3RSCA

Crystal structure of calg2, calicheamicin glycosyltransferase, tdp and calicheamicin t0 bound form
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
397
structure length
397
Chain Sequence
b'HMAHLLIVNVASHGLILPTLTVVTELVRRGHRVSYVTAGGFAEPVRAAGATVVPYQSEIIDADAAEVFGSDDLGVRPHLMYLRENVSVLRATAEALDGDVPDLVLYDDFPFIAGQLLAARWRRPAVRLSAAFASNEHYSFSQDMVTLAGTIDPLDLPVFRDTLRDLLAEHGLSRSVVDCWNHVEQLNLVFVPKAFQIAGDTFDDRFVFVGPCFDDRRFLGEWTRPADDLPVVLVSLGTTFNDRPGFFRDCARAFDGQPWHVVMTLGGQVDPAALGDLPPNVEAHRWVPHVKVLEQATVCVTHGGMGTLMEALYWGRPLVVVPQSFDVQPMARRVDQLGLGAVLPGEKADGDTLLAAVGAVAADPALLARVEAMRGHVRRAGGAARAADAVEAYLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalG2
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase/antibiotic
total genus 141
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA02
3DZCA 2IEIA 2X6QA 2BISA 3S0JA 1JIVA 3EBPA 4YI5A 2H1HA 1L7XA 1RZUA 1H5UA 4BFCA 2O6LA 3NC4A 4N9WA 3CX4A 3VDMA 3S28A 1L5RA 1IIRA 2C9ZA 2HY7A 3OKAA 2GPNA 2JZCA 3CEJA 3NP9A 3MT9A 4X7MA 3T3HA 4GZ6A 4AMBA 1UZUA 1PNVA 2KS6A 2PRIA 4CTMA 3OT5A 4WHMA 3EBOA 4EKEA 4NEQA 4F96A 1Z8DA 3WADA 1Z6PA 1V4VA 4GYWA 4WADA 3ZCPA 3IAAA 3MT8A 2R66A 4GZ3A 4MI3A 3NP7A 3VDNB 1XC7A 3BD7A 3L01A 3DDSA 5IKPA 1RRVA 3RT1A 1P4JA 6GPBA 2F9FA 4EL5A 4RENA 4M60A 5DXFA 3S29A 2G9UA 2GM9A 4WACA 4KQ1A 1P2GA 2R4UA 2R4TA 4MHOA 3ZCSA 3HBJA 5D00A 3G2IA 3TSAA 3TAXA 3L7DA 2IUYA 4YUAA 4CTNA 4XIFA 4MRAA 8GPBA 1B4DA 3VUEA 3BD8A 1AHPA 2QN3A 1WW2A 4RIFA 2AZDA 2IW1A 3E3LA 5GPBA 3MS4A 3E3NA 1P4HA 4Z5XA 2PYDA 4AMGA 2IYFA 4NESA 4MI9A 2GT1A 1C50A 4FZRA 3T3DA 2FETA 1FU4A 3CUYA 3ZCTA 2P6PA 3Q3HA 3QKWA 4RIHA 3SYRA 3HBFA 4YI3A 2VCEA 2IV3A 1HLFA 3BDAA 3MT7A 3WC4A 3DD1A 2QLNA 4M7PA 1JG6A 3NB0A 1J39A 3S27A 2ECPA 3NPAA 3D0QA 2QN1A 1PN3A 1YGPA 5BNWA 2JJMA 1Z62A 1F6DA 2BGTA 2F3UA 3CUUA 4RBNA 3ZCRA 2PQ6A 1L5QA 4GYYA 2XCIA 3D0RA 1XV5A 3CV3A 5C1DA 3DDWA 3CUWA 1NOJA 3OTGA 1BX3A 2ACWA 5TMEA 1C3JA 2SKDA 2G9QA 5LQDA 3CUTA 4X6LA 4GZ5A 3C48A 3ZCUA 4FKZA 3ZCVA 2ASVA 1NLMA 2JLBA 2AV6A 4G2TA 1GZ5A 4L22A 4M83A 1FTYA 4AY5A 2GJ4A 1LWNA 1YA6A 5TMDA 3IA7A 3O3CA 2VSYA 4F9FA 1FA9A 4MI6A 3TOVA 3GUHA 1QKJA 1GPAA 4LEIA 3HBMA 2C4MA 3NAZA 2QRHA 4CTOA 1LWOA 1KTIA 1E1YA 2XA1A 2XGSA 1UQTA 3COPA 2F3SA 2F3PA 5HXAA 1Z6QA 4X7RA 2QN2A 3E3OA 1GG8A 2Q6VA 1NVKA 3C4VA 4N39A 2PRJA 3C4QA 3OY7A 4EJ2A 1A8IA 2VCHA 4N3CA 7GPBA 2FF5A 4W6QA 4X7PA 2QN7A 4AY6A 3NCHA 1JIXA 1EXVA 2PYIA 1P2DA 4KQMA 3CUVA 4HWGA 3G2LA 1UQUA 3G2NA 3MTAA 3OTHA 2QLMA 1FU8A 5JTUA 3VUFA 1IXYA 4F97A 2QN9A 2VG8A 2C1ZA 4LDPA 1GPBA 2G9RA 1L5VA 3L7BA 2QRMA 3G2HA 4RIIA 1NZDA 2QNBA 3T3IA 4RIEA 1SXPA 2OFFA 1JG7A 2R68A 1FC0A 3BD6A 3PE4A 1F0KA 2H1FA 4PQGA 2BGUA 1K08A 5TMBA 1XL0A 1FS4A 3Q3EA 5JTTA 2XA2A 1Y6GA 2GPAA 2QLLA 3AMVA 3ZCQA 4GPBA 3MRTA 5ENZA 4EKYA 2WTXA 3BCUA 1RZVA 1L5WA 3OKPA 3T3EA 1L6IA 2GEJA 3L79A 2YJNA 1GGNA 4KQ2A 1NOIA 1NZFA 1P4GA 4N3BA 2BFWA 3BEOA 4MICA 5IKOA 2ACVA 1PSWA 1WV0A 3BCSA 3PE3A 4BQEA 3D1JA 3MTBA 1XL1A 3UYLA 1JIUA 5TVGA 2XA9A 1SXQA 5I45A 2IYAA 3T7DA 3WAGA 3GPBA 3S2UA 2R60A 4RELA 2VSNA 2IEGA 2GEKA 2IV7A 2GPBA 3OY2A 1FTQA 1XOIA 2QRGA 3FROA 4BQIA 3G2JA 3QHPA 1K06A 1C8KA 3T3GA 1P29A 1WUYA 4CDRA 3MSCA 3H4TA 1AXRA 1M5RA 1QM5A 3HBNA 1WV1A 1Y8ZA 1JEJA 2XGMA 2SKCA 3OKCA 4N3AA 3RSZA 1XKXA 3H4IA 3SYMA 1GFZA 1O6CA 2XCUA 3T5TA 2AW3A 4NC9A 3CEMA 3L7AA 3MRVA 9GPBA 3CEHA 1P2BA 4MHSA 4EL0A 3Q3IA 2XGOA 3BCRA 3MS7A 1L5SA 1EM6A 3RSCA 5DLDA 2X0EA 1WUTA 3MBOA 4XI9A 2QRPA 3MTDA 1PYGA 2X0DA 3MRXA 2G9VA 2C1XA 1E4OA 4BQFA 4AN4A 2QRQA 2X6RA 1VGVA 2ATIA 2AMVA 3MQFA 5D01A 2QN8A 1WW3A 1Y6FA 2F3QA 1FU7A 1GPYA 1FTWA 2SKEA 4HLNA 1C8LA 1ABBA 5DU2A 2QZSA 1NOKA 2ZB2A 3L7CA 4RIGA 2XMPA 4REMA 3RHZA 4QLBA 3UYKA 3OTIA 3G2KA 2X0FA 2FFRA 3MS2A
chains in the Genus database with same CATH superfamily
1NXSA 4KUHA 4IH9A 1NNSA 2XXBA 5C0OE 4BLPA 4LRXA 2XT6A 1SCJA 1KJWA 3TVDA 4ZKDA 1C4KA 4DR4B 4X92A 7MDHA 2ZBRA 2WM3A 3G0GA 4MK4A 2P9YA 5KSWB 3PF8A 5AOVA 3O21A 4AECA 4IF6A 2H2AA 3E9QA 3JVVA 1B23P 1Y9JA 1MRNA 2H31A 2FG7C 1O77A 4BFCA 2O6LA 3EOBI 3GVCA 2WIKA 4HP8A 2IBTA 4WXHA 5IN5A 3G6WA 3JQPA 5FAXA 1H69A 2YS7A 4EPTA 1N2CB 4BNYA 3TRDA 5EWMA 1XZCA 4U7DA 3B82A 1D4ZA 3UH1A 2KW5A 4F5EA 3OKAA 2RD2A 5KQPA 2R1ZA 1FZQA 4FIDA 1Y9EA 3K5PA 4HG2A 2FP3A 1FQKA 4ICIA 1C1DA 4MMZB 2VWHA 3R7LA 3JZAA 1LDEA 3PKJA 3COWA 1OA0A 3R3YA 3T3HA 3W7VA 5CFLA 1UZUA 2Y27A 4BLVA 4P4TA 1SUBA 2HRCA 3OFNA 2Z6VA 3BORA 1P4SA 4H35A 4YDSA 4JELA 2E5WA 4KOEC 2B2NA 3I39X 5G0UA 4H7HA 3I4LA 4NEQA 1DEAA 1HDCA 2ZUDA 1RLJA 2I4NA 4G5XA 1FNCA 1RKXA 5AKJA 3RK4A 1YE5A 1A9ZA 4DA9A 2KWIA 4U2CA 2RCYA 4YECA 1E2JA 1WCIA 3ZKWB 3S1SA 2R1TA 1XE3A 2R66A 3PPIA 2QPLA 5HJ7A 2PX0A 5A2QA 1VGQA 4JGIA 4RVDA 1NW7A 3LP6A 5AVKA 1NV8A 3T0IA 4DLVA 5IC6A 5IKPA 4E2YA 1QVAA 1XEXA 2TECE 5AKYA 1Q7BA 1MOPA 1EU1A 2IDZA 4EBBA 5IYZB 3GOHA 4ZAFA 4IIGA 4KWIA 4EL5A 4DDTA 1ZJZA 4B73A 2IYVA 4QGFA 4QDUA 2GZ2A 3H3JA 3C3BA 4GVXA 2GCOB 4M60A 4F93B 1ENPA 2WIBA 1XEWX 3QUQA 3SHOA 4CFSA 1SZDA 2GM9A 4DM3A 2QG6A 2O1XA 4YEDA 2EAUA 1O94A 2CHVA 4WUVA 4WK2B 2GD6A 2X5NA 1DJMA 1F12A 3PJRA 5DK4A 2W71A 3P71T 1GRVA 4RKWA 1XD2B 1JQ3A 2EVWX 2F48A 2J0VA 3FWYA 1PT8A 4ZANA 1WNFA 3EEIA 4H1HA 3L77A 4MKGA 4UU0A 1UXJA 4IJ6A 3PVZA 2XUKA 5IU6A 1LLFA 2ZE7A 3EZ7A 1ZC4A 4C6SA 2AOUB 2J4FA 3T1VA 1CU1A 2FWAA 4L6CA 5KIAA 2EARA 1QQ7A 3KD3A 4H18A 2QE6A 4A8JB 5D51S 4S1NA 1F4VA 4BAUA 1SELA 5JUWA 3ODPA 1DBRA 1GXSA 2VJQA 1E0JA 1P7WA 1EVQA 1YS9A 2YRXA 3CFYA 2DLDA 3D2CA 1V71A 3L18A 1R0RE 2OSBA 3PXEA 5CUQA 2A7XA 1VL1A 4NP6A 4R8KA 3SU8A 3LK6A 5CDYA 2NP6A 1WA5A 2QN3A 2Z5VA 4I99A 3RIXA 3ZG6A 3WICA 4M86A 2E21A 3KLOA 3FCXA 4OI2A 3ZD8A 4PBRA 4FR0A 8MHTA 1LSSA 1TF5A 2OMKA 2GZHA 2NZVG 1NBMD 2YXEA 1JV2B 2QV7A 5CLIA 5A3SA 3RFFA 3S81A 1J7JA 2IW1A 2QIOA 1C4OA 1OFHA 2H4XA 1JSCA 1PQPA 2HIGA 2PVCA 3F4LA 4AUEA 5FOUA 4I3HA 3BBLA 3P0HA 2W6OA 2W6ZA 3BX1A 3IP9A 1MEJA 1RSZA 2PSDA 4V38A 2HI0A 5FP0A 3F8WA 3PUHA 3JQDA 1JSRA 1CLEA 4DCNA 2GD1O 4M89A 2WTBA 3WIDA 4X62B 3AUSA 2H4JA 5K45A 4YUYA 4JLDA 4Q7KA 3MIIA 3KZXA 3EMVA 3IP3A 1XX6A 2D3TA 3ZS8A 4G4GA 5KCZA 1IE3A 2BF7A 2P27A 3EZNA 1QX4A 2CXRA 1OZGA 3TZCA 1VLHA 2VCYA 3FMIA 2WDPA 2BELA 4WMLA 3FCEA 2AFHE 2HU2A 4XDYA 5FTWA 2CXQA 1RJ9A 5J2TB 1CHDA 1ODCA 3CPJB 2A84A 4TTIA 1ONPA 2IV3A 5BPHA 1WB9A 2CLOB 4TV9B 3RS4A 3RSFA 3JSXA 4O8CA 2PFKA 3IVRA 4I55B 3Q10A 3GELA 2J0EA 2D1RA 2FCRA 1JHYA 3TLCA 2PSEA 1P33A 4G5QA 1QANA 3ACDA 2H6EA 2W90A 3GUVA 3EIQA 2WK1A 3D0OA 4IGFA 3DP7A 3ONVA 1FRFS 3U7HB 2H06A 2N1BA 3PEYA 3TIGA 1GPUA 4FILA 3OLXA 2ZBVA 5HGXA 1GUFA 1PT5A 1U4NA 2I6SA 4MYDA 5JVDF 4Y1RA 5JEEA 3VR4H 4EPVA 1Z15A 5BWNA 1YTLA 4KAXA 3IEIA 2YWJA 1I1HA 2WILA 3AILA 3TKAA 4EWLA 2YMPA 4O59O 3SSAA 3LX4A 2VEOA 2V1UA 3G89A 2J5BA 1AQYA 3E0QA 4Q4AB 4Y6OA 3S4YA 1TZ2A 2ZSFA 2V59A 2AMLA 3LHDA 3IBSA 4E30A 3PR2B 2XXAA 3RTEA 1QR6A 4JL8A 3SFZA 3V8MA 5KEIA 4OHMA 4UFPA 3Q1LA 1NOJA 3AQ4A 2C97A 1N78A 1G7TA 2ODPA 3ZHBA 2JA1A 3H9CA 2W8BA 4AJKA 4BVJA 2AHOA 2B1QA 3STVA 3PX7A 3U7QB 4Q02A 1XP5A 4DPLA 2H1VA 2XVMA 4QE3A 1FQOA 1YJAA 1T6XA 4KQEA 4PC1A 3VU9A 3AEQB 4BJ5A 3RU3A 1EFVB 3VPHA 4HMQA 3L1HA 4EAQA 2KBEA 3OZAA 2BLNA 1QONA 2XECA 2OHHA 3T8YA 2IZ7A 2QW8A 3TGWA 1UEJA 2DSNA 4FD3A 4EKIA 4JLWA 2UYHA 4ZVNA 2DM6A 4GOLD 1WZUA 3BXOA 1EB8A 3DL0A 3KBBA 3LGAA 1VJ1A 1W5AA 1C8VB 2YICA 3QEBZ 5D5PA 3HK2A 3MGGA 2R62A 4FCWA 2J1LA 1YA4A 2GK7A 3CF2A 2JGEA 2IYLD 3HNRA 1M74A 3LW8A 3MUFA 1QIGA 4G9EA 4HWPA 4JDPA 4L22A 1CR0A 4AS3A 2QVBA 3ESAA 2JLWA 3QEOA 3D7LA 4DLRA 3AI2A 4IIYA 1SVLA 1DB3A 3GEPA 4G97A 1DWOA 4TV8B 4JSYA 4QQNA 6REQB 4CKWB 4CL8A 1TOAA 1ZMRA 3TL6A 2VSFA 3CVOA 5E8RA 1XWFA 3FTCA 2AFIE 4QX6A 3IOEA 3K9LA 4LEIA 5DTEA 1L5MA 1W48A 1KIFA 2CEKA 2EWMA 3BWXA 3CKLA 3K96A 4X3CA 4BJ1A 2Q2QA 4MIYA 1ZRNA 2BC9A 1F8FA 2PKXA 2B3DA 3A1WA 3C39A 4I3FA 2IWRA 2WU1A 2ACKA 2F1RA 1K0UA 5SICE 1UQTA 4DUGA 2UZ3A 4HQOA 4NJEA 1AQJA 1Q6ZA 3L7LA 1T5LA 2ZM6B 1DFHA 1IXZA 4ND4A 3W1VA 1XG5A 3LC2O 3N2GB 5CB4A 2GD2A 1EHYA 3HDQA 1HE4A 4PU0A 5KOJA 3E48A 2ZI7A 1NAHA 1KE1A 3RYIA 3ROKA 1I10A 2HX1A 4OVKA 3UT5A 1SXGA 1OWOA 1MIOB 2B83A 2FR8A 3BC1A 5CMLA 2ZBQA 5BNZA 5I7WA 5KYTA 3D8SA 3T6KA 1C7JA 3MCTA 4F0JA 5CVTA 2LV8A 1YTUA 4BY9E 3MTJA 2QXYA 3D3NA 4MVJA 2ZXUA 4OY3A 1B7GO 4ERXA 1YOVB 4MKIA 3GAAA 2PUHA 4J49A 4X7PA 3Q3GE 3BF8A 4XRRA 1H2EA 3CG0A 3OF5A 4ZAWA 4Q1BA 1E64A 3ETJA 1LV8A 1M7HA 3HLTA 1H1LB 4DTIA 4K7JA 1K0FA 2G8LA 1VPTA 2V6MA 1Y6JA 3QKSB 3SBXA 1G21B 4I4LA 3S2IA 4FFSA 5BURA 4GXRA 1DC5A 2VPIA 3UJNA 1NVBA 4QODA 2BT4A 5BYBA 1KFBB 5CB0A 3R23A 2QEQA 2RGCA 4AYTA 4FN4A 1QGUA 1SJ9A 4WN9A 2QM3A 2PMCA 2VDUE 2X8WA 3LPMA 2OXFA 5BNFA 3VZDA 3OZTA 3ZWMA 4BWFB 4FYWA 2C1ZA 4I46A 1I1NA 1BS1A 1F9AA 2CFCA 2G9RA 4I1UA 4PYOA 2CKDA 3F71A 4OK3A 5FBZA 5C8DA 1J00A 1JDVA 3JYQA 3AHDA 4MW9A 3RUHA 3WFJA 2XCTB 4PG4A 2VRNA 3G9QA 2AQKA 4IHJB 4UMEA 5FFFA 2ZRFA 2J08A 3TRKA 4BNZA 1K6IA 1KAGA 1MXHA 1Q1GA 3LKZA 1KOLA 2VNIA 2QPTA 1BCRB 1GAEO 3OQBA 3TF5A 2HKIA 3R20A 4EY8A 1S2IA 5J4HA 2B61A 1OYWA 2HSZA 3CO0S 3CW9A 3BWBA 1E0SA 3ZY4A 1U31A 2WD9A 4CVNA 1S3GA 3DZIA 3SR3A 3E03A 1ZK2A 3KVVA 5DWVA 1LNSA 5K8UA 2O8EB 2W93A 4V2UA 3P0IA 3IX7A 1CEXA 4QUAA 5JV5A 1NATA 4JXJA 1FB5A 5H3CA 2PUJA 1Y6GA 4H7DA 4RD4A 3TW4A 5C4MA 4YPFA 3MWDA 1BC5A 3QX9A 1CUIA 5PGMA 4D8XA 2A2ZA 5C4IA 3QFSA 3D8NA 1OCEA 4U3JB 1EYZA 2YQZA 4URWR 3KXDA 4JUFA 4QOFA 5HQJA 3WLQA 3PICA 1HY3A 1QZUA 1X1BA 2JDIA 3EB9A 1A8SA 1XMSA 3KJIA 3FI9A 3PGKA 4LI0A 4XX1A 3UMBA 4N76A 2QS9A 3IHWA 2AI3A 2H2IA 4WINA 3EIFA 3KQQA 2NQ8A 4LY6A 4N4AA 1JEYB 3A9CA 4F3TA 3GAZA 1OH7A 1J9ZA 2FU5C 1N6PA 3WRXC 5LB2A 1XIVA 1SM4A 4HDCA 1NZFA 1Z2NX 1C3XA 1L5FA 3P1JA 5ALMA 2XIJA 2CUKA 1J24A 4I9UA 5JNLA 1W85A 1A9TA 2FE1A 1R0WA 2FLKA 1EJBA 1NQOA 3M2TA 2JAHA 4Y2VA 4F3NA 1ZY2A 1X80A 3HB4X 1HTWA 3LY9A 5CK4A 1A04A 2ZSBA 1DXOA 1YE3A 3L8ZA 3PDJA 1Q19A 2YC2C 3AM5A 3OP4A 5B3AA 4IHKA 3WP1B 4QRIA 5B2FA 2C04A 1KJ9A 2G71A 3P9IA 5IJWA 4WN3A 4UJ5A 1I5OA 1LKZA 4RKRA 3I5YA 1ADBA 4HAXA 2H18A 1VMAA 2QENA 4XGNA 3U4AA 1GKIA 3RFCA 2XJ9A 4H1WA 5K2MA 1BW9B 1F2UB 3SICE 1BXGB 4EI7A 1N6NA 2V3CC 2E4AA 1WDTA 1CR4A 1OYYA 2ZYUX 1N2EA 4M76B 1OBCA 3PI7A 2Y1KA 3PDIA 2V7VA 4JX8A 5U4XA 1ZOIA 1F7VA 4EQ6B 1QFMA 1HTBA 1N3IA 1Q0PA 4D3XA 1TVEA 4XVRA 5EUCA 4ZJYA 1MO2A 3PCTA 3OY2A 4CU2A 2FWPA 1FTQA 1RHJA 1ZHFA 2WV7A 3ENZA 1E9AA 3VR6H 1XOIA 5ESWA 1U8FO 3FW1A 2CY0A 4YONB 5JYCA 2ERXA 2RK6A 3SZLA 3A1FA 3K9NA 2O5CA 4MQEB 4XD7D 3C8DA 4AVYA 2WIFA 4M1KA 1UOPA 1E7QA 3UTCA 1GEGA 2JI8A 2PS9A 1RXSA 2WNHA 4RTRA 1JR6A 1PGNA 3TFOA 1IRIA 1ULSA 2CWDA 3FB4A 4ARBA 3QRWA 5K3BA 5THKA 1U0BB 4Z7JA 2VZ8A 1S3IA 4NJMB 4KLRA 1JX6A 3KPUA 2QJRA 1HE2A 3K0BA 1M5RA 1QOQB 2ZE8A 2YS6A 4BL5A 1UZMA 3M6IA 2LWIA 2JVJA 2DOKA 2FMXA 3M2PA 2B1RA 1KHHA 1REQA 5D86A 2AA3A 2HHLA 1J1IA 1QYVA 2WZQA 3C2QA 3QWHA 1QV6A 1YCDA 3BGWA 4PRKA 5GQSA 4RLSA 2FCAA 4CUKA 1LDMA 3MMNA 2QAGA 4B84A 4ZOLF 4GKKB 4FJ0A 5BRAA 3IHLA 3O93A 4BGVA 1E9DA 3ZDDA 2UXBB 4YAEA 4A1FA 1DJPA 1P2SA 2BWJA 2FGKA 2X2FA 3LQFA 1CVIA 1M6NA 3MRVA 3QI7A 4Q47A 2O23A 1QU3A 2B7LA 4I19A 3IFSA 3AHEA 3EVBA 3H2JA 3LDGA 1JKMA 2XGJA 3QG5A 2QF7A 2FPIA 3L1UA 4OSEA 4RJJA 4WA7A 5EXEA 1DLIA 1U0TA 4MW4A 1RBYA 1FLNA 3RSCA 4KU4A 3O9VA 3NXSA 2QUAA 3PIDA 4O1HA 1WUTA 4MTLA 5DHRA 5JZ9A 2PXHA 3EA0A 1PHRA 3KYIB 1M2GA 3MTDA 4A10A 4BWGA 5HKBA 1C9YA 3T52A 2VDOB 4M21A 4TTSA 3EDOA 1HEUA 1WXEA 1Q20A 2G9VA 2REXB 4WKPA 5AH0A 3D6UA 4EI9A 2DXIA 1H2WA 4BQFA 2JC3A 4YXWD 4KFUA 3ZX4A 3E23A 1T8SA 4CLRA 1JLLA 4BZWA 2HXSA 5A9TA 1ZD2P 3PQDA 3WNVA 1XCBA 3CH4B 4IZOA 4ZVLA 4CEJB 2Q3MA 1ONSA 2ATIA 2I1WA 1ODTC 4NVRA 2NUPB 2O3UA 1QSGA 3EDCA 2EF0A 4BNXA 4DIBA 1GTSA 2WMOB 1NVFA 2YFQA 5IBPA 3RT9A 4BFZA 1P2UA 3K09C 1MIHA 4FTWA 2UZIR 4WLUA 4IDHA 1WXQA 1GPYA 3Q7SA 5DGHA 5T67A 2HPVA 2XYVA 4M1WA 5EHGA 2UXDB 5F9FA 3BSWA 3TVTA 5D5QA 4CRWB 5HRCA 4RCVA 4LF7B 4COOA 1CQWA 1MB0A 4FEAA 2IHUA 1E7WA 3T7RA 4QDJA 3L82B 5KTMA 5LYJF 1A50B 2QX7A 3QWIA 2ZAGA 1RQXA 4L6AA 3TW8B 5K01A 4TLAA 2BM1A 3K30A 4GC5A 3E9RA 3UJCA 2X0FA 2CNKA 3AG5A 2BTOA 3K1AA 4LBYA 1J1UA 4RL6A 2CMKA 3ABQB 3G0DA 4URZR 5KYWA 5HIJA 4PGAA 2VHQA 4TRRA 3CCFA 2QTCA 4UEQA 2YZNA 1WXXA 4KKXB 1GJRA 4WFIA 4CF7A 3OC6A 4P3KA 3FCOA 3GJZA 3O9MA 4NIMA 1DHTA 4YRAA 3HKDA 2Q1YA 5J59A 5JOQA 5B53A 4FM9A 1W75A 3DT8A 4NG4A 4HRYA 4LJKA 1JWAB 3AEXA 4PHCA 3CRZA 3KHTA 1A4XA 4LGVA 1GRNA 1ONOA 1IIRA 1KVTA 3ESRA 4LYJA 1L5ZA 1Q0ZA 3C7CB 3TTTA 4O2BB 1HSZA 2WYIA 1W0KA 3ABOB 2BFDB 4E46A 1B8PA 3DKRA 4L95C 2IXFA 4B3DA 4OSOA 4P5DA 4KQCA 4S3MA 4CR6A 4MZXA 3FH0A 1PNVA 1LLDA 3HCRA 5HDBB 1OJLA 1QIEA 1U0RA 2QTVA 3JQ7B 3DWFA 3I5UA 4CTMA 4IIEA 2DBZA 3ZUGA 5KJFA 3C8MA 3K71B 1OX4B 3H5OA 1ZX1A 2Z5LA 3EXG2 4H27A 1UZAA 4UM8B 4UZFA 1F8GA 4MUHA 1QH9A 1JHDA 3KJXA 3SGLA 4WAUA 2JH9A 5F9MA 1KS2A 3PL1A 4HQLA 3EDQA 1G3IA 1Y4SA 4TT3D 3M6AA 3UQZA 4EB6B 4Z53A 2FN3A 3OBIA 3Q6IA 2J59A 4GM1A 1JIQA 2R6GA 1RRVA 3L05A 3AYXB 3IJRA 5AJZA 3TQIA 4R0MA 1Y8CA 5ICEA 1VJGA 1XTSA 2O05A 4Q7EA 1HZZA 1GSHA 4K2AA 1MX1A 2VHWA 4TTRA 4ZQIA 5IN4A 1YQXA 5MF6A 5DNYB 3QP9A 4TN5A 2X5KO 3OCVA 1K7EB 3UUWA 2Q7OE 5IT5A 1R0CA 4QAJA 1N4AA 5CXSA 5E6SA 1JL3A 5B4TA 4AZSA 4DSNA 1HFKA 3CWCA 5FUWA 1FUYB 1GSOA 1G4HA 1DFGA 2GRUA 2C03A 3KTOA 4HYQA 5T5QA 1RHUA 1TU4A 2Q5FA 3EAFA 3DNPA 4TXJA 4ZDWA 1WP4A 3UAWA 4HL6A 1TKRA 1DOZA 3IT0A 5BYAA 1T0IA 2RHRA 5LDHA 2R7LA 1JHUA 1XA3A 1YU6A 2WWWA 3K9WA 4MUMA 4XSVA 1QGED 1W0JD 5FI0B 3WBFA 4D8UA 2IS6A 4U7JA 1L4EA 2IP1A 4EG4A 5CGQB 1L4LA 3RC3A 5I4IA 2NV6A 4Q00A 2FH5B 1HE1C 2YVKA 2FYTA 1IOWA 4B3IA 5KNBD 1BX0A 3IAM1 1H2XA 4ZT5A 5T4FA 2Z04A 2ZU6A 4BVHA 1CJSA 1E2IA 4RIFA 5TEVA 1J5XA 4P54A 5KHAA 2VH2A 4L08A 3UGTA 3QGMA 3TGPA 1M1YE 3OZ7A 2GAIA 1NPTO 2Q9BA 1Z73A 4HDRB 2ZDQA 1G5RA 2YN4A 1G6Q1 4FQ7A 3NV9A 5ERYA 4BFVA 1BYIA 3ABZA 3R3JA 4QG7A 1K8XB 2QMYA 2Y2VA 3SX2A 3SBOA 4BP8A 1Q0RA 1VI2A 4JP1A 1Q14A 4YBRA 4S04A 2VFAA 4URHA 4U0KA 1ZI8A 2WT9A 4ALKA 2FUNB 1UJMA 5M04A 1C0PA 1FS6A 3NV7A 4FFPA 3EZLA 1L5KA 2IU3A 2MR6A 2FB9A 4UVIA 1J1ZA 1EK5A 2G72A 2OUIA 1LSOA 3M81A 4FE4A 4G4IA 3DG9A 4FZRA 4B6SA 2J3IA 1E3WB 1IUOA 5J1TB 3H2SA 1FU4A 3I23A 3Q2KA 2VJAA 4U63A 4OGFA 1YS1X 1MCZA 1H2AS 1L3CA 3DAPA 4BO0A 5A9RA 2QK4A 4ONEA 1QE5A 2DY0A 2F1HA 5HJ2A 5LC1A 3HVJA 4FFRA 1ADFA 1MO6A 4TS4A 2AN5A 4UTXA 5DX1A 1Z22A 3SYRA 2J6IA 4IF4A 5AVXA 3Q9UA 3SIXA 1XRMA 2YMLA 4H4EA 4P33A 4UM9B 2W22A 1DTEA 3TVYA 2XNDD 3NDJA 3VHXB 1IHUA 4GWKA 2O8FA 2Z58A 3LBFA 1USKA 4CMAA 3OLYA 1GQQA 2D5AA 4X5OA 3TD6A 3E9MA 3WWEA 1W4ZA 3ZWOA 2FRVA 2PN1A 3AY0A 1QFZA 2FXVA 2YJ5A 3PX2A 4FHFA 4MW0A 1XZQA 2JHFA 1KFEB 2OZKA 3EFBA 3GU3A 5TPWA 2BZGA 2X76A 1IDN1 2NTNA 4MVJH 1XK6A 3CC8A 2C31A 3IMEA 2DLNA 1KDZA 3DQQA 1XCGB 1SIWA 4DRXA 4ACBA 4BEVA 5F73A 1MHTA 4JEIA 3EPJA 3F9CA 1QYDA 2AD1A 2JFVA 4YH1A 3U0VA 1MW9X 1RCUA 5CDTA 3HU1A 1E5TA 3O91A 2QAIA 5BQFA 3ESBA 4PHGA 1MAUA 3M82A 3AFMA 1TK9A 2C42A 4KNVA 1VCNA 4Y9RA 4ZVQA 4YWJA 3L41A 3QLUA 2YVAA 3M4XA 3VXKA 3CV3A 4KVAA 2OMEA 4NCKA 4UXIA 1H6DA 2I7VA 2PEYA 1VXOA 3I6YA 3L8DA 4UMVA 3QVXA 4B3XA 4F45A 1L7PA 4AZ0A 3FF1A 1G3MA 1KC1A 1KMNA 4XQEA 3WDLA 2VDPB 3DE1X 2Q2VA 1GGJA 1CUXA 1XRSB 2VJCA 1RWBA 3JPWA 4PO8A 1OROA 2WUWE 1RLOA 1Z0ZA 5BW6B 2X9VA 2NVUB 2EHDA 3P2MA 3Q8KA 3P2OA 4IIHA 5EN4A 1OFTA 1TNDA 1Y9AA 3RVNA 3QBDA 3A4VA 1VXRA 3PD1A 3KVRA 4Q37A 3ZCVA 1ECCA 1E1MA 2ASVA 2FQQA 4MR9B 4OA5A 4Z4QA 4HQFA 4IV0A 3IO5A 4UPDA 3UGKA 2Z1MA 2JGJA 3UOAB 1YB4A 3PZBA 2KM1A 3KFVA 2I29A 4J7AA 1GQ2A 1N0WA 1VBMA 2P4HX 4JMLA 2AKAB 1YA6A 1BQ3A 1C1HA 1UJ4A 1HSOA 2FPKA 2I6QA 4H4CA 4QUDA 2CLLB 4ALLA 1K97A 4MSUA 4DDKA 1E79D 2H00A 3AKCA 3C24A 3OOSA 3KZNA 1ZI9A 4EW3A 3WIUA 1CQJB 5TDHA 2B36A 2D2XA 1XKTA 3CX6A 1GPAA 1UFKA 3EY4A 4EDHA 3KWJA 3ZZNA 3LX5A 3PWSA 4X1IB 3U26A 1QB8A 1G1AA 1A2KC 3W2IA 1LEHA 4BZQA 5JNRA 1SXJC 1J0BA 3F4BA 3GRAA 1P5ZB 1Z5OA 1EWKA 4WZAA 4JWTA 5F4ZA 4N03A 3VPBA 4C3UA 3TNLA 4ZV4A 2GK4A 5AKKA 1W36B 2XQFA 4Q9IA 3IT3A 5A6SA 3ILXA 1NQ5A 2P79A 3VNUA 3TI9A 3DEFA 1JU4A 4MYSA 2VI5A 1Z6QA 2ZSDA 3A4TA 3FJYA 3ZU5A 3OWOA 2I1QA 1FFEA 3C4VA 4MQ5A 5GONA 2HYIC 3X2EA 1HFJA 3O8RA 5BNWA 1X74A 2PJZA 3Q7IA 4ZI7B 2RG7A 1KDVA 4HXGA 1RPAA 4DIMA 4ZYYA 3LCUA 1SXJE 2BGMA 3FD8A 1AU9A 2FF5A 3ROMA 1UF9A 4D9KA 3AW9A 1GT91 3B8HA 5IBQA 5HRAA 1MMFB 2LRHA 2OBBA 5BSHA 2XD4A 4ER5A 3V6LA 10MHA 5K3AA 4DPMA 4HFJA 4HDKA 1FP4A 4V3BA 3U2QA 5IWAB 1Y1RA 2PCJA 4JP3A 5F7OA 1LS6A 4N41A 1T9BA 4NOJA 1VLZA 3IXQA 3K5WA 5FBQB 2C98A 2MSNA 2YDXA 2YFKA 3TOSA 3VKUA 1Q57A 3KE8A 3OF3A 2BKEA 1KSJA 4LYHA 1GA4A 1UDCA 4S12A 5JSZB 2W6JA 4B2PA 1T35A 3WRWA 5A4FS 1SD5A 1VHTA 3CG4A 3GGOA 3FDIA 3ISVA 3QJ5A 4MOWA 3KQKA 1UOOA 2D2VA 1GNTA 1Q92A 1UBJS 2ENUA 3DVRX 4PFQA 4QUEA 5KNLA 4AQYB 1KFCB 3E1SA 2PSHA 1SHZA 5FHRA 4PZLA 5MGNA 1OREA 2OM6A 4XH9B 2C4WA 3VOAA 3GCWA 1XF1A 2IVZA 1SIBE 2QSZA 2OFFA 2VQ3A 2ZJFA 3EGIA 5FNZA 4Q4CA 4EHJA 5AVQA 4XFDA 3EDYA 3L8GA 3PS9A 2NO1A 2AG1A 3CHYA 1EHIA 2OCBA 3L0BA 3OU6A 3PC3A 1MQ9A 2BHNA 2MYTA 5IM5A 4GPIB 2X8JA 2YN2A 5TMBA 3AF0A 5CDFA 4C20A 4CG2A 4O1MA 5E4FA 5B7PA 3QOXA 3AUJB 2XA2A 3WZLA 2GCPA 4YRMA 2IZOA 3VYTB 4BTVA 1VE6A 2H1WA 3WWPA 2GPAA 3FYUC 4CLEA 2OCAA 1Z5PA 1V1RB 4HLDA 2DE0X 2MSCB 2BHRA 4J1TA 4MQ6A 3VNSA 3E9YA 3EBLA 1NJ5A 1VFPA 3MTEA 4EKYA 2YV4A 4BJ6A 2XADA 1OH5A 3IIMA 1A7UA 1U5AA 4Z1OA 4HN9A 1X19A 1PG0A 3P0JA 4W5WA 4LF4B 4JYAB 2CXOA 3V1KA 2R6FA 3OQMA 2C96A 2VP3A 3C6KA 4IEIA 3FYHA 2XMRA 3NAMA 4KXXA 4P82A 2NV2B 1YR6A 3NOVA 1B16A 1E1KA 4MA5A 2ZJ3A 4JENA 4IX9A 2PG3A 2LZ0A 4PLFA 4TLMB 5K8CA 4BO6A 4HPJB 4OXNA 1G2PA 1ZSVA 3B1WA 3PKZA 2WT8A 5ESDA 3ISJA 2ZJ7A 2J7PA 3V48A 4XB1A 2EZTA 3DZJA 4RA6B 1R50A 3G49A 1DQNA 3URMA 3BDVA 4H60A 1V0JA 2GERA 5EIHA 1C1YA 5CITA 1HUQA 4HKTA 5CIQA 3BMOA 4DB4A 3MWLA 1YULA 5JWHA 4OAQA 3U3DA 3UYLA 2G09A 2JD2A 3JQRA 4HXFB 1K4KA 4S1VA 5EE3A 4BX0A 2HJHA 2GHIA 4Y8VA 4CNQA 1AV6A 2DHQA 1T5HX 2IXTA 3OLZA 2CYAA 4LY3A 5JY1A 1QP8A 2AJTA 2Q8PA 3S2UA 1SBYA 4A5SA 5DM2A 3BAZA 1I2DA 4GI1A 4D99A 3RG2A 3UFBA 4D43A 2JFYA 2LDXA 5CA1F 2VQFB 3K4QA 2GLUA 3BWDD 3A6EA 3QYAA 2Z1DA 2FF7A 3AIKA 3GLHA 1JEOA 1KZ1A 2ZVJA 3KHUA 4GOXA 3SX0A 3D6FA 4QTXA 3RF6A 3K2BA 3M9XA 4JL6A 4RD0A 4ZZIA 3FKSD 4RK6A 4AJ9A 1QVWA 5EXPA 4AM8A 4BGEA 1YJQA 3T0GA 2HSEA 3Q40A 1NTOA 1H6CA 2VYQA 4FMBB 4P53A 4MS1A 5GM1A 4YMGA 3FRJA 3IUSA 5CB4F 4A0HA 3AESA 3JR7A 2GTHA 4DR3B 3N8NA 4C87A 4RTLA 4INAA 4EDFA 5BORA 1JEJA 3L6DA 2WTNA 4ENVA 2LP4Y 2SKCA 2XGMA 3MF4A 5K9ZA 3HXLA 3GEDA 4WECA 1EEHA 2G9ZA 1G8YA 3IAM6 3RS5A 2JGAA 1DQRA 3LU1A 3ZW9A 4B7ZA 1H85A 4MVJF 2YIMA 2ZB4A 4NPHA 3FMVA 1N1MA 1LI4A 2GILA 3LBHA 3DM9B 4XFJA 1LW7A 2A35A 3DDOA 3CPHA 3G88A 1U0SY 3AHCA 2M2IA 3JD4A 4RZ2A 2W2KB 1VE5A 4JNCA 3RIYA 3UBMA 2VLBA 1EIZA 1YFJA 5IVKA 2WPDA 1QIDA 1FYDA 2ZJ0A 3E7PA 4RNCA 4X6XA 5JCJA 1V43A 4HXYA 1JPUA 2OGZA 2WUVA 2QG9A 3H42B 1JEEA 1TM5E 3UBTA 4U8GA 4HN2A 1SBHA 4MO9A 1WAMA 2ZS8A 4KBGA 2E37A 5MFZA 1M34B 1OE0A 2C9DA 3A1UA 4QQRA 4TWIA 3RS8A 2DETA 2NNWB 3PXAA 2W2MA 2AUMA 1TKAA 3I0NA 1CF4A 4CFYA 1HL7A 1L7QA 3FCUB 4F2GA 1QO0D 1R4AA 1AN9A 1C2YA 1EESA 2Q5LA 1TW3A 1WXWA 4D98A 3CLSD 2HWYA 3I9KA 4F6CA 2PJDA 1E1QA 2EGHA 3TRJA 2V6FA 1J49A 4EZBA 1XEWY 3FLAA 2G06A 3FNIA 5AHWA 1UBHS 2IH2A 1DXYA 1S96A 2AMVA 4IMIB 1BDHA 2RAPA 1U98A 4UCFA 1RZRD 1N6HA 3G6KA 3NVDA 4B2IA 1WW3A 4R2IA 2QBYA 4QDKA 4HQNA 2NZ2A 5CURA 1Y6RA 1Z74A 4M3NA 4ZVSA 3ZHXA 1KZYC 3CKYA 2MSLA 5JASA 5JS8A 2L18A 2J5RA 5TF4A 1UBTS 2WHPA 4GOOD 4RIGA 2AD5A 1G5QA 1PV1A 1QC5B 2JBWA 5CT5A 1GPH1 4N18A 3H9EO 1F9EA 2D00A 4FC7A 2DTXA 3T9CA 4DCSA 3MS2A 2Q3EA 4LRTB 2E48A 3K8OE 3PLNA 4BPRA 1GL6A 5L9AA 3SS9X 2JAPA 3DC7A 4MQ4A 3NC1C 4OJMX 1A3CA 1XXLA 1TYBE 1RZUA 1SVUA 2PRSA 4N0PA 3UOGA 4RMNA 4LXGA 2W2PA 2FQ1A 2JJ1D 3UAYA 1MB3A 4GGPA 4UCWA 3R6GA 4MAMA 4B44A 1UDBA 5CLFA 1P72A 2WF7A 1ADCA 1D04A 1TIPA 1VZ3A 4NPCA 4TGLA 2CHFA 2P35A 3VH4A 1SIOA 4IDAA 4RY0A 1UC8A 2B98A 2HSDA 2JZCA 2YXLA 4EY3A 3CEJA 3E3AA 1CY7A 1OBHA 3B13B 4X7MA 4ALIA 3AF3A 2ZTUA 1H4SA 2WI8A 1IAVA 2GQ0A 3E8XA 3BERA 2RK4A 3QVJA 4ZO6A 5BPFA 3QELB 3PJEA 1UKZA 4FCCA 2Y68A 2Q0HA 4MNTA 3Q15C 4F96A 3AONB 3SJCA 4PO9A 3ZQJA 1MRSA 1XSEA 1ZNYA 4DCUA 2D5BA 2WIJA 3T4EA 1W581 3Q1KA 3JYLA 4R1OA 2RH4A 5MN6A 1OHHD 3ITKA 1T15A 3N6XA 2QMEA 3STYA 5DKFA 3U44A 2CMDA 3B9QA 1EXWA 1WMFA 5LD2C 1P62B 2W2XA 1XA4A 3N6VA 4YDQA 1E62A 2FOIA 2VRWA 3E9ZA 3KUDA 2JFUA 4HB2A 4MQFB 2BSXA 2QZ9A 2VZ0A 4PG7A 5ANRB 5EKUA 2AN4A 4KXUA 3TZQA 2E4YA 4ARSA 3UB2A 5KTSA 4Q4HB 3C70A 4L2IB 4M46A 3WTBA 5KVSA 1HOXA 2FP4A 1GGMA 1RBQA 1A2OA 3DT6A 3BREA 1WETA 5CVVA 2QRVB 3V8EA 4DSZA 1BX1A 3KYBA 4LVCA 2ZTHA 2AS0A 3KV3O 3ANSA 3X2FA 2P78A 2FSPA 2NTVA 3PNOA 1TUGA 5H3LA 4DLKA 3A32A 1Z25A 1P2FA 4EEXA 4M9XA 1AA6A 4HLUC 4BMYA 5BN5A 2B6NA 4OLAA 3GFTA 3ADDA 1COWD 1LX6A 3K0KA 3FDZB 4WLOA 1UH5A 1KEUA 2O5EA 5HUQA 1CUYA 2ZAYA 3I72A 3WLHA 1WMAA 3MB5A 4OYRA 5AVVA 4ZYXA 5HZKA 1AKEA 5TQJA 4TXHA 5ALZA 2RHHA 2J33A 4JY7A 1LQ2A 4BZZA 2IUYA 3FA2A 4DMRA 2I2DA 2JCSA 5FBVB 1XTBA 4R7ZA 2QJTA 4UEOA 4XIFA 4GLBA 3D54D 4KB5A 1I6LA 4W5TA 1P3Y1 4KDFA 4EQZA 1KORA 1NM5C 3DFIA 1RFGE 2XTZA 2ZVPX 1YNOA 5KWSA 4TKUB 1KYVA 2FA9A 2LTAA 2ORWA 2VK8A 1NMSA 1HFWA 3BGDA 5C80A 3A6FA 3HDYA 5EKXA 3RJ5A 5EIEA 5LP6A 1Y37A 3I1JA 1JPVA 5BSTA 2AT1A 4E1BA 3BZUA 1JLSA 3OOEA 3MS4A 1XZIA 2FRDA 2OPBA 1FSGA 1OXBB 2V8BA 4IY1A 4NI5A 5EZYB 1B6GA 5GGXA 4BECA 4D9NA 5GV7A 3NZEA 2O0LA 1E5LA 1JQBA 1PBTA 2R00A 3EIWA 3R7NA 3OPYB 4LOIA 3SQMA 2Q4OA 2VN8A 2ZCVA 2PZJA 2YIVX 1RKQA 3CMMA 3EVTA 5DN6A 3ZI4A 1E5XA 1GTG1 1RWOA 2C9YA 5GOZA 5ADHA 2AKEA 3U39A 3REQA 3ZPXA 3WR5A 1ST2A 2BFFB 3LGXA 1SHKA 3LKBA 3LLMA 2Y0EA 1C9KA 3R7AA 1TL7C 1PGPA 1JR3E 4HEA1 1HYBA 1WZCA 1OAOA 3R6LA 3MERA 1KE2A 4KQXA 1JWBB 1E8NA 4K8RB 1DKRA 2O8VA 2X7HA 5IH3A 4KTVE 3OE7A 5G3ZA 2XZPA 1CUVA 1CUHA 3CLTD 3RYCA 3FYDA 4YJ2A 3I6QA 2HU8A 1EWTA 4AZ3A 1SB8A 2B37A 2R3SA 2PKQP 3T1TA 2CDBA 4PHTA 2M1ZA 2DHRA 3K5HA 4YJKA 5FWYA 3O2NA 2YV1A 4P4UA 2BF4A 2DFTA 4XWTA 5LL6P 5EIXA 3BTOA 3R0XA 5FI3A 1H9AA 4BVEA 1G9SA 2ZUFA 1KZ9A 1Y3FE 3ZNPA 3JSAA 2NU9B 2DBQA 2OCXA 2JS7A 3HO1A 4CCYB 3UA4A 1T0BA 2BUCA 2OHGA 2V65A 5KVQA 1AHNA 2VATA 1CS4C 3PGVA 5D87A 5TXGA 3ZVNA 1UFVA 2GASA 5K3OA 1E2UA 2ZSUA 1Y3AA 3R3HA 4PPFA 3AF5A 5TE9A 5HZGA 3LY5A 4H6WA 3N87A 3P5BA 1A8UA 2A5GA 2A0XA 2IQIA 1D6MA 3PEEA 4DLLA 2DUNA 1BX3A 4TKVB 5EJGA 3UT6A 2J45A 3QKRB 1XYYA 4YWHA 3ZV3A 1IZ0A 3WIVA 2C2WA 2OM2A 3HYTA 3JQ9C 3MYRA 1KFKB 4TSFD 3VU3A 1E6KA 3WAKA 1UKYA 2JPDA 2WWFA 1V6AA 4Q9NA 5DBOA 3TK1A 1ZINA 3S6JA 1V45E 3MAAC 4Q82A 4TUYA 4ZO4A 3MTQA 3UZUA 4GI2A 1THGA 3BIFA 3I42A 2I6UA 2PLWA 1A8PA 3IUPA 2ID7A 4TWZA 3UG6A 1NU6A 4M37A 3VYVA 4KV7A 2WJZB 4WEOA 4X1YB 2I91A 4IICA 3W34A 1U1GA 3UAXA 3EIXA 3OFND 3F5DA 4QU8A 4MYUA 3MINA 5CFMA 2UXCB 5L3VA 3TBFA 2COEA 1H05A 1UM9B 621PA 4JVMA 4MGIR 4D82A 3AEUB 3K0CA 3N39C 4D0LB 5KMGB 1WB4A 1K98A 2ZU0C 3P2IA 1FL9A 4LBVA 3DDCA 1HDOA 4HEQA 1N2GA 2QZJA 3B60A 3GUHA 3H04A 2Y1XA 1CS0A 4JLSA 2XUAA 4KV9A 2WFAA 3RNOA 1DHRA 1AKMA 4TTQA 2ONZA 5DT9A 1IPEA 2JJYA 4INOA 3U7JA 3ZWYA 5HJ5A 5KINB 2H0QA 4J8PA 3ZGLA 5JQGF 1OB2A 1M1NA 1XFDA 2O6HA 2VPWA 3O03A 5FOTA 5IANA 2R6DA 1NVTA 4GOJA 3FR8A 4M9ZA 4JVLA 4XEUA 5ALIA 1ATIA 4BU1A 5BUZA 3GVPA 5F35A 3AUFA 1O6BA 2J6BA 4CR7A 3T5MA 4AP6A 3ZLTA 1NJGA 2WSSA 4FB4A 5BUQA 1GCIA 2F1OA 1A7JA 5TC4A 1M2JA 1YZKA 1B00A 1MENA 1IQUA 2AK3A 4LA4A 1T0UA 2VNJA 3PKIA 3FVVA 4HAIA 1O94D 4IHAA 2EW2A 4JBNA 5I7EA 3ADCA 3VR5A 2VQEB 3RH0A 1NUHA 1R1DA 5SV2A 1XHLA 1T9GS 1L4MA 2WR8A 4HVTA 5ALJA 3NHZA 1RT9A 2LKDA 2GR9A 3QV2A 4FYJA 2NSDA 3EGDB 4HI0E 2JGNA 1UAYA 1Z4LA 2UVQA 3DP9A 4ZAYA 1TD1A 5SYNA 5TSDA 4HX5A 4CV1A 4DCGA 2JCGA 3DR5A 5F76A 2QN7A 1JXMA 3BGSA 1JEAA 3IQEA 3LQYA 3LFHA 4KIWA 3FJ1A 2ZZMA 1NF9A 3V1TC 5E4YA 2UYYA 4MLPA 1PV2A 3A27A 4HAUA 4XJVA 4MTCA 2C99A 5E95A 3RBXA 3RBVA 2PH3A 1R6BX 1WEKA 3GGPA 3H7AA 3U4QA 5E1DA 5AESA 2JBHA 1UQUA 1WM1A 3TDNA 2GCIA 2FPWA 2NXCA 4AP5A 1NG1A 1EBFA 3VX4A 1JE0A 4IDPA 2OV8A 3TI7A 4DY6A 4KXVA 1IU9A 1FU8A 3NEPX 4IWXA 2G0NA 3TR0A 3DMDA 4PSKA 1AT1A 3ORFA 4LXXA 3NIWA 2CVPA 4EW2A 1LLUA 3AETB 4EYOA 1PDOA 1QF6A 4Y6SA 1ZLYA 1PJQA 5FTJA 5AM1A 4CLHA 1URPA 3LSYA 4HYTA 4FHDA 3NBKA 3LLSA 2FPGA 3EXHA 4RORA 4OB6A 3JQGB 4IO0A 1NUQA 2XMCA 5ALFA 4XGQA 4YAUA 4BNKA 1B0ZA 2OA0A 4MUAA 5IKXA 1P7VA 3D9QX 4KR2A 1EUYA 4UHEA 4QRHA 4DB2A 1JE1A 2FWIA 1V1MA 1DDIA 1XRPA 3RLFA 2GN0A 3BWVA 1U8AA 3SZGA 3BD6A 2CBGA 4TQGA 4E5PA 1VSVA 1Y8AA 3NNSA 3PYLA 1V5GA 1ISFA 1TYDE 4PQGA 2FPPB 4RESA 1PRYA 3U6KA 3FHCB 4JZYA 2WE8A 2WA2A 3JAKA 1HXHA 4MWGA 3VRHA 4B8YA 4BCBA 3WGOA 1AKNA 2E4ZA 2RGUA 3KHKA 2Y76A 1DIRA 2GWHA 4NCJA 2YL2A 3A1VA 4L8YA 3I0MA 3VGPA 3KELA 5I9TA 1OAAA 1XVAA 1GRRA 1USVA 4RH0A 4R8SA 2J4DA 3AMVA 2Y1WA 3BFJA 4ZHQB 1WZIA 4A5OA 2WVJA 4YAIA 4WCFA 1XTJA 5JRDS 1T3LA 3WO0A 3HUUA 3F7MA 4MUEA 2BZSA 3HJHA 3PFKA 1A2BA 2HRBA 1QZXA 4XUEA 5DYIA 3JW8A 4XTRA 3IRUA 4BMXA 1GZUA 2I2CA 4C4ZA 3DKVA 3PEVA 4M2LA 1VHQA 2IPXA 2W2QA 4JIGA 2B8TA 3C87A 3DD5A 4PO3X 5E6UA 2GFQA 1AK2A 3IQZA 3IR5A 3RM3A 5C5EA 1B3BA 1C5KA 1S3FA 2CF6A 2GPJA 2OG2A 1LI7A 1OZHA 2HCTA 3L0DA 1W30A 3P2YA 3LUKA 2VF4X 3H1AA 1AB6A 1H5QA 1ZGGA 1ZU5A 2QORA 3HCBA 4C7MA 1K5PA 1WCWA 4PANA 1ZR2A 1QRSA 1XNGA 2QMQA 1CEQA 1SOAA 5DHPA 3VSDA 2DPYA 1R0SA 2BTQA 3ZBPA 4BP3A 4RHUA 2C0QA 2WF8A 1ZK3A 1TCCA 5AKZA 3LDUA 1I30A 3FLEA 3ZC3A 1JKXA 1NRWA 4GH5A 4DARA 4F6RB 3IUNA 4NMXB 4R5HA 2ISQA 1KRHA 1XRJA 2F8MA 4E94A 1QHSA 5GJCA 4M4SA 3D1LA 2N75A 1EEXB 1X7YA 4B34A 4J1SA 2PXCA 1G66A 3L4BA 2XXJA 3QX7A 1IMOA 4PV7A 4UBLA 1GUBA 1BEEA 1FDIA 2BRUC 3BRWA 5F7ZA 4AO6A 1T1GA 3S5JA 3GA0A 1FRNA 3PUKA 2QT0A 1ISIA 2OAQ1 1C4WA 3A36A 1QWOA 3HNPA 4P98A 3P4YA 1TJYA 1TUBB 2C4UA 2CL0X 2WKSA 2DSTA 3Q6NA 4CT0A 5KTRA 4P31A 3T5BA 3GQBA 5JECA 4HDNA 5A04A 2CLDX 1GD1O 2I7DA 3DHEA 1DRJA 2BE9A 2WSBA 3DPSA 3JV7A 4IW3B 3I30X 3TTWA 4LKRA 5TPZA 4BQIA 1BAPA 2AJLI 4R3NA 1E2BA 4EG0A 4UASA 1XKLA 3PFBA 2XT0A 1CQXA 1ULZA 4KVFA 2BH9A 5CLHA 5D1HA 5GY7A 1Z5ZA 1UKVY 4C0XA 4OX9B 2VJDA 4YRZA 3DUFB 1PJTA 1BN6A 4J7CA 3ANNA 4Z9YA 3DZDA 4FX2A 4YAKA 1BD3A 2DG2A 2H65A 3V1YA 3BMQA 1NU8A 3TIFA 5GONF 3VNAA 3CTPA 3Q2OA 1I7LA 3KXKA 4HCJA 1ULUA 1H94A 2RGXA 4C7BA 4Q01A 1VB3A 1OJ7A 4QYXA 4JT2A 1N2CA 5DGIA 1M7BA 1K3FA 3CZMA 4UTPA 5BSFA 2C2YA 3JQ8B 5IUNC 3NTRA 4RTKA 2QUHA 4QDTA 4AG6A 1YCGA 2HHHB 3D3EA 3BBPA 4NK5A 3GD7A 4DY4A 1O97D 2HSGA 3JZFA 5JVDB 5H59A 2I6GA 3L7AA 4DABA 2HQBA 2BDUA 3PUYA 3UQYS 1J7KA 4BXOB 3O8CA 1ABEA 1VA5A 5DI9A 3CNHA 3LA6A 3QEKA 5KI6A 1FUEA 3FSRA 4O33A 4PX3A 3NTUA 3LLUA 3D02A 1IUPA 1JZTA 3O84A 3OOJA 1D7OA 3R4VA 1DAEA 4Y7CA 3TEMA 3WLJA 3ZKWA 3KKEA 4IRUB 2C7OA 4TSKA 4Z4FA 3IKLA 3O4JA 1XELA 3R2JA 4I8XA 4FS8A 3DHWC 1Z7GA 3AM1A 5ARCA 3I52A 2NU8A 2C29D 4U5QA 1GHTA 2E1RA 5B7GA 2G88A 4AN4A 2BFOA 4NMHA 1XYVA 3OJLA 1KA9H 4HEA6 4IIXA 4MUXA 4CG3A 5IYZA 3TEJA 1LH0A 4MVJG 2V5VA 4QBIA 5D01A 5TR9A 4CXMA 4M99A 2GCOA 4Z0PA 6PFKA 4EVSA 1E6LA 3AV0B 4WXEA 1R74A 7ADHA 1H3FA 2AOWA 1PK7A 2OFXA 2WW8A 3ZV4A 2SKEA 2ORVA 5JCOC 5LMCA 1EFCA 3ENVA 5KREA 3IP7A 1KNQA 3NTXA 1DXHA 1T0PA 2C4KA 1ICEA 4WX2B 5DYYA 3R9KA 2QD1A 2ZB2A 1Z07A 5FDFA 2NUAB 1UBEA 2MJLA 2WZBA 2JANA 1SUDA 1YD7A 1ZEJA 2AOUA 2FFRA 3H2GA 2VYVD 1VG1A 1E60A 2D2IA 3G1UA 2ZRPA 3AB8A 1MFPA 1P7ZA 1V7CA 2CLSA 3Q5DA 1PZEA 3HFSA 2OCPA 4OHFA 4A8JA 2C4VA 2TMYA 4GXTA 1JIVA 1QAMA 3CGWA 3E82A 1U8EA 3MGKA 5NULA 2WKPA 3JVEA 3IDOA 3PCXA 4BO7A 1VHLA 3UJHA 1FDVA 1L7XA 4NBKA 1QJ4A 2GM4A 4P93A 2B0JA 4LQCA 1Y1LA 2A78A 3IP8A 3HC7A 3QYPA 4OB7A 1XQVA 2CE2X 2VOJA 3FETA 4ZRDA 1T6NA 4QO7A 4CMIB 1R3DA 1BFUA 4K26A 3I1FA 4PBSA 4LF6B 3F6CA 3O1IC 1KF0A 2J9GA 1HG1A 3KSMA 3ORRA 3V9AA 1G4AE 1O95D 4O02B 1YZYA 3HKEB 4WJLA 5IBCA 4MS4A 2NP7A 2XIQA 3GFSA 2ZUWA 3EZYA 3FBGA 3U3JA 2ZCJA 4DBVO 3PJGA 4TL9A 2IK8A 2Q5QA 1GKLA 1UPTA 2A9RA 2WICA 3CE9A 3LC7O 4KC0A 4YDRA 2AXPA 3L46A 5DX0A 3ASZA 3DL7A 3JU3A 4KI0A 4EHDA 4FT4A 1I0LA 4IGIA 3V4PB 2VYNA 3PQ3A 4C3VA 2IHJA 2R8RA 4ZPXA 4KGXA 1LF0A 2D7DA 2VUHB 1Z3IX 2C20A 4MB2A 5J5VA 4LZOA 3NP7A 5EWJB 3RGWS 3N7UA 3P97A 4D0GA 4XIJA 1QG6A 1EUDB 2HA3A 1QE3A 3SIWA 5J2TA 5AK6A 1FVOA 3NYQA 4FW9A 2BUBA 1I4TD 3FCAA 2F9FA 5I9LA 3PQCA 4I55A 1WQ1R 4HV4A 1OFUX 1ZW6A 2DF8A 2JRCA 2XV1A 3ENKA 1XXHA 3R4CA 4L4RA 3L06A 4L9WA 1G7SA 3UMRA 3MJVA 2IUTA 4C6HA 4D7AA 4Q7LA 1G6OA 1GA1A 3E4DA 1GNPA 2NZJA 2BKUA 4LRYA 3ZQ6A 1P2GA 2B1IA 4CF5A 3MMZA 3U16A 3RS2A 3ZDXB 3COVA 4CEIB 1P1IA 1NW4A 2R4TA 4XM0A 2BD0A 2APJA 4UVEA 4F86A 2PS3A 2Q62A 5D00A 3KUXA 1Z0SA 2WJVA 5LOVA 2NUTB 2HDOA 1FDTA 1NWHA 2JJ2D 1NC3A 2ADOA 3F3KA 3CN7A 1Z82A 5HR5A 4FSHA 2RAUA 1DBPA 2CL7X 4OBEA 1JQLB 2GZ3A 1ORVA 1EZ4A 2W2NA 3CLUC 4K46A 4ND8A 4UJ3A 3DFMA 4W99A 4UZSA 3UMCA 4EHFA 3TZKA 1G8MA 2FVXA 3OPQA 1ZM4A 5A5VA 5KAPA 3PXCX 4RY9A 4ZRNA 5A4KA 3L5OA 1N9GB 3WIEA 4DV5B 4ZO8A 2HOQA 1WW2A 1Z08A 2CXNA 3N7AA 4HS4A 2OV1A 1A71A 1U3TA 3QKUA 5EJ2A 3U7QA 3A1TA 1VDZA 3AEQA 3CURA 3LO8A 2Y05A 3C3XA 2PQ0A 4PQEA 1EFVA 3RKRA 1V26A 2NXNA 2YHSA 3BJIC 1X7HA 2JFWA 4HAOA 4KI7A 3IMFA 4W1PA 2HCRA 3HJRA 3CH7A 3N2EA 4X3PA 3E27A 4F7WA 4QAQA 3THRA 3KC2A 1XO1A 3D64A 5J58A 1TQ2A 5DBEX 3RSQA 1EQUA 2YNMD 1SD1A 4LSZA 4CLXA 2ZAIA 2DUMA 2JARA 2QX9A 1B3RA 4QGBA 3KYCB 3FDXA 3ZCTA 4KFTA 2WTUA 2NZYA 1CY8A 2F59A 4KGVA 1JBKA 5H16A 4DT1B 4JI0B 1ORDA 2GPYA 3DZKA 5DNAA 5DW0A 4TV8A 6REQA 4L51A 4CKWA 1JBQA 1CEYA 5IC5A 2NLOA 1YZLA 4PNPA 2A6PA 3WL8A 3IOYA 4ECAA 1N1GA 4D6PA 4YP1A 1P5FA 2FY8A 1JG1A 4XKJA 1MR3F 1RDFA 4IKEA 5EEGA 1Y8RB 4OG2A 5EOVA 2GB4A 5FUBA 4UTRA 2A0KA 2Z4SA 2EC5A 5ALYA 3WL5A 4XRGA 2I22A 4CMBA 1HLFA 1PJCA 4OQNA 3VR5H 2P9FA 4H17A 4C5BA 1S9HA 2GJKA 3D6VA 4F4JA 2WA1A 3W9BA 1NHGA 4ARIA 2HWUA 1U8CB 2J9FB 1Z5UA 2ZZKA 4FOPA 5JXHA 4KHZA 3N2GA 1DNPA 1M6VB 4LJLA 2XZDA 1BXRA 2ZWMA 4QLOA 3HADA 5IM4A 3TL3A 1XD8A 3KJFA 4HDSB 1MIOA 4LN1A 3GFQA 3BTVA 4GOND 1Z62A 3IULA 4EB8A 1ATZA 2YHUA 3V97A 4DQXA 3GVXA 1OZAA 3BKWA 1XQXA 3KLNA 4Y9UA 5LU9A 3AKZA 5EJ8A 2VBGA 1WB6A 3TTXA 1YOVA 4DHWA 4EUSA 1XN1A 3SZRA 3EX7C 5LR6A 3MOGA 2ZT5A 2RG1A 1SCKA 1X8KA 1BCSB 4OJKA 2GHQA 1SOWA 4F71A 4EUFA 4C7VA 3IV7A 1H1LA 1NUPA 3A3OA 3DGEC 4N48A 3FUWA 5EVCA 4C4RA 4EEKA 1X8JA 4KZKA 4PHHA 2G6BA 1P7PA 1V8OA 2XTJA 3AFOA 2VA8A 4XWYA 4Q5IA 1S4MA 4KK3A 3HB1A 4UHJA 4AZWA 3UAVA 1ZD8A 3DNFA 3EXIB 1JDTA 2ZW9A 2H5LA 1RLMA 2B0CA 4K9OA 4Y9DA 2B8NA 1UBLS 2QI9F 3SD7A 1Z18A 3IVCA 1OW3B 3A9VA 1JFLA 3I0ZA 5CU7A 4B6EA 1V7QA 2HYDA 3C48A 4BFXA 4BO9A 4E21A 1QAOA 3QVVA 2CLEB 1I6KA 4ZOLB 2YJ3A 2HLDA 1U7OA 2XDWA 3K3PA 3N3BC 4ZEMA 5B1SA 1W0KD 4BRUA 4KNYA 1TQ6A 3NBZC 1V25A 1A96A 5LCXA 3S8MA 4R7GA 3TH5A 2QSUA 4D79A 4CYMA 1A9RA 1ABFA 3IR7A 1TCAA 4IHJA 4DSTA 1R9MA 3QPAA 5A4JA 3ORHA 2ZIWB 1T2AA 4EO4A 1FTYA 3RAEC 2WJHA 1SPBS 2FJPA 4PQRA 1JHQA 2ZB7A 2WFZA 2IEAA 3GYBA 2B7CA 3ENWA 3TUJC 1I7QB 1D3AA 2VSYA 1SGWA 2RGNC 2WUEA 3PHJA 3PG5A 4KQHA 2GDZA 2QYOA 4UHHA 2AE2A 2O2IA 2N9UA 3AX6A 4K1LA 3BH0A 3THOA 1QH1B 2CNWA 3OZFA 1FP7A 1QKJA 5A7GA 2O8EA 4GPD1 1CRPA 1IM5A 1PGQA 2VT2A 5CW1A 1FYXA 4P0TA 4RPIA 1JAIA 2P9GA 3IQWA 2OXTA 4WLVA 4DJJA 3MJSA 5K8VA 2EWWA 3HO8A 2QR3A 4QBTA 1VSTA 1CF9A 3HHPA 3RQIA 4O0LA 5LZ5A 3U37A 4D9HA 4F6LA 4KO8A 4E0BA 1FPMA 1VIVA 3D5TA 3IB3A 4J4HA 4U3JA 5IABA 1U2GA 3OTWA 1ZEMA 3WZMA 4ASUA 4MQMA 2PWYA 3OIFA 4FKBA 2G4VA 3ZGZA 2DBYA 1YZGA 2YWGA 3I5AA 2VHUA 2J9RA 5T57A 4EVRA 4A0GA 4AURA 1NBWB 1IHDA 2BFAA 4EX7A 2YH2A 3W9YA 2B8EA 2QOEA 5LYJB 4ZT2A 2WJ3A 6ADHA 3Q0TA 2XODA 5ALRA 3GFOA 2VCHA 1WKCA 4D4HA 3GA5A 2HJRA 4GAEA 3S7TA 2H48A 1IXRC 1LJ8A 4UNNA 1YNSA 1C30A 2HA5A 3U4HA 3AINA 5DNCA 5LZ9A 1WXHA 4HD8A 1NUUA 2R8ZA 2ST1A 5K1ZA 3CF4A 3H8JA 4OXKA 1B14A 5AK4A 3LG2A 3PBKA 4ENRA 5JAMA 1X3LA 2DAPA 2HDWA 5I4BA 4RDCA 4Z0HO 1Z6ZA 1ZI6A 3ODGA 3TW6A 4IINA 3W2TA 4EJFA 2D0IA 2NZXA 4YRFA 3HV2A 3PXGA 1QYRA 4IOMA 1ZDMA 1BW9A 1F2UA 5CGZA 2V7UA 3OQOA 1BXGA 3NHWA 3MCVA 4R41A 3D7KA 5K0FA 1ENOA 5A02A 1WMEA 1AOXA 2NAFA 4F97A 2BHTA 2RC6A 2ZKLA 4IDEA 4OBWA 1IYZA 1JAXA 4MP3A 4BMSA 4DJAA 2R1VA 4YR9A 2GVNA 3GZJA 1A4IA 4J2TA 3SHFA 2HEIA 4LS3A 1V8PA 4LFAB 1FRQA 3BB1A 3HP7A 5DBIA 4NECA 4BU0A 1CEEA 1IXKA 1CZRA 1UT6A 2QVXX 3QMMA 3QUTA 1OZ0A 2O3SA 1GNSA 3PDUA 4AY4A 1NZDA 4DQ0A 1UMKA 1BDJA 2QNBA 2HBYA 4IQGA 4PZDA 1ZHOA 1MZVA 1QZZA 3TOZA 4NQRA 1Z13A 2VYFA 2XLCA 3LS2A 4IIVA 5EXDA 2ZSJA 3T9BA 1YRBA 2R68A 4GE3A 4MQEA 3TBKA 5EFOA 2H1SA 3DDUA 2YY7A 3PE4A 2PSJA 3FWKA 1U3FA 2FZKA 3EF0A 5AUQA 2H29A 4YJ2F 5CJJA 5JALA 2GZDA 2UZAA 4MYRA 4PAWA 4QHTA 1EUZA 2G08A 2R11A 4WGGA 4AJLA 3C97A 3G9XA 1P17A 2C9CA 3KVYA 3I9MA 3OVMA 5CLGA 4YROA 1VMDA 3Q5EA 3H9GA 4CZ2A 1GZHB 2GJ9A 4L4XA 4GMDA 4M9SA 4ROSA 4KXQA 3U17A 4JU8A 2YBEA 3BXFA 1E3DA 4IP0A 4CFZA 4PF1A 1NN1A 2G8NA 2RSLA 3AR4A 4INJA 4NEGA 3UANA 4GDFA 2UUPA 3BRQA 3EW7A 2IUUA 1H8HD 2H92A 1TK3A 5ICSA 4RU1A 4JI1B 2ZTVA 2IQ5A 3KKZA 1NP7A 1EGMB 4N8DA 4BJHB 3FFXA 1UKAA 1L6IA 3C7KA 1HURA 2R5FA 1XZ8A 4Q0MA 2X8BA 4QJBA 3PHGA 2JLXA 4F3KA 3M33A 2QJOA 2XYPA 5BSWA 2AG6A 3WDKA 5A3RA 1DEHA 3JQFA 5T64A 1CY0A 1TO6A 4ZTBA 2YXPX 4X45A 2JLRA 3HYLA 5FPSA 1P4GA 3MOIA 5FLEX 2OHXA 2A5DA 2BFWA 4OQLA 5CM9C 5COAA 1RWVA 5JNWA 3IAXA 3HU3A 3V8NA 4HPXB 2Q1UA 3K9HA 4F56A 5BUSA 5GIPE 2QLTA 1FBTA 3BCSA 1AQUA 1MC8A 1NURA 2F1KA 3QUSA 2GMWA 3QU2A 4HGOA 3BB4A 4R2LA 4UHDA 3WGHA 4BX9A 2VKQA 3F0TA 4LZNA 5A6VA 5AQ1A 1IPFA 1A0OA 3BFPA 1C9NA 2XHEA 2ZT6A 5F52A 3HJBA 3WB9A 2Y1LA 4REQB 1CR1A 3BA6A 4HB3A 5KU1A 2XQGA 4Y18A 4RTJA 3DM5A 3IV6A 3OFSA 1NW5A 1R0KA 1T29A 3S2YA 4CEJA 4BMDA 3X1WA 8AT1A 1C0KA 1LX7A 1RXYA 1EINA 1M2HA 1PWZA 3OUTA 3BE8A 3P9NA 4L6IA 4LTNA 4E4YA 1PZGA 5GZ1A 4RELA 1CFJA 5EYPB 3RS0A 2IEGA 4IRXA 4V1CB 5KO2A 1U1DA 3JWPA 3P52A 1V7PC 4L3OA 1NXVA 4DYDA 5DIZA 3MNFA 3VSAA 2OXCA 1JUDA 1V3TA 1JP7A 4W7IA 1PI3A 4IQFA 5AOBA 2L0XA 3NJRA 1X9IA 3OQIB 2IEZA 1TAGA 3G3EA 3HB0A 4NV0A 4OIFA 5ELMA 5LLSA 3TLAA 3UWKA 5L53A 1U0NA 5HCUA 1WF6A 2AFIA 3E9NA 3GF4A 3HPQA 1CNMA 1LD3A 4O6VA 4X94A 2EX4A 5C1OA 1WUYA 3AY7A 1D4OA 3FHJA 3MXTA 4OKSA 3MSCA 4XLTA 1H22A 2ZIGA 3FBTA 2CVFA 4J0IA 5AKLA 1H2BA 3PPWA 4PM4A 5EJIA 1JFSA 4F5DA 4KJXA 4DDVA 2FMTA 3NTOA 1P61B 4IG9A 4WOCA 3RSZA 2C8VA 1IJBA 3CH6A 2D54A 1XWIA 4L73A 2IXDA 3JYHA 4XUDA 5EWLA 3VR0A 4C4XA 1VP3A 1Z4NA 3TM4A 2OQRA 5ES3A 2AW3A 1X1QA 2GBLC 3EH1A 4HTFB 2Q3BA 1J8YF 3IMGA 4O2BA 2BFDA 2ZOSA 2P2NA 1R0XA 3CT6A 4B33A 3EJWA 4L74A 1AKUA 3F5FA 4EGQA 1PBNA 3JQ7A 3RJMA 2P2YA 2NO6A 5BSEA 1S01A 1ZYUA 2V7QA 1CB0A 1TEZA 3OX1A 2V97A 1LZLA 3UH0A 2OG1A 5EWMB 2XT9A 1EM6A 5JMPA 5ALLA 1RBZA 3Q98A 2G04A 2FW6A 3L7KA 4L5JA 1MPXA 4Q05A 2A4KA 3NRCA 5JCXA 2IYXA 4HEHA 2JIBA 1UEIA 1T24A 3T0FA 3MRXA 1OKKD 2POQX 1EM8A 5DGXA 2C1XA 4EB6A 1XZLA 3R3ZA 4A03A 3OI7A 3BYZA 2OD9A 4BTEA 3JQBC 1NSFA 1LC0A 5C5CA 5AJTA 3HS3A 4U9HS 2D5IA 2OORC 2OV3A 4AWBA 3G8BA 4I6JA 4N01A 3G7NA 4CLOA 3MELA 3AB3A 1S2GA 2W6JD 4QELA 1RC8A 4MCIA 3N8GA 3TO5A 4RD1A 2AEFA 1F2VA 2R1TB 4N5IX 4DA0A 3GHYA 3TMAA 2GD0A 4D44A 4PC3A 3LO5A 3L93A 3WYBA 3C0KA 1E1LA 4QEKA 1XCMA 5KVAA 1WCYA 2CVQA 1XDUA 3DCJA 4WD3A 4YCAA 3RFVA 8ATCA 5G3YA 5J3JA 1IY0A 3EXG1 3TN7A 4QLBA 1TAUA 2WVAA 4MGYR 5C35A 3L0CA 5CXUA 2IH4A 1G20B 5F2NA 2XWPA 3IODA 4U2GA 1LDYA 1MKYA 4LC9A 5FBKA 1JXQA 5AK3A 5CLQA 1B42A 3K5IA 2ZYDA 4JQYA 4B5KA 1NQUA 1WPRA 1KYQA 4BNUA 1GTRA 3NKLA 1QV9A 4MUJA 4BO1A 3NOOA 5C52B 5HCNA 3ZTWA 4L78A 1H5UA 1E99A 3DBVO 2J87A 1GZSA 4FMDF 5SZKB 1T8WA 1G18A 3X1JA 3T9EA 3DR3A 1S02A 1TJ4A 4FVTA 4CKBA 2WINI 3IP1A 4HAWA 4K9MA 4Y2HA 4YRCA 1BHSA 1QQ6A 3B6EA 3AI3A 4J43A 2XUJA 4QT0A 5ED0A 1DPGA 3ZWQA 4EG7A 2JI4A 2G25A 4MV7A 1QOZA 2DT8A 3RODA 1GXSB 2HTEA 2GPNA 4FSXA 3IT1A 2XE6A 1LBTA 2CSXA 4M9CA 5CVUA 4RPJA 2AI1A 4GZ6A 1M5UA 1CD5A 1CUGA 1PZFA 3C6YA 3OIYA 1VSQA 3OPNA 3P4UA 1QS0B 4UXJA 4BNMA 2KS6A 5IHPA 1NL3A 2AZTA 1Y3CE 5CBKA 2NYUA 3QQ5A 4NTZA 1RVV1 2JFNA 1E3WA 3P5SA 3DEZA 5H02A 4EKEA 1TRKA 1R4MA 2O7SA 4XSGA 1Z8DA 2P3QA 2J7PD 1DOHA 1H1DA 1ZNZA 4CNBA 1Z2CA 1QRDA 1BVRA 3WL7A 4QC2A 1GTZA 4MEJA 3IAAA 1J2TA 1HNNA 2OWDA 3WYAA 2I1VB 1NRIA 4RNDB 2P67A 3A26A 1Q0UA 1BQ4A 1YH3A 1HDZA 4TMFA 3LZDA 4X90A 3OIDA 4XUCA 4YLYA 3RT1A 4HMPA 4IX1A 2WZCA 3VHXA 2QY9A 2VAVA 3EAGA 5HF5A 3BL5A 4UUQA 1EJ0A 1FMJA 1XU7A 4JT9A 1GAWA 4I1YA 2CUTA 3B9RA 1RRPA 1NUAA 1T0JB 3A1DA 1UEXC 3DWGA 4H7PA 4KO4S 1KDRA 4ER3A 1XCJA 3MB8A 2WWVD 2BHLA 2O07A 5KPJA 3SLRA 2ODTX 3ASYA 3M1YA 4IV8A 2EP7A 1K7YA 3QPCA 1E92A 2JIZA 3C6MA 1EGQA 2RB5A 1RJ9B 3JQCA 1GKYA 3Q5GA 2AFVA 3I9OA 4L72A 3X2SA 2PUCA 2F43B 5DHFA 2J3LA 2WP0A 4MIOA 2R6CA 1NLZA 2CEAA 3NAGA 4REOA 1L0BA 5TX7A 3UB4A 5BY2A 3L0OA 1HEIA 1AQIA 1KMQA 4ZO9A 4PWZA 3B53X 1JDSA 2VJLA 4DM4A 5LKRA 2VBFA 2ZBDA 5DYWA 3F2IA 2Y4OA 4HWRA 2O3RA 4M0MA 3WGNA 1RNLA 4OLBA 1AXEA 2D06A 2FW0A 2GDJA 1O9GA 1FYWA 2E7ZA 5I8WA 3E2IA 1J2YA 2W2LA 1F4PA 2DCUA 3O0TA 3HWRA 4BJ3A 4C4AA 3OM8A 5DNVA 5U4QA 3JY6A 5BWBA 5F5LA 1XDWA 4L27A 3RU2A 1AN0A 4Q4JA 4Z7QB 5HS4A 3DH0A 3HA2A 3I2GA 1WOMA 1W96A 3O47A 4DNXA 1S8AA 1WNTA 2GF0A 3AHHA 3CYFA 3KOXA 2O8CB 2OL4A 1CZHA 4FEGA 2HWKA 5U9CA 2JVIA 1P4RA 2REQB 4LOHA 3D4IA 5TB5A 3SYTA 4DDMA 1AKWA 1SPXA 2XSZD 4MR9A 3A1SA 1P0MA 2AG8A 1E20A 1K88A 3AV3A 1PP4A 3RC9A 3PR1A 2CYBA 2QTTA 2GZMA 2O3QA 2W0MA 2X58A 4QLAA 4S0XA 3B1ZA 5KCMA 1ZD5A 2GT1A 5BOVA 3HSYA 3RJ9A 3ZX5A 4GDMA 3GT0A 1EUCB 3EOAI 2LW7A 2OHJA 5C9ZA 2W8BB 4Y6PA 4MP6A 4JVNA 3AVWA 2N0SA 2OO5C 3HABA 1JQDA 3DFZA 1E2MA 3T3DA 3JWJA 1RRKA 4QSHA 3VU9B 4QEZA 5HF6A 4ARUA 5IYZF 4C0LA 1CBUA 3FGPA 3VZRA 3WHLA 3LVQE 4GM4A 3GROA 2WVHA 4G3XA 4CMEA 2VJBA 1CQJA 3LD9A 4GSLA 5F1PA 3U1BA 4CGZA 5E9JA 4RM2A 1CQIA 1ZRHA 3ED5A 3IDFA 4X1IA 1NN0A 2UZ1B 4KL8S 1E1QD 3IP6A 3AUKA 2AOVA 3G1TA 3L6OO 4OKNA 1NYTA 4ZOBA 1JDJA 5IRCD 1E2LA 2WM2A 3WC4A 2IOYA 5BVHB 2V7BA 3EVFA 5F3RA 1ZICA 4DEYA 1XZGA 5BUCA 4ID9A 1GQYA 1R5BA 2I54A 1IZ9A 1VGRA 1BWPA 2AI2A 2B9VA 2CKMA 1G8KA 2EQ5A 5CA1B 5KVVA 1BDIA 4HDMB 3O83A 3LXUX 3PNYA 2V54A 3H99A 3M5WA 3I92A 4QQFA 1EE2A 2F62A 1H2RS 3UKDA 1RRGA 1J56A 1ZGCA 1S8OA 4EELA 4JI2B 3AR3A 3FHTA 2BGTA 2QUZA 5L3RA 2D5LA 1ZH2A 1U90A 2OVFA 3A11A 3N8KA 4GD3Q 4PXAA 2G83A 1C7ZA 1GNVA 1VI5A 1ZMXA 1V11B 5HIIA 2Q4RA 5EI5A 2BMFA 3LF2A 4H6VA 3TRIA 4Q1EA 2PMWB 1FK8A 2ZWPA 3W5SA 1W2GA 4H3HB 4BZXA 2DFDA 1NP6A 4NX2A 3E7FA 1CUWA 1ESNA 1SKUA 1XAIA 3PU6A 5ICFA 5EMJA 5JO0A 3L04A 3MGCA 4UHKA 4AIRA 3I04M 3QTBA 1EVZA 2IZ6A 1E2HA 1QQ5A 1VHDA 2G3YA 2QNRA 2X9LA 2YWHA 3FSJX 4FZ5A 3ZS9A 2RGYA 5AW5A 5ICCA 3DULA 3DE6X 3M3PA 1G3UA 1P5HA 2PKQO 3FWZA 1Z06A 4ZV7A 5REQA 5AW4A 5IDQA 3SFVA 5FFNA 2QRUA 2YXDA 1PW7A 1YR9A 2P7HA 3TL2A 3LT5A 2NXEA 2O2XA 2X2EA 3E9DA 3UV6A 2I8LA 1G41A 3UJ7A 4I1SA 3RTGA 3N2NA 3K4PA 1KQFA 1BDBA 1A77A 2V0CA 2JLCA 5L7YA 3RUDA 1TJPB 5IH7A 4LJ6A 2JH8A 4OO3A 1QGUB 4MI6A 4QVIA 4ER0A 2GO7A 1H9BA 1R9GA 2JI6A 2NADA 3D7SA 4QYSA 4C4SA 1QLHA 4XVUA 3LCVB 4MLZA 4B6QA 3TQOA 4M54A 4LDNA 3K8QA 1X7XA 1EWRA 3QLVC 4NFSA 3ZXXA 4YPOA 1WBDA 3FF4A 1NT4A 2OSVA 5I6DA 3OX2A 4M1YA 4L9RA 4CTOA 2AR7A 1EFUA 4KMMA 5I7FA 2YYSA 1R9NA 3D2LA 1T36B 3V6MA 1V1RA 3JVDA 3WE7A 3ZH9B 1KTIA 3ERCA 3PTLA 4Y0NA 4JUDX 2P6OA 4UM7A 4ZGWA 2QQ5A 3PB3A 1MVNA 5FBLB 1DQZA 5D3QA 3FNBA 3V42A 5LOVF 2IYQA 5JJCA 1DRWA 3BMCB 4JBHA 1WBJB 1A82A 3NBXX 4QDZA 2W6NA 4WRRA 2R5NA 4JJ6A 2WABA 5C8XA 2XWBF 2W98A 2CNDA 3AZPA 3JTEA 4CCWA 3E3OA 2PT5A 3I37X 1JJBA 3PIRA 1UXKA 2HU5A 4HQRA 1BU5A 1I2BA 2CL5A 3H7IA 5AXDA 2AC7A 4N6GA 3CQ9A 1I1QB 4PSVA 4XEHA 2Q1TA 3DLAA 2NAPA 3C3DA 4C43A 3GLGE 3ROTA 1TTPB 2Z9BA 2ZDGA 3H0CA 3MWDB 3W05A 4QKQA 5B57C 1E4YA 2GZRA 4TX1A 3K70C 3IGFA 3P9CA 3VZQA 1D09A 5AI8A 4L4UA 1K6MA 4CV3A 3V34A 1NBMA 2OCLA 3W5VA 2YY5A 4H9GA 5SY9A 4ZWNA 1CE8B 2BFPA 5F21A 2X2PA 4P08A 2JI7A 4RA6A 2NO5A 4E1VA 2Y67A 5K09A 1YUMA 2VAXA 3LKVA 5ESRA 3PGLA 3QITA 1C7EA 5JYEA 3JAWB 1J97A 1IN1A 2B99A 1YQUA 3SX4A 4KPUB 4EGCB 4P6VF 3MTAA 1AHHA 1L4NA 3FXAA 3HNOA 2AIRA 4JJKA 4OFBA 1W85B 3BK2A 3I1IA 4YBZA 4D6YA 2XBMA 3DKPA 4L4SA 1YCFA 2CXXA 3CH5A 3MJDA 4LC0A 1YQ9A 4Q3BA 2AF3C 4DXHA 2A33A 1FS5A 1UOQA 4O3MA 1W47A 3B85A 3IH5A 1PSZA 4CM8B 1XNHA 1KK3A 1ZUWA 2X3UA 1GPBA 2PRKA 1MFZA 3LOPA 4QSMA 2WJAA 3L7BA 2XZTA 4TV8F 4WWHA 1IATA 1FDRA 3B89A 2JKZA 3H4VA 4R31A 1Q1NA 1K6XA 2XMDA 4HGRA 4L8FA 4BIMA 1I7NA 4GLLA 1NVGA 1PL0A 3DJFA 5JAUA 1XJWA 1RM0A 4LRQA 3I9FA 4H15A 2Y8EA 4RIEA 1QK4A 3D8TA 2PBZA 3F90A 4CMKA 1QYCA 5DN6D 5JAOA 3U09A 2F1IA 2ONYA 4A1OA 4JI6B 2Y1DA 2Q5JA 2FDRA 2W4QA 2ZYGA 2BBOA 3CKKA 3FTQA 4JEUA 3HZHA 1IJFA 5IAKA 3PDIB 2P4EA 5CVDA 5DBGA 1Z6GA 2IC5A 2FAXA 4FJ1A 4CG0A 4E31A 3DAYA 4C9BA 5KQSA 3W79A 4PAMA 3MMSA 1XL0A 3RVOA 3JWEA 5JTTA 3RU7A 1UBRS 4RTSA 4LHZA 5EIBD 2D0OB 4GMXA 4W9NA 3NT5A 3QVLA 4B6FA 3GFPA 3FFBA 1GG9A 3LUHA 4GPBA 4ITUA 4DMCA 1MJFA 3QA3E 5FX2A 3MHTA 5LLDA 4E7PA 2VDRB 4RQAA 3KQUA 3PFHA 3EUFA 3WBJA 5CDHA 3EDMA 2ZSKA 2AH5A 1GVNB 3FWHA 1C1XB 2JFFA 1IZYA 2QHXA 3P96A 3EEQA 4R16A 3EPHA 1W5BA 9MHTA 3HCCA 3BF7A 2AOXA 1K7SN 3DOJA 3IDSA 3O2QB 1HO3A 2ZCUA 3RS7A 221PA 3P2EA 2W0SA 1TJ3A 3VI3B 1REQB 5GVSA 5AM5A 2ALJA 1UINA 2PZEA 5HQ3B 2R7MA 1U7HA 1CJBA 2FEWB 2HSWA 4K9PA 4NU6A 1VCMA 3VBCA 1R64A 1KRWA 4N3GA 4BNLA 4FGKA 3ROQA 1YJ8A 5IJ0A 2FZWA 4P81A 1UPUA 3E6AA 3FUXA 5J9FA 1N8TA 2B7BA 1NX6A 1Z6TA 3D6MA 3NJ4A 4AS2A 4F38A 3ZN2A 2XNSA 1VPEA 2FE4A 4L4YA 4MVJI 3VDRA 1G5FA 3SXPA 2HJVA 1CT9A 5B7NA 5I47A 1YDEA 4IDCA 1U9IA 1T5TA 2R97A 4JVSB 4RA9A 5E3IA 4CKEB 4DMGA 5ELXA 2OEPA 3S2GA 3T7DA 2ZJ6A 2PPVA 3GGCA 5AVUA 3DWIA 3A2KA 2XUGA 4RZQA 1PS0A 4OMUA 1WZNA 3LPDA 1WMBA 2FN7A 3BILA 2QB5A 2R7NA 3PL5A 1Y48E 2PUVA 4FYXA 3T3MB 2GEKA 1BD4A 2V7TA 4NKRA 4EHIA 3GPLA 1UK7A 3EHEA 2H2DA 5HE8A 2I7TA 3VU0A 3I5XA 4BVFA 1JBEA 2ZWAA 1RMQA 4U6NA 1ZCBA 1E4EA 4V0NA 3WLSA 4Q6BA 5KTYA 1KETA 1GARA 4P38A 5SZJA 1BROA 1N5DA 4M0DA 2F90A 2FWJA 3VZBA 1JWLA 4GQBA 1QC5A 1VFNA 3WLRA 4G65A 5F9HA 1UODA 2OGUA 3ANXA 4GBED