3RS9A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima in complex with p1,p3-di(adenosine-5') triphosphate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
490
structure length
490
Chain Sequence
HMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 178
structure length 490
sequence length 490
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rs9A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rs9A02
2Q5RA 1JXHA 3MBJA 1YGKA 4LC4A 1TZ3A 2NWHA 3KEUA 3D3JA 1KYHA 1RFTA 2JG5A 3RTGA 3B3LA 3EWMA 3IKHA 4S1HA 3UQ9A 2RBCA 4C5KA 1EKQA 4GM6A 3KTNA 3RO7A 3RS8A 5BYEA 3UQDA 1WYEA 3W4SA 2ABQA 2QHPA 4DU5A 4KALA 3RQ2A 3GBUA 1TD2A 2F7KA 2HQQA 4JJPA 3FHXA 4X8FA 5COJA 2DDOA 3RU2A 3IBQA 4LBGA 2YXUA 2AB8A 2JG1A 3NM3A 5CGAA 3RSFA 1TYYA 3NL5A 4S1MA 3RNOA 4E69A 3RQHA 2AX3A 1BX4A 3RU3A 2O8NA 3NC2A 4YL5A 5F0ZA 3RRBA 1EKKA 4XF6A 3GO6A 3MBHA 4EBUA 3RTBA 2JGVA 3RSGA 3RO4A 3RQ8A 3B1QA 2AWDA 2DCNA 3PZSA 3RSSA 5TQIA 5BYFA 3NM1A 4UBEA 2C49A 2AJRA 3QAIA 2PKNA 3LJSA 3RM5A 4E8WA 3RTAA 4C5NA 2AFBA 1VI9A 3B1NA 3K5WA 1JZTA 1VM7A 3NL6A 2C4EA 3IN1A 1LIKA 3ROGA 4JKSA 3RT7A 4LCAA 1UB0A 4K8KA 4K93A 3IE7A 4S1IA 4WJMA 3UMOA 3LHXA 3ROEA 3RRJA 3GO7A 3UQEA 2VARA 3RQXA 3UQ6A 2FV7A 4C5MA 1L2LA 1RFVA 2DDMA 5BYDA 3RTCA 1ESJA 3RQQA 4KADA 2PKMA 3H74A 3NL3A 3NBWA 4KBEA 5CGEA 1VK4A 3RTEA 4C5JA 3FHYA 3ROZA 4K9IA 1ESQA 3RRFA 4LBXA 3ZS7A 2HW1A 1V1AA 2AA0A 3UBOA 2F02A 2A9ZA 3IH0A 2DDWA 3PL2A 3UMPA 3I3YA 1V1BA 4E84A 3B1RA 5C3ZA 2R3EA 3DRWA 3HPDA 3RPZA 1V1SA 2ABSA 3VASA 4N09A 4PVVA 3RSQA 1JXIA 4YWRA 1V19A 3N1CA 3OTXA 4S1IB 3LOOA 1RKSA 2XTBA 5BYCA 3DZVA 4E8ZA 4K8PA 4DC3A 3HICA 4JKUA 3H49A 3LKIA 4C5LA 2PKKA 2AJPA 3BGKA 1TZ6A 3K9EA 2I5BA 4B8RA 3RTDA 3Q92A 4KAHA 5C41A 5B6AA 1YGJA 4KANA 1LHPA 3JULA 4EN4A 5C40A 4XDAA 5C3YA 1RK2A 1RFUA 2I6AA 1GQTA 3B1PA 3NBVA 3CQDA 2V78A 1YHJA 3BF5A 3Q1YA 3RS9A 1LHRA 2QCVA 3IQ0A 5CM5A 4EOHA 4B8SA 4K8CA 2A9YA 4K9CA 3QA2A 3NCAA 1DGMA 3NL2A 1RKDA 4O1GA 4XF7A 1C3QA 2HLZA 3HYOA 3KD6A 5F11A 2PKFA 1LIIA 4O1LA 1LIJA 1GC5A 3RT9A 1U2XA 2DG2A 3RPHA 4E3AA 3NC9A 3ROXA 4E8YA 3D3KA 1LIOA 5TRWA 3B1OA 2I6BA 3RREA 4N08A 4U7XA 3VAQA 5EY7A 5EYNA 3RQ5A 2YXTA 4K8TA 1RKAA 1UA4A 3KZHA 2R3BA 4XCKA 4EUMA 3RQ6A 3RY7A
chains in the Genus database with same CATH superfamily
4GBJA 1W25A 1L4EA 2V3WA 3DF7A 3G02A 1Q7CA 5K3SA 4ESEA 2VOSA 1D4AA 1BMTA 1MQSA 3OAAA 3Q10A 3F98A 4G85A 1USIA 4JIMA 4V3BA 5HK8A 5JSKA 2EBWA 3OQHA 1H2XA 2QE6A 4FU0A 3Q8WA 5DXJA 3G2MA 3RS8A 3ZJTA 2YJGA 3L8FA 3L92A 3ZWOA 1VMDA 1AXGA 1R37A 3CT6A 2CKDA 4ZVUA 3SBXA 5BO5A 2ZITA 4B6EA 3V2IA 2C1ZA 2SKCA 3MTIA 1YI0A 1J9GA 4DCGA 1SN7A 2FOLA 3GMTA 3KVYA 4HEA6 3OQMA 4ZCSA 2X5OA 2Q4DA 1IZ7A 1GUAA 4I4LA 3GGSA 4G86A 3VTFA 1JR6A 3E4CA 3PQDA 3PX7A 4S1VA 4PBTA 4UHCA 3CRZA 1Y89A 2JEYA 3HK2A 2NU6B 1U1EA 3JSXA 3EXG1 2X40A 4UKDA 2PUDA 1L5SA 2CLIB 3O4HA 1R4ZA 2WTAA 3IUSA 1V2HE 1X8XA 2WMOB 4R2WA 3HNPA 3PYXA 4HPXB 1XRMA 4UXJA 5E3IA 4BMVA 4YXWA 3RTAA 1IOVA 4J16C 3P0FA 1TOAA 2OSVA 2P9YA 1SVIA 4P4GA 4WKNA 4AXXA 3E2MA 3DB2A 3ZZ1A 1AUQA 2GSWA 2HBZA 1U6KA 2OBFA 2Z1NA 3G2KA 2HIGA 3SP1A 2QN9A 3AJDA 2WUVA 2ZAMA 2XLCA 3KUKA 4OG2A 3S81A 3OCJA 2FCRA 2GBLC 1ACMA 2X5XA 1NMZA 4JBWA 4IGAA 4IXDA 5BUZA 3TNLA 1OX4B 2GESA 3EB9A 3RW9A 2VP6A 5JXJA 4OMFG 4QNNA 4B7AA 4URYR 2XOKA 4QQFA 3ODGA 2CFRA 5KSPA 1PS0A 3IAUA 2WG0A 3L07A 3PJGA 5B7NA 5JI2E 1F0NA 5JZSA 1MC5A 4AI6A 3TDNA 4PQEA 1WVGA 4Y7DA 3DC7A 2H2IA 1RWNA 3GCZA 4KI7A 2H5IA 2O1EA 1RKXA 2Q5QA 1X7ZB 2JBAA 3RVJA 5KWSA 1WETA 2CLFB 3R9KA 1XK7A 4DC0A 5M5BA 5JNLA 2PZGA 1BKSB 2JIZA 4MKZA 4E51A 2Q4BA 1J20A 5DNWA 2H1IA 2WDPA 2Z2JA 4JSRA 3J7AC 2GN9A 4PQYA 3DXZA 1R3UA 1WB9A 1FRNA 3L8EA 1NXXA 1EUDB 3GH1A 2YZ2A 4LXTA 4DLAA 1WHTA 1I4LD 4ZCLA 2OD7A 2ZYAA 3RGGA 1TCBA 1Z2PX 4F0JA 5KTSA 2ZRFA 2A4KA 5U1PA 2FFAA 4P34A 3X1JA 5AI0A 1UXOA 1IE3A 1JFSA 5HW0A 1K7CA 4WRRA 4BQIA 1CR0A 3GLGB 1BDIA 4TT8A 2IY7A 4K81B 1C3LA 4MHTA 4ZAXA 5D1HA 3VMMA 2ZAOA 3ZV3A 1E3SA 4E5DA 4IF4A 2CXTA 1HE4A 4TMTA 5SY9A 3QA2A 4IINA 4QFBA 4UD2A 1VG0B 3DEZA 1UIRA 5ECYA 2ZWVA 2P41A 1JHMA 2VWPA 4KOAA 5E95A 5LU9A 4OL9A 1SHLA 3M81A 3H13A 3IDSA 1AUOA 4YT2A 2RK3A 1YJCA 1JTVA 2NAFA 2ZU0C 4GP6A 1V9SA 3IP1A 4AULA 5IUKC 3TZHA 1YQXA 1T9GR 4KQ9A 4MMZB 3LFUA 5L45A 1XXHE 5JS7A 1H2FA 1DJPA 2PHZA 3ID6C 3TL3A 4BZPA 1XNGA 3OURA 4FKMA 4UTNA 2A59A 1R7RA 4PC6A 1NU8A 2G9VA 3N8HA 4N3GA 2F9MA 4N5HX 3GLRA 3OESA 3HS3A 1LFAA 1U2GA 1Z5UA 4MV0A 4P58A 4IIFA 2VJPA 4WZAB 1MEEA 1R10A 2GAAA 4V2UA 1DZIA 4JGGA 1VSUA 4X5OA 5DWVA 1K0UA 3OEWA 2HKIA 3BA1A 3PZRA 1T34A 2OOSA 2VP3A 3M2PA 5A7FA 4ASUA 1CFZA 5I7AA 4FTWA 2PH1A 4NECA 4DCSA 1F17A 3T54A 2R60A 4PR0A 2IXGA 5TV2A 4BRZA 2WHEA 4OAOA 3TD2A 3DPUA 4CLEA 1XEXB 4ECEA 4C2UA 4YRNA 1YFLA 3GLIE 1VYVA 1Z5NA 3LMKA 2DBVO 3FUCA 4KCGA 4EJFA 3N2AA 1SWWA 2I7TA 4WVFA 1P7CA 3I37X 3SHTA 1OH6A 3Q5GA 3W8DA 4EVSA 2R00C 3VZBA 1AK1A 1PD0A 2FR8A 2F3QA 5IU6A 5LA6B 1M2EA 2P9QA 3ZH2A 2CY0A 3VU0A 1QO0A 4DWWA 3MBHA 1LWNA 1XRJA 1P1BA 2ECKA 2VHCA 4FI3C 3TZLA 3TFQA 3SEZA 1T35A 4FCVA 4EPWA 1ZESA 3ZQJA 1PTJC 1ZSNA 5EYPA 3P4XA 2HA6A 1VIVA 1ZUNB 3IQHX 4J0QA 4KPGA 4RV5A 3PXGA 3ZBUA 2GCGA 1BC5A 2CFCA 1JEOA 2Q5JA 4HP8A 1AB5A 3Q9SA 3UQZA 2CDAA 2VZLA 1P4RA 4J43A 1S8AA 4RVNA 1ZISA 2CJPA 1UFVA 4HAXA 3WIOA 4GC5A 2AXEA 2X8BA 3CONA 1L7OA 1KPHA 4CFYA 2IHNA 3TX2A 3ORQA 4PCAA 1U8FO 3AW8A 4ML3A 2FPLA 3KB1A 1DCFA 2HSEA 2AC4A 2AKYA 2I6UA 3PR2B 1KS9A 5CX1B 1XPUA 5JZVA 1T1IA 2NG1A 5K0EA 3MERA 1A4RA 3NONA 1VK4A 4V1CA 4MA5A 4XASA 4O4JB 4ECAA 1MDFA 1B15A 3U6BA 4ENPA 2DUNA 1L1FA 1P19A 3PFWO 3RS4A 2JAHA 1P80A 2ZAGA 4D9MA 3NGXA 2LXNA 1PL0A 4QU5A 4J94A 4ER3A 4L5YA 2WIBA 1NPYA 1QFSA 2COKA 4LBZA 3G85A 2NOAA 1X1AA 2JKVA 5AVKA 5LMCA 7ABPA 5JWRA 3JD0A 3MT8A 1PR1A 2FETA 2BFFA 2GLUA 5DYNA 4JKUA 4LQDA 2HA5A 4XGIA 2IDKA 1FXUA 2N46A 2YX1A 3WP0A 4EYKA 4IHJA 4UFOA 5EPUA 1YCGA 2F6RA 5HEKA 4RZIA 5TY0A 1MEJA 4AMYA 3WL3A 1HLPA 4HDOB 2C8JA 1EJ6A 1LUAA 4AMBA 2I3BA 5AHOA 5JYEA 4KAFA 4YS6A 1FLDA 1Q1QA 1Y6ZA 3FGZA 3HCRA 1IN6A 5HE8A 2J0QA 1GDHA 1R16A 2FAXA 4Y9DA 2A5DA 4FC7A 5EEGA 5ANRB 5FB3A 4EA9A 2H1FA 3PTAA 5LD2C 2CMHA 2DPGA 3Q3JB 3UUFA 4R9SA 2Y92A 1KDTA 1J0EA 1DPFA 1BXRA 4RTLA 1G21A 1JPJA 1VCMA 1QQTA 5FXMA 3QU9A 3DV0A 3E9CA 5DI9A 2H1VA 1ZEJA 4UXHA 3WIEA 1UJCA 2V7TA 4I9UA 1USWA 1NXPA 4M1ZA 2I7VA 4LK3A 2Q5IA 3WGUA 2QN2A 1QHHA 2C54A 4N0MA 4Q21A 1XB2A 3AM5A 2QTTA 2I4RA 4TTIA 5FNZA 3RKUA 3CNNA 2WE8A 3C97A 4QWMA 3RIYA 3H0CA 4I1IA 2B34A 3BHNA 1O9GA 5TPZD 3BMNA 3MW8A 2QRVA 4NZMA 1BCSA 1I51A 2IVFA 1WYEA 4X3OA 4LZWA 4EA8A 1JU9A 2RBKA 3S7TA 1Z6XA 2OFPA 3AHGA 4KRXA 4O02B 4ZTBA 2RGNC 4V3CA 3PB3A 4CR7A 1O89A 4N76A 2EBFX 4N8DA 4RA9A 1UOOA 4XUCA 4ZAVA 1ENYA 2P0AA 1KBZA 3A6HA 2EX4A 1ISFA 1SUBA 4YCDA 1Z62A 5EY5B 1KY2A 1PS9A 2PPVA 1G291 1JHVA 2P4HX 2V7WA 1L7MA 1ZOLA 3I9OA 4MYTA 5HUQA 3CEAA 3THXB 1T4DA 4ZHQB 2C20A 3ASZA 1FVHA 2O0HA 4C3UA 4TVSA 5ALFA 1UWVA 2RH4A 3RQIA 5CB6A 4M0MA 2WFZA 3OJEA 3KTDA 2PMWB 2JBWA 1ILWA 4UCWA 4GVXA 3TW4A 1QIKA 3B5JA 1YR2A 2BI8A 2A5FA 3LX8A 2OG1A 1L5YA 1ORVA 1USGA 2PEYA 3H1GA 3H9BA 3QXXA 3T3MB 2JHGA 5D7BA 3FMGA 1O3YA 1U2EA 3IXLA 1RJWA 1EWTA 1F51E 4OMUA 1Y8AA 1G17A 2Y0DA 5ALLA 4JKOA 4AUKA 1U1IA 3CKLA 1GGKA 3AR6A 5IH3A 4F46A 4NZNA 1D03A 2VNKA 4B43A 1M2WA 2BBOA 5A1TA 4K0KB 1MFPA 5BNFA 3UK6A 2EJTA 3NYRA 2FU5C 3E9YA 1Z6GA 2B25A 3B1XA 3P96A 5FT9A 4DQVA 4EHHA 1EESA 3A05A 4FYMA 4PX9A 1V7CA 2YN0A 4GPZA 1E1MA 2E37A 3N7UA 4ZIRB 1NMXA 4EHAA 1COZA 1V9LA 2H11A 2WU4A 3FTCA 2ZE6A 2Z09A 4P7FA 4YACA 1G9TA 1H93A 1THMA 1UFOA 4UDYX 4YEDA 1DFGA 2AD5A 3LOQA 3IQIX 1V2GA 4B35A 1ZK3A 3TEJA 3QV2A 2RE8A 4PZYA 5HS4A 2WHRA 2DUWA 1SXJC 3B1RA 2MTBA 1NAIA 2EJCA 4GKJB 3CZMA 2CCGA 3NV7A 4Q9LA 3TQOA 3JQ8B 5AXBA 4BPRA 1K9SA 3AERB 1RWWA 5LXTF 3SBOA 3FKQA 3IURA 3TK1A 1GUFA 2CVPA 2FG6C 2RG7A 3RS2A 1WB6A 1YIOA 2ZREA 4RDCA 5ICMA 4LC9A 5EIXA 4KANA 5GP1A 3VNBA 2VYQA 1P1CA 3PC7A 4PG6A 1JJFA 4EECA 2VSFA 2ZS7A 3T41A 2G77B 2YRXA 2P9EA 1W85A 2CD9A 1QKIA 4FN4A 1LBIA 4ZOCA 1I9CA 2QTWB 4ZEWA 5FD8A 3QKWA 4DBVO 3CGWA 3H5NA 3CZ9A 2VT7A 4MAMA 4O4JF 4ZKDA 1JX6A 4FJ2A 4JLKA 4OHFA 4R9UC 1ZRHA 5CLJA 1V8DA 4HLDA 3GFRA 1YB4A 4O3FA 4TQ9A 4XWGA 3IAFA 4MQUA 2CVHA 1I0IA 2GEVA 3RT9A 3LDHA 5K0BA 1QF6A 2Z3VA 2PZLA 5AVOA 4ZAFA 1SUAA 2ADMA 3N0RA 1IUOA 3AEXA 6REQB 5L3VA 3S8EA 4QU0A 5CW1A 4J03A 1X94A 4Z0NA 1MVNA 2R8BA 4YRMA 2O3JA 4X24A 2I6GA 3IEUA 5KYXA 4P3OA 2A9YA 1IJEA 3K9QO 1PSDA 1N2JA 2GZMA 5G1PA 5CDYA 1P5FA 4C3VA 3RVKA 3HJAA 1YGKA 2OM6A 5C8ZA 1P4JA 4IOJA 4MW9A 1RFTA 2P4UA 2CZQA 2OOKA 1P74A 2AFVA 4HNSA 4P3XA 4RKEA 1KAOA 5KNCD 3ZVNA 4IXNA 2H1OA 1Q2UA 2FX2A 3A28A 4FNGA 1N2CB 1TZMA 3EGXB 1UBUS 4P8RA 4TX1A 3V55A 5COJA 2EW8A 3LY8A 5AI4A 4ZVRA 1P1JA 3FPAA 2Q29A 5AKLA 3MJVA 1AU9A 4N7BA 1WR8A 2AYZA 5ALVA 3HDTA 2HT1A 5KKCA 4RZ2A 3KT8A 1RZ3A 3NBZC 3PK0A 2HCBA 4XARA 1YGYA 4N5MA 3WGLA 2Z3WA 2VNIA 5F9HA 4K05A 3JQ7B 1NBHA 3HXTA 2J59A 2VWGA 2Y1DA 1KORA 2LDBA 2AQIA 3QPWA 4KFSA 4DCOA 1AB6A 4EEZA 1OU0A 3CB2A 1RPNA 2XJ9A 2DECA 2OGWA 3KFVA 2OAEA 4RX1A 2R8PA 1P6XA 3T7IA 3VNVA 1Z68A 1IRIA 4ZGBA 2B1JA 2UAGA 3NJRA 1JZTA 3KZMA 5A05A 4RA6B 5EIHA 3MIIA 3TYXA 1UAAA 4LJKA 4KXLA 1D1TA 2WEKA 3OI7A 2B4AA 4HX9A 4NJMA 2JVJA 2R4TA 2ZI6A 2GQ0A 3MILA 2WUGA 3LW8A 4AK9A 1Z4JA 2VS1A 3HUFA 1CQIB 1V71A 3QZUA 4NQRA 5TF0A 4B48A 2RGXA 4C4AA 5JDIC 3K9LA 1VHLA 1AQLA 4U2FA 4QG3A 2AJLI 2X1LA 3KQWA 4LGCA 3STHA 2FG5A 2Q3JA 1YZQA 1ZY2A 3IP5A 2QRMA 3AT1A 5D01A 3H5TA 3NS7A 3SIXA 4TZ0A 3K2QA 1C9JA 4H3KB 1XMIA 1AO3A 4DWJA 5KU7A 1M75A 1PFKA 3UMJA 1W49A 2FMUA 1CUYA 2CMGA 5DM60 5K8LA 3GPIA 1OXKB 1VL8A 2A3NA 3TDKA 5IJZA 1ONBA 4B83A 1EFPB 4D3SA 5K1ZA 1C1YA 1L3CA 5K0SA 1XJWA 4MUEA 4N3NA 4H7HA 2GBFA 1V1SA 5B36A 2AOTB 4BVGA 2FPIB 4KN9S 4GZLA 4K6CA 5DGCA 5TJHA 5A4DA 1TF7A 4BJ5A 1QNLA 4A8JA 1XIVA 2CSUA 2LD4A 2GA9A 4P53A 1H22A 3QPCA 3ZE9A 1OE0A 4EMTA 3SI7A 5L3QB 1W88B 2VH1A 3OO1A 5J3JA 3GVHA 1PTKA 2P6PA 3K5PA 3TTWA 1E1RA 1XD9A 2TYSB 3MRVA 5BW4A 2Q9BA 4R98A 3MAGA 3EUFA 4XVQA 3GFQA 1XN1A 3MA0A 3RYFB 1JG2A 1K06A 4EOHA 3NWPA 2GPAA 1V5WA 1NDUA 2LIPA 3B2NA 3L4KA 2P2LA 1Y1PA 4DPLA 3DUFB 3EE6A 2R7AA 5HKAA 1IM2A 1Y9AA 3AEUA 3PP8A 4PZAA 5IBRA 2CUNA 1U8TA 1U99A 2QJTA 2ID9A 3L7BA 1ZVQA 2FWBA 2QM8A 4R7ZA 2J5QA 2YICA 1L0BA 1SOMA 2JIBA 3Q9LA 1QVRA 2DX7A 2JFPA 3QY0A 4RL4A 3WG9A 5FLXA 3OICA 3LC7O 1NXVA 3LFHA 4G0YA 3O4VA 3K1YA 1IZZA 4DJFC 3IV9A 2V8BA 3TVTA 2QRKA 1E79A 1W59A 3F8SA 3VOBA 4F1WA 3TO5A 1V5EA 2O5CA 4BQPA 3E2IA 5AVYA 3HNRA 3U37A 3HO8A 4YXFA 4Q9AA 5CU7A 3DO8A 3I39X 2O3SA 2RMKA 5FH9A 1WD7A 3BK7A 1FU4A 2ZWAA 1B6GA 3BL8A 4DKXA 4DRYA 3RC3A 3RIXA 3L7DA 3WL8A 4RADA 3UM9A 4EKIA 4KQ2A 4NCHA 4PM4A 3ZWPA 2N0SA 2H8KA 4MR7A 1G59A 2QYHA 3A4VA 1RJGA 1JEQA 3UJ9A 4HV4A 2JB9A 3QKRA 3NHRA 1LV8A 1Q3KA 3DULA 4BATA 4FDLA 3D8NA 1N5LA 3QEKA 4QD3A 4RV4A 2ST1A 3VR6A 4X0EA 4CKEB 1B6RA 2B2CA 1BX4A 4YAKA 4ZT6A 3K9FC 4D9JA 3NRBA 1P9NA 1DEOA 1W0KA 3F7MA 3ZD6A 3TH5A 3WL5A 4MP6A 5K2MA 1U2TA 2P2CA 1CRWG 4HAZA 1IONA 3QKIA 4P98A 4GLFA 5K6TA 1Q17A 3RKSA 4AKEA 2C49A 2YW9A 1UL1X 4C21A 2QD2A 4EL0A 1CYDA 2PXCA 3FAKA 4S0ZA 4J1TA 4KQHA 1F60A 2C4HA 4FT4A 4RZQA 1MRZA 4TSFD 5DYTA 3QITA 2XUQA 3R0QA 1XPJA 3VZSA 4BNUA 2R8YA 3IPRA 1Y4AE 1QB8A 5ERXA 1CUGA 5JLJA 2GCNA 1UBEA 2VCEA 1UDBA 2EZUA 2H2FA 2VHJA 2WU3A 4OCZA 3T3DA 4O2AB 1ID1A 3HB4X 5ALDA 5AQ1A 4GC9A 1N0UA 3R6GA 2E0IA 1YQUA 3SAJA 3K0SA 1E2QA 4EELA 4B76A 1FRVA 4ER6A 1ZXBA 5CCBA 5AHKA 1ITZA 3D8BA 1U0LA 4QQRA 1IJKA 2AN3A 1P62B 3CJTA 1D07A 3EEYA 5L4NA 5MFZA 3Q8KA 3GP3A 3N3AC 4ZVTA 1NTOA 3H1AA 4FOPA 1LVGA 2VOJA 4P80A 2CXRA 1RJ9A 2OHHA 2PFSA 2WIGA 1RNLA 4DA7A 1XOIA 2V3VA 4CQLA 2XCLA 1PT6A 4RHEA 4EO9A 4BRUA 3F1LA 1G8KA 5H7XA 1NC3A 3SPXA 1ECLA 3JQBC 1A9SA 3AC0A 3QKSA 4LEIA 4M9RA 5EWMA 3KXLA 5TPWB 2FV8A 3TLZA 1YJQA 3ZDZB 4ACAA 3K6SA 2A0YA 1GZ7A 1W19A 1RZVA 3BQNB 4MR9A 4K7JA 4M7PA 2Z6AA 2HQOA 1HZZC 1SQ0A 1YB5A 4IWNA 1TF2A 2VXCA 4COKA 8GPBA 5KMGB 3OE1A 4KDRA 1LHRA 2O52A 3TLMA 3M6VA 4PS0A 2BBWA 2B4YA 2CD7A 2V0CA 4QYMA 4TS4A 3HYOA 5KWIA 1RPTA 4KNWA 3JALA 4I5FA 2IHYA 3PRHA 8OHMA 1IRXA 3U0BA 3KS9A 3L9WA 1UIMA 2Z3ZA 2ZYUX 2DGDA 1NBMD 1QLHA 2R6R1 4Y18A 4PHFA 3ZHQA 1E5TA 1LA2A 3IOEA 2O3TA 2NYVA 3LBHA 3MLEA 3MS2A 5KHAA 4OB8A 3UHOA 4DRXB 2X9QA 3QVLA 3ZWYA 2ZU6A 3D9QX 4JQSA 1Z9BA 2HQ1A 2OK7A 1FXWF 1DAKA 1D4OA 1T9CA 5CM2Z 4EKYA 2L18A 3MGCA 3QLEA 1QKKA 4O2BB 5JNSA 3F2IA 3RWBA 4LZAA 5B53A 1PT9A 5BYEA 2IYFA 3QUAA 4JENA 1WCXA 3DW1X 1A82A 1RLMA 1ZM4A 2I1LA 3A9SA 2OO5C 3G2IA 2AE1A 4RFSB 1G5IA 4CG1A 2REOA 2CMDA 3KHSA 1D2MA 2C2WA 4P7GA 1PNVA 1SQ6A 3L41A 4WA7A 1N3YA 1L9XA 2CEKA 1EZZA 2CUKA 2ONCA 1KC1A 2WP8J 2Z2KA 1FNBA 2WVJA 2WJIA 4DV1B 3ADBA 2EW1A 2XMSA 1RFGE 4NZYA 4N8EA 1GWNA 4ZQGA 1QMGA 3MT7A 2IZOA 4KUHA 3PXDA 1EDDA 2Y8EA 2EU8A 3B9RA 1KZ9A 4Q4AA 3BBLA 3KC2A 4E22A 4BFXA 2R4QA 1R0SA 3IVMA 3OU2A 5KUTA 1E64A 2N42A 2ZRGA 1PEDA 4BBJA 3W2FA 2IYOA 3I5AA 5JD5A 2A2ZA 3ESCA 4NCXA 4UMEA 3QYPA 4N5LA 7MDHA 4QECA 2FPSA 3RADC 3LJSA 1UBCA 1KDYA 4UMFA 1N9GA 4ZI7A 3FR8A 4B40A 5LZ9A 3OZFA 4F92B 1UZAA 4D46A 2EGUA 5JG7A 1TE2A 2MT9A 4PEVA 4ERNA 3SYTA 1II9A 1U8XX 2ZIZA 3T4PA 5G0WA 4EW3A 2K7FA 3BWXA 3VU8A 3H9CA 1SBNE 1ZUHA 2Q6IA 5EUBA 1EWVA 2P2YA 3FWPA 2P78A 1M1XB 1GP2A 1W8DA 4WWHA 5F2KA 3ZM6A 4F11A 5FEMA 3BWYA 2FMHA 4V2IA 3ZHRA 1B2RA 3WV5A 2B20A 5B6JA 3HYSA 1YBMA 3COPA 4V0QA 1DG3A 1AC5A 3C6XA 4LJ7A 4QPPA 2QA5A 2OCLA 5AFSA 1HOXA 3QE0A 2XNJA 1Z33A 4C0KA 2Z58A 1ZD8A 2GYYA 2QPAA 2ZGVA 5AHXA 1WCYA 3NHJA 5CVVA 3TB6A 1WZEA 4RH3A 2BJHA 2B83A 1H66A 3K96A 1H6DA 1Z26A 3RC1A 3VO8A 3GPDG 3AVOA 3IDFA 4KX3A 1E1YA 3R4CA 1QRSA 3UAXA 4G0UA 1DC8A 4Y2VA 1QYVA 4PXYA 4M9QA 3K16A 1R2QA 1K2VN 3RHFA 4XW2A 1YZLA 4DY4A 3LRXA 1S0UA 4H6PA 1MENA 1MVOA 4JUDX 1AKMA 4YAJA 1I01A 1IXYA 3HC7A 1L8QA 3IH5A 2V6FA 1AY0A 3QF4A 4KR3A 3CM0A 3OZEA 1SO8A 4NMXB 4D9FA 3TGLA 4EAQA 2BUBA 3BKXA 3GT4A 3CVWA 3IBCA 4KO1S 3N0WA 4O2AF 1CG6A 2B99A 1XU7A 4IDBA 2PMBA 1M1UA 2HCFA 2JBAB 5HR5A 3AL0C 1C30A 1J9ZA 1HG1A 2TRSB 3AIOA 1IBCA 2HW8A 1GRNA 3RG8A 2J48A 4G09A 3TL2A 4NNJA 1E6EA 3KYDA 4ZVSA 2XH8A 3KVRA 1CNEA 3DAYA 3IDAA 3QHQA 3LJKA 4HDKA 1L1RA 4PHGA 4PLVA 4C0JA 3IT2A 4C78A 3HYCA 5LKAA 4NL4H 4D80A 1CY1A 2BFCA 3R7BA 1AKRA 2XB4A 5C53B 3DCYA 1WHTB 2QVYX 4D8YA 3FUVA 1MXHA 2YJTD 2JW5A 3KFXA 4FMCB 1P77A 3UENA 5DTEA 4EMSA 2KYRA 4RYLA 3NNDA 4KLCA 3P2JA 5BPHA 1L7VC 2ZJ5A 3L5KA 4G8DA 2L82A 3P94A 4YPVA 1IUPA 5KVSA 1WMEA 4FXPA 3ZS8A 5T8KC 3PD0A 3FSGD 1R3DA 3UJHA 1MB0A 1XD2A 3MD9A 1ZP6A 5D84A 4FS3A 3U4AA 2PZMA 5EZQA 3W06A 2I6FA 4OLJA 1UBNA 2ARKA 2FEWB 2J30A 1WF6A 1UT5A 2UKDA 3FOEC 5F3WB 1V4VA 1I0LA 1VLVA 1JG1A 4YRKA 1FFYA 1IAVA 3IXMA 4L5JA 1HA3A 1WOYA 1IMOA 2I9PA 4R51A 2WP0A 2OHOA 1AVTA 1Z39A 1AD2A 1RMYA 1T5DX 2VJKA 5JCJD 3J80A 3N2ZB 4KSYA 5AVQA 1QHGA 3LT5A 2AQHA 3NM6B 1AS3A 1WEHA 3FTNA 2BMJA 4TM8A 1MF7A 2Q99A 4U2DA 4XWAA 1TQ8A 2W90A 2YNMA 3QEJA 3VOSA 3TSOA 5JT1A 4KYVA 1E69A 4ACBA 2N9UA 3EW7A 2F62A 4C4PA 1QDUA 3LDFA 1QTRA 4DM7A 3ESDA 1UK8A 1OFTA 1X0VA 5TT0A 2RGYA 2B21A 1NUSA 4B6SA 5COBA 5EMMA 2J46A 4CBVA 1FTYA 3FVWA 3L1HA 4BNYA 3SIWA 1CDEA 3IRVA 3OAAD 5DLEA 5CD9A 1MJFA 2DHEA 4CU2A 1UFRA 1IHPA 1Y3DE 1GIAA 1Z45A 4EOGA 4UDOA 4WJMA 2OLJA 2OQVA 4GSKA 3DBHA 3G5AA 5HQ3A 1XUOA 4N1AA 3C41J 4QO8A 1ZVKA 4U2CA 3N05A 4M0PA 4Y2HA 2XZLA 5GJVC 1SK8A 2B36A 4PCVA 4MWZA 4EUFA 3UMGA 1JSZA 3TN7A 2GEKA 1GM5A 2PGOA 1NF9A 1TAGA 2OFFA 4C5BA 1KQFA 4BNFA 1A7JA 4II2A 3GEMA 3JYPA 4A6XA 4B3XA 1Z0DA 2Q8QA 2YJ4A 5FIUA 1NYLA 5EYPB 3TPZA 1D6SA 3HACA 4MWEA 4FD3A 5J9FA 4BGIA 2NIPA 1YR3A 4LF9B 2WD8A 2ZRIA 4RHXA 3EYWA 2VQEB 5IXSA 3EDOA 1CHNA 4DJAA 2IH5A 3QX9A 2X5KO 1V8PA 2WUWE 1WMFA 2EQAA 1IUKA 1HEYA 3OZDA 4JC5A 4XKJA 3V6MA 4YXWD 1IIBA 3CEPB 1QV9A 3TBFA 3T5CA 2PLNA 2HIMA 3WNCA 1O0CA 2IV2X 3DE1X 1TZ6A 2GZRA 1GN9A 2P7IA 2PGXA 4FB4A 4L4ZA 2FN9A 2LCFA 4JBXA 1QX3A 1XJ5A 4YCSA 3ESAA 4V1CB 1DJOA 4AC9A 1L5WA 3FD8A 4MROA 5BSUA 3O75A 3O7MA 5BVGA 3H97A 1DEXA 1I4EB 2DFTA 1BWPA 1V95A 1E59A 1Q0HA 2W6OA 4K9CA 4KLRA 2QJRA 5BSWA 1E58A 2FN7A 2FLWA 2XOKD 3FROA 4N01A 5CP8A 4CIDA 3KBBA 2XTNA 4IG9A 4L8VA 3C8ZA 2Q9AA 4RQUA 1TQ2A 2BFFB 3CTMA 3D3KA 3RBXA 1RMTA 4M21A 1WWKA 2XCQA 4UZFA 3VAQA 3GP8A 2H9YA 4TL6A 1NZDA 2JIZD 3OWHA 4OHOA 4IHJB 3E9QA 5ALJA 5LN1A 3OIWA 1QRUA 4A03A 1R8JA 1X7DA 3OQBA 5TMBA 4Y98A 1S96A 2HAEA 3W5HA 3VFDA 4B7XA 1KIMA 3MQ4A 3CG4A 3V33A 1ZI9A 1MX5A 3HADA 3B7WA 5EWLA 3R75A 4INOA 1KSFX 3H75A 4DF3A 2H4XA 3SC4A 4MW7A 4R71A 5KNLA 3IUJA 3H5IA 4W8OA 3VO1A 3TX6A 3D8HA 2JF0A 3T95A 4ENSA 2QM0A 1BXRB 2DT8A 2XDWA 3F49S 1G21B 2KB0A 3TI9A 3VSCA 3R7SA 3ZXSA 1EGVB 4AECA 4EY8A 2H3HA 1KBOA 2HM7A 2ZJ6A 3DV0B 3IKVA 3LT4A 3OSZA 5KTYA 4FPXA 4GOMD 2WPDA 4JP2A 2CV0A 3FETA 3CUVA 4F2WA 2QY6A 2EOAA 4FMCF 4MRMA 1RT9A 3BMCA 4G26A 3U4IA 3QFCA 2GFHA 4PSAA 4UHJA 2CDBA 4BX0A 3USZA 2MCFA 4NSNA 2ZK7A 2RDMA 2YTZA 3BMNB 2QRVB 2IZ5A 3OFVA 5F3DA 1BCSB 3PRYA 2I9KA 2C2HA 3JZFA 2NADA 3GX1A 3IL2A 2ZXUA 1QHIA 2A9QA 3JVEA 3LQYA 4MV3A 1STOA 4E21A 4WK6A 3I42A 2Q4OA 1RYDA 2PN1A 2RK4A 2WAMA 2NM0A 3ILYA 3NTRA 3PI7A 2RI6A 2O7NA 2JC3A 3QEOA 5PGMA 1HFJA 4EO4A 3B5EA 5JJKA 4GWKA 4JLPA 4HNUA 4O25A 3AUTA 5JS8A 3EAGA 1D5WA 4ASUD 2G6TA 3I32A 4B4KA 2IYNA 2CLOB 3VNQA 1I4OA 3CF6R 3UZUA 3NI2A 2ID4A 3NTXA 5LR6A 3HSSA 2WKPA 3EDYA 3RT1A 2QUHA 3BX1A 3INYA 3I64A 2AR7A 1NNSA 2OLEA 3I2JA 1U04A 2HOQA 1M1YE 4BQRA 3OVMA 4LHYA 2HN9A 3A6KA 1ZONA 3QOWA 4IY1A 4UUMA 4Q9NA 4R3WA 1QH8B 4YJKA 4BNMA 4YJ2A 3NYWA 1NQUA 1WTCA 1QO0D 3KYJB 4DSZA 3WLPA 2R8OA 1N1DA 5JO9A 3T3EA 3TNYA 4GKKB 3VPHA 3OHSX 1SCAA 5INTA 4DN6A 1YU9A 1CY6A 3QEMB 2VUIB 1TIPA 5A04A 3HKEB 4JOQA 2VHYA 1RI1A 1YR7A 3MAAC 2VAWA 1YVPA 2WSLA 3GJ6A 4GR9A 2F67A 3OZSA 2H2WA 2O59A 4KIFA 4UEOA 3OKAA 4XVHA 1D1PA 5DW3A 4YUVA 1XTPA 2BVNA 2EF0A 1U9YA 3CLHA 1M33A 3GMIA 3NTQA 2ZI9A 4MGZR 4U3JB 1TUEA 2B92A 4JROA 3I9V6 3JYHA 3NFYA 3UYKA 1GRVA 1GDDA 1KYXA 2XKAA 3CLUD 3SQOA 3SSMA 1A1SA 1HWYA 3KU4A 4CTJA 1XMQB 5LSAA 3C45A 3BG5A 4RS4A 4MW1A 4WCDA 5J1TB 5YASA 2PX6A 1M2GA 1HLDA 1OX6A 4H9GA 4JBHA 2GZDA 5BW5A 4XWOA 1K8RA 2K2WA 4QAQA 3M4JA 3JTMA 3OIVA 4Y2JA 1X1DA 4CMEC 2QRZA 5I4BA 2ATCA 1XAGA 4NCNA 4WBXC 4BWFB 1DX9A 3A4IA 2I6SA 3DNFA 1FS5A 4IHAA 2MYNA 3O74A 3LDUA 1XV5A 5ALUA 3FOZA 1RP7A 4OATA 2R3BA 2XGMA 4MPDA 4RVFA 2QAIA 3AV0B 2GD6A 2VJNA 3BB3A 5L95A 2M6KA 3RJMA 5JJIA 5TSDA 1W85B 4QUAA 2J9XB 2F1JA 4LXUA 4TQUS 1W9MA 1LVUA 2MYUA 3HFSA 1IBKB 1TC2A 2WJAA 1OLSA 3MB5A 4MCAA 3BE4A 1WPXA 2FSHA 2OMEA 4TXNA 3H4VA 1V9CA 2WQZA 4U02A 5TC4A 1JG7A 4YV7A 4QZVA 2EDCA 1CNFA 2GC6A 1E6UA 1PGQA 4EYQA 1LPSA 2IVZA 1B0PA 2EG9A 3PEUA 1Z7EA 3AZQA 3IBYA 4KTVE 5GVRA 3WYDA 2V7XA 2JATA 2PQ6A 5CM8B 4NABA 1U0FA 1MG0A 3HL4A 5CIWA 5EKDA 1Z8NA 2DR0A 1A5BB 4D0RA 1KMHA 5DMHA 5KYXB 3A2KA 3FPGA 5HQTA 1LLFA 2H1CA 4ALJA 1GRCA 3VA7A 1BE1A 4IHJF 1UKZA 1KZGB 1FP2A 4D8WA 16PKA 1LF5A 3U19A 4R1SA 5FL3A 3TOCA 1WMDA 3UQYS 1NM5C 1Y3CE 1ATZA 3NAMA 3OPYA 1M6NA 3FYSA 4BVEA 2D4HA 1W7AA 1D09A 2HDOA 2DR3A 5KYKA 4M1KA 1B8OA 5C8XA 4GOJA 1FNSA 1LIKA 3ADDA 1JMVA 1Z0FA 4M7RA 1J33A 2MDTA 2XVMA 1SULA 1G5HA 1D6MA 1ZSYA 5FQOA 1JUDA 3EWIA 5IKEA 3HCAA 1CS0A 2I2AA 2XMRA 3EEQA 4CKWA 1CLEA 1I1QB 1YBHA 2JGFA 5JISA 1TW3A 2IEBA 3IOCA 3LCJA 4QUEA 4LS3A 3HPRA 4FONA 5DM0A 1O54A 2X1MA 2F1HA 4GI1A 1BGVA 4IEIA 5ICCA 4ZN6A 2WT4A 3NDBB 1JG4A 2PTGA 1JDJA 4OQEA 3JASA 1QMPA 5C37A 1ACLA 5G1OA 4FR0A 3ELWA 2GBLA 3FFAA 2GWRA 2RJ3A 1LH0A 1ZCBA 4ZKEA 2NPFA 3AVQA 4EG3A 5LDDC 4H35A 4FJ0A 4CMKA 4W5NA 1NMYA 5JBQA 4IFIA 4PHHA 4NJMB 3ZTTA 1Y6GA 1SC3A 3ZHXA 1XCBA 2DPXA 2BSQA 1JIKA 3BSWA 2ZRJA 1J70A 5LYYA 4E4TA 3EQZA 4MPJA 4A36A 1EX6A 5AQEA 2PU7A 3LBNA 4BJ6A 1KAHA 4RMJA 1ULBA 3FNEA 4F21A 5HYVA 1EWKA 4HK4A 2VTDA 4BQOA 4J0DA 3PNVA 1AJEA 4W5RA 4JFAA 4EHNA 4NK5A 2DFDA 2EWMA 2PV7A 3LLVA 5KEIA 3IKJA 4G97A 8MHTA 2BGNA 1PU2A 1WZ2A 2J33A 3PXEA 3FR7A 5FR2A 4DVJA 2HLNA 3RU7A 4L16A 3SZOA 4F8JA 2P77A 3KKMA 3VKVA 3R5SA 1UT6A 4PXAA 4E3ZA 2B94A 3FI0A 4BKUA 1ZGBA 4BV8A 4IQFA 3VBCA 5B3LA 4A8JB 1E2JA 1OC4A 1GLVA 4GQIA 5K01A 3ED5A 4GP9A 1ISHA 1UINA 4LGVA 3ZK9A 1B76A 1B8VA 3F1KA 3KB2A 1W75A 4AKTA 2QG6A 1WXFA 2J6BA 3GPBA 4X62B 4RZHA 4Q93A 5AR1A 4Q4DA 4CR6A 5B6PA 4K6OA 1M5UA 3AUJB 4YASA 1VLJA 4W1PA 5CFLA 3IKHA 3UAZA 3COSA 1EXMA 1FLVA 2L19A 4PFQA 1K2WA 5E9QA 4FFOA 4Q7EA 1N1GA 1UBGA 1K7SN 3GEHA 2YDYA 1S8FA 3AEUB 3FBTA 3E03A 5FOWA 3U7RA 3BZUA 4GQBA 4J4BA 4ZVOA 3SIRA 3D6HA 3L6EA 3D2LA 5FPTA 1JDTA 1M2JA 3DDUA 5EI5A 4CDNA 3OM0A 3KKEA 2DCUA 5I47A 1FMTA 3WX0A 1G64A 2ZJ0A 1AXRA 4PWZA 3RSFA 1BWQA 3KKNA 4YDRA 4DG5A 1ZG3A 2QIOA 3DWIA 5JEDA 2O2CA 1EFUA 2FP4A 4BJHB 2AA3A 4B45A 1NVGA 1L1QA 2QI9C 4I9NA 2C99A 3UB4A 1V0JA 3BXXA 1RTKA 1W581 5KKAA 4DZTA 1E3TA 5JYBA 2BW0A 3DB1A 3KHKA 3MGKA 4GMHA 3H5LA 4M89A 4NNPA 2HJ9A 4KE6A 4RHUA 4WDRA 5MDHA 5DO9A 3K2IA 4E5SA 5DHFA 2CL7X 5TQJA 2EBHX 5EP3A 4HGYA 3IMGA 4BO1A 4AX4A 4HWOA 3FTQA 2R00A 2P1ZA 2DHCA 2XTZA 3NIBA 3WLEA 2A9RA 3ZDBA 3K4QA 4MR7B 5DGDA 3JZMA 2QTVA 2J3LA 4OHMA 1YDHA 3P9KA 4X20A 5DYWA 2QNIA 4FYYA 1XQWA 3SYRA 2VJCA 4P86A 4B6RA 5EIOA 3FNRA 1TEXA 2NSHA 4BFWA 1NUAA 1PTJA 2AC7A 8AT1A 4D0NA 2E1PA 2FFQA 2I3ZA 2X7JA 1QVWA 2C3MA 3NW9A 4FEYA 2QMUA 3PC8A 2XEXA 3M3DA 2H2DA 3LBIA 3OUUA 4BO6A 1M8KA 3P1JA 3QCZA 3D5QA 2REXB 2BE9A 1Z22A 5DXAA 4BWVA 3NBFA 1V48A 5A4JA 3UMMA 4CETA 4DV5B 2ACKA 3IV7A 3NJ4A 2HA0A 1KFJB 2A6PA 1FFEA 3AILA 2C42A 1JDNA 3IUBA 1Y9DA 3NBAA 4INAA 4LDJA 4NG4A 2P8SA 1JIQA 3JQ6A 1C9MA 4HGNA 1JVNA 4ARBA 2A9JA 5H02A 2PD3A 3R6LA 5HBGA 4IZ6A 1YVUA 3U7JA 2QNRA 4R0VA 4D44A 2G1UA 5BV8A 2FE4A 4MGIR 4ND1A 1KOFA 4L02A 2PFGA 5BR8B 4YDHB 1UMBA 3EOBI 4W63A 1CJKC 1T2NA 2HIHA 2WFLA 1PR9A 2Z2ZA 1SXPA 3ET5A 3WMXA 3G1UA 2V78A 4MPPA 1S7CA 1SVUA 1ZK1A 4MP8A 1XF1A 1ZHHA 4F8EA 1FLNA 3AIMA 1XCJA 2IGBA 4D4HA 5K0CA 5LDHA 2XBMA 1IN8A 1TU4A 4ZO4A 2OCGA 3WLHA 4Y30A 4KMMA 1MKYA 3KD6A 1H4VB 5KOHA 1FMFA 1WHSA 3KJZA 4LCBA 4DG8A 4F4DA 1RJ9B 4A5OA 3E9DA 3D5TA 3JXEA 4CV3A 1LZLA 1X7GA 4BTVA 5EGSA 4U7XA 2Y1OA 2WJVA 3JWJA 5LP6C 1A7UA 3QKSB 3TEMA 1W8IA 5JVDB 5EWMB 3SHQA 3T15A 3K6SB 3EZGA 4MYHA 1SG0A 3EEFA 3P2IA 2HO5A 1BWRA 1I36A 2CXHA 4MR9B 1IJBA 1JSCA 2BFOA 5I4IA 1GTRA 1GL6A 1DO2A 1GZ4A 1TIBA 3H18A 4AYXA 3RTGA 1SB9A 4UM5A 4DLPA 1E3QA 3ZWMA 1LPOA 2OC4A 3AQ4A 1Y6QA 3IVRA 2OA0A 1MO2A 3MCZA 4D3ZA 3I2FA 1E1RD 3SVTA 4Y2QA 3F96A 3JALB 4YGYA 1PJQA 2FW0A 1A98A 4Z7NB 1F8YA 2X3UA 2I4TA 4YRIA 1GCGA 1WCWA 2WVAA 2HHAA 5C8YA 1G9XA 5IANA 1VLQA 2B1IA 5AJZA 1ECFA 2BGTA 3LUFA 3NRJA 1T29A 1WQ4A 4IIXA 3ZI7A 1N5RA 1R50A 1DWQA 3O1IC 3GJRA 4HAWA 5LFAA 4OV6B 2BD0A 4J75A 1GPUA 1PO7A 4G5SA 1C2TA 2PLAA 4JJAA 4RL6A 5U4QA 1GT6A 2PUBA 2RGNA 5F5LA 3I2GA 4BMSA 1Y81A 3TM4A 4LVOA 4U2BA 1J42A 3PXUA 3OHMA 4NI5A 1CY0A 1E79D 1JJIA 1HTWA 2I7CA 2WA2A 3P5SA 3TS1A 4A2PA 3C7CB 1KNQA 3FYDA 4UAGA 3SX4A 1OXXK 3O0TA 2ZPUA 2V8OA 4CLHA 1K7YA 3PGJA 2V0GA 3NJ8A 5FEUA 4N41A 4A1FA 3ZV4A 1PQWA 2Q3CA 3FZYA 4B1FA 2V9ZA 5DLYA 3WB1A 3K35A 4QPNA 2HB6A 4LZPA 1KI2A 4LV6A 1Z2AA 1TJNA 3EBOA 4HN2A 5IDVA 5IT5A 1Y7LA 4P5EA 3MRSA 2O2ZA 5K0TA 3AOEA 2ZBPA 3N59A 3HEAA 3V32A 2NU7A 3ANNA 3QHAA 3VR6D 2R1TA 2AN5A 3N39C 4KWCA 4EI8A 1B74A 3WLJA 4K9IA 5DULA 2AUMA 1Z0IA 4JYPA 4OI2A 3FI9A 2ZVPX 2PAAA 4Q3KA 2FR1A 5CT8A 1GUYA 1OY1A 2CZGA 1N9GB 3OJ0A 1E2IA 3GA7A 1W0KD 4XQGA 4ZI7B 3I3YA 5HUJA 5AK0A 4GE3A 2HTEA 1PEKE 3OD5A 1TAHA 4I66A 1CY4A 2R3EA 1L4FA 5IN4A 3K0AA 2OXFA 4BNWA 3MJEA 3TZQA 1NJ6A 3FOBA 4BGUA 1QV6A 4RY0A 3L0BA 4IVNA 3QXGA 2HHCA 2VA8A 2ZJ4A 3IILA 4IMPA 4MWDA 3UN1A 4N9WA 3EWAA 4ETNA 3ZCSA 2DOKA 3DR5A 3U3JA 3I9LA 2GUWA 1WQ1R 4DOMA 2C29D 1J22A 2DVMA 3V9PA 821PA 1YS1X 3K4HA 1FUEA 2R8ZA 3PU6A 3BFVA 1XZBA 4K0RA 2A58A 3Q7EA 2ZIFA 4LRXA 3NL2A 2DT5A 1MRSA 5E1MA 4UDNA 1T2CA 5IAEA 5T4EA 3T0FA 2AZ4A 621PA 1T9DA 5I9MA 3ITDA 3ONNA 3DE5X 1T4CB 3ILSA 1IB6A 1BVHA 4R1QA 2H51A 3VVLA 3VRHA 3BL6A 4XM2A 1XCGB 4ZOEA 1E4EA 5E6RA 4AG6A 1VI2A 1VPDA 4RXMA 2H1HA 2QLJA 3A4TA 4GPTA 1N5MA 3M0EA 2JD2A 4Q48A 3QG5A 2D2VA 3WAKA 3IHKA 1O8CA 3FMOB 3LXRA 2ORVA 2Q5HA 5H16A 3QF4B 3PQ7A 4L6CA 3ZU3A 1EFVA 1ZUD1 3WLFA 4E13A 4DEYA 4CQMA 4KO3S 2BFNA 4OIMA 4UHEA 4N6NA 4ZIYA 4LRSB 5KJ6A 3B1FA 1U0JA 2D8AA 1G8PA 4NS4A 4RUKA 4DSUA 2GCBA 1C30B 4EZIA 3SE0A 4XJSA 2ZTSA 1L7BA 2CNBA 1XK6A 3KUXA 3U3KA 3FNHA 3KYDB 2G36A 2WVGA 3X1KA 1RQLA 4HDKB 3CWCA 3NHWA 1NN0A 1DSSG 2BM9A 2BFCB 1EJ2A 2IP1A 4FEGA 1BMFA 4MJ3A 3ZR4B 2WWXA 2V6MA 4E08A 1UBTS 1IHXA 4DLZA 2PZAA 3P26A 2ZBVA 3SDSA 2QEQA 1OJLA 4QOHA 3G2LA 4B7UA 3I76A 2DPYA 2ZRDA 3ZBPA 4CG0A 5J43A 1XD2B 1ULSA 1V5FA 1WVMA 2R86A 1SVLA 3UGKA 4DA9A 3QIVA 3JQAA 3SFZA 4B8WA 2XJAA 2QQEA 4X9XA 3I01A 4FFBA 5HRCA 4BCCA 5LZ5A 1G0OA 4JY7A 2NSYA 4X8OA 2A0WA 4G5YA 1FPMA 1NHGA 2ZB7A 2NACA 4PYJA 3AR5A 2QUJA 5HK9A 4ICIA 1UC9A 4H7PA 3JYOA 3WXBA 1IH8A 3W5CA 4TQGA 4X6YA 1ZLXA 5AI6A 4ZD6A 3R8FA 2FSVA 4LJ5A 3M9LA 2Q2NA 2OXIA 1RLOA 3K71B 4RTRA 1HK7A 1GA1A 1WQ3A 4M60A 3W5AA 1NDHA 1U63A 4FVTA 3FOFC 3AWIA 3NTOA 4C88A 2JD1A 2DKOA 5H0IA 3PJFA 1LBQA 3NWBA 5CFMA 3ICEA 1GQRA 3CPSA 4G5OA 4Z5XA 5JSZA 4KWTA 2ZFUA 4M8NE 5JDIA 2AN9A 3X1ZA 3K9WA 4RCZA 1RWXA 1NOIA 2G07A 3OOHA 4JP1A 4WCFC 1CPYA 3EY9A 2WHXA 4EBBA 3M6AA 3ZWCA 4IILA 3URMA 3V8NA 1CRQA 1F5SA 5E3HA 3IELA 3M1IA 3KTFA 3MD0A 2QOEA 3UK2A 1G7CA 1PN3A 1UZNA 3DBHB 5FUXA 4J49A 3ZCUA 3BGOS 5HQ3B 1OOEA 4QM6A 2MSEB 1F5NA 2A7XA 2QT1A 1JLHA 4RTPA 2O19A 1OPRA 2AV6A 2YWHA 5FAKA 2FRDC 3OQNA 3DBRA 1UF9A 1ZOOA 2PGAA 5IAKA 4IFBA 5BWMA 2WSSA 4JBYA 1QFZA 3Q1YA 4NEQA 4F71A 1EP9A 4HRAA 3QVKA 2QW8A 2OGZA 2RAPA 1N4AA 4IQ4A 1N6RA 4BRSA 1NP6A 3V4LA 4RTNA 1IN4A 4IIJA 4BMCA 3WL6A 1D5CA 4LX0A 1A0OA 3AINA 5B58T 4DM4A 1MIOA 5E6UA 2AOUB 4XTRA 1ADJA 3C3PA 5KNCH 1A1VA 4MW2A 5L7TA 4Z4HA 3PIRA 2I91A 1B73A 1CKEA 3PEWA 1UKCA 3KQPA 3R4VA 4NV1A 5AKIA 2ZEJA 1SKAA 4LZOA 1MEOA 2RHHA 4ZI3A 4XSGA 1DUVG 4K03A 3ZWVA 4FW9A 4DDMA 4G23A 1M0SA 1RHUA 1TEHA 5BVGB 2YN4A 1GFWA 2Z5VA 3QVVA 1YL7A 2Q5LA 2BZ0A 2CVZA 3C6MA 2ORIA 5B1SA 3RABA 2BUAA 1SXHA 1ZINA 1E99A 4EUKA 3UK1A 1VL5A 3L6UA 6LDHA 3K9HA 2WQ6A 1HQDA 5AVVA 4KLNA 4N6GA 3C7DB 3DL0A 2XE6A 3PC6A 4XOUA 1SVWA 1MT0A 2GLXA 4Z9YA 3UB3A 1G66A 1MX9A 2GVNA 3M9XA 4Q7KA 1Q15A 5KNDA 1SU7A 3W2GA 2WLTA 3MEQA 5IT0A 3DEJA 3SYNA 5LQMA 4WZBE 1L5HA 3ND5A 4PAMA 2IW3A 4F3TA 2PYDA 3IAS6 1OWLA 3QPAA 1PZGA 5KINB 2V3CC 4R1NA 4CVNA 5FUWA 2IF2A 2QROA 1U65A 4BV9A 3GRCA 5DNCA 4S12A 1NA5A 1W36B 2ZJ3A 1JH8A 1M2OB 1KI3A 3WQQA 2NO6A 1EX9A 1XELA 2PZFA 1QO7A 3P2KA 1CQXA 1GNQA 2VDRB 4HUQA 5EWLB 3CZCA 4BN0A 4XIJA 1CJBA 1L8OA 1VHTA 2A9VA 2DU8A 2C3PA 3MMSA 3PVZA 4FLEA 4FOTA 1CLUA 2C7BA 1IWBB 4L15A 4AY5A 4EHLA 5SZHB 2PRIA 1GXSA 3OWXA 3A3PA 1UP6A 4KOEC 1DIBA 3WGIA 4GIBA 1E92A 2GS9A 3MS4A 2PJUA 5ARDA 3MINA 4R31A 5HS6A 5IJAA 5ILQA 5L3ZA 1Q1NA 1CIVA 4UQLA 3GN2A 3U56A 4LF6B 3CZ4A 4F4UA 4X3PA 4DDTA 2AXPA 4FINA 4MGHA 2UYGA 3WTCA 3MYYA 4JQCA 1L7NA 3C43A 4QWWA 2Y6UA 2P8JA 4HDQB 3COWA 4LSWA 4F4JA 1L2LA 1E2PA 4MRMB 1ZX1A 1OA0A 3BMCB 3H1EA 3GCXA 5F7XA 4C4RA 5JSUA 1D6JA 1PQPA 2ZCJA 4P7BA 1Q1BA 2QMQA 4BC1A 5F4ZA 1J9EA 4IAOA 2XD4A 2EWWA 1YZ3A 1F38A 2R1ZA 4UVHA 3W79A 3EBPA 1A4IA 1VG8A 2PM8A 1WIWA 2N3ZA 1VIAA 1HFEL 3NYIA 1GAQA 2FQQA 5GGYA 3TSCA 1MPXA 3W4KA 4LF4B 3LCUA 5DNAA 1X3SA 1KMQA 3IFSA 4G2TA 4KUGA 4U39A 4WFKA 4RTSA 3LQKA 2OL4A 3CRW1 5I5EA 4M86A 1YS2X 1C50A 2AF3C 2B5OA 3F9CA 4OK6A 3BF7A 5BURA 1YCHA 3EFBA 3U3ZA 3P9RA 3UUWA 3WKBA 4D41A 3UMBA 1W2GA 4J29A 1VE6A 1W4LA 1X13A 4NC9A 1OLOA 2QK4A 4DSTA 2F8TA 3JS5A 1RFUA 2XUZA 2YHIA 3A6EA 1RBQA 4NCIA 1Z83A 3AEZA 3T7CA 1Z5WA 4JLOA 1JN0A 4P3PA 5BNWA 2BKLA 2W2QA 4UCFA 3RSLA 4YJ2B 1DGMA 1Y4DE 3WGTA 3KQVA 1GT91 4FYJA 1GNTA 4PGFA 4EZBA 4Z49A 1JDZA 1JHRA 3PNQA 4A27A 3QIAA 4QUHA 4UHBA 3WGVA 3H2GA 5B4UA 4PYNA 1FMCA 2W71A 5FTWA 4AJEA 2WB4A 5L9AA 3EPKA 3N2EA 4JITA 4UBKA 1HZZA 5JANA 2JCXA 4YAEA 1W30A 3DZIA 3FHLA 4AW9A 1P2BA 2IYVA 2FW9A 2V98A 2Z4TA 3ND6A 5EYNA 3QVMA 1DQYA 4Z4GA 1N33B 4JB8A 5F9MA 2B78A 3QPDA 3RY7A 1JIUA 4MWTA 1QE3A 5HBRA 4B7ZA 5F2NA 3ZU4A 1HE2A 2V7VA 3M1AA 3THYA 5DGTA 1WDMA 4EVQA 4PZ0A 1Y80A 1YI8A 4POOA 4NAUA 1EZ4A 2GXQA 4C03A 5CFRA 3W4SA 4CUKA 3GMDA 1R0BA 1SY7A 1QHSA 5EUMA 1GZDA 4FB5A 3FHXA 1NVVQ 2IZ7A 3R3ZA 1KVQA 4D4KA 3TLAA 4CCYA 5KYGA 3RYIB 3Q2IA 4M83A 4ZV9A 3S5JA 1CY7A 4I50A 1RC0A 1SC9A 1JT9A 2C5EA 3WRYC 1C0LA 1KJQA 1KS2A 2WWGA 1V3TA 3D31A 4MJXA 2QQ5A 2K4MA 3TZCA 1EFCA 3WE7A 4MNTA 1KSJA 5EIWA 2OO5A 3V2GA 2QDKA 2H9IA 3PI6A 5JNUA 3AVUA 2P4SA 2ZM6B 5JQGF 3BRWA 3O4FA 3HCWA 5JJBA 4Z53A 1NR5A 2BMDA 1E2FA 3KEOA 4DCCA 1OLSB 1C0KA 2PXAA 1TJ5A 4TS9A 3CBQA 1IG0A 4C5NA 2P3OA 1OFIA 1ZKDA 2ZYWX 3JZAA 1H3EA 4F45A 4LZNA 1W36D 1YFZA 1LDEA 4H6XA 4JJKA 3R3JA 2INGX 4EX7A 2XUPA 3LHXA 1NNEA 4H1UA 4AJIA 1JJ7A 3B3AA 3EFOA 4JDUA 3FPJA 1UJ5A 2QTMA 1KMHB 1CR2A 1LK5A 5B2ZA 1PV4A 4UFPA 3BMXA 4M98A 4MRRA 1SKQA 3X43A 3AB8A 1EA7A 3GCDA 5BN3B 1IBMB 1ZI8A 3OPYB 2F4NA 2WPDD 3WLOA 2HW1A 4DDKA 1SC6A 1FVFA 1XR3A 2QRQA 1RAFA 2PDAA 3KYIB 5GZ3A 1ADCA 3KT0A 3RYTC 1PD1A 2GK3A 3UGTA 3W6NA 4KFUA 1MAHA 2C94A 2VAVA 3MJ4A 4LFCB 3ZPXA 3AWDA 2GCIA 2A4MA 4JZKA 3LOOA 3LUKA 3FDXA 1CS0B 1QG0A 4CKWB 5K0FA 1D2RA 3ZHVA 4WD3A 5BT9A 1SCJA 4ALLA 1EVIA 1OC2A 1RVV1 2PGJA 3GIWA 1UK7A 1T5SA 4NARA 4QXQA 5ALHA 1TMOA 3K73O 3ABSB 1WUKS 2GPNA 4LRUA 4PGAA 3UA4A 5C40A 3SQDA 1C7IA 2DTXA 3B3GA 1VHJA 3DGFC 3FYHA 4DV2B 3N28A 4LJ4A 1P44A 3GXBA 2YCBA 3FCUB 3JASB 3QKTA 4U5QA 4NE2A 4RIIA 4FHEA 3L6OO 4OMDA 3HMKA 1LDMA 4E4YA 3P0JA 3UWPA 3WYAA 2C2MA 1EQ2A 3QENA 4ZV7A 3OOSA 4GFDA 4PR3A 2ODQA 2XHZA 3V7WA 2YV3A 3KOUA 1MBZA 3WS7A 4S35A 4DJJA 4QUBA 2O3UA 1NVMB 3CKYA 4JLNA 3LUDA 4HLQB 3W78A 2QTBA 3AKYA 4PZLA 1C0IA 3UEOA 3FPFA 3OIFA 1QUFA 5J2TF 4CRWB 2G67A 4GAEA 4IVPA 3ZUPA 1ZDMA 4MKRA 5C34B 2EC5A 3COYA 1BNCA 4L95C 4MR8A 4FM9A 3KEUA 4MUGA 4Q3AA 4C5KA 2VL7A 3LU1A 1Y0BA 2XWQA 1P31A 1RM3A 4HYQA 3NIWA 1JE0A 1I7LA 2VSXA 5BYJA 3L6CA 2ZQZA 2GCAA 1J8YF 4R2HA 4WGGA 1OF1A 4YJ2F 2FN8A 4QELA 2PT9A 3MG9A 3GG9A 1V5GA 4XB1A 5DMXA 3AJRA 1JAIA 2VXOA 4B3BA 2KWIA 3AJ9A 3DKRA 4KB5A 4PWYA 5FNVA 2BM1A 4AWBA 4TMWA 5JXWA 3F78A 1Y7TA 2BISA 3IEIA 2OTCA 5T8KA 1PRYA 3ABQB 4W8GA 3WLNA 3TXYA 1NXOA 4LXYA 5IZCC 3DTVA 4NBUA 3CCCA 3EVGA 1JZSA 2YJNA 1N0HA 1Y7HA 3EGCA 3JQ9C 3LKZA 4N40A 5LLSA 4BU0A 3VH1A 2Z1DA 2WJ6A 4QVKA 1NOJA 3OLWA 2J5RA 3NM5A 2OORA 4YGXB 4X61A 4I5IA 3B1QA 3U3XA 1XMXA 2L42A 3D4LA 2XCRB 4MXDA 2QG4A 2VHVA 3M6MD 3PQEA 1LVHA 2KHZA 3M89A 4YRCA 4LFAB 2C8VA 1X7HA 5ES3A 1VI9A 4MA4A 3PPVA 2FWPA 2UV8A 4PZ9A 5ADUS 4ZA2A 3DLAA 5LBTA 3UJNA 3NDIA 1JQLB 3K0CC 4MVWA 4OHCA 3DDSA 4RQBA 5GOZA 4RY2A 2Y4NA 3C15C 2CNNA 2I6XA 4ZO6A 4OHYA 1EAYA 4KDCA 3SC3A 3HGMA 4EYGA 2ZQYA 4L7VA 1QGOA 2E21A 3OZBA 3D6UA 3AKCA 5AHRA 1U81A 4FFPA 1G4AE 5DYYA 2IV7A 3AIIA 3QA3E 3UQ6A 2FP4B 2BV3A 2WD9A 3BILA 3DOUA 1RYHA 3D0KA 5KJFA 1TEZA 1TZBA 4OA5A 1C29B 2FUG6 3VDXA 4M0LA 1BN6A 1ZCFA 4YMUA 5BRAA 3K94A 2ZKLA 3Q3VA 3Q72A 4HTAA 4IV8A 3DP9A 4JOBA 2VNJA 4NDAA 3RVPA 3UNXA 1HX7A 4G0MA 3AFGA 2D2FA 2HDNB 3BKWA 4JUBA 3ZDEA 4UM9B 2XW6A 2VPTA 3VV2A 1XO1A 1NPTO 3PPWA 2CF6A 3VBEA 4JA2A 5TLSA 1KZ4A 4C4ZA 1N8TA 2VNHA 3AYXB 4S2UA 4XLLA 4XQEA 3OTXA 1JBWA 4D92A 1BIFA 1RXIA 2FJUA 3L46A 1J97A 1F48A 1S89A 2ZYIA 3NOOA 4D9HA 1TAUA 3E7DA 3T3HA 4QA9A 4V0OA 2PX8A 3MJTA 3GOHA 2JJQA 1YTUA 3RR2A 5FTLA 2C3YA 2J3JA 5AW7A 1HNXB 4KQ6A 3OTHA 3W6OA 4E07A 5C1BA 2DRIA 4NH4A 4JV5B 3NRSA 2F3SA 1U5AA 5COAA 2QCVA 5F1OA 4RKRA 2W9XA 1KXJA 5IPFA 2C59A 4E6EA 4Y6GB 1XRSB 2LNDA 3F71A 3G8DA 3NBQA 2Q46A 1EWYA 2RH8A 3QWFA 4N6OA 4F4FA 5KQMA 3WHIA 3RUPA 2AYYA 2GF0A 4MIEA 4Z9BA 1KAQA 5JXHA 2IY8A 4LRQA 1DC5A 3DWFA 3B2QA 3HV2A 4FGUA 2Q1WA 2IWRA 4KXVA 4KWIA 1U2XA 4BMZA 4JR1A 1FY2A 2YQZA 4G5GA 5J4LA 3KL2A 1SEPA 3CR7A 4WECA 4IVQA 1NRXA 2YQ4A 4QTXA 3S2UA 1I7DA 4GDFA 1UMBB 1DO8A 2NSDA 5NLLA 2PKQP 2QLFA 2WFLB 4CMJA 1KOJA 2AI3A 1KYZA 1IPHA 1TUBA 1VHQA 2IYRA 2AEFA 3HKDA 4XZ3A 4KNYA 2CGEA 1DXHA 3ONEA 3ZV6A 2FF5A 4RSHA 4UHKA 1JW9B 5HFJA 3NWJA 4DAOA 1QPZA 4Y0VA 1AKEA 1T5IA 2ERYA 3MC1A 1KVTA 2A3RA 3GJ3A 3BXZA 4DA4A 1XVTA 5KOHB 1WHSB 2I66A 2BCJQ 3RH0A 3NGLA 3GMSA 3B7PA 4IS3A 4MICA 1QR6A 4UOEA 3PGKA 1P2DA 3S2SA 1BXGA 1GPMA 3I34X 3K5IA 3QVWA 3ZC3A 5ADVA 1EBFA 4U00A 1JSLA 2QUBA 3WYBA 2PRJA 4WACA 4M0UA 1LPMA 5I8ZA 3ZU6A 4FQ5A 4OH7A 2AFIE 4TKVA 5A02A 4MYDA 4D45A 2PZEA 1Y1TA 3IUMA 3WGJA 1V37A 1KYIA 4M88A 3THSA 4AMVA 4L5IA 1AZSC 1NWCA 2Y1EA 1C0PA 2D62A 2ZRLA 1M1NA 3VZPA 2HU7A 4RZ3A 3R0IA 4BFLA 4UBJA 3LPLA 1UP4A 2VHZA 3E9RA 3G17A 3B85A 3RRMA 4B5LA 5HZKA 4NXNB 4M4SA 1I9GA 1TDJA 4QREA 3BH7A 2PVCA 4WHMA 1HKHA 5K3DA 4YYEA 1VYUA 5KSZA 5GONF 2HGZA 3I9MA 3G88A 5E0OA 4C20A 1TVCA 3HHPA 2FW7A 1BRTA 1GA6A 1UM9A 2GK6A 1YBFA 2WU1A 3W5SA 3H7AA 4WZ6A 1Y3HA 3F74A 2F9LA 4TLLB 3V1UA 4ETMA 3QFFA 2QQ0A 1G8MA 4AICA 1N5KA 1P3DA 3STWA 1O77A 3MMPA 4PRLA 3ZQ6A 2E4VA 4LWPA 1AN0A 1HYHA 4U5XA 3UJ7A 5C9ZA 2BSXA 3BC1A 2WM9B 4FKBA 1ZK0A 5G3YA 2QTGA 1Y37A 3AUXA 3INGA 5B4VA 1QS0B 2ID8A 2Z9CA 3CZ5A 2PR2A 2ATVA 3L8DA 3WLLA 4IGEA 4E32A 5JRDS 4GX0A 5K9ZA 1GZHB 3HM2A 3BCSA 4KO2S 1HT2E 4EARA 2QQFA 4KV7A 3RQSA 2RHOA 3LQ4A 4CLOA 1HRKA 4GMFA 4GSLA 3VSDA 3ZS7A 4JEUA 1DADA 1HORA 3UAVA 1VHDA 1VMIA 4RPCA 6ABPA 1AKNA 2SKEA 3F9RA 3II6X 3KDSE 3DC2A 1F1JA 4JL5A 1GZVA 2OLKA 4Z0PA 2ZB2A 3SDBA 3TJMA 5E9JA 4EF4A 4Q4CA 4KPYA 3O9ZA 3V3KA 2C7VA 5T3UA 1XXHA 1WZNA 2V9CA 4GEKA 1H2RS 5K99A 1KEVA 1XA4A 1PLLA 4JI7B 1ADYA 2AJDA 2IXEA 2VF5X 2W6JA 3M4YA 5K0JA 1LCIA 2HDHA 3CPJB 4UM9D 1QOQB 1QLJA 1N7GA 1T8WA 1ULHA 1WNTA 2IIQA 3FTFA 1LHPA 2AMFA 1ORRA 1YDGA 2XNCA 1KY4A 2C2ZA 2NU7B 2UYHA 4LXGA 2R1TB 4YRPA 3WQSB 4DVGA 3TQCA 2Y3IA 3U4QA 1DX6A 3IYLW 2I99A 3FNGA 2VHUA 3OLYA 4OIFA 4YBZA 4BNJA 4DGQA 5EP1A 3ANXA 4JGBA 4GU5A 3T1QA 1X42A 4HYYA 1Z0KA 1Q44A 2E1RA 4WIAA 5IJ9A 1EFAA 2OXCA 2G5PA 1KVUA 2XDAA 3E2PA 4QPZA 3K0AB 2KS6A 4HH3C 2IPOA 1GILA 1QYWA 4KKVA 3NOXA 1RC1A 4P83A 3A27A 3S44A 1KK0A 2QVCA 4HMPA 4O4LF 4ITVA 5EXEA 2R6DA 2AT1A 1U2QA 1IVYA 3ETHA 3WK4A 3LNTA 1YDWA 3ZXYA 5EQDA 3Q15C 2PWZA 2I33A 3AHDA 4LRWA 4P6VF 2WSYB 1Z4PX 4WFIA 3K3PA 4ZEOA 5EIBC 4U7FA 3D8UA 4RDXA 3CNQS 5A6VA 3R6WA 4IOLA 5FPKA 1LRJA 3Q12A 1QQ7A 4Y2SA 1ZGCA 4AS2A 4D56A 4AJ2A 1T9GS 4AYTA 4C43A 2ZSHA 2VHXA 4DMRA 5LIPA 3KETA 1EKQA 1I7NA 1P61B 3DBOB 2WLSA 7YASA 5K8CA 1ZRNA 2BT4A 4NYJR 3T7RA 4CL2A 1R4MA 1VZ2A 1CIJA 1DZ3A 4G8JA 3KJGA 3GZNB 3QGMA 3ZHSA 2M6RA 4P0PB 5M29A 1B16A 4N48A 2PKCA 1X86B 4KQIA 4FHZA 4R3NA 1E4EB 1RW4A 5E6RB 3QF7A 1B14A 4XRGA 5ABPA 2X9NA 5JXIA 3OFNA 5G02A 3V1YA 5G0UA 2YYAA 3QUCA 1EFVB 4F1KA 4C29A 1AV6A 1ULAA 2C2GA 1WZCA 3KWLA 3G9TA 1KPIA 4ZXFA 4CQMB 4KXQA 1VBNA 4MUNA 2Q6OA 2JLRA 4PBSA 3VVBA 5C46F 4UARA 4HB3A 1KL7A 4B3SB 5AH0A 3AM3A 3K5HA 4XDGA 3SJCA 2ODAA 2VRWA 2XYGA 2AOVA 2JHFA 3LUCA 4CF7A 1W5SA 4DMGA 2CJWA 2YW2A 1QYRA 5JFTA 3VZRA 4YMVA 3A0RB 1J21A 4B3HA 2X4DA 1E62A 3RIMA 5GGXA 2XKJE 4LJRA 3PLAE 4YLEA 1FUUA 4V1CI 1HE1C 3EQ8A 1NM5A 4Z9FA 4AD8A 2O4CA 3OQVA 4ND3A 5FLEX 1UXGA 1GRQA 3I01M 1SZPA 3P9QA 1OWOA 5HQJA 4JP8A 4BVLA 1QDEA 4KAJA 2ROQA 4RXUA 3EA0A 3TF5A 1NJ8A 4RWZA 2YC2C 4RELA 1VB3A 4Y9TA 3LGSA 3JQAB 1S1MA 4WN3A 3N8DA 1XMJA 2YV2A 4U7PB 4GOOD 3SR0A 1L4LA 2A0UA 2IEAA 3AHFA 3NC1C 3W34A 2JH9A 1UKEA 3TUZC 5B4TA 1V3VA 1VC2A 3ESXA 3EQ2A 2ABSA 1ZOSA 1SBHA 2ZSAA 3DV9A 3H3FA 3NC4A 3KALA 3GVIA 3CV3A 4R8KA 5AM3A 3EEBA 4OOEA 4AURA 5CDSA 4L2IA 4U7DA 2EFEB 1FX1A 3PYMA 3VTKA 1U0SY 2XI4A 4AUEA 4QRIA 3ETDA 1PCXA 2X1HA 3T7DA 1GZUA 3IVCA 2PQ2A 4REQA 1XU9A 2GHRA 1D2AA 2AOXA 2H1WA 2Q4TA 3OJXA 4GM1A 3MBOA 4KZKA 4C0LA 2H4JA 3QMPA 1VRVA 1YJ5A 4GWLA 1L5LA 3UW3A 3HBAA 5JSZB 1A96A 3U7EB 5JAUA 2JLYA 1X1RA 1W2HA 3AVYA 3EA5A 1XEAA 3TR6A 4A8HA 4K8OA 4A2QA 4I5EA 2OWDA 4EW2A 1LIIA 3QWBA 1E6MA 2A30A 1MC1A 1D1QA 1KEWA 1ECPA 1K5PA 1X38A 1ZOIA 3JVVA 1PDWA 3ZN2A 2D00A 1R6VA 2Z5FA 3RHSA 1Y63A 4Z4EA 2ZXFA 4DW8A 4NCJA 1QFXA 4N08A 4KQWA 4LNUA 1J8MF 2OWEA 4CT5A 3CNLA 2GK7A 3DBRB 3DONA 2GBGA 1F3OA 1QXSA 1EJBA 3NWEA 3OOWA 3OTQA 5CJPA 2DQ4A 1JQDA 2JCVA 2QF7A 4FHCA 1OYWA 4H3SA 1KQ3A 2NZVG 3REQA 1NVVR 5AW4A 1F14A 5ALOA 3ZLVA 2FQYA 1GTJ1 3N2YA 4UNRA 1Y8CA 2ZSDA 2J67A 1SBIA 2A9PA 2QYSA 2XVXA 1LJ8A 4IIJB 4JJGA 4IGKA 4BN4A 1GG2A 2POQX 2CMKA 3IBQA 1BVYF 2IK8A 2HNKA 1R5JA 3EZFA 3PGMA 2XB2A 1CP2A 3KM0A 1MIOB 5E6UB 5A1JA 4YRRA 3WLTA 5EJ7A 1IQRA 8ATCA 1XDBA 1JHZA 2X6QA 2ZIUB 3FSEA 3GJYA 4OQDA 1XKTA 4CDMA 5KTRA 2G1PA 2BY4A 4F97A 2KW5A 1RPAA 1ODTC 2ODPA 3KAPA 4N12A 3V97A 1NT2A 2GTPA 2HH9A 1DBVO 5HF6A 3CX7A 1PYGA 1XALA 4ENVA 1WG8A 2AG1A 4TRRA 1UPFA 1K5GA 1ECJA 3P9SA 3LZDA 4UNSA 2YWEA 2W6PA 1K6IA 1KAGA 3OEHA 3P0RA 5GVSA 3OA2A 3SIPA 2V7BA 2NU9A 4DE5A 4CQMD 1L5VA 4YCLA 1BXZA 1AKVA 1E5VA 1Y1RA 1KDPA 2Q3BA 3D1VA 1M6HA 3PS9A 3AEQB 1PHRA 1Z7GA 3M5PA 3D8SA 3TTSA 3LC1O 4JU9A 3FMPB 1L5HB 4JVSB 1U0GA 3HVIA 3O21A 3T9EA 2PRSA 2F3RA 1JEYA 4PYKA 1OH7A 1CULC 4AKGA 5AW9A 1IQUA 2ECPA 1VJGA 3L1UA 4HGZA 4HWGA 2FJ0A 1IOWA 1BMFD 3GT7A 4AJPA 4HUQB 1GZSA 2BL4A 2HSGA 1FS4A 3ICPA 5H1YA 2I03A 3CMMA 3H5OA 4RIEA 4IDGA 2QUAA 4I1UA 2J0VA 4IG4A 1GXSB 1ZH4A 1KI7A 1RHQA 2D0OB 1OTHA 3DFZA 4KUEA 3AKDA 4M1SA 4EHBA 3B51X 2FQ1A 3U9TA 2EGHA 3MINB 1TTPB 3JQAD 1OZ0A 5F4BA 4MI3A 4AZ0A 4Y6OA 5LJLA 1VGRA 2LZ0A 4LKOA 1U94A 1SOVA 2GJ4A 3GEEA 3L01A 1B4DA 4C07A 4J7UA 4QXRA 4PPYA 1K6EA 4PSKA 2V6GA 5IN5A 4ZTZB 4N4AA 2BGJA 1A8SA 1NW5A 5C8VA 1JYFA 4D42A 4EHKA 2HTFA 1V8ZA 4Q1EA 1KMMA 1OIXA 1JHAA 3ANTA 1DDOA 3Q7RA 1Q50A 2L69A 3OT1A 4LNAA 3VR4A 3ZU2A 1NW4A 1PG2A 2Z8XA 3TTUA 1MC4A 3N70A 1QANA 4QOEA 4DARA 3KB6A 1EVLA 2QVGA 3CJRA 3IAM6 4MIYA 5LL6P 1BD4A 2H3EA 3S2YA 3AHCA 2XB6A 3EH1A 5LDGA 4Q3BA 3SYLA 3CC8A 3ETEA 3RUHA 4AKSA 4B33A 1RXWA 1H5QA 2Y71A 3GRZA 5EJ5A 4H0CA 3CNOA 3N07A 4RYDA 6NULA 4YT4A 1QE0A 3IIIA 3MJCA 3WMRA 1F0YA 2I71A 1YZFA 3TWOA 3X44A 1B6SA 1KDZA 2IYTA 4RJLA 4FGWA 2QNBA 1KI6A 2YHIB 1FE8A 1GO2A 2NNWB 3OM1A 4DLRA 2LKCA 4WKPA 2F4VB 1WBBA 1H4SA 4LWOA 4YJ3A 1E2UA 1CP3A 1EKXA 2QORA 2V59A 1XMSA 5GM1A 1MB9A 3IMEA 4L8FA 4N7MA 5EAIA 3U9LA 4TN5A 2BI7A 2Z57A 1Q20A 1E1QA 4LY9A 5T57A 5TDHA 4DCUA 2VORA 2HT6A 2EP5A 4MGYR 3KRTA 2WSSD 4IJ5A 1RYNA 2GD2A 3CF4G 2FJPA 1MAAA 2YVKA 4MI1A 2DPLA 3E1SA 3LBFA 2WWVD 1KEUA 2XUAA 4ZK2A 4OH1A 4YYZA 1CJUC 4QU9A 1GQOA 1TQDA 2ZR8A 1KO8A 3E7FA 3HFRA 4HQRA 4RORA 5DSXA 5GV8A 4A2CA 4JXXA 1Q3HA 1YRWA 5F2OA 1EFHA 1FTWA 3R20A 2O50A 3QW2A 1I5EA 2ESRA 1V8FA 3CHYA 2W83A 3MUEA 3FB1A 1OXTA 5H80A 1VIYA 2EF1A 4X41A 2H7CA 3THYB 1S3IA 5HZGA 2ZUUA 5ALSA 2NTEA 4B4VA 1BDJA 3E7PA 2P3QA 2V03A 4LJ6A 1RQXA 2ANCA 1OKKA 4BHTA 4RJTA 5K2OA 3SJ7A 4QJ5A 1N57A 1BQEA 4JA0A 1LI5A 1NN1A 2XMGA 4UXIA 5ICFA 3SS7X 5K3EA 1LBHA 3QELA 1MGPA 2FXVA 1HKUA 3L7MA 4CCYB 2B1RA 4WSOA 1IQ0A 1R27A 4YP7A 1JR4A 2VDMB 3A36A 4I50B 1KDRA 3GRAA 3JZDA 4KVAA 3ZTYA 1P3Y1 1W73A 1B0AA 1XAHA 3UGJA 5KX5B 2VHQA 1JPVA 1BDMA 4NAVA 1P4HA 4IR7A 3VOTA 1JG3A 1OFHA 1U2ZA 2RKOA 2V7QA 4PZPA 3IA7A 4YMTA 4R9NA 1RBMA 3IDZA 4NBSA 4ZEVA 5K8UA 3PV0A 1DTWA 2GOYA 4O29A 4ZAGA 1PR4A 1H0SA 2VDOB 3FNIA 3KELA 1S8OA 4D4JA 2OXEA 2FX3A 3DEKA 2V6BA 4GOLD 2EKDA 3JAKA 4FE3A 4ISBA 5I7FA 1INLA 2WICA 4MV8A 1R8QA 4QTTB 5HKLA 1Q14A 1V7ZA 2GEBA 1JEDA 1SIOA 2IHUA 3EIHA 5TB5A 1ABFA 3QX3A 4ER0A 1ZUIA 2QVZX 5A4MS 1QH1A 2ZB3A 1ZMBA 1J2YA 3EFOB 4LRTB 3TPCA 1Z4IA 4DRZA 3NFRA 4S1WA 1Q6YA 3B60A 4O4IA 1AS0A 1C14A 1MJ5A 3QFHA 3BGVA 4KVZA 2HA7A 3H8SA 1XTIA 1Z17A 3F5DA 1T25A 3JVUA 1A5SB 1V16A 2WZDA 4MINA 3WMEA 4ZZ2A 1QF9A 4DADA 2B4TO 3FDZA 4NHEA 4DUPA 3TNDA 2UUAB 1UEIA 3HBNA 5LZ7A 1SVNA 3HDYA 1GFSA 2EZTA 1S8NA 2RHRA 5FI1B 5JPIA 4G1BA 3AEYA 3WY9A 2A1UA 3L4JA 4TL7A 2K2QB 2NU8A 4PN3A 3AESA 4B3RB 3KDPA 4FW8A 1X1TA 4TLCA 3FZEA 4M1WA 3SDZA 2HJWA 3ZWWA 3H65A 1YS6A 4JIGA 6YASA 3ENWA 3P9YA 4PN7A 3MJSA 4PG5A 2P30A 3WJ1A 3IAXA 3QSYA 2R87A 4QXAA 4GPAA 5C0OE 4C6SA 5BT8A 3PG5A 2D1YA 1I7PA 1OVMA 2UZ1A 3HY3A 5IMBA 1NOKA 3TCNA 3H6GA 1KMNA 3O31A 1Z34A 1O94C 3B8EA 2CHVA 3WMGA 2O5EA 3JCZA 1BHQ1 1EEXB 3KYBA 3OQPA 3SC6A 4Q18A 3K09A 4HFMA 1TKRA 1A97A 2I8CA 4FCTA 1M72A 1X39A 4L0MA 1BCRB 4RVDA 5CTJA 1MOPA 4Z8YA 1M83A 4CFZA 2IYQA 3FPSA 3DZFA 3RVNA 1F2VA 1Z7BA 2DTEA 2VBFA 2DKNA 3PHHA 4DA0A 2YYYA 1DC6A 2XD9A 2CLMB 2J0UA 3RDPA 1OX5A 1FYEA 5DM1A 1NZJA 1TCVA 3HO1A 1OBFO 4YL5A 3FWHA 5DTMA 3ANSA 5AD1A 2D5AA 1T3LA 2IYYA 3PWKA 4EY3A 2X2EA 3U3MA 4F4CA 4BUBA 4P93A 3E23A 1NONA 4MR8B 1PUXA 1YUMA 4DTCA 5JRZA 5CXSA 3QE9Y 1S9HA 1YS4A 2WHPB 1W5EA 2J7KA 1O6GA 2VZ0A 4GLJA 3FIUA 4O1HA 2Q2VA 4B87A 5GTDA 5TF4A 5DP1A 3N8KA 5JAQA 3P32A 2IX3A 5CT4A 1XVLA 4JC8A 2GBCA 5FNVB 2FSGA 2P1DA 4LRYA 4PIMA 5IJ0A 2P6UA 3GJXC 4OJYA 4YRJA 4DV4B 1R9GA 1Z5OA 2LE0A 4GICA 5P21A 1K9VF 3GBPA 3GNQA 3VR6H 1CUHA 2BMVA 3DTVB 3KJIA 3V4RA 1DQSA 2G1JA 5JCPA 4HJRA 1GCUA 1HO3A 3RYHA 4UAJA 2JLBA 4XM1A 1R64A 1EP2B 2EKLA 1J2TA 1Y9JA 3GK3A 4H3VA 4G8CA 4WI1A 5TGZA 4RXTA 3V9AA 2CXNA 4LY3A 3ROZA 5FBQB 3EC1A 4Q3DA 3FH0A 3D59A 1XRLA 3IVGA 4HFNA 4XGKA 4EI9A 2MSLA 1QF7A 1LC3A 1D7AA 3IODA 4WT7A 3RG2A 3ZWBA 2XDQA 4ZOLA 3FOCA 1ONNA 1XZIA 2KMLA 2W2MA 2XQIA 3BRWD 3UXYA 3WL4A 5MN4A 3NG1A 3HVJA 2VAXA 5EJ2A 3WO1A 3ZBQA 3FCSB 5DJ5A 3R7AA 4BWYA 4EFLA 5JQWA 1D4FA 1A4XA 1UXJA 1T13A 2PMFA 4LV8B 4EQZA 4I50F 3H49A 4ZJZA 2VP9A 3UHJA 4X54A 5B6AA 4CJXA 1OJ7A 3GRUA 5CA0F 3NB0A 2I8AA 1DQPA 7REQB 3JW8A 4FLMA 1DPGA 5KDLA 3E82A 3SYMA 2X77A 4RC9A 5B5SA 5BMVF 1G18A 3JQPA 4XVRA 2FR8C 4YAUA