 2TMYA 5EMKA 3R0VA 3RYIA 3SBXA 5HIIA 3Q12A 1MDFA 3MINA 3ZW9A 4MRNA 4XRGA 1I01A 1W0JA 4LXHA 4D8TA 1L1EA 4P4GA 1MW9X 1QYIA 1E60A 4M4SA 3PUKA 2IYEA 4XVHA 5ER6A 5EYPA 5IBQA 2PGOA 4Y9TA 3ZPXA 4BS9A 4NFYA 4Z4IA 2G88A 3RSSA 1EVQA 3CCBA 2IYPA 3CLSD 5DLYA 4G65A 4LG1A 2OEPA 5GM1A 4KXYA 3W5DA 4O5AA 1TUGA 4UDNA 4ZTBA 4B7ZA 1RC1A 1HOXA 1JKJA 3NBFA 2AXNA 3DEIA 4U1RA 4WV3A 4XSVA 2BBSA 2FW8A 2OV3A 2DU8A 4JL6A 4M1ZA 3ZWYA 4TKVA 3DE7X 3JD1A 3EBPA 3SM3A 4U7TB 5FV7A 1GHTA 1XRNA 1DFHA 4KLAA 1VGQA 3ZHZA 4HNVA 1QU3A 4ZDJA 3PS9A 3CUWA 5FH9A 1W5EA 4ALNA 5EI5A 1P60A 2GM5A 3BJIC 1GL7A 3IIMA 4LC0A 3UICA 3CQDA 5IBRA 1JVBA 3H9CA 4D45A 1TQ6A 3X1YA 1OXXK 4ID9A 5HKAA 1AQJA 2DTDA 2CN1A 2B7BA 3UZUA 1DBWA 2QORA 1U63A 3P19A 1NRXA 2AQ8A 3DEJA 4S04A 3OC6A 1ZUNB 1LVUA 1I2AA 3HXPA 3O8OB 1U98A 3I5XA 1RQPA 3F6PA 4FMCF 1SBQA 2BV3A 3GBVA 2BLLA 2ICAA 1PV2A 8OHMA 2XITA 3GAAA 4X7BA 3KQKA 1RRVA 2ZYSA 3OOSA 5K3CA 4D6PA 1RT9A 3EJWA 4RGYA 2VTBB 1LF0A 4HVTA 1S7GA 4P0QB 1OKKD 2FFJA 4OLFA 5H70A 4QYIA 1UPTA 3N6RA 4UFNA 4Q7KA 3VR2D 5EXDA 3EWSA 1Z47A 2H9YA 1XELA 2OD7A 1P4GA 3ZI0A 3HNRA 2ARKA 4IIVA 3BZBA 4KACA 1O94D 2EIXA 1D0VA 1Y3DE 2O2DA 4LQ4A 3VXKA 1OBCA 5AQ1A 3C6KA 1EM8B 5C41A 1U8TA 3BB3A 3DMHA 4DILA 1GPBA 1ACJA 2DY0A 1E8NA 2CYAA 2XRFA 4RIEA 3VHXA 1MAVA 4B3BA 4BLQA 1TLTA 4ZU6X 1H9AA 3BGDA 2R3BA 1V1RB 2XCIA 2FMFA 4UTVA 1RWQA 3MG9A 5L4SA 1RCTE 2VH5R 1PO7A 5F0ZA 1QIMA 3Q0TA 2V9PA 2Z2KA 1R12A 3PX7A 1O95D 1T4DA 1HY3A 4ILKA 5B7PA 2PS9A 5F1OA 2BKEA 3LSTA 4YH1A 1UWCA 2AFHA 5GQSA 1TGYA 3D6VA 4H6WA 4LXUA 1I3NA 1PR3A 3H18A 5JJCA 3NUGA 1NLFA 2JKVA 3FZGA 2X1VA 4ITVA 3EPJA 2VPWA 1RZVA 1GZSA 2DH5A 3SPXA 5HF6A 1OXMA 2OBXA 3C8HA 3VKVA 4MROA 3EGDB 2WIGA 3VPSA 2FWMX 5KYWA 1AX9A 1J23A 2OY0A 3GLTA 4US2R 4K9CA 2C58A 1CR2A 4K05A 1RPZA 3D4OA 3PRJA 3DE1X 4YAKA 3KOZA 5SY4A 2QM7A 4ZKEA 1SUSA 4M0FA 2BI8A 4A8PA 2FG7C 3IOEA 3L8GA 4L4UA 4WCFA 3CEJA 4MI3A 2OQ2A 4WADA 4C4OA 3W7BA 1EUCA 2OPBA 5EKUA 3U0BA 2GJ9A 3UBMA 4RWEA 1C14A 2D5CA 5AK3A 1NBME 3NG1A 4MDFA 2ATIA 1N0HA 3MWFA 1VC2A 1QH0A 3HJ6A 1ZIPA 5AK6A 4JC8A 4A2WA 2ZYUX 3RIYA 4LYYA 1RKXA 3A05A 4GM4A 2NYUA 4DDMA 2PZAA 3GCWA 3GJ7A 3H8WA 1E2UA 1H0SA 5M34A 1VMDA 1QIFA 3FCUB 2ZSAA 4ICIA 1W36D 1LTHR 3PGMA 4GBGA 3T0FA 5FUQA 1T6NA 4MPTA 3KJFA 3ESCA 3Q3GE 4P5DA 5FADA 3N3AC 4KK4A 1QYVA 3G49A 3OY2A 3TNYA 2EDAA 5I5GA 3QXJA 3A3YA 2JFHA 4PHHA 5AH0A 2WFMA 1EDZA 1HE4A 4UHCA 5JS2A 1F4LA 2WTAA 5D84A 1XTQA 2P5SA 3T9CA 4GECA 4MVJD 1DXOA 4AQDA 3WMXA 2Y9MB 4PFSA 5HMMA 2HA7A 3EVTA 3ENZA 2IYSA 1IC6A 1P1HA 2FN7A 2OZKA 3GFSA 4P54A 1JEQA 2DPGA 3LSYA 1G20E 5EJMA 4PX5A 5FAKA 3E1GA 5IVKA 2G07A 4IJ5A 4S1TA 2N1BA 2YVAA 4N3NA 4OIFA 2OWEA 1RPNA 1M8JA 1AKUA 2YW2A 3A27A 3H75A 4LMAA 2Q5IA 4U39A 4YRLA 3VYRB 2X3FA 3DD1A 4G41A 3RTEA 1Z4PX 2GJAA 4C0LA 1XZLA 3BOSA 3YASA 4NS4A 3PNSA 1NVVQ 4QXOA 1QZXA 5IX8A 3BL6A 2J3HA 3D7SA 1L5ZA 3T7TA 1PL7A 4K9IA 5K7SA 1AF7A 3JARA 1TVKA 3W4JA 4CNBA 4DGQA 1D7AA 4GFDA 4OY3A 3AF6A 1JAZA 2ISSD 3ZJ4A 4EOHA 1EVLA 2ZYWX 2BLNA 4W63A 3RWBA 4BN5A 3KB6A 3TOVA 3C3WA 1NAIA 3PXAA 4TXNA 1J33A 4OYHA 3RT9A 3L6RA 3ZX5A 3QKIA 2VO1A 3GUVA 1Z6YA 3BL5A 3SZLA 5C8XA 5L3SB 3ZJUA 1WDLA 3B3JA 3KWLA 2FSVA 1NU8A 4M99A 2JIOA 4UCXA 3VU8A 4FB4A 1OWPA 3M5DA 4BMPB 2XZOA 1TAHA 1Z0SA 3NAZA 4DCPA 1P61B 3KELA 1D2HA 3PDCA 3C3PA 3OQPA 4JLBA 1LDGA 4IQGA 1NATA 2VDJA 4IIEA 3GA5A 4H3HB 1MO3A 3ND8A 4RHUA 4BX2A 3HUDA 3PCXA 4A1FA 1UJNA 2P6RA 2EX1A 3DZCA 3T6KA 1UDXA 1QJ4A 3WK6A 3TFOA 4GXQA 1SHLA 1KEKA 2NSLA 1X0VA 3R24A 2JI7A 2PL1A 4I4CA 1LJLA 1XJWA 3FJ1A 3B12A 4LHVA 1RWOA 4QIHA 2MTBA 1AK2A 1FTWA 2VIIA 2SCUA 1ZJJA 1ADFA 4PVDA 4RY0A 4O2BA 3RREA 4DJAA 2J46A 4TV8A 2XYQA 2VHJA 1VCIA 2QSYA 4IDOA 4M7WA 5F1PA 2YBEA 3PE4A 1ID8A 1IAQA 1NMZA 1TPZA 1VL0A 3IBFA 3K72B 4C4XA 4FYMA 3OC0A 4OXYA 3RSHA 1ZG3A 3U7FB 3IRVA 4TT3D 2OXEA 1EFHA 1ZM2A 2WHXA 3WYDA 1L6IA 4BFZA 4I4NA 4A4DA 2P7IA 4DXDA 3RK0A 2JAPA 3QE4A 5JQGF 3NBUA 4HVAA 1UFKA 1IOVA 1LRLA 1XNJA 1Y8AA 2B4QA 4GI1A 3HZHA 5DN9A 4B3IA 3OWOA 5EIXA 3KZXA 3HYSA 2DBZA 2Z2XA 1INLA 3DP9A 3H5LA 5C46F 3NP9A 4AWAA 4AK9A 4MP8A 1K0UA 2BHRA 2OFPA 4IXDA 2WNHA 4RL4A 3QFRA 4OYYA 4ROTA 2YZGA 4UNQA 5JVDB 1M2VA 1OREA 3COVA 3R3VA 4IRXA 1CULC 3H2YA 2WG2A 3H3JA 4OQEA 3I6MA 3MRXA 3TRKA 4X64B 2QU7A 3OZEA 4EUMA 1ZH0A 1X1TA 4L08A 4TTPA 3VKUA 1VM7A 3AKEA 3OZDA 1JKIA 2MYPA 2QYTA 1A9SA 3DAOA 3KPYA 3LUDA 4DADA 1U99A 4RTJA 1L7PA 2EBFX 3P9RA 4XFJA 2VRNA 1N34B 3JQRA 3B1XA 3JD0A 3NOVA 3BJEA 1C1YA 2BP7A 3O82A 4LC1A 4NJEB 3REGA 5DFAA 2RDMA 3W7VA 4B6JA 5FI5A 1XFDA 4EEXA 1UP6A 5KQPA 1YJQA 4JSYA 4PHFA 3GJTA 3MS7A 3WQHA 3U7QA 3UBTA 4F3NA 4QPPA 2J7PD 3OY7A 3Q7PA 3R7LA 1TEVA 4PG6A 4NQRA 2PJRA 5JARA 3H86A 1XCJA 3UAYA 1FFCA 4AUMA 4GWLA 1KJJA 1UBGA 4HFNA 3B3GA 2W2PA 1O77A 2O2ZA 3V9AA 2DSTA 4IEFB 1MEEA 3TLGB 1FS6A 4OYRA 4DG8A 3IAUA 5HGXA 1NXTA 4KOAA 4I9FA 2Q50A 4M21A 3A04A 1KDRA 1BU5A 3GUYA 3WX0A 5B64A 1J9ZA 4TN5A 1D6MA 3TM4A 2QG6A 3TLJA 4HXYA 4FFPA 1A2BA 1TA9A 3BCRA 3O8BA 4J3JA 5DK4A 1IN1A 3C3DA 1YR2A 4PRYA 1B41A 1NJ5A 3ESYA 2CJPA 2DWOA 3O93A 4KNWA 1YACA 4MUAA 1PJ4A 3NGMA 1MH1A 1UZAA 2G9UA 4MR7B 1C0EA 2Z30A 1C7QA 1YE8A 3EQ8A 4NOLA 4YWJA 1V7QA 1DP4A 2B8JA 1L4YA 1ILEA 1TMKA 4YUAA 1VIVA 3KRTA 1V16A 1A9YA 1EFVB 1PNQA 3G88A 3OP4A 2GR9A 1V8PA 3LFHA 4H1VA 4MKXA 4L22A 4U7JA 1OYYA 2M9MA 2XVMA 4OI2A 5T6BA 3DUFB 1GXSA 2WTEA 2P3QA 3LFUA 5EG5A 3SFZA 5KYKA 5K0TA 3NVAA 1I14A 4QEKA 3O9MA 3WGTA 1BWSA 3A9VA 3UGTA 4C7OA 1EP2B 3LMKA 2E1PA 1TRKA 3T7SA 3GEBA 4QA9A 5KNBD 3MWEB 1BJKA 3ZHQA 2JLRA 3UUFA 2GERA 2XUQA 4MUGA 3WRXC 2H29A 3IOBA 4WJZA 4BZWA 5A71A 1IN5A 2H07A 3AXSA 3HV0A 2ZAOA 1RAEA 1KZ7B 1X6VA 4BVBA 5LJLA 1URPA 1LI5A 1ZBQA 2C3YA 4FYPA 4ND3A 1JHUA 1FNSA 2DPYA 3TL6A 3F8WA 3SBEA 2ZU6A 4N3BA 4QFMA 1Q95A 1KU0A 2KS6A 3AY3A 3CLUD 3QLVA 4I5FA 1E7YA 2GFIA 2XB4A 2XUPA 5HP4A 2FUNB 4DV4B 3PXDA 1YDFA 2YWDA 2OHVA 3CLHA 3PT9A 4A6PA 1XJCA 4D9EA 2PX3A 4BNZA 3RQ8A 3TIFA 3PICA 4QVKA 1YF3A 4LF9B 2XEDA 3IVCA 1GAEO 4ALJA 1JDSA 4PVVA 3L1VA 1SCQA 1VLQA 3LP6A 1GR0A 3PPYA 1RQ7A 4BASA 4YHBA 4HRXA 2NP6A 3X3HA 4L6IA 4BQQA 3U3RA 2RAFA 3WSWA 3B1ZA 2WMDA 3LBAA 4FI3C 4OK3A 1CUXA 3IUBA 2PQMA 2NQ2C 5E7QA 1ETHA 4ZO8A 5A0TA 1O5OA 4K46A 3OAAD 1LPSA 1WX1A 1KYZA 4KQKA 1G2IA 4Y6LA 3LPAA 3U3DA 4R1PA 4FONA 3X1XA 2VZ0A 1YC5A 1BE1A 3EXG1 4XB1A 2GPAA 3FSGD 3N2IA 3BGVA 3IO3A 4EEZA 5CDGA 1XP5A 3H5AA 3CZ9A 3ED5A 1OR8A 4BRZA 4N39A 4WNAB 2P8SA 2JHGA 4IX1A 4B8YA 4ZJYA 5KNDA 3P0FA 4TKMA 1A5TA 4H60A 1CUAA 2JI6A 2QE7A 1ZNWA 2OGZA 4AZ0A 2BFBB 2YKGA 3FYUC 2ZQZA 4KBGA 5ESDA 1L3CA 3RBAA 3ZLVA 1G8MA 4Z7JA 4YMGA 4JXZA 2FP4A 5DNVA 2R96A 3A4NA 1IIBA 3CY6A 2Z3VA 4PAWA 4JLSA 2V7VA 2NUPA 3HWSA 5CRIA 3LBFA 4JBYA 1P77A 3PTLA 3FHLA 3FIJA 4Q7QA 3FHYA 3MCVA 1HORA 1FSSA 2H54A 3W5VA 1P2VA 4A1OA 2L19A 3K0AA 2XNKA 1BS1A 1R9MA 1LTKA 3K0CC 3PF9A 4LOLA 3T7RA 1GNVA 4GI7A 3ZLUA 3GJ0A 1ITZA 1M0TA 4URFA 1ZSYA 2WAYA 3PRHA 3T9AA 3Q6NA 3BIWA 4OFXA 5HBRA 1NSYA 2WABA 1NXWA 2N9UA 2PKYX 4XARA 3EGXA 1FX0A 3EZFA 2ERCA 5DGXA 1YHJA 1GUBA 2VLIA 1KIAA 4WH0A 4B85A 1M2KA 1PR1A 1QDEA 1JJFA 4DTIA 3DZKA 1RKAA 2P0YA 5FBKA 3RGWS 4CF5A 1T2NA 1Y81A 4TVSA 2GM3A 3NHUA 5FBLB 2XECA 2BZ0A 4D3XA 2ZGVA 2VNJA 3K2IA 4PLFA 3RUFA 1WOYA 2FV7A 3CVYA 3BJZA 1XMSA 4RTRA 1DZ3A 1W29A 1JDBC 2RFLA 3NP7A 4XGIA 2OORC 1SZPA 3Q15C 1YI8A 4GQIA 4WBNA 3IUMA 4GKJB 1EFAA 4JYBA 1DBRA 2ZIEA 1KIMA 3RY7A 3FBGA 2VK2A 4RMGA 3VPAA 1JXAA 3LUKA 3EH1A 4DARA 2A3NA 1TTQB 3OZCA 3OQOA 1KDPA 1NOJA 1US8B 1ECGA 1PVVA 3H2GA 3ZE1B 1OBOA 2VCHA 3Q8LA 5BYFA 1U28A 3LHSA 3EZ6A 3HU3A 1F0KA 5KCMA 4C6TB 1YS2X 2ZCVA 4Q4HA 1ZK0A 3I6YA 3RK4A 3W5SA 3DVQX 2AMFA 3RBVA 3VPCA 4YT4A 1JLRA 1ES9A 4B84A 3JYLA 2QVCA 2ID4A 1A7KA 4U7HA 1QP4A 4TV8B 4KIWA 1KI3A 3OIWA 1LBEA 1MB0A 4JLJA 2WJWA 4BCCA 4RTPA 4MO9A 1V6CA 3CKYA 5F2EA 5TGDA 2RBCA 4IJKA 4M9QA 1IXRC 1LSUA 1FYVA 2O1SA 3L0CA 5TJ9A 1K66A 2JAQA 4FYVA 3ZOKA 4D9KA 2PGXA 2E49A 4RZXA 4MQ6A 2V7TA 4QC2A 1IWBB 2EP5A 1X9HA 2J5RA 2HMSA 3HUTA 1N1DA 2A7QA 4NU0A 2G9VA 2MSEB 4LJ9A 4UEQA 2D0IA 1G8GA 4LHXA 2JJ2A 3COPA 4QPNA 5DW3A 4K6KA 1SQGA 3ROKA 3AFHA 4UMEA 1F2TA 3QW4B 3RM5A 4Q1FA 1T1RA 3ZW8A 4U00A 1O6ZA 1FP1D 2B1RA 4RJKA 4XCVA 1HMPA 3T3OA 3Q0EA 3I92A 4DEXA 5CB4F 3DOHA 4LYFA 1FEZA 3BWDD 5AI6A 4Q18A 1JE0A 2OBMA 3ROFA 3GRKA 1U7WA 1EKKA 1CDDA 1UJBA 3KQOA 1QYDA 2P69A 4KYUA 4JGIA 4OATA 3V8BA 3GA7A 4MQFB 3ADBA 2XCRB 2O8BA 1KQOA 1CJKC 1KRHA 3LQRA 3TGLA 1PQ4A 4JBWA 3WE7A 4C4RA 3HCBA 2A30A 1O9GA 3K92A 3Q87B 1QLWA 3SE0A 1U0SY 3MMNA 3KSUA 3OF3A 1RPJA 3DDHA 4IZ6A 4ZAVA 3G5LA 4C5AA 3D6AA 1B73A 4UBEA 4US0R 2I3DA 1XHEA 4KPUA 5BWLA 2RE8A 1J5PA 3GJZA 2XMDA 1YJCA 3N59A 4L7VA 4UXIA 4L3WA 4WKPA 5DM4A 5HTKA 4Z53A 3UMOA 2V9CA 4M6WA 2FEMA 4HADA 1K68A 4HZIA 4RU1A 4EHKA 3IILA 5FHRA 1KEVA 2Q7XA 3JZAA 2D1YA 4XWAA 3VAAA 5LP6F 1ODLA 1ILWA 1S9HA 3PEVA 5HFJA 2ZYDA 3BGSA 4MITA 5IVIA 3W5UA 1JFTA 3Q7SA 4BLUA 3T5BA 4XTCS 5C7OO 2DDOA 2XF2A 3JQFA 2VQSA 1SJ9A 4G0ZA 4HQRA 5IZ4A 4OMDA 5FXMA 4RVOA 2N42A 3CH7A 2K2WA 4YCSA 2PUDA 3GBUA 3VR5D 3CG4A 3NW9A 2GHIA 4AF8A 1EFDN 3NDRA 3U61B 1DTEA 2PH3A 2QLNA 3JSAA 3TKYA 4I1OA 1NW5A 3LXUX 3IT0A 2WAMA 1C0LA 2H9AA 3P9YA 1KJYA 3OZSA 3X0DA 4AULA 4CBVA 1RBZA 4ZVSA 3ND9A 5DYTA 3P2OA 4E5KA 3BEOA 3DTVA 2ZEJA 4J07A 4I1SA 4X0EA 4XPZA 5LOVF 1SCAA 5DP1A 3RIEA 1S2LA 3N2GB 3QPWA 4HPWA 4IDFA 5CPFA 5DRYA 5KVQA 5FCDA 4EW2A 4TKLA 4Q9HA 4H7EA 2CDBA 4Q05A 2HA0A 5T5QA 2ET6A 2QJRA 4B81A 3VC7A 1G2PA 1WZCA 3NWOA 3P9ZA 4EHFA 3Q7RA 3T3DA 2F3RA 3QKUA 3HPDA 2YBDA 3E3AA 2ZJ7A 3M5WA 3EN0A 3HKEA 1LPAB 4L0MA 1CIVA 1PFKA 1YQQA 4JODA 4MXDA 4GMGA 3WGGA 4CQMB 421PA 1SEVA 4CEIB 3AW9A 3MMZA 3D4NA 4IG9A 3K53A 4KQIA 4MV6A 2WINI 1G20B 3EC1A 3MSCA 3U4GA 3ZH9B 1S2GA 1TIPA 2X2PA 3MFYA 5K6AA 2O59A 1XMQB 1H3EA 3ZV3A 2NZWA 2DGDA 3CC8A 4GE0A 3FOEC 1G0NA 3HY6A 1HI9A 1YZHA 3L7OA 5GM2A 2VSFA 2HNBA 5FL3A 4AJ4A 1G5RA 3JQ7A 2HA2A 2XKJE 2EOAA 1HSZA 3NNSA 2Z6VA 5GZ1A 1QGUB 2BH2A 1ECBA 1ZJ6A 3E2MA 1XVUA 4JP5A 5IM5A 2RHJA 4H15A 4ZCTA 5HOQA 5KTOA 1XMPA 3LC0A 1QC5B 2YJ5A 5DLDA 5GJVC 2Y66A 5KX5B 1CZNA 2QVYX 4ZANA 2V96A 3HSSA 3QEMB 1Z07A 2FPMA 3U49A 1I0LA 3AP1A 3OF2A 821PA 1ZMBA 4Z5XA 2CF6A 1UMDB 3NTQA 4M36A 1QGED 4Q16A 5FPSA 5H1YA 4BZQA 1T25A 5DKFA 2MHCA 2J0EA 2FPSA 4NE7A 4B71A 4WDQA 2GX6A 2W71A 3MQ2A 2Q6LA 3DBRB 4IQ4A 4D41A 3TBFA 1OILA 4KR9A 1CZOA 1DKMA 4P31A 3SYLA 2WZCA 4AJPA 3LD9A 4HAZA 2WU0A 3OUUA 5DPMA 4EWLA 3FTQA 4Y9RA 5DWDA 3QVKA 3QXGA 2QN1A 5E1MA 3G7NA 2X0JA 3LKZA 4EATA 5KYUB 3GRAA 4BE9A 1MC5A 1I13A 4FYYA 4K8OA 5SYNA 5JS6A 4LNAA 1U0TA 2VDQB 5ALFA 1MN6A 1FE8A 3IQ0A 4C20A 5BWMA 1FFEA 3HGTA 1JHDA 1PJSA 1RBYA 2WSMA 2YHIB 4U2FA 4RABA 4E2WA 1QRUA 4G8CA 2YZ7A 2OFFA 5JLJA 2FK8A 3NNNA 4UJ3A 4Z6KA 1IM8A 1I7QB 2GEFA 3BFJA 3VX3A 3C2QA 1V1MB 3P2EA 1ZI9A 3B3FA 5JC8A 4R81A 3S99A 1E2JA 1I33A 1N5DA 5DM1A 1FVHA 4R8MA 3VOSA 3UV7A 3PRYA 1UA4A 1NLMA 3QVUA 1U7TA 1AK9A 2B6NA 2ODNA 1FUIA 3MT8A 5K3BA 4DSZA 4XWOA 2MSKA 5G0SA 2NUPB 3D5TA 1RI2A 1EU1A 1GQSA 3LC7O 4Y2VA 2ZM6B 1NXPA 3KB8A 4MUHA 3HJBA 4X7MA 4BAGA 3DVAB 4CMBA 3IVAA 4HN2A 3F5DA 2HEIA 5L45A 2P68A 1L3IA 3LNCA 4YPVA 4I3GA 4YRQA 3K0CA 3NM5A 1U4OA 2ZI5A 4WW0A 1ONNA 3NM6B 4E51A 4F9FA 2Z95A 3AWIA 1MT0A 5AVKA 3S1AA 5KMGA 3H87A 4P9NA 5DIZA 4XI9A 2DC1A 3WR5A 5AWFC 4DT1B 1RXVA 2O8VA 2SNIE 3O47A 1ZINA 3ZEIA 4RK5A 3J81k 1KNQA 1EE1A 1MVOA 4L4XA 3TD9A 3CZCA 2XV1A 4AMUA 1GYRA 1VL6A 1R4AA 4FE4A 2B20A 2X5JO 5DWQA 3IKTA 2HJWA 3RC3A 4D96A 4EABA 2A7XA 5JZMA 1Q19A 2BI7A 1V95A 4PSKA 3FWPA 5EIAA 1A5BB 4GOLD 2EW1A 4F92B 3A7DA 1IU9A 4IDEA 2CNOA 4MYTA 4B6QA 4CE6A 1FQKA 4CI0B 1LSSA 2AWNA 3MM4A 5IC5A 5FV4A 3T5AA 4CCYB 1ULBA 3B53X 3EEOA 3A1DA 5IW8A 4AROA 3PX3A 4MULA 3SN6A 3AKCA 1KP2A 2J32A 1H8HA 2WQ7A 1R9NA 3TX2A 4DAOA 1HO3A 4QJ3A 5KTSA 1N2BA 3IQWA 3HQ4O 4OSPA 2AFRA 3MUEA 5SZIA 5KNDH 1EBFA 1NXQA 3BKXA 2O0JA 1Q6YA 2AVDA 4A91A 2ODBA 1SCIA 4MGYR 4CIDA 4D8WA 2CD9A 1U2QA 4UHJA 3ZGYA 3ADPA 1Q1GA 2JFFA 1XRQA 4RZ2A 2AGVA 3Q2OA 5KNDD 1H5UA 1V41E 3MJ4A 4NE9A 4BTEA 4RSGA 4TL7A 2DRIA 5E0KB 1GTG1 1NVFA 2H18A 4I08A 1GPYA 1V8FA 4RK0A 3MELA 2QE7D 3PU6A 5G3YA 5JSHA 2YH2A 3EEQA 4JB2A 3ZVRA 4O4HB 1V19A 1CERA 2ZYRA 4X44A 3H2KA 4QBKA 5JYCA 4K8KA 1WF3A 3A9UA 2AVNA 3PFHA 4N6GA 1ECCA 4HVLA 3PENA 1DXQA 4RK6A 1GVHA 1X2EA 5AW3A 2JBWA 2PYIA 3BJMA 4RY9A 3Q7QA 3ZWXA 3I9KA 1Z63A 2VT6A 2IPNA 3ROTA 1PR5A 4RQBA 1AA9A 1JAYA 4TXLA 1MC4A 3L8YA 1X3LA 4L15A 2EZTA 3TW0A 5A9RA 3NUZA 3CEMA 4HLNA 5F11A 5ARCA 3SYNA 4MUBA 3KCNA 3T15A 4PLZA 1T2FA 5LA6B 2QQEA 2OOKA 1Y8RA 2GCBA 4M8SA 3ANLA 4PPYA 3E15A 2CNWD 3COWA 3H11B 1K88A 1RC0A 4GM0A 2VQFB 3O74A 1UAGA 2QV0A 3OUTA 5BO5A 3JULA 2ZBRA 3A32A 1CVIA 2I9KA 1M7BA 3QOXA 3PR2B 3G8CA 1RU3A 2YCLA 3FHJA 3BMQA 4EUNA 1I5EA 1E1KA 4MRAA 1DAKA 1L7AA 2REBA 1YNOA 2QL7A 3ICWA 3VVLA 5ALTA 3X1WA 3THWA 1JMYA 3F6YA 1LK5A 1F6BA 2BE7A 4HPXB 4D43A 2QY6A 1P9OA 3BE5A 1PQYA 2DAPA 2E1RA 3DYIA 4NBKA 3VNQA 3L02A 4CKBB 3ZYZA 4M55A 4XX0A 1YK1A 5JADA 3NM3A 3RIGA 1BEEA 2GBPA 1HEUA 2CUNA 3H0KA 1O9BA 2GGSA 2D2FA 4M88A 2FXVA 2NUAB 1WZUA 2HAEA 2O2CA 4CXMA 5DM2A 1KQNA 1N6KA 3NMUF 5BN4B 1XTZA 3WJ2A 2QLLA 3IRUA 4E5MA 5HZKA 2UUAB 3UAWA 1TI7A 1GNQA 1KO7A 4Q9AA 3ZCXA 1KHHA 4HLQB 2XZTA 4BVLA 4W9NC 2A9ZA 3W2FA 3EW7A 4M0PA 4BEBA 7AT1A 4MA4A 2GDJA 2Y2UA 3E5NA 1WB9A 3QNWA 1JEOA 5BN3B 3EODA 4EDHA 2GEVA 5TJHA 2E6UX 3JVEA 3EXHA 4DNQA 2X77A 3SZMA 1DJPA 4UAUA 1Y8ZA 1JZQA 2I2BA 4XWKA 3CO5A 1SVSA 4LHSA 4LGYA 1G8YA 2WB2A 2EQ5A 5H3CA 3ZV7A 5JQGB 2IIQA 5KNCD 1VSVA 2Z2YA 4QHSA 1U0JA 3AR2A 3T7KA 4GOKA 3V4FA 4GPEA 3WLJA 2BAGA 3WWDA 1PR2A 3PYMA 4UU0A 2IZ0A 1EGAA 2VJPA 4XASA 2VP6A 2VNKA 2OBLA 1G20A 4GOJA 4RA9B 4A2CA 4RVHA 1EK1A 2B8TA 2GD0A 4WK6A 2QRZA 4KAHA 1OX5A 4AURA 4I0WB 3LI2A 2ECPA 5JMTA 1WKCA 2OYSA 4EFDA 4D9HA 4NJMB 2F9FA 3FAZA 5HQ3A 5SY9A 3B70A 3SJUA 4Q4DA 2JATA 2I4NA 2DPHA 3C3XA 3ICCA 4QREA 3SYKA 1TUEA 2FPRA 1OLUA 2P79A 3BS4A 1OE0A 2EARA 2JAWA 4JI1B 3TCKA 1N1EA 5HZGA 2RGEA 1FMJA 4RDHA 1LIIA 1JSXA 2OZLA 1CQJB 3EXEA 3ZNNA 1H0KA 4DA9A 4DBLE 3RSGA 4W5RA 2VTBA 4BXOB 2QIOA 3KJZA 3UAGA 4MX8A 3IIIA 1JLHA 3FNFA 3GDGA 4R1UA 1KEWA 1VBFA 2ZB7A 1UMDA 4X45A 3NFYA 4NE2A 4JBLA 4A5SA 3I01A 4FMDF 3T5DA 4JJZA 2V4ZA 3CVOA 4R54A 2XTNA 1IZ7A 4US1R 4C4SA 1YV9A 1ZN8A 3ITEA 5H16A 5JZOA 4I1IA 4E3AA 2JNWA 2ZRQA 1WUJS 4YMIA 3PTAA 2UU9B 3WGVA 3UAOA 4NCXA 4FT4A 1A96A 3OPXA 2IA5A 4G3XA 5ALXA 4HY3A 2UVDA 1NKSA 1RQRA 5U4XA 1M66A 1PRYA 4WN9A 4Y2JA 4OU5A 2Q1YA 4GX2A 2IGTA 1OI3A 1DHRA 1QZZA 1UBSB 1TLLA 1Y0BA 3AVOA 4KGXA 4F4HA 3I28A 2G1PA 3FSEA 2JCYA 1E3WB 2ZSBA 3GV0A 1KH2A 1SG0A 1QOQB 2GSDA 2VJMB 2WE8A 5C31A 3VX4A 4BVFA 1QKKA 3AJ8A 5C3MA 2PUGA 2ZE6A 1LNQA 3EA4A 3V1NA 2CL7X 2QAGC 2RB4A 4R8LA 3K5IA 5AQEA 2I2DA 1EI9A 1DG1G 1DQSA 2R87A 2Q5RA 2FWNA 2QN7A 2VHWA 3GGPA 3RYCA 1M5RA 4R2MA 1GQQA 2IXBA 5JAPA 1CRLA 2PFSA 1OFVA 2I6FA 1T29A 4YJGB 4O4JF 2ENUA 4TL8A 2DERA 3VJRA 4FTWA 4AD8A 4O4LA 1CJSA 1OUMA 5JJ5A 3T7DA 1BFKA 1BRTA 2QX9A 4HXFB 5AW5A 3W2GA 5LZ7A 4QJBA 3I1JA 5AJXA 5JAOA 3WJ1A 2QMYA 2ZJ8A 4DMMA 1ISFA 3QKSB 5E95A 2XE8A 4QRDA 3IURA 6LDHA 4OJYA 4XB6B 2Y6UA 1AKYA 2F43B 2NZVG 2XA9A 2GT1A 1N5IA 4MLCA 1SKMA 5C5CA 4MMXB 5KOIA 2FAXA 1Z0ZA 3HXTA 3PXUA 5G3ZA 1AXGA 1NBHA 1SO8A 3PJFA 3S1AB 3VSAA 4S1OA 2C9CA 8MHTA 3B7PA 1ZNYA 3CB2A 4HTFA 2A58A 3Q1LA 5DGHA 5FUBA 5EVCA 3UWOA 2EYQA 2NV6A 2XIJA 1JJ7A 1MUUA 4WJMA 1K0FA 2X5OA 1W19A 3CJTA 1CDOA 1R0CA 2HHHB 1G41A 4QO8A 3WNDA 3ZK9A 4INJA 3KQMA 5K1ZA 1B2RA 1II0A 2NUTB 2MYUA 3UJHA 2H31A 4FXOA 3UWDA 5LYJF 2KHZA 2R11A 1DJNA 1KU6A 2QX8A 3L0YA 4OXIA 1ONPA 2IZZA 4QSMA 3G2JA 4CTKA 4YRSA 3HR8A 1ZICA 4P4LA 4BE7B 1SIOA 1JECA 3AH8A 3D3NA 3ZWVA 1NYTA 2P65A 3IKJA 3L8FA 1KC1A 1J70A 4JS0A 4XEUA 3H4IA 2GFQA 3JWIA 1O2DA 2D2IA 3DDZX 4Z4CA 4JUIA 1TKAA 4D6YA 2EKLA 1Q0RA 1PU2A 1U9CA 4XIYA 4DKXA 4WVLA 1ECFA 2J33A 3MS4A 1QUEA 4ACAA 1VXRA 3DL2A 4UMVA 1RWXA 3SF8B 5C8YF 1RWNA 4JP8A 2YOGA 4Q5IA 5CA1B 2AYYA 1YBMA 4UQOA 1L0BA 3E6AA 4KNYA 1PZGA 2OHFA 2M98A 2HY7A 2Y1EA 3TECE 1PYGA 2HGZA 2VG8A 1J2TA 3UKJA 1E2GA 3EZYA 1MNQA 4KDEA 4JZYA 5F7JA 1I4OA 3T7EA 4D1YA 2WWWA 4R7ZA 4Z0PA 3U5TA 3ZE0B 3O1IC 1CYEA 5C8YA 4LJAA 5B2FA 3K6JA 3BF5A 1PUIA 1DX9A 3NJRA 5EN4A 1T24A 1DNPA 3PQCA 2PVSA 4RS3A 5HF8A 2V6IA 1RYDA 4YUVA 1VJGA 3DZJA 3EGIA 4TUYA 3TG2A 4CEJB 3RPZA 3GMIA 1YQEA 1L4EA 3OKCA 4JBHA 4UVIA 1V48A 1ND6A 1YGPA 4JENA 4H27A 3SK0A 2R6ZA 2JD0A 2QGZA 4IXNA 1WJGA 2MSNA 1OPRA 3AV0B 2BDEA 4OP1A 2FW7A 2F90A 3QE2A 3HSKA 2R3EA 1TT5B 3VDRA 3OPQA 5G0UA 2I2CA 2HH9A 4MK4A 3O9ZA 3I4LA 4OHZA 3ES9A 1KO1A 1TZJA 1F9EA 1G8SA 3T3GA 1WHSB 3VHQA 2ZWAA 1OC4A 1TO1E 1PEKE 3QF4B 3WLEA 2GETA 4L95C 2Q28A 3SJAA 4I6JA 2VZ9A 3DKRA 4ZI3A 1RHJA 1UUFA 4LY6A 2X86A 4MKFA 1SC4A 2G0TA 1WHTA 1KJIA 3GFQA 3QVTA 2H2AA 1YRLA 1Z62A 1WRBA 1J8FA 2O3JA 5ABPA 4MS4A 2GN1A 5FA5A 3K9WA 3ONDA 4UZFA 4K9OA 4TTTS 4HRYA 3P0IA 2OP0A 4FOOA 4E3ZA 4ZPJA 2HF8A 4P2BA 4J0JA 4HBGA 5HSGA 3SEFA 3WQQA 3ADOA 3FF4A 3BK2A 3BPSA 3RHSA 3S40A 1NU6A 5D3MA 4E1AA 4ZT5A 3WGMA 1A71A 4PNEA 2YVLA 3HY3A 1K06A 3MIIA 3G89A 4DMHA 5KO2A 4MVJF 1N6LA 3FYTA 1F2UA 1PFGA 1GQRA 4MB6A 2QP9X 1O4VA 4YV7A 3BRSA 4V0MA 5G4KB 1HNZB 5JQWA 4BNWA 3OKAA 4Y6OA 4ZQGA 1OCEA 1Z45A 1SHTX 1WU8A 4NCHA 2C77A 3G0DA 1IZ8A 3A1EA 3OJXA 3OIUA 3S2EA 1V1RA 1TT7A 3M34A 4MYCA 2HLZA 1UKAA 3I2HA 4HTAA 4RY2A 4Y2RA 2IVZA 1NWHA 3KSRA 3VR6H 5DCWA 3BEDA 3LPLA 3A4MA 2NZXA 1YOVB 2OLEA 3CLKA 1R6TA 2PJUA 5DASA 4CM1A 3EZ9A 3EXIB 2H1LA 4LSGA 5LQDA 2HWUA 2VN8A 3OE7A 2XJAA 4R0VA 5KSWB 1A4IA 3LQKA 1Q5PA 3L1HA 4HATA 4YASA 3S81A 3WGIA 4BLWA 5HNKA 2QGNA 1GKIA 3F5QA 1QNLA 3CF4G 3O2NA 1RE0A 5BWBA 3OFJA 1EWTA 1T9GS 2VPIA 4XUGB 5HCIA 4KWHA 3MMXA 1GAQA 1NW7A 4BQFA 3A0UA 4FXPA 1JXMA 2G5GX 1H2HA 5AYVA 4KMRA 1Y1TA 1GFWA 5BXQC 4CUKA 2VDOB 3PZSA 5JEDA 2O0KA 5AW6A 2Z83A 1Z0DA 1NYQA 5ERYA 1E2QA 4RKWA 2G3YA 4EG8A 5BV0A 3ZGZA 3BWCA 5BYJA 3N70A 4JYAB 3DKVA 2Y1GA 3NWEA 1RYHA 1C81A 3WTBA 2NO6A 3Q40A 5EIOA 3HDGA 4KREA 1TKCA 2I7CA 5ENDA 3JQ6A 3DHYA 2QZJA 3CF4A 2CZQA 3OI7A 1QVZA 5FR1A 1YRWA 1Z8FA 3S28A 3WY9A 4B32A 1E92A 1AKVA 2WJHA 3ROZA 2AEMA 1ZCZA 2I66A 5K3SA 3EVNA 3EAQA 5KJ6A 1FOEB 1FTQA 4LRUA 3ZIDA 3R76A 1YCDA 3R5TA 2PXAA 3UGKA 1M6VB 4GBED 4D4HA 4YV1A 1NVKA 1PT5A 3JYPA 4G0QA 2PCJA 3RSLA 4QO7A 1YB2A 5E1OA 4B4DA 2Z5FA 3T3PB 3ED1A 4M87A 3VSEA 3ZIUA 1M6WA 2HFKA 1NR5A 2OQRA 2WFAA 5BUCA 1JKXA 5DSTA 1P9RA 4MW5A 3VKHA 3IEPA 2X4IA 2WZBA 1Y6QA 3RB8A 4DMFA 2GZ2A 4KWEA 5DWVA 4Y0NA 3GDHA 3SX2A 3PNQA 2G71A 1HUQA 1IPFA 1EFVA 2JF0A 3BH6A 2FGKA 5FT9A 2FSHA 3RU9A 4MKGA 3FTCA 3KVYA 4K3VA 2XB8A 1N6PA 1YHZA 3W9BA 3AGPA 1YRAA 2WKWA 2OV2A 1J06A 1G8PA 2QR3A 1N25A 3MTDA 3I6BA 1NTOA 1DUIA 4AMZA 3OWXA 2QN6A 1LCIA 1JZSA 3SLRA 1NQXA 2ZTMA 1IBCA 3R3WA 1Z83A 1PW7A 4L8FA 1EWVA 4RVUA 4XQEA 2QTZA 3EYAA 4X7RA 2PS1A 4N0EA 2A3RA 4TWJA 1WSBA 4CKWA 1R0LA 2HA4A 2WT4A 3O8QB 4NYJR 1SKBA 2DPLA 2ZK7A 2FEAA 5EA2A 3W1WA 2DE0X 3I83A 3UATA 2WJYA 2BL4A 5BNWA 3O7MA 4KB5A 4BMOB 1J0AA 1RWKA 4BB9A 4C2AA 1F1BA 4RAQA 1JDUA 2C9YA 4O1HA 4MPRA 1IRIA 4LV6A 1Z5ZA 1WSAA 1MZVA 4LWOA 4D0GA 1FSZA 3RABA 2DWQA 2ABSA 5EWMB 3CX8A 4C7KA 3D7RA 1UJCA 1GUYA 1HRDA 3JTEA 4BPRA 4FDVA 1ZYUA 3QKSA 4YQFA 5L3SA 3GUCA 2IKSA 3D5EA 2EGUA 3JQ9A 3AVPA 3JQFC 5MGNA 3OOYA 1MEOA 1H0RA 5DHTA 4HR7A 4NYIR 4E2FA 4EVSA 2FZLA 3FKQA 4EG4A 3OTWA 4IHJB 3A2MA 5JDIC 1I6KA 1XF1A 2P4HX 1A2QA 1OVGA 1G7CA 5JHGB 4P4UA 1F4PA 2IS2A 4Z9AA 1ORHA 1BYIA 3HB9A 1KGDA 4PWZA 4Z4GA 4UM9D 3RVRA 3BMNA 2B83A 2WNIA 4V2UA 4E09A 4KI7A 4F5DA 3NHLA 4WLNA 2A5YB 2G1KA 2B5WA 5JNLA 4TLMB 2WYHA 2XXAA 1RHRA 3QITA 1X1RA 2ZIVB 4L2IA 1J25A 2B69A 3CJRA 4XGKA 3GPBA 1WU7A 3ROPA 3AHDA 2TMDA 4GWGA 1X8JA 1Y9ZA 4KXMA 4W7IA 2ODPA 4WHMA 4WNCA 1IBKB 1JPVA 2YDYA 4TLAA 3DZVA 3LT4A 1Q1AA 1QFSA 4C22A 4DUYB 1HDCA 1ZO8A 3KV3O 4NXMB 4GRIA 2A2ZA 3SIPA 5CLFA 3F6RA 2Z56A 3DLTA 1EXWA 2HR1A 4N5NA 1WCYA 4HGOA 4MKZA 3JY6A 1O5TA 3A1WA 1CEXA 3K9GA 3QVSA 5GONB 4EX7A 1FZTA 1BMFD 3AFIA 3LX6A 2X2OA 5K8IA 2GJ4A 3KFLA 4GBMA 3V97A 1Q0PA 1UH5A 4WKCA 4AUNA 3GLGB 4EAAA 1UBHS 2C1ZA 3QMPA 3MAAC 5E6SA 2OV6A 4BP9A 4B7AA 1J8QA 4GLFA 4C87A 1OZAA 3KR2A 3U31A 1R5BA 1PGOA 4IUBS 3H1AA 4QOEA 5TF4A 1E6CA 5A4JA 4KN6A 3K0FB 4NLLA 5KYYB 3EG9B 2FPUA 1SVOA 4ERNA 4WOKA 2DJ5A 2ZAGA 1AM4D 2VRCD 4KQ1A 3DPIA 3QV2A 2GBLA 4EMTA 4JX8A 5HK9A 5EL0A 1ZRMA 2JIPA 3H0CA 3OX1A 3TMYA 3LDUA 4DCGA 1EB8A 5FP0A 5IULC 1Y6RA 1R5JA 3H9JA 4CF4A 4R2KA 4CFYA 2EF0A 4ZYTA 3ZWCA 3H8SA 4JUCA 3V6LA 2VRBA 4P3NA 4GX1A 1JIQA 1W581 3HVKA 4HF7A 2IY9A 1VA5A 2XMSA 2XJ4A 2Q4TA 4QDOA 3LUBA 4MPJA 1YNSA 3SX4A 1QFZA 1RAIA 1JHPA 1KMHB 2C84A 2Q9AA 4AFNA 3I34X 2O3SA 4OYLA 1N4AA 3KVVA 3OIFA 5P8WA 2H6EA 5FI1B 1OAOA 1RXUA 2GTHA 4OA5A 2R8ZA 3PPIA 3ZY4A 1Q0TA 5ICFA 1Z2DA 2V1XA 4ZVKA 4O63O 3VKGA 1NFRA 3GLFA 1U8XX 1BCSB 3DMRA 3RROA 4BQPA 3KJQA 5ITVA 1WBJB 1RRGA 2ZT8A 4N5IX 1IEXA 1US8A 2AX3A 4XWGA 4OJTA 4Y67A 5FOXA 1JYFA 1RCUA 1Y8QA 3KXKA 4PC3A 3AL0C 2GVDC 3B3QA 1UEJA 3WK9A 1KEPA 2Q2QA 4HC4A 6Q21A 3DZIA 1SK8A 5J5AA 2W22A 2FPIB 1W88B 1NFQA 1FRQA 4BB5A 5KVSA 4AY4A 2YXPX 4NHEA 1VJ5A 3UG7A 3WRYC 4BMXA 4ZYVA 1YVDA 1KP3A 5ALKA 3HLYA 3RS5A 3SXUB 3DLHA 2BHSA 1XFAA 3REQB 1B0AA 3VTAA 3VHLB 1JT9A 1ZMTA 1DAGA 4LC4A 3PPXA 4D02A 4CMKA 1Y3CE 3EVGA 2CFSA 3EARA 4XSHA 4YMLA 1GFIA 2P1DA 1YFKA 3C16C 4B73A 4BVKA 1AGYA 4GU5A 4LCAA 1KSFX 1CUEA 3TVTA 4YRNA 3OU7A 5U9CA 1ESNA 4D9GA 3ZD9A 4RQUA 3VPDA 1R37A 5ALNA 1QM5A 5DNCA 2VSOA 3SSAA 1VJCA 5K0FA 1GRNA 4RZUA 5IJWA 2GEBA 3EAGA 3ENQA 4FP9A 1T8YA 4I9NA 1RMTA 4IDCA 4IDDA 4C2BA 1V11B 4AJJA 1P33A 3A31A 5H59A 1QX4A 1W4ZA 2W6OA 3LT2A 3KYIB 3D0KA 3FY4A 4Q7MB 2PAAA 5JD6A 1ZL2A 5B3KA 1AQNA 4D0NA 2RK3A 4HWOA 5CXSA 3V4OA 4QM7A 4AT1A 3JD3A 4X93A 3ZGXA 3H9UA 4S1PA 4XQGA 2VQ6A 3DBHA 2HBQA 5F52A 3RGGA 4MEJA 3TZLA 5AM2A 4U7XA 1F20A 1T1JA 4DW8A 3EQ7A 1EHYA 2BUCA 4FNGA 2XT0A 1OYWA 3C7AA 3AL2A 3EY4A 4DL9A 1SVNA 2G04A 5CG2A 6CHYA 4KFCA 1X87A 3R0QA 1A5AB 4ETMA 3IHWA 3OLCX 1L4KA 5C3YA 2PR2A 3ZGLA 2V7WA 3DJFA 4CIWA 3ORHA 2XE4A 3DDOA 3PX2A 4WEOA 3U4HA 3PKIA 5EUCA 4PTZA 1W1UA 4C05A 2ZAYA 1NI4A 3ZTWA 1KAMA 1XC7A 1KHTA 4ZZ3A 1GKYA 1JBEA 4B4WA 1Z6AA 1YB4A 2PS0A 4EY5A 4JI2B 1I7LA 2O8EB 5K0EA 1JIVA 2CMGA 4PYOA 1RJGA 3IJPA 3QTLA 2ONCA 3ZU6A 2H2GA 3FN4A 2CXRA 3LUJA 1KYTA 1YJBA 2Q4DA 2GA8A 5BOVA 5IKMA 3V1YA 1MF7A 1P5FA 4RZ3A 2FW1A 4UVHA 1FDOA 1O54A 3UF0A 4MQUA 3LHXA 4ZMRA 3T5TA 2DB3A 1JUDA 5BVHA 2D1FA 4UBLA 1CP3A 1O4WA 1UKZA 4JD5A 1H8ED 4DVJA 3NDJA 1WPXA 1Q14A 1AU9A 1YMVA 2BEUA 5LZ5A 3DB2A 4DU5A 1FF9A 3KJGA 2RAPA 4B6GA 4B3FX 5GGYA 1VPWA 5LIPA 1UFOA 4YJFA 2EZUA 1N2HA 3HV2A 4ZRDA 4B3DA 4LJ4A 4HEJA 1H2WA 3CNBA 4J16C 5C5IA 8GPBA 3G9TA 3BRQA 5FUMA 1W35A 1ZD1A 1EWRA 2XAUA 1R27A 1R3DA 2IUSA 3AT1A 2XUHA 2JLZA 3UA3A 4L5JA 1ATIA 3AEUA 1BNCA 3BFPA 3V33A 4CGYA 3I9OA 4BIMA 2BGWA 1QNFA 3PLAE 1WYEA 3BXXA 2TS1A 2M2IA 2N0SA 1X9IA 1CJCA 4NG4A 1F5NA 2VT7A 2HPAA 4WLFA 4M22A 5DNDA 5IAKA 4E4RA 2O8DB 3EXAA 3KQPA 2AYZA 1JF8A 4B1FA 4REQB 1LQTA 3EZNA 5EE0A 3DF9A 3NBKA 5GJCA 5IEBA 3R7DA 3KKPA 4KUGA 1TM4E 1U7OA 1N4DA 3A6HA 1XWIA 3DW1X 4UKDA 4LXTA 3ROQA 2PGDA 4C3ZA 1KEEA 1BXGA 1VGVA 3KKKA 1X94A 4ZOLA 3SSMA 4G4SO 5CT6A 2JVKA 2HK9A 3O8OA 3PUIA 3TM5A 5JWRA 1LH0A 3A26A 4B6OA 3E9MA 5BNTA 5JC1A 5A9TA 3GLHE 3QFTA 3STUA 3M4XA 1N75A 2RGBA 3VYUB 4NONA 2QE6A 3MLAA 1NDHA 3KD3A 2C59A 4RPCA 1WMFA 4HI0E 5FR2A 1NURA 2WTUA 4QYIB 1EUDA 4RD2A 1FFYA 3RRFA 4J4BA 2GD1O 3L1JA 5MFPA 1X1CA 2XXBA 3DA8A 1WMBA 4G97A 3MYYA 5LQJA 2KPOA 5KOHB 1ZU5A 2DLNA 4UCWA 1UMBB 1VBNA 2PMKA 3WGKA 4AKSA 1XZ8A 3HYCA 1B1CA 5JDIA 1RQ2A 3PQ7A 1HTTA 1BJRE 3W8NA 4OHFA 4MUFA 1QVWA 2AOTA 1H9BA 2FMUA 5LMCA 1S3FA 1V3QE 2MWMA 3C1OA 4XM1A 3TRFA 1MO6A 4P0PB 1Q50A 2JAHA 4AMGA 4TWRA 1Y6FA 4WWHA 2Y6VA 4ROSA 2QGFA 3F97A 4KNVA 3CG0A 5AVXA 2X5XA 2XEXA 4HUQA 5IJ0B 2SKEA 1R5OA 3CPSA 1UDWA 2VEDA 3NV9A 5C34B 2WZQA 4PPGA 5L3VA 2UUBB 1CZHA 2D4AA 2QAGA 4DUGA 3G2LA 2EJVA 3V8PA 3A6DA 3FPSA 4ZI7F 1UT5A 3ELUA 2B35A 2YV4A 3N76A 3K9QO 1SVUA 3VTKA 4WJLA 2I6BA 2AR9A 2A1UA 4U2CA 5SYAA 1ADBA 3PDWA 1WP4A 3DAHA 3UMCA 4Y2QA 3WZLA 1C3QA 4YBRA 1JEDA 2V1UA 3IHLA 4FOSA 4AAYA 3FOBA 3OTGA 3BL8A 1UMCB 3DTVD 1CFJA 4MINA 1OB2A 1PKXA 2JCSA 2KYRA 4DLLA 5U4QA 3VTZA 2XDAA 4ND7A 1ODIA 5KDOA 2C5GA 1RM3A 2B0CA 3PUJA 1YFLA 1MAUA 2BCGY 4E84A 1CY4A 4ZVTA 1F2TB 4J1QA 4WFJA 3FI0A 5JAUA 3EPHA 1E1QD 4DS3A 2VDLB 2KLHA 5KYYA 3RJ5A 3DDNA 1AQIA 2CKMA 1AB5A 1EVZA 4TRMA 3DDWA 3TEJA 3WRWA 2YYAA 2Q21A 1DIGA 2QW1A 2XHZA 2QVZX 3GJRA 3GYBA 5F33A 5A4MS 4BNIA 3KJIA 3VO8A 5JBQA 3S2GA 3F7NA 1B6RA 2DFNA 4FLFA 5FD8A 1J8DA 4JEMA 5BSVA 4CG3A 1IN8A 1Y42X 1QDLB 1JMKC 1AZWA 4DMKA 3NWBA 2C7QA 2ZTSA 2DLDA 5AVYA 1H66A 5DK6A 3ONFA 5I47A 3GAZA 4ZVLA 3O90A 4WXHA 4F56A 2YS7A 4ZCLA 1XKQA 1XQ6A 2AKAB 4EYSA 3GB9A 5LXTF 4G5QA 2PH1A 5AM0A 3MTEA 2A0FA 4GBJA 4XM0A 3TQSA 5HJ7A 1KQPA 2H65A 1XNHA 1T5OA 4M54A 4PLCA 5G02A 2HJVA 1H65A 2WQ6A 3DO5A 5AKGA 2PEYA 2WUFA 2YVQA 3EHEA 4XIFA 5EWLB 1V7ZA 1JEQB 1W4AA 4ZARA 5B7QA 1J49A 1MA3A 1WCV1 1B2LA 2AB0A 5KTYA 1RFUA 2LBPA 2CDNA 4S1VA 4HX5A 4HJRA 3VDQA 1ZL0A 4I8XA 1CF2O 1LSJA 3DBVO 4DNOA 1VHLA 2H2FA 3E5HA 3ZV5A 2J0QA 5A4KA 3UHJA 2R2AA 5KJEA 1RE1A 2UAGA 1R4ZA 4NV3A 4FSDA 4BRWA 1KETA 1SQ0A 1TADA 1XTRA 2J59A 2QTAA 2W90A 4LCJA 1SMKA 4UUPA 4D0LB 1OFUX 2X8LA 4LSZA 4X62B 4F93B 4HB3A 4ZJUA 1KI2A 4TKVB 5M2QA 1JP7A 4PYNA 2F64A 3DLIA 4INPA 3U9LA 5BMVB 2X4LA 4HDKA 2O3RA 2JZCA 3A25A 3JVVA 3AF1A 2HYDA 5BRNA 4CKZA 1OOEA 4IJWA 3OZXA 1ESQA 3HPRA 1W5SA 3EDQA 3D3WA 1G8FA 5D87A 3PCTA 2VI5A 2OBYA 1O1YA 3B1OA 4A26A 2VSYA 4F97A 2F4NA 2IITA 2AA3A 3PQFA 1NKVA 4L3VA 2GNPA 2XYPA 2YWBA 3IJ5A 2V3WA 1COWA 5KQLA 1IBLB 3HCNA 1V1BA 1MOZA 2H0RA 5CM5A 4F4FA 4Q7JB 2P0EA 4Y98A 3BULA 5EQFA 3RS9A 3V4LA 3PGVA 3ROGA 3TDNA 3LT1A 2EGHA 5CGZA 4DE5A 2VUSA 4Z0NA 4GD3Q 4GSLA 2B37A 5EPOA 3IBGA 4GI3A 3ZD6A 2Q45A 3L8DA 4Y7DA 3UC9A 4BFVA 1YL6A 1AS0A 1O6CA 4HQKA 4ND8A 2C0PA 3N28A 3IR7A 4PQYA 4RGQA 1IDN1 1ZAKA 4WEQA 4QNRA 1XDDA 3EYWA 1E9CA 2JLAA 3V4VB 2BCEA 2P30A 2VPYA 3AEKB 4BYGA 2VTVA 5BR4A 3ECCA 5KQMA 1ATZA 1NI4B 4EA8A 3K70D 3V1MA 1JLLA 2AQHA 1B76A 3BZUA 4PY2A 3DEAA 1H1LA 1I6WA 1OF1A 1D9XA 4F38A 1L4FA 2KSQA 4RZHA 2BF7A 3O4GA 4BVJA 1RQXA 2ZRHA 1Z33A 2H59A 5ILQA 3MBOA 2Q1TA 4B76A 4HX9A 4KE8A 1SVLA 3K4QA 3LO5A 1M34E 5DHQA 2GN6A 3R9WA 1UJ2A 1M83A 1V3TA 2CEKA 2AN5A 1ZLYA 2VUIB 2Z04A 3WMFA 1P1FA 2MINA 1H5QA 4HGZA 2EKBA 3ANXA 4D81A 1VE6A 3VV3A 1V6AA 5FL7A 1A98A 3FLBA 3I5YA 2C9OA 2EWMA 4Z1MA 4B3RB 4NC9A 3DL0A 3RQSA 5TIIA 3RQQA 3MF4A 4F45A 1PG0A 4MS3A 1SXIA 2I2AA 5IPFA 1HDGO 1WMEA 3IP3A 1TD2A 2REOA 1I1QB 4A8JA 1U94A 2D2XA 1KRXA 3GP8A 3D6UA 4CMAA 1Y6JA 3CUVA 1CHNA 1L4MA 2V0NA 1WB6A 2WYVA 3E05A 1EZZA 2P27A 3EIEA 1SXJA 3IPXA 3MYRA 4IKOA 3VU3A 2YICA 1XI2A 3OHSX 5I4KA 2DYKA 3U2QA 2AR7A 1QHNA 3MT7A 2C2MA 4TLLB 3EIHA 2C9BA 4N41A 3ASZA 1QCDA 2D4HA 4EMSA 2LCQA 1B23P 4S1IA 3WSTA 3FVQA 4FWBA 2IYYA 2YW9A 1H69A 3TRJA 3M1AA 1OX6A 1J9EA 4XEHA 4Q1EA 3AR7A 5IZCC 1SUPA 3IVMA 1A7JA 3UHFA 5CB8A 1M33A 5ADHA 1T13A 2X1HA 3KPJA 1B26A 4ESEA 1TJNA 2VKQA 2WM3A 3RJZA 3Q6IA 1WTAA 4WESB 4DKJA 4L85A 4BFUA 1BXGB 1G3RA 3P2YA 2BKLA 3A6ZA 3K1JA 5KWJA 5CA0A 2FPGA 4FFMA 5DJ5A 1P3DA 1TD1A 2C5EA 4ZGBA 3OJ0A 2BR5A 1X0XA 1IWPB 1HE5A 1FPQA 1RABA 5BORA 1I4DD 1JQ3A 3GFRA 3K0KA 4B4KA 5LOVA 2DUNA 4WX2B 1J7JA 2CVQA 2NU7B 4U9IS 4OQZA 1C80A 3ZX4A 3CH6A 3GVPA 3KOXA 5BSFA 5JSQA 4CGZA 1ENYA 1NHGA 1C2YA 3KLMX 1ISGA 2OECA 1EUYA 1O5IA 4HLDA 5LBUA 4EJSB 1KI6A 1P3Y1 2I80A 1NVBA 4C6RA 1PG5A 1PTJA 1N6NA 2HCFA 3CR3C 2JPDA 3M6XA 3COSA 3IHKA 4NX2A 2AFVA 2YVUA 5E2AA 3FLEA 3HJRA 1TRHA 3RRYA 5EGNA 2BSQA 3RQXA 2D5IA 4FJ2A 5EE1A 1N0WA 4I19A 3WGLA 1HLDA 1DTWB 2W2QA 3A9RA 4D0RA 1Q11A 1PT7A 3V42A 3PCRB 1YR1A 2C7BA 1U0HC 3FWHA 1ZDMA 3RAJA 3GH1A 2BMJA 4PAQA 5GGXA 5BR1A 1GXSB 3BD9A 5FJJA 5AW9A 4MW2A 1A9ZA 4MR8B 2IPOA 4B3SB 4EUSA 3C15C 3IV7A 4WA8A 3ISTA 4J0IA 3NT4A 5HS6A 1UT6A 2IXAA 4MQEB 2JGNA 2LXNA 2O2SA 4M1WA 4AUKA 1DCKA 1SPBS 4JH0A 1H8EA 4OJNA 4KR3A 1MR3F 2JAUA 4TKZA 3EIQA 3FPAA 3IMCA 5I7EA 3VAQA 5CDSA 1FVXA 3DOIA 5DTJA 1G16A 3BRCA 2Q3DA 3DCIA 4KTVE 1EG2A 2F59A 1ZSNA 2VNIA 3K6KA 2ZUCA 3T4PA 4QFBA 4A8TA 4F4IA 3EXHC 5JOQA 1AO0A 4N48A 1OGIA 5F1YA 2C5BA 3UMFA 1NRIA 3NLLA 2XXJA 4CR6A 2BEWA 1IIRA 2RK4A 5DBFA 3REOA 4G26A 5CTJA 3N87A 3WIEA 1GTL1 5E9JA 4EB0A 1T0PA 5E3IA 5KOYA 3IA2A 3PFIA 1O6GA 4YDQA 3U7HB 1UADA 3P5BA 2RI1A 2GXSA 1TO2E 4KPGA 2NACA 2C4KA 2O5CA 3I9MA 4NARA 1T4MA 4ZV4A 1XB2A 2X8WA 5IJXA 4B87A 1RAFA 1TQHA 2G80A 1J8MF 4N82A 3E8SA 1JBKA 3T95A 3JR7A 4F4CA 5AJTA 2L18A 3LHDA 1C8BA 5CVEA 2DHQA 2Q5CA 5F7OA 1UZNA 2X9NA 1F8GA 3KU4A 3MLEA 1NUPA 4TSFD 3ZIAD 1QTQA 1YC2A 2IHUA 5TPWA 5A5EA 2RGDA 3H0EA 2C78A 2FW9A 1J0XO 2JGRA 2BZGA 3ZDDA 5CCXA 2H1RA 3OG9A 2P2NA 3SOZA 1GV0A 3FPEA 3LZ6A 3VI3B 4WAUA 4JLNA 2OCLA 4DLZA 2F8MA 2ABQA 1NMQA 3SQOA 3DMTC 4G9EA 4MIEA 3ZV4A 5D6NA 2BKVA 5TARA 1J0BA 4YO7A 3TJZA 1JNXX 1C1HA 1GNRA 3DGEC 1Z6QA 1K5PA 2AOVA 3QSGA 5HE9A 4ENVA 4PAMA 4G5OA 3K0HA 2V6MA 3OHPA 3TEMA 3HGMA 3FG9A 1YJ5A 4P8RA 3K4PA 3FCCA 2EHJA 4B2IA 4TLDA 3FBTA 3IEXA 3NEJA 2E2WA 3WP1B 5DX8A 3ZCRA 1TD9A 2HGSA 4ONEA 1T8UA 3H16A 2D13A 2HDNB 4NDAA 1ZXBA 2C88A 3VH2A 1GEEA 1R4MA 1QYWA 1Y7PA 4AF6A 5F12A 3E58A 3L5OA 3MC1A 3GOQA 4XGRA 5K6AC 1GC5A 4MRVA 3T3MB 3VDXA 1JQEA 3CRZA 1VE5A 4N18A 4EITA 5DNUA 3E03A 1Y89A 4M53A 4ZA2A 1Q7TA 2HMWA 3N5CA 3RVMA 3H4VA 4BNDB 3VASA 2ZXUA 5ILGA 2BBTA 1ICIA 4YJKA 1E9SA 1TJPB 3HMQA 4BTLA 2XADA 1PJ8A 4A9AA 3DQPA 3CRW1 3KYJB 2QUBA 1USIA 1W7AA 3UQEA 1OWLA 5EP3A 1SGWA 3PGLA 4P33A 5DNYB 1TTTA 5JQGA 4CEJA 1E2PA 5K0CA 5CCBA 5CVUA 1ZD9A 2P6MA 4J7XA 3TW6A 1NOIA 4OX9B 2ZYVX 4P80A 2VATA 5K8JB 5COJA 4HFRA 5C0OE 4B3XA 4LBZA 1EFCA 1PSZA 2YHAA 1Y9EA 3DOFA 3WWZA 3IH0A 1IXZA 2ACWA 1RAGA 2ZRFA 1IXKA 5TQIA 3KD2A 1QHXA 4RA9A 2W43A 1U7HA 2VTDA 4OCZA 3WICA 5L6LB 2VQEB 4ZQHA 3EQZA 4FKMA 4C0AC 3DTTA 4AZTA 3RKRA 5K6TA 2D1QA 3KOOA 5IBCA 1E9FA 4QBHA 1YK0A 3LYUA 1SULA 4Y9SA 4WSOA 4CLOB 2PT6A 4ANFA 2P3SA 4QUHA 2XOXA 1KYIA 3U81A 1L5MA 2FSPA 1QHIA 2QTCA 2MYTA 1TQ2A 1FP4B 3L9WA 4NBNA 3L0DA 1T6YA 3ETEA 4PHGA 2JD2A 1NTRA 4DA8A 4KR2A 4C43A 2C4MA 5C7LO 4KR7A 4JR1A 5H9WA 1O95C 1RI3A 1Y3IA 4J0GA 1SG6A 1TCCA 3QHPA 1IONA 4OK5A 4YRZA 1FTSA 1IYZA 2AIRA 2H57A 2P9QA 2WEKA 1UC5B 3QYJA 4FMBB 4MGZR 1JWAB 3CWCA 1V1JA 1GQYA 4BKRA 5CA0F 1A8PA 4FKZA 4YAUA 3STXA 5BQOA 1HMYA 1EE2A 3WDSA 1A8QA 2Q5OA 1N77A 2J0SA 1XKXA 2PKCA 2QU8A 2A9JA 3VZSA 1I3KA 2IP1A 2XI4A 2Q3EA 3KKMA 4S3MA 4BDTA 5IH7A 2OCGA 1ML4A 3CVWA 2F62A 2V5UA 4JIMA 3ZOZA 3TG8A 1RIFA 3D4LA 1DGMA 4DBZA 1SHJA 1RRKA 2ZYGA 2Q2VA 3A6LA 3I5AA 4QDUA 3GZTB 4IHAA 1GWNA 3DJYA 1CY7A 4M98A 4MW6A 2PMCA 4G1UC 1FUKA 4ID3A 4QG3A 2VP3A 4CQLB 1XR3A 3DO6A 1KFJB 3M4YA 5CLLA 3EQ9A 1VA4A 1H1TA 2NTYC 3INRA 1SCUA 1ZVKA 3HJGA 2WZDA 2XQFA 3M49A 1U4SA 3HYTA 4BECA 2ZUEA 1DKNA 1RJ9B 3UQ9A 1WNTA 2ZRMA 1F2DA 1XCOA 2EG9A 1YS7A 4QDJA 1CQIA 2VF8A 2HJGA 1MB3A 1DQPA 1Y63A 3RVBA 4OL0A 3PDHA 1TCAA 2AOUB 2C4NA 1PJLA 3LC2O 1IXSB 5HFAA 2D8AA 3JAKB 2NU9B 3KDPA 2G1JA 2RG7A 1E8MA 3QXHA 2CXQA 1TCBA 3OZIA 1TCVA 5CM2Z 2OUKA 5DGDA 1QMGA 1ZGAA 3L1UA 5E6RB 3WLOA 3HO1A 4IIJA 3G8DA 4LXIA 1T1SA 2FUG1 4I1RA 4RMNA 4ER7A 2R7MA 1TNDA 4OQLA 2G1UA 4OHBA 3GZ4A 3NBQA 2Z9CA 2FCRA 3P0RA 1G6OA 2Y1LA 1QG4A 2B3DA 2BIFA 5IUKC 3R5HA 1VL2A 5LOVB 2L0XA 3FFTA 2UYCA 1LY1A 2P6OA 2YNMA 4CLRA 3HRHA 1XYYA 4R1SA 3WK5A 1BS9A 1F14A 2FOLA 4WZ6A 4EDFA 4HDNA 1EXVA 4DLAA 2X58A 3I8OA 2G72A 3LT5A 1FJGB 1OIXA 1PWZA 4FBLA 3SP1A 3ZBPA 2FVXA 2C7GA 1KJWA 3WB9A 3DGFC 1BMDA 1OBVA 2AG6A 2GZSA 3K8QA 4H17A 1MQ8B 2C2XA 5AW4A 1F8FA 1QH1A 2F48A 2XYRA 2X0EA 3ILYA 2R48A 1YKGA 2Q7OE 2CMFA 3NBXX 3QLUC 4AYTA 2FRDC 2QTVB 2W6NA 2FP4B 2WDZA 5AI9A 3UNXA 2W11A 2V6GA 4HFMA 3WKDA 4D4KA 1FNNA 4C07A 5BNIA 1K27A 1KDYA 2I65A 3AB7A 4NQZA 4LF7B 3W5CA 5J4HA 1GQFA 3SNHA 1Q1EA 3L0ZA 2B7LA 4TPKA 3RBZA 3ABSB 3KZNA 1XA3A 3BAFA 4DR1B 3AI2A 3M4ZA 4URHA 5PNTA 3KWJA 2BR4A 3QYAA 1AHIA 1BGXT 1ZIOA 4GVLA 4MP6A 4P34A 4PLGA 1D6NA 5TPZA 1VHTA 4HDSA 4AQYB 5HF5A 2R1TA 3KB1A 1F60A 3WIBA 2I0FA 4TXHA 5DBEX 1YU6A 3HXKA 3RLIA 2QBYA 4DLUA 4PSDA 1K4MA 3IMKA 3KO8A 3NKFA 2Z6AA 1S4QA 2JLQA 1BQEA 3R7AA 3OOEA 3DNFA 2O23A 1NONA 3QQ5A 4ZO7A 4FYXA 1B16A 3NXSA 2J3KA 2M6KA 3QEMA 5CW1A 4R9SA 1P0MA 1I7DA 2GZHA 2QZZA 2P8JA 3PI7A 4GI5A 3CSSA 4LHWA 4L72A 5ALHA 2R8BA 1OHHD 2K87A 1NVUQ 2P9CA 3EZLA 2TMGA 1D8TA 3C6ZA 4Q01A 1LV8A 2UUPA 1YSCA 4MOWA 1CFZA 1Z88A 4UU7A 1NJGA 5A05A 1Q21A 4ZJPA 5HXAA 2H00A 3LCVB 3VUFA 4ZVOA 1H6DA 4BWVA 5C9ZA 5I3ZA 3IP6A 2EFEB 2WIBA 3BD6A 5JLAA 1KDOA 4O8ZA 4CF6A 3QELA 3RI3A 5JCJA 5BN5A 3V8EA 3VHXB 5LQAA 2JFVA 3I9JA 4QJIA 4R4JA 2IXDA 2HMYB 4M76B 3A3OA 1WDWB 4FCTA 5DN6A 5AESA 3SS7X 2VT3A 3SR4A 1YONA 3W2EA 1VL5A 1QO9A 1BX0A 4ML3A 1TZCA 3FR7A 3EX7C 1WW3A 3DE3X 1I0IA 2UZ1B 2XAAA 1NI3A 2IEBA 3K5WA 4DJDC 3JATA 5DULA 1JQBA 4N76A 5JW6A 3NUQA 2ZBQA 4X20A 3ZKWA 5DOVA 1ORTA 3THRA 2ZRGA 2W6ZA 3AR3A 3LYAA 2WKRA 4GT1A 1E18A 4A0SA 4CG2A 1JJIA 2ODWA 1KMMA 1P74A 3NTLA 4QOFA 5LWQA 4N8EA 3HU1A 3BMCA 4YAFA 5KMGB 1HDYA 1FRVA 1N36B 4MEBA 5T67A 4G07A 7REQA 1ANKA 1J8YF 5CXUA 1L3BA 4RFLA 4JDUA 2CB9A 3UT5B 2CZGA 4RVFA 3ZE2B 3TBHA 3D6FA 3FOWA 4DLVA 1AV6A 4YK7A 3OFNA 1LI4A 1L7QA 2H4YA 4UUBA 4Y1EA 5C7YA 1AJEA 4JC0A 1JG7A 1WP9A 1L4UA 2B4AA 3LL4A 2QTNA 4UCQA 1SC9A 5EIFA 4LY9A 5GZ3A 2HCRA 5JBIA 2H5JA 2GKGA 3RU7A 2CHGA 2ZIXA 4FLEA 2E4AA 4O2AB 1ZCJA 2WVGA 3LBNA 4JFRA 2AH5A 5H81A 2JJ1A 5LP6C 1BCRA 1IHPA 1SB8A 4X6LA 2Q6VA 2VHXA 2B4KA 2J8ZA 4BNJA 4Z4HA 3LX5A 2O57A 5B7NA 1KE2A 1ESDA 5ALMA 3DEKA 2HIGA 5JSFA 3TLEA 1QZTA 4WKOA 4W82A 1NVWQ 4M83A 3AHEA 1STOA 4O2RA 3LY5A 4YAJA 1CUYA 5F3RA 2J4DA 5MN6A 4IJMA 4AJ1A 2ZE8A 1O6BA 5A6SA 1B8NA 4J6FA 5CNJA 3JWEA 4GYWA 1BW9A 3U4QB 1N3IA 1BDBA 1QG0A 3K8OE 4H08A 3TXXA 4MDEA 3EVDA 4B3GA 3QX9A 1OFUA 4LXGA 4ZOEA 5TV2A 2LCIA 2C92A 4CLOA 2D5AA 4QTYA 1CKEA 4DRZA 4B3JA 3EUEA 5B6JA 5A3JA 4NBSA 3HXQA 2ECOA 3D0OA 5G0TA 4RHFA 1M2OB 1GUDA 2RGAA 4EQZA 4YRMA 5MN4A 1M67A 2BHTA 2QN2A 5FBWB 2P77A 2YQ5A 1ISSA 2OCAA 3IT1A 4MEAA 4QICA 3ZHBA 5BOSA 4UAVA 4HLCA 3ZHRA 1Z12A 3R8FA 3A2NA 2KI5A 4ZI2A 1L5HB 4BMCA 2XMPA 4JZKA 1KOFA 4HMQA 1DFGA 4RK1A 5M29A 2XB6A 5DGIA 4GUDA 4Q7EA 4KRYA 4Q24A 4KXFB 3FXAA 4B2YA 4DHEA 3CM0A 3PQ2A 4ZMSA 3NM4A 4RYLA 2PX2A 3Q5GA 3E9ZA 1ZR4A 1CW2B 5F5LA 5ITZB 5A04A 1M74A 2C3MA 4IPTA 5KWVA 2V8OA 5KS2A 3ZCSA 2I6SA 2QW8A 5H3HA 3G5UA 1ZMXA 3AIOA 4RTOA 3FYUB 2LNDA 3R3JA 4HNQA 1FXWA 3AU8A 1KSGA 3JQBA 1C2TA 3RNOA 3R5XA 1CCWA 1DT3A 5JECA 5EJ2A 1IB6A 1DRUA 4KKVA 1Y9AA 4DPKA 5AK5A 5A0FA 1KJQA 3DNMA 5J63A 2PE5A 4D8YA 4RACA 3LCUA 4BCDA 1X8LA 1EVYA 4JNKA 3JWGA 5EVJA 4ZWNA 5TQ2A 4R16A 4J29A 4ZYUA 5T4HA 2F4VB 1E59A 1GUAA 2BMEA 1LRJA 2I54A 2IYXA 4TLCA 5C2JB 1G38A 3NL6A 2CYCA 4HDQB 2QT0A 5KHAA 2ON6A 2O54A 4QXQA 2JGVA 2R6CA 2VHTA 3OE1A 2HCBA 1JEJA 4OLHA 4WE3A 4BO9A 4ZICA 3BMOB