3RSCA

Crystal structure of calg2, calicheamicin glycosyltransferase, tdp and calicheamicin t0 bound form
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
397
structure length
397
Chain Sequence
HMAHLLIVNVASHGLILPTLTVVTELVRRGHRVSYVTAGGFAEPVRAAGATVVPYQSEIIDADAAEVFGSDDLGVRPHLMYLRENVSVLRATAEALDGDVPDLVLYDDFPFIAGQLLAARWRRPAVRLSAAFASNEHYSFSQDMVTLAGTIDPLDLPVFRDTLRDLLAEHGLSRSVVDCWNHVEQLNLVFVPKAFQIAGDTFDDRFVFVGPCFDDRRFLGEWTRPADDLPVVLVSLGTTFNDRPGFFRDCARAFDGQPWHVVMTLGGQVDPAALGDLPPNVEAHRWVPHVKVLEQATVCVTHGGMGTLMEALYWGRPLVVVPQSFDVQPMARRVDQLGLGAVLPGEKADGDTLLAAVGAVAADPALLARVEAMRGHVRRAGGAARAADAVEAYLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalG2
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase/antibiotic
total genus 141
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA02
3EBOA 9GPBA 1FU8A 4KQ1A 4AMBA 1IIRA 2ACWA 4F96A 1WW2A 2JLBA 2XA1A 1C3JA 2XGSA 3D0RA 2X6RA 3H4TA 3RT1A 1JIUA 2QLLA 1L5QA 3ZCSA 2GM9A 2VSNA 3Q3IA 2X0FA 1FU4A 3DZCA 3T3HA 1GFZA 3CV3A 3NP7A 2R4UA 4AN4A 3BD8A 4Z5XA 1JIVA 2F3QA 2GJ4A 4X7RA 4M60A 5JTTA 4QLBA 4RIGA 1L5WA 5D01A 2WTXA 4MHSA 1FTYA 3QHPA 4M7PA 2IUYA 3NCHA 2QNBA 3WADA 1BX3A 1C50A 1NLMA 2G9RA 2G9VA 3ZCVA 4F9FA 1YA6A 1E4OA 4MI9A 4WACA 1P4JA 1NOKA 2GEKA 2SKEA 3G2HA 3OY2A 4NESA 2SKDA 1M5RA 4FZRA 4HWGA 3L7AA 4RIHA 3MT9A 2IYAA 1PYGA 1Z62A 1FTWA 2R66A 1PN3A 1WW3A 2IV3A 4M83A 4EL0A 3T3GA 4N3CA 4YI5A 8GPBA 1JG7A 4CTMA 2AMVA 3BD7A 1B4DA 1UQTA 1EXVA 4BQIA 2QN8A 3S0JA 2PYDA 1K08A 2GPAA 3C48A 3OY7A 4KQMA 4NC9A 2QRMA 1NOIA 3OKCA 3MRXA 3C4QA 3ZCUA 1VGVA 2H1FA 4YUAA 4CTOA 5TMBA 1XC7A 4X6LA 2C9ZA 3MSCA 2IEIA 2QN3A 5DU2A 1AXRA 3VDMA 3WAGA 4BFCA 3NPAA 1NZFA 2KS6A 3HBNA 4RENA 1C8LA 1LWOA 1HLFA 1L7XA 2BISA 2XCUA 3UYLA 3VDNB 1QKJA 3MS7A 3SYMA 3BEOA 3S27A 2ATIA 4GZ6A 3ZCTA 4MI3A 1YGPA 2BGTA 2QN9A 2XMPA 3GUHA 3MS2A 2FFRA 3PE3A 1L6IA 3OTGA 2JJMA 3Q3EA 3T3DA 2IV7A 3HBJA 1JEJA 3T3IA 2OFFA 5JTUA 5D00A 3SYRA 2R60A 3DD1A 6GPBA 3E3LA 4BQFA 2F3SA 2AW3A 2ECPA 1WV1A 2GT1A 2R4TA 4EKEA 3COPA 5BNWA 5TMDA 3OKAA 3Q3HA 4GZ3A 3T7DA 2PRIA 1J39A 4GZ5A 3MTAA 4MRAA 3RSCA 2ACVA 2QN2A 5GPBA 3PE4A 2P6PA 3WC4A 3BCSA 5DLDA 5DXFA 1ABBA 4WHMA 1P2DA 4CDRA 2XA2A 3TAXA 3L01A 2PRJA 3MT7A 1NVKA 2QZSA 2FETA 2AZDA 3OKPA 3DDSA 3MQFA 3EBPA 2QRHA 1C8KA 3CEHA 2QRQA 2SKCA 1FC0A 3CUYA 4GYYA 1AHPA 4RIFA 3G2NA 4X7PA 2VCHA 3MT8A 2VSYA 2X0DA 4RIIA 2IYFA 4PQGA 2GPNA 2Q6VA 3NAZA 4HLNA 4MI6A 2AV6A 3L7BA 4KQ2A 3S29A 3QKWA 1IXYA 2PYIA 1Z6PA 3CUVA 3HBMA 5TVGA 3T3EA 5ENZA 4GPBA 1L5SA 4REMA 2QRGA 1XV5A 2G9QA 3G2JA 1SXPA 1JG6A 2XCIA 1GGNA 1L5VA 4GYWA 1GPYA 3C4VA 2VCEA 3MS4A 3NB0A 4XIFA 1WUYA 2ZB2A 1SXQA 3CEMA 3TOVA 1EM6A 3CUWA 4LDPA 1UZUA 3GPBA 3RSZA 3CUUA 5LQDA 1E1YA 1WUTA 3MRTA 1V4VA 3E3OA 4RELA 3MTBA 4BQEA 3MRVA 3OTHA 5TMEA 2IEGA 4FKZA 1O6CA 1Z8DA 1GZ5A 3ZCQA 3G2KA 4N9WA 2QLMA 3BDAA 3S2UA 3MTDA 3L7DA 4EL5A 3FROA 3TSAA 3VUEA 5IKOA 4N3BA 3DDWA 4YI3A 2F3UA 5I45A 5HXAA 1XKXA 1FU7A 1XL0A 1K06A 4F97A 3OTIA 4L22A 3IAAA 1UQUA 2QN7A 3IA7A 4G2TA 4EKYA 2C1XA 3G2LA 2H1HA 2QN1A 1JIXA 5IKPA 4CTNA 4RIEA 1PSWA 1RZUA 3G2IA 1P4GA 3O3CA 4EJ2A 1L5RA 1XL1A 4WADA 1FS4A 2IW1A 2XGOA 3H4IA 3NC4A 2F3PA 7GPBA 1Y6FA 1FA9A 2O6LA 2C4MA 4MICA 1NZDA 2BGUA 2C1ZA 2XA9A 1XOIA 1P4HA 1LWNA 3BD6A 2G9UA 1Y6GA 1FTQA 4LEIA 3D1JA 1F6DA 2X0EA 2PQ6A 2GPBA 2ASVA 3UYKA 1QM5A 1P2GA 2BFWA 5C1DA 3CX4A 1GPBA 1KTIA 2FF5A 4XI9A 4NEQA 1H5UA 3BCUA 4X7MA 4AY6A 3NP9A 1F0KA 2HY7A 3ZCRA 4RBNA 1RZVA 1PNVA 2QLNA 2VG8A 2XGMA 3L79A 3E3NA 3T5TA 4N39A 1P29A 4AY5A 1NOJA 4AMGA 2YJNA 3S28A 1A8IA 3RHZA 3MBOA 4W6QA 3VUFA 3ZCPA 1GG8A 3CUTA 1Y8ZA 4MHOA 1RRVA 3BCRA 4N3AA 1GPAA 3OT5A 2F9FA 2X6QA 2QRPA 2GEJA 2R68A 3L7CA 3AMVA 2JZCA 3D0QA 3HBFA 3CEJA 1P2BA 1WV0A 1Z6QA
chains in the Genus database with same CATH superfamily
3EBOA 3OA0A 4NBLA 9GPBA 1H66A 1K88A 2X6TA 3OZVA 4EFKA 2I33A 3T7EA 5K2OA 4IEFB 1EVJA 5JASA 2H92A 4H7DA 4DLPA 3CZQA 1DUSA 3IAEA 3AUXA 2E7ZA 2PH3A 2RHCA 4NSNA 5JAIA 2FKNA 4HDKB 2O5CA 1YIDA 1YR8A 2IPOA 1EHIA 1ZYUA 3RUDA 1DARA 1WJGA 3B9RA 2BI4A 4V0SA 3FRHA 1DTSA 2R7MA 1NBEA 3S2GA 1J0EA 1H42A 2O8VA 3DB2A 2AVDA 2YFKA 3AOEC 4RK6A 5D8DA 2OE2A 2GTHA 3ANMA 3VHQA 1M6HA 2VSNA 1YVPA 3IBTA 3TSOA 2Y8EA 4ZI7F 1KMHA 2E4AA 3AY3A 1N57A 1QFSA 2QENA 3DZCA 4TYQA 5B7PA 3CWQA 1UDBA 1FF9A 3AUJB 2W6ID 2XADA 4LQCA 5CVTA 1ZUD1 3KRTA 5F64A 2ECKA 1L7EA 2B1QA 3EDCA 1DZIA 3COSA 2RGGA 2GBFA 3R20A 4JCOA 3EIFA 3QYJA 5CNKA 4MLPA 3R5XA 3O8OA 5SYAA 1ZGHA 3NNNA 4DT1B 2WSSA 4OI0A 2HCFA 4Q18A 2W2NA 4UU7A 4XGNA 1Z82A 4OGFA 4N7JA 2Z3ZA 3D6JA 4Y2RA 2R8BA 1NXPA 4BP8A 4OGGA 2WYWA 2OHFA 3B3FA 4RANA 1YC2A 5K0CA 1JIIA 4PZDA 1Y80A 4KK3A 3IHLA 3U39A 1SEPA 1MH9A 2H7YA 3IJEB 4US2R 4KPUA 3A6HA 2VYVD 3FYDA 5CLLA 4CLXA 2NIPA 2TRSB 2UZAA 3Q87B 4Y7DA 1ESEA 1IY9A 1VE7A 2VBIA 3KAJA 1DI0A 1G19A 1UEXC 3SDZA 3PYMA 1HL3A 3AILA 4KLZA 1ZR2A 1UBCA 1KXJA 3IPXA 3QVJA 2QTCA 5DTEA 1JXOA 4JIGA 4D9JA 1DFIA 1CQJB 5CU7A 1XI2A 1B00A 3STXA 3BTSA 3UJHA 5EIEA 1T35A 2CB9A 2UYQA 4X84A 5BW6B 5BO5A 3ZK8A 1BH6A 4PANA 4DTCA 3I5XA 1WY5A 2EKPA 2P11A 1R88A 4IDOA 4IQGA 4UAVA 5DBGA 1K5PA 5B2ZA 5JATA 4C21A 2OCDA 1E4YA 3I4LA 3R6LA 4FYWA 3VR1A 4EECA 5THXA 2YOHA 1LSOA 3HM9A 3KQSA 4RA6B 4DV4B 2ZUBA 4AYTA 1M8KA 221PA 2V65A 4IKOA 2R79A 2J45A 2AXQA 2ZT6A 1V3TA 1QO7A 3CZCA 1I0ZA 4YTEA 1ZL2A 1FDWA 2IV3A 2QL9A 3V46A 4R3WA 5FBVB 1T2DA 5DSTA 4PG8A 1JYEA 2DLNA 3W04A 5KEIA 3OCCA 4RPLA 2BFAA 3SFZA 2Q50A 1YVDA 3F5SA 1IN4A 2RH5A 4RMNA 3SAJA 1KH3A 1KVQA 2YJ3A 5FL3A 1QIJA 2A9KA 1E98A 1KZHA 1KRXA 2GN0A 2QTMA 3ZVKA 4J2TA 1BMFD 1NNLA 1TJ3A 4IDGA 1WBDA 2X0IA 4MCHA 3G9QA 3VNQA 1KRHA 1J33A 1YB1A 4UPDA 3T3PB 1DBPA 1VOTA 4ERNA 2QD1A 3D7KA 5CNIA 4YP0A 1EQ2A 2VNKA 3OCJA 3OY7A 3LQ1A 4D3FA 2J3KA 4UUAA 1SFRA 1P2TA 4H0FA 2DEUA 4NICA 3CE6A 1Z0IA 4RXTA 1J4AA 2VSQA 3GJ4A 3OU2A 4KXUA 4UBKA 2LCQA 4A73A 4EKGA 4BO1A 4XFDA 1B6GA 3OJEA 3UMSA 3P20A 1M83A 2H9YA 3AEYA 3HDVA 4LQLA 4L78A 4F45A 1TQ8A 1XWWA 2HK6A 3AKDA 1UK9A 2WIGA 5IM5A 5ALKA 3UAXA 4V1CA 4KGDA 4OH7A 4L6AA 4YUAA 3E0XA 2MYNA 3N7TA 4QSMA 4QG7A 3PC8C 3S1LA 1XC7A 2WHXA 1SWWA 3UMFA 4KXFB 1A04A 4IVNA 4BVAA 4Y0AA 4WL0A 5B3JC 4IRUB 3PUYA 1AZWA 4Q4AB 1S02A 5DU2A 4WSOA 3UK1A 1SR8A 1MB3A 4PFQA 2G1JA 5JW6A 3WAGA 1QJCA 1T3LA 3SWWA 1MO3A 3FWKA 4B3MB 3E84A 2JASA 2GVDC 1MF7A 5CUQA 4B6RA 5A05A 4DCVA 4G0UA 3GJSA 5CG1A 5K05A 3T0FA 2PKRA 3L7KA 2Q5JA 2CUNA 3BXHA 5C34B 2OUKA 4MIYA 3VDNB 4PIMA 4EYKA 3UK2A 5I4IA 4H1TA 3F67A 3IDOA 3JWJA 3MS7A 4IZIA 2BEKA 5IF9A 4DR6B 1OMOA 4MW9A 1FW8A 3ZQ4A 4EA7A 4FW8A 3OZGA 7ADHA 2BFDB 1JU9A 5LKRA 1JLLA 4EJMA 2PBFA 1P1JA 4PRZA 2G71A 5IU6A 1NUAA 2G67A 2QN9A 4GBMA 4TL7A 4DR4B 4YR7A 1NJFA 3MS2A 3W8DA 3T7SA 5IWAB 3LNTA 3LF1A 2P5TB 1OC4A 3UWPA 1DSSG 1I5EA 1JEAA 1Y4ZA 1Y1PA 2FSVC 2IIPA 3GMSA 4MV6A 2IV7A 4EB6B 5KNLA 1PNRA 2XR1A 5CPFA 4TMWA 2ATEA 2KBEA 1E2EA 3QKSB 1UK7A 3CT6A 5EXXA 3DCNA 1NVVR 2FN3A 3RGWS 4CPDA 1KYTA 1V3UA 3F3YA 1NTOA 4JUDX 4PLZA 1L4MA 2NX2A 2C31A 4MGHA 3KLNA 3WR5A 3X2SA 4D3SA 4LZAA 1XEWX 2F3SA 2FSHA 1CHDA 1NNSA 3USZA 2JB9A 2RJ3A 4ND6A 3AYZB 5IH3A 4KIFA 4AO6A 4Q4HA 1DCMA 2H4HA 4H31A 4C03A 2QT9A 4P35A 4MW0A 1ECFA 4UUOA 2YZMA 4OGWA 3RAGA 1RQNA 1LDGA 1KFKB 1MABB 1UKZA 3E81A 3KHTA 3OT1A 2WTEA 3C7TA 3H2IA 4Y67A 4NK5A 4BN4A 1PJAA 1ZN9A 2HMWA 2IIBA 4YXWA 2QF7A 4JLJA 1U2DA 2OYRA 3VAYA 4A2PA 4DSZA 5JCJD 3GLKA 2GPWA 3A1SA 2IDMA 2WU3A 4MJXA 2CF6A 5IM4F 4M8NE 2PU5A 4OFZA 2PGDA 1P2DA 3LC1O 4LV5B 5C5CA 4U6QA 2VXCA 3U44B 4M1QA 2VL7A 1JAXA 2YXEA 4JP2A 2ZPUA 5CDFE 3WHLA 3WNVA 4DPLA 4JZYA 4KYTA 4FHEA 4AXBA 5EUMA 3IEVA 5TDHA 4I9UA 2CD7A 3I9KA 4XE5A 5HQTA 1R4NB 3CKMA 3DDSA 3ZD8A 2HFKA 3DHWC 5A4AA 1K3FA 4H6XA 4IP0A 2H59A 4RVFA 3EUWA 2H7VA 2FPGB 3IAM1 4FX5A 1TM5E 1SQSA 2XKBA 5EMJA 4UHCA 5DYTA 2YXBA 3HY6A 4NV1A 1E1CB 4QU0A 1XDZA 4PHCA 1N2GA 3NTVA 2XAAA 4IMPA 3QKRB 4JKIA 4EB8A 3NIDB 5J63A 1G0NA 3B1WA 3ET4A 3FMFA 4M1OA 1MPTA 3UJ9A 1ULSA 1VYVA 4FMBB 1Z12A 1GA4A 2FFHA 4FNMA 1ISJA 2G1PA 1NAIA 1O96B 4RH1A 2J32A 3F3SA 3JRNA 4XUEA 1V9SA 2WPNA 1QXSA 5BSUA 4MVJP 3QEJA 1DV2A 4PHTA 2NUAB 3VR6H 5BN1A 2VDLB 1MQ8B 4E5KA 1GRCA 2P40A 3GA7A 1ML4A 1XTUA 1NSTA 4ZI2A 5KYUA 1I3MA 5JZMA 3KEMA 5CFPA 4REQB 4B74A 5HQ3B 4PGAA 4AJEA 3F97A 3COZA 2A0FA 4HDSB 2CMDA 2H5JA 3UJ7A 2YYAA 3DCIA 3N2IA 3Q7IA 4MW6A 1MHPA 2PZ8A 4JCCA 4Q7MB 3UZUA 4H9GA 4CKBA 1ZRNA 2D74A 3TM5A 1XHFA 1EFAA 3ZXIA 3CNOA 1H1DA 1JG6A 1MB0A 4LQ4A 4QEKA 5CX1A 3BEDA 3U37A 3EQZA 3ZTYA 3BSFA 1Z29A 1WRBA 2COEA 2HO5A 1E9FA 3HJRA 4TT3D 4CXMA 4D97A 4PR0A 4RFSA 1GPYA 1B73A 2YINC 3M83A 3F78A 4IKEA 3QYPA 2O59A 1F17A 5L4LA 1MO4A 4DEXA 1ZIDA 2IXGA 4G26A 3VU0A 3SBDA 1OWNA 1YRQA 3CEMA 1CK4A 3IOCA 4JB3A 4DBLE 5KYKA 3VNVA 3MTEA 1XZHA 1YQXA 3VU1A 1ZITA 2O3TA 3ISJA 3N9IA 4LHSA 4B79A 3I73A 4OMDA 1IXRC 5EWJB 4PTYA 4RDCA 3SQWA 1PZXA 4HCJA 4BJ3A 1XNRB 4MQ4A 2AF4C 5TXGA 1Y8AA 3O3NB 4E5PA 2PX0A 2QYTA 3Q7TA 4JS0A 3RRXA 2XUDA 4ASUD 4GEGA 3F73A 4P4GA 2XZOA 2WJJA 1H22A 1O8CA 2QTAA 3DDZX 2QA5A 2WD8A 1JE0A 1ZRMA 4I4TB 5DSXA 2R5FA 4FYIA 1ODKA 4U3JA 4ZI7A 3LVFO 4BCBA 3AWDA 1TO2E 3MRTA 1XD2B 1L0BA 3HS3A 3KCQA 4P80A 1TO6A 2W6IA 4JC0A 3SXUB 1LK0A 1RBYA 2AFIB 3N3AC 3AJAA 4BWVA 4PN7A 4R05A 2CWDA 3DNPA 4TWIA 3W5HA 5JUWA 1NF9A 2DM6A 2ZWPA 3MRVA 1MQAA 4DC1A 1VIAA 3BYZA 3HR4A 1D07A 4UZFA 1D0VA 3C14C 2O8FB 1L5GB 2O8DA 1U94A 1UJNA 4BLWA 2M1ZA 1D5WA 3BK2A 1EH5A 1TEHA 2GCGA 4QFDA 4DSOA 4F2HA 1HSOA 4ENTA 3G82C 4DR1B 4AU1A 1TX4B 2EV9A 1Z6GA 1C4XA 2IT1A 3HRKA 2IELA 3R24A 1JLSA 3VR4H 4WT7A 2R6FA 5AW6A 1NN1A 3H6KA 4ZTBA 3A1WA 4ZJZA 1SU4A 4CJXA 2PGIA 1RVDA 4RHUA 1CUBA 2WOJA 1PWEA 1WKCA 3NFYA 2PEZA 5FORA 3VNAA 1YZUA 4YMVA 4B3DA 4LHZA 1KFCB 2DE0X 2ICAA 1VPLA 4HTFA 1XL0A 4LV6A 3SC3A 4AJOA 2QRVA 4JLVA 1Q6ZA 3P32A 3UIEA 1OB2A 2GHTA 3E9CA 4IXTA 5TQ0B 1LI5A 2QGNA 3S28A 4WBNF 3MWDB 4NIMA 1F7VA 2J3LA 4ZGGA 2K2QB 2IZOA 1Z4PX 4OD0A 4XVUA 3IDAA 3TFOA 1PX2A 4L22A 4QUEA 3IA7A 2AW5A 2Q27A 4KJZA 4RA9B 3RTDA 3L49A 4OX9B 5HRUA 2PH5A 1JKJA 3EVGA 1P7YA 4G4JA 1OWOA 4NFLA 2VS1A 3KE9A 3H7IA 1GPNA 3TPCA 2OZVA 1UADA 2P5UA 2ZBDA 4BRSA 4ITUA 4IIFA 3TQSA 1QZUA 4EG7A 4UVIA 1WB4A 3G7SA 2AKEA 1JHMA 4BX8A 1H9CA 1Y3FE 3G2IA 2UUOA 1W5TA 4M8SA 4DY4A 1E58A 1NVMB 1XVLA 1CUGA 2QPAA 5AVWA 1THZA 4L5AA 5MGBA 1PFUA 2OHGA 2DERA 3B1KA 1AKMA 4Z0TA 3WOHA 4B75A 4LRXA 2FMUA 1L8AA 2J30A 3K9QO 3EF3A 2YRFA 2VHEA 5E1MA 1EA7A 3W3AD 4NARA 4IG9A 4KPGA 5A9RA 1DOAA 1OASA 1VA4A 2GHIA 3QG5A 1CD5A 1KZ1A 2BY4A 1JAHA 4OAOA 2FZ5A 2JCBA 5DZSA 9LDBA 5JH7B 3UFXA 4YONB 2J3QA 2KWIA 3AESA 3VC2A 4OJQA 1CY1A 3KYCB 5JVDB 3U4HA 2JIOA 4Q39A 1BO6A 1G42A 3C1AA 4ZQGA 4ERXA 3NAMA 4FTWA 1X9GA 1WBBA 1GTRA 1UMBB 1I33A 4Q9NA 2VSXA 1XK7A 4JP8A 2ASVA 2WT8A 4FGKA 1L7OA 2VWQA 2COKA 1JEEA 1RMYA 1F4VA 1H4QA 5L6LB 3GNQA 1IOWA 2E5LB 1AKRA 1DZ3A 4NOLA 2Z2KA 1GCOA 3K1TA 3I9JA 1DKOA 1JIJA 1OX4B 1P1RA 1BS2A 1Y3BE 1GQRA 2J3MA 5AKEA 3D0KA 1YGYA 3PHBE 1SIBE 4ZU6X 3D7NA 5CFQA 5JZOA 4D3ZA 4LF6B 3LCUA 1LW6E 4MJ7A 2DFKB 3ZI7A 3LM8A 3IVGA 1QHHB 3UK6A 1JZSA 2XGMA 3F9IA 3N2KA 5DKFA 1OXSC 3F6BX 1NRIA 1QC5A 1S5PA 3IIMA 2PLWA 4FGJA 2C4HA 3U1VA 3MLEA 1QJ4A 1V3VA 1DAIA 4KEAA 1SIUA 2H2IA 1NP7A 4JOBA 4L5IA 4N6GA 5AVJA 5GONF 3QE9Y 1DO8A 1GYPA 1B8PA 1E59A 5AI9A 4OLBA 4OYYA 4UHHA 4A8TA 4C4ZA 4GKVA 5DYWA 1YAHA 2AFHA 2HJHA 1HEUA 4NCNA 4PFJA 1E99A 1GT6A 5KAMA 3KQYA 2JEZA 1EK6A 2B5VA 3LWDA 3S44A 4K6OA 1Y8ZA 3TTYA 3KT3A 5L6MB 1U2TA 1II9A 4D98A 2HNAA 1L3IA 2Q6IA 3FMIA 5JAMA 3JCZA 1RLIA 5IC5A 4B6GA 4RJTA 3G2QA 4P84A 3IBSA 5D51S 5AIAA 3RU3A 1H0RA 1JA9A 3V8PA 4JSYA 3LIPA 4A0FA 3E9MA 5CLIA 1K8ZB 3CNEA 3I6QA 4FYVA 3R5SA 4J0QA 3AVUA 3OE7A 3SJUA 2AH5A 5KOHB 3EZ9A 5CIYA 4JDPA 4KQ1A 3IQHX 1TT5A 1V5IA 1EYZA 1E8MA 4KIWA 1Q0RA 3I05A 3UUWA 4G0NA 3DFIA 1WMFA 3G0BA 5EP4A 4LSMA 5FJJA 4ZK2A 4JLBA 4ZVOA 1P75A 2HXGA 1XZCA 1RKBA 2XVZA 3IB3A 3FY4A 5DLPA 5IM4A 1NAHA 2AZXA 2XBMA 5KU7A 3T7TA 3GWZA 2IOQA 1FFEA 1E9SA 2X6RA 1NMYA 3A8TA 5IAGA 5LU8A 2IBSA 3HXLA 3OQBA 2IYUA 3G8DA 3B6EA 3IURA 4IIXA 2O2XA 3B2QA 2X1LA 1M0WA 2GERA 4HXGA 4IZHA 3AL3A 3L8ZA 1U2GC 2VQ6A 2WIAA 3HCRA 3KT0A 4FCWA 1E64A 2H4ZA 4XSGA 1EKXA 3CX7A 5D87A 4BN5A 3HBAA 2B20A 3F4LA 3L8DA 4DIFA 2BEWB 3UPTA 4JKOA 1NPTO 5CITA 1R50A 3QFTA 2BJVA 3QRWA 4DNFA 4CKCB 4LPKA 4JBNA 1Q0SA 1EK0A 3PR1A 2B8NA 4GNKA 2ZT8A 4R8KA 4R9UC 4X7RA 5B36A 5JSFA 1MZVA 4MHSA 4L2IA 2FPOA 3QHPA 5CJ2A 4P81A 5IUJC 1FSZA 2H51A 2GFIA 4OREX 1FUKA 1SU6A 4FUTA 5AD1A 1L9KA 2BBTA 4GPAA 5EXTA 1MGPA 1NLMA 1Y9EA 2I71A 1YRYE 1CJTC 4YP5A 3A04A 1N2HA 3O47A 1VLMA 1IBMB 3ZCVA 3LUGA 1PBTA 2GM3A 3MRSA 4HV4A 1ACJA 2EFHB 3TW6A 1BS1A 2NZXA 3W5IA 3HDTA 3ZVMA 3GP8A 3R0VA 4W5RA 2DBZA 3FSEA 4I4CA 3OJWA 1W5BA 1YR6A 3A6LA 2OK7A 4EG0A 1WPRA 2FPRA 4OA5A 1ISRA 3WIEA 2VIIA 1EDZA 4FFLA 3E22A 2EIHA 3ITDA 2O2EA 2X9LA 5H5JA 2C8VA 3GPDG 4JD5A 3DV0B 4W1RA 2HQOA 4AW9A 5CM9C 5T8KA 2YZ2A 2AFVA 4W8GA 4NFYA 3MJEA 2YY7A 1E1LA 5AJHA 4WCDA 5A0TA 5FPPA 2O3SA 2ZSUA 2QP4A 4LQDA 4HEA6 4AJKA 3KTAA 2IXFA 2NO9A 2R66A 1MEOA 2WU1A 5DWVA 4Z9BA 4GS5A 2QRJA 3RHTA 1ZMTA 3WYBA 1YFJA 2WVHA 2ZRHA 5FEUA 4HZUA 2VWGA 4R1OA 2WNIA 4GI3A 1BCSA 1K4KA 2IKQA 4GLJA 5K3AA 1PRYA 4FFBA 4IGFA 3F5QA 2AOTB 3GLHA 5NLLA 5REQB 1M54A 4RD0A 3EGXA 9ABPA 4TKUA 2GPAA 4DRYA 1K6JA 3KUUA 4G5HA 1U7XA 1VSTA 1YQEA 2P9ZA 2PU7A 4HFRA 4RXMA 4ZVSA 1YJAA 1W0CA 2R5NA 4I6EA 4OH1A 1ETHA 3C4QA 2GLTA 2O9JA 3B1VA 1OKKD 4PNHA 5MF6A 5C3UA 1WA5A 3JZMA 4RHCA 5B58C 5IJWA 3BQ9A 3QJYA 2R4QA 2H0RA 3G9XA 4Y0NA 4IKPA 4ZOBA 1X1QA 4JJIA 3ZI0A 5TMBA 4BNJA 1L4UA 3FSJX 1LZLA 1TUBB 1XALA 2G08A 2QN3A 3OHPA 3ODGA 3ER8A 5FNVB 2PKXA 4CL8A 3GUUA 1CJBA 2OCXA 3L6RA 4Z9FA 4PAMA 4WINA 4XDZA 4UNSA 1RKQA 4HD8A 1UF9A 4FT4A 1S2OA 4LSGA 1EVYA 1FLVA 1LC3A 3FLAA 3H2GA 1SU7A 3GNSA 1OFHA 1QOZA 5ITSA 3Q9NA 3GRRA 1A9RA 1RJ9B 3I34X 3B1ZA 4K9SA 3TXYA 1V8ZA 3GLFA 1G2PA 1TAQA 2I2WA 4P08A 2BBWA 1R0SA 1BW9A 3DTVB 4EQ6A 3PDUA 1J0BA 3WRXA 1P7CA 4QG3A 5K0FA 2NXEA 3B9QA 3KSRA 2NV0A 1Y7HA 2O05A 3QPAA 1UOPA 1HMYA 2P9BA 1X1EA 2Z5VA 3GHYA 1Q2XA 4K88A 5IX8A 2C82A 3TZEA 1GGJA 1G0OA 2G8LA 2WA2A 2H9IA 2B61A 1CYDA 3R5TA 1ZGZA 3W2GA 2QZPA 4TRNA 4UW9A 1ORWA 3EVZA 4ZYYA 5JRDS 1H2FA 4NAUA 4WBNA 5P8WA 1E2GA 3QUBA 1QHSA 1IJFA 1SZPA 2ADOA 1QG0A 3QEAZ 1W9HA 3V5NA 5LD2C 1P61B 5AM3A 1WHSB 2QVZX 2FAXA 2PO5A 3V7YA 3HUTA 1E7QA 2KHZA 4EKDA 2VEOA 1E6KA 2DWQA 2XNDA 1BWQA 4OSOA 4XJVA 2RDMA 5AYVA 3RS9A 4WN3A 5JV5A 4RULA 3LYUA 1DP4A 1CRZA 1Y1SA 2BMDA 1XLWA 2QRLA 4MVXA 3H9GA 3EEFA 3PBKA 2GT1A 5AVOA 5H9VA 3Q2OA 1RKVA 1JBKA 3MNFA 3LLCA 3KQVA 3FCCA 2JGAA 3H17A 4ZMBA 1YR9A 3Q3HA 3QVOA 2OO5C 1FMJA 2HQSA 4I1SA 5JDIA 1NUTA 4O2RA 1WUKS 3KSDO 1BC5A 1ZVKA 3DR3A 4MWEA 1C1XB 2LPMA 3VKHA 1DL5A 2A5FA 3EG9A 3R3ZA 2CXQA 4M98A 3V8MA 1V16A 3ZX5A 1UMDA 1C1DA 4Q01A 2PD6A 2IITA 5DLDA 3PPYA 5EIBD 2D0OB 2H31A 1UMCB 1JHRA 1IHOA 1R1DA 2XNHA 5IAAA 3BXPA 3CE9A 4QJ4A 2UYCA 2AR9A 4J29A 7REQA 2L2QA 3I45A 5BWMA 3CYFA 3L01A 4WA8A 1CR4A 1FRQA 3GRKA 2ZIXA 4XUDA 1MQSA 1MJFA 1M2EA 1X86B 4YCJA 1I4EB 1GNTA 2GAAA 3ZGLA 4CR7A 3FJYA 4PIVA 1E69A 5JLJA 1QP4A 2OV2A 3EBPA 4QVKA 4OJTA 4GL2A 2XODA 2XDAA 3L6EA 4NCIA 1CB0A 4BFVA 3WL7A 4J0HA 5DGHA 2QRQA 1RCUA 3LT0A 3WGZA 1Q3TA 1HOXA 3CIFA 3IRUA 1KIMA 3TK1A 1BMTA 3WWDA 4HFJA 2BR5A 1JPUA 2IQ5A 2AD1A 1JR3E 2NN3C 2W6MA 4JT9A 1EB9A 1Q12A 4UPVA 1O0BA 3O91A 4P4SA 3W2EA 1WXIA 3A6GA 3EUEA 4IO0A 1CQIA 4RGVA 4W4TA 4EYEA 4G81A 2WINI 4WCFA 3RFVA 5EIHA 1V7CA 4CEJB 3A36A 3EDYA 2GAFA 1IQRA 5CA1A 2OBLA 5ELXA 1Y8QB 2ZB7A 3HL0A 1OH8A 1VE5A 3QVSA 2PFKA 1XE3A 2JRCA 4IEIA 3I9NA 3OX4A 5EZYF 2QJFA 3N2EA 4LXGA 4MPPA 3DGEC 3AZOA 3MTGA 4ZVVA 1Z35A 3UK0A 1MEEA 1XP5A 3RLIA 5CEJA 4BX9A 2Q6LA 3RUHA 1X38A 4BCCA 5L3SB 3A6PC 4NABA 4QIHA 1CDEA 3G49A 5AK3A 5LFAA 1HQDA 2WLTA 4DLLA 5B3KA 1WEKA 1Z5GA 3L2OB 3IEUA 3QYAA 1NI4A 1Y4UA 1B93A 1R0RE 1X74A 3MILA 1P4SA 1YHYA 1LNZA 2DU8A 3L5KA 4IQ4A 4TUYB 3FOEC 1XTIA 1KZYC 2IZ6A 1M6VA 1TD9A 2VDWA 4LHWA 4CM4B 5THQA 3UJDA 4KXYA 3GA5A 4OQXA 4BYMA 1D6JA 1TZBA 3AGPA 3WSTA 4F5YA 4M0EA 4Z7NB 5C2JB 1GQ2A 3UAVA 1YA4A 2GLUA 3VOSA 2PXAA 5KVVA 2OP1A 3EIXA 5G4KA 1RE0A 1EJ2A 421PA 3NCTA 1ZMXA 1Q6YA 1RVV1 4DYVA 3ZQJA 4CM7A 5TT0A 3FOAA 4NU5A 1U9IC 2AYYA 4MS3B 2FEKA 3UUEA 1Z8NA 1JQBA 2X9NA 2G4LA 2VQDA 3IV9A 1N8KA 2W71A 3CO5A 3OPYB 2Z56A 3Q98A 2CNWA 3BL6A 3QV2A 1YL5A 2I8LA 1Z68A 3RRMA 3T1VA 4A10A 1BD3A 4AMYA 4WUVA 2AB0A 3OU7A 1ZD2P 3TFQA 5ALNA 3SBEA 5LQDA 3AVTA 2C3OA 2R11A 4JBYA 3GLGB 2F8SA 1GFIA 4ZCPA 1XZDA 2BKEA 3CN7A 1NNI1 5D3QA 5FH9A 2C8LA 1I7PA 1C81A 3FCAA 1WSBA 2CEAA 4BZWA 1MH1A 1RXYA 4MYDA 4Q3NA 3IEIA 1V4VA 4TV9F 2JJQA 4R68A 4UBMA 3ROEA 3CLHA 2FHPA 1EG2A 4PFSA 1S2DA 5AI6A 4OU4A 2CJYA 3RIMA 4S1WA 2V5VA 3QITA 1XTVA 3VA7A 3ETLA 3GEPA 4HN2A 4KH1A 1EZ1A 1VRVA 1GPWB 3H1BA 5A5GA 3M49A 4ACBA 2QW8A 3NWPA 5CAEB 2PUCA 1NBAA 1CUVA 1UJCA 2NO4A 2ZROA 1P0IA 2QTHA 2Y6UA 1EFDN 1MVLA 3FIUA 2Q2WA 4BUZA 1ZNXA 1YZQA 3L7YA 4G5FA 1QIKA 2NZJA 5FWDA 3TWOA 2PRKA 4OI4A 4MDEA 1AUOA 2WYVA 4XM1A 2DKFA 3DXYA 4KP7A 4XLLA 4ZT2A 4OM7A 4WOBA 1M2GA 4B76A 3RIGA 2Q5EA 4L9RA 3JAWB 4FBGA 3GVIA 5KKNB 2V0GA 5IHPA 3DW1X 3LLUA 1KAOA 2G07A 1Y33E 1GUFA 4S1NA 2BOVA 4KQEA 4PZCA 1E3DA 1SG6A 1ULZA 3BWCA 1CR2A 2QVBA 4LCJA 5EWMA 3BAFA 4KWEA 2NO6A 4MUFA 1Z5UA 2DR2A 4YRFA 4G65A 4MKHA 5E38A 4F8EA 2F17A 3BERA 2BL4A 3P71T 4LJ8A 4HAYA 1AKVA 1Y0BA 4QGGA 4XM0A 2P69A 1W19A 1QDUA 2DAPA 2H1HA 4DLWA 2VEDA 1TMGE 1W0KA 4BXOA 1JIXA 1NN3A 4PG4A 1UPTA 2V7PA 3JQDA 4W8HA 5I7WA 5KWSA 2IBTA 1XZKA 1UUFA 2V7UA 3FD8A 3V4VB 1PD1A 3H8VA 4TTSA 1WZ2A 1R6DA 2EBFX 4OYRA 3FDJA 2PX3A 3N87A 1DBQA 4UM7A 2XUIA 3S2FA 3NMUF 3ZV5A 1S2IA 3R2JA 4LHEA 2J0EA 4QXQA 3PICA 4KVGA 2DMRA 3G2MA 4JX8A 4KACA 3FFXA 1BQ4A 2L82A 5CVVA 4BO7A 1RC8A 5JCPA 4H60A 3ZEAA 2C9DA 5J2UB 5AVKA 2EGHA 1WDWB 3JQCA 3OETA 3UGKA 3BE5A 4NI5A 5HRAA 1CRQA 1SHKA 1R6TA 1RQXA 1WD5A 2I2AA 2NQ2C 3HRHA 3UJNA 2GK3A 2VP4A 3JQ8B 2BHRA 1NMEA 5K3CA 4D80A 4RHXA 2WTNA 2BMWA 3HLYA 4M1WA 4AZVA 1XVVA 2FLKA 3GCWA 4HTAA 5FDFA 4OP3A 3IHKA 4YRDA 2CFIA 3RIYA 5U9CA 3E8SA 2JJ1D 2WW8A 4EA9A 2ZRCA 3F47A 3UXEA 2V96A 5C4GB 3OBIA 2G7MC 1XROA 4QLOA 3BAZA 3CLSD 4E5SA 5J59A 1VKNA 4H17A 3A7DA 2XCTB 5CDSA 3JD0A 4CQLB 3O90A 2AI3A 4PG5A 4GI5A 2QPLA 2XTAA 2IZ0A 1RAHA 4D3YA 3ABQB 2CKDA 3WQBA 3GAMA 1EVEA 1IPHA 1FFXA 2OZEA 4TQUS 3RK1A 1LFDB 5K4GA 3K8ZA 2WMOB 1O6GA 3N1UA 2C96A 2YVKA 1ZM7A 1F3LA 2X3UA 1PUXA 4JIMA 4Y9UA 5LZ9A 2GD6A 1KR5A 1F0KA 1CS4C 3GP3A 3HCBA 2VF7A 1UBNA 4HJRA 1RZVA 2AGVA 4UUNA 4WWHA 1PNVA 1J07A 1EJ0A 1VDZA 1H8HD 4NULA 3AHJA 1DAGA 4XGQA 3IESA 2D8MA 4FMDF 5AJYA 4IDDA 3NDJA 5G1OA 1NLFA 4PO9A 4EGAA 4LYGA 2HC9A 1KORA 1OFVA 2VP2A 3H4MA 3CF4A 1G9SA 4B47A 1X1BA 2ZJYA 4ZPJA 2M2IA 4MR8B 4BNUA 3RFCA 4BFLA 3D3WB 5LQNA 2ZR8A 1EDOA 1SNYA 3DLIA 4HQNA 5EN4A 1J90A 3A6KA 4UFNA 1JNXX 2ZBQA 3B5JA 3SHWA 3JXEA 2PX2A 3GRUA 3WLNA 3SYLA 1RI2A 3ZWCA 3WIBA 1HORA 5H59A 3VDXA 4HPXB 3FHLA 4G4SP 1XEWY 1FSPA 1UXOA 4WRRA 3KX2A 4WIAA 1JE1A 3D7LA 4MAMA 1YVEI 2P2SA 1R4MB 2HJ9A 1DXYA 2H4WA 2VBGA 4DLAA 5BN3A 1IQPA 4YBRA 5CCEA 1RBQA 2O06A 4RORA 1MU0A 3HYCA 4BRUA 4JGIA 4FD3A 1ZD3A 4L6CA 4WX2B 6REQB 1DRUA 3X2EA 2PBLA 1UKAA 3EEBA 5DCUA 2I62A 3MMNA 1SVLA 1QRTA 2WJVA 1E9BA 3CKLA 4NY1A 1KZGB 2HWXA 2ZI6A 1ECGA 2IOFA 2WV9A 3FBWA 2GZ1A 1XCLA 4WGFA 2PNJA 3WK4A 3GJ7A 2R97A 5K0SA 2XPCA 4TKVB 1GADO 2P7HA 2DUMA 5K51A 1M2WA 3R23A 2DQYA 3HHPA 4HBZA 3OQNA 1ZP6A 2J6HA 2R1UA 3SYTA 1H1LB 1VCIA 4ZEXA 1QV6A 4P32A 1QCDA 1L4BA 2BFDA 1GPJA 1A4XA 1Q0UA 3WB2A 4L3OA 5D7BA 4MIEA 2XGSA 1S3FA 4FHDA 3FDXA 3V7UA 3HRIA 4HS4A 3BC1A 3TRDA 4RWEA 1DDIA 4HLUA 2ZS8A 5LBIA 4BB5A 5JHHB 2YWXA 1LRKA 1L5QA 5J2UF 2ORIA 4B71A 4EGFA 3L0CA 1C3XA 1E6MA 1VRWA 1KY2A 4LNUB 3LLSA 3M89A 4QU5A 1N2OA 1TUIA 2PSJA 4EB6A 3E5RA 1YDFA 3ICPA 2CLOB 1AG9A 2XYQA 2BHTA 3HJAA 3NP7A 4OHCA 3TEMA 4D8YA 5EA2A 4AN4A 3FPGA 3CVJA 2E5FA 2C9BA 3THXB 3HSYA 1XJ0A 4WV3A 1SGWA 2EXXA 3E9QA 3EPHA 1GSAA 2J08A 3KQOA 2GBCA 1KVUA 3ZWBA 4DYHA 1DTWA 3FNHA 5LOVB 2DH5A 1XAGA 2D0IA 5I7SA 5BV7A 4EJSC 2OD9A 3S1SA 2WHQA 4W1PA 1XQ6A 1I1HA 5DVZA 3JARB 1TTPB 2BN4A 2G9RA 3OI7A 3RQIA 3KR2A 2W0MA 3L6CA 2RBKA 1XJQA 1P74A 4ABTA 3AETA 3DWIA 2FA9A 1E9AA 3X1DA 3B6JA 4PXSA 3A25A 1YDEA 3G8AA 4ZDIA 4TSFD 1SXJC 4LOAA 1OFTA 1U81A 2YQ5A 1JG1A 2VUIB 2BTOA 1ELOA 3ETJA 3FB1A 3UKDA 2H1IA 1PQPA 1VIDA 1D4ZA 4P33A 3IDZA 2VHCA 3TB6A 3ZHCA 2Q8QA 4D79A 2NQTA 1SHLA 3O4VA 4D0SA 5JXHA 2PSDA 1ISFA 3TCXB 3VSEA 1WXQA 4UPEA 4HWGA 4U1RA 4C1BA 1ZN7A 1UIMA 2ZIEA 2H8KA 3ERCA 3IC5A 3H5RA 5E1OA 5K6RA 5GADl 1TZCA 2DJIA 2Z43A 4MWBA 1EQAA 2XW6A 3EFEA 2JFOA 1QFZA 5DM1A 1JB9A 4AVYA 3R9WA 1R0CA 2IDJA 4MUGA 4HB0A 3PL1A 3M6WA 1JQ3A 2IYXA 5DLYA 1Y9JA 1V5FA 4AMVA 4M83A 4MCAA 3T3GA 4QYIA 3W78A 2J67A 2ZSAA 3GGGA 4N3CA 3C41J 4UD2A 3X0DA 4R9RA 4B0PA 2YV5A 4X7BA 1F48A 1DQYA 4IUDS 3WGQA 3WHKA 3IE2A 3S0JA 4BATA 4TTQA 2D06A 2G36A 5J2TF 4BUJA 3T3NA 4OL0A 1EGAA 5AUOB 2F8LA 4QAQA 4AECA 1R00A 1SXJE 4RU1A 3I62A 1KEVA 4Z86A 4LI0A 1BDHA 4XPZA 4BV9A 4S0ZA 1BHSA 4ER6A 3TSCA 2WR8A 4JYZA 1QYIA 4FSHA 2JHCA 1AHHA 3Q40A 3ZWYA 5IT9A 4U7WA 2C61A 2P5SA 1OGJA 2FP4A 2O0JA 1DPFA 4X85A 2ETXA 4MPTA 3GVXA 1REQB 2P8SA 4EP1A 2DY1A 1ZJYA 2OHOA 3SM3A 4G1BA 3E7PA 2LKDA 2PL9A 3LX8A 3MGAA 4IUCS 2YJ5A 5AI0A 2VP5A 4IIJF 2YZNA 3HABA 2JVJA 4I1VA 5F1YA 2ZTLA 1GM5A 2XQJA 4G86A 4Q1CA 4QDTA 1QB7A 3ESAA 4JC5A 4J4HA 4Q6BA 1QX3A 5ILOA 3GGSA 1BEEA 1H1TA 4B3RB 2JI4A 2F00A 2W83A 4JUIA 3PWZA 5AVUA 2OK8A 3HK2A 1QGAA 4WTOA 3WSVA 5HNKA 4X41A 3BFJA 2P5YA 3WBFA 3ZDYB 5TGDA 1GR0A 1G5FA 5E4FA 4WPGA 1M6WA 5KVQA 5FOUA 3IL2A 5B1YA 2I4NA 1KF0A 1R66A 2EJVA 2UZIR 4J4BA 1T5TA 1FFWA 3H3JA 2V7VA 1W48A 4GE3A 4QNNA 3ZK9A 4V24A 3D6NB 4D9EA 4Z4HA 4P3PA 1IAQA 5B1SA 2CVZA 3GPLA 1KI7A 1PQYA 3HCCA 4Q24A 1SY7A 1XA4A 3LP8A 1LVGA 1HV8A 4GMFA 3IMKA 3LHSA 1YGPA 3U16A 4Z8XA 5HS6A 3IVMA 5IASA 1R2QA 3I6MA 1PGNA 3LVBA 4NATA 4WFJA 5BVGA 2OCIA 3QLEA 1NR1A 1IU9A 3IH5A 3OTGA 2YQZA 2RIPA 1KO1A 1L7MA 2V6JA 1C9JA 4OQMA 1BXKA 4N5DA 4DNPA 5L3QB 2A0KA 3HBJA 3KPWA 1N6OA 4JY7A 2Q3CA 3MW8A 4PR3A 2JI8A 1V48A 2ZI9A 1PG2A 2II6A 2MHCA 4PLHA 3W9UA 5I9IA 3U7GA 2C3PA 3NBXX 2AFIA 4I14A 2CDNA 2Q4RA 2IQIA 2X1VA 1BDIA 4NFHA 4W5JA 4BJHB 3ZS9A 4YO7A 3U1TA 4YRZA 1O3YA 3L9XA 4NAVA 1JSCA 1FFHA 3OTOB 5EXEA 5E6RB 3IODA 5AKKA 3GJZA 3N8NA 2Q5OA 4KIGA 3CH4B 3ZJVA 3T7DA 3T1NA 1TTHA 3KM0A 1VJ1A 4UM9D 1KQGA 1P5RA 3BHNA 4MRAA 5CM8B 1CDZA 4H7FA 2JGNA 3LY5A 4FFDA 4R8LA 4XCVA 3MAJA 1GFWA 1ZUNB 3KHUA 3C3YA 3RJZA 4HVCA 5CCBA 2IS6A 1LC0A 2GOYA 2M1XA 4D5GA 3K70C 4WI1A 3C45A 1SUIA 2CMGA 5J4VA 4QECA 2VYQA 1JUDA 2XB4A 3QVMA 4NPCA 3H11B 5E6UB 4JB2A 3QW2A 4KBFA 3CH7A 3ORRA 4CDRA 5K8TA 1YUBA 1XMQB 3I8XA 2OUIA 4BE7B 4MHTA 4MQMA 1VHJA 2FOLA 5CDYA 2RHJA 4HR7A 1MW8X 2EWWA 4JVMA 1FFSA 4URZR 4W7HA 3GLTA 1U99A 2Q49A 3PUZA 4QATA 2DR0A 3VDRA 3G7UA 4G1EB 5EKUA 4EHNA 2Q41A 1SKYB 3QQ5A 2R86A 3GFVA 4RF5A 2N47A 4JJ4A 4RZHA 5ARDA 4XGIA 4FEEA 1UEIA 1F9AA 1PJ2A 2HA0A 3G1TA 3QVTA 1EFUA 4HEA1 3CZ5A 4IGAA 2NU8B 4F46A 1E89A 4R1QA 3OLZA 2CT8A 1W7AA 1WKVA 4Q16A 1XZMA 5AUPB 3D6HA 1L5MA 2BTQA 2YW9A 3D8BA 1BWPA 3TE6A 2GUWA 1L4HA 5T57A 4J3JA 4KFRA 1DO0A 4HNSA 1CV2A 1S4MA 4GYYA 2B4YA 3DO8A 2A0UA 4EPWA 521PA 1HE5A 1MAWA 1NSFA 2X41A 4AJIA 4O4IB 3DAOA 1FYEA 1H8HA 1O6ZA 3OX3A 4MPRA 5K3BA 1GILA 1PG5A 3QK7A 1U2SA 4J1TA 4N1AA 5KDLA 3V2UA 1CHNA 3W34A 4U7PB 3L4KA 1WPGA 2H07A 3P9RA 4Q82A 4YNBA 3DLHA 4KPYA 4PQGA 2OZLA 1NMZA 2MINA 4HLNA 3B9PA 4OBWA 4WW0A 1ZRSA 6LDHA 5FA6A 3VZDA 3T4UA 3D2CA 5LVAA 3WMGA 2O54A 5LC1A 2HQ1A 1EK1A 1V4BA 5JH7A 1LLCA 2A2ZA 3MJFA 5JE8A 4F93B 3UV6A 4IWXA 3MSXA 2V3WA 4HQ0A 3O75A 5EJ7A 2WFLB 3EPJA 1AQIA 4TMKA 3JQGB 1UMBA 1UBJS 3T3EA 2VUTA 4HYEA 4MRNA 4Z1OA 3PNQA 5C1IA 2R48A 4KX5A 4REMA 4RV9A 2QRGA 4KITB 1K66A 4AROA 3SZUA 3S7TA 2YC2C 3KELA 4JNKA 1A7JA 2IP2A 1E4VA 3E82A 3D2BA 3PXDA 5SZKB 2Y77A 5KJ6A 4DJEC 2XZLA 1CDDA 1G5RA 3EGIA 2YMQA 1L5VA 5EJAA 3DOJA 1CQPA 2G8NA 5A7GA 4LA4A 2GZ2A 3C4VA 4IIVA 3EZ6A 3MS4A 3OZFA 4PTZA 4XIFA 3E27A 3E4DA 1MNQA 3BGVA 3EE6A 3W7AA 3BIFA 4PC7A 5GJCA 3WBJA 2C7RA 1E1QA 2IZ7A 4MDYA 4Q1EA 1T9CA 3FGOA 4YJGA 4EPTA 4QUAA 3N58A 4TYPA 4C7VA 3CUWA 1CLEA 4AS2A 3P0RA 2X8WA 3CQ9A 3TM4A 3NUQA 2RCNA 4J03A 4FR5A 5FXMA 4MTLA 3OFSA 1X77A 4NHOA 2RKWA 4D9MA 1QF6A 1AQ6A 1X87A 3S5UA 2I0FA 2F8TA 1Z4IA 2EBUA 3RK0A 1E0JA 1G20E 3KVYA 4OGKA 3ZDRA 4DXAA 4RNDB 2QZ9A 3NS7A 5I7VA 5I7OA 2B1GA 2VH5R 3A37A 2FRXA 1AS3A 1QHEA 2PH1A 3A58B 3ICVA 1Z18A 3MEQA 3P9CA 4XFJA 5JPCA 1G1MA 1T8PA 4EGSA 1DIGA 2G63A 1SQFA 4HUQA 2ZIVB 1KQNA 4U5QA 3VAZA 3KKZA 1DBSA 4ZJYA 1NTRA 3WAKA 1IH8A 5BYJA 4DL9A 2R2AA 5FP0A 4EITA 1XXHA 4IH1A 5AVZA 1O5TA 2JBAA 1Z8DA 2JJYA 1U3TA 4LF4B 4PPFA 4C3OB 2A57A 3SI7A 5TRTA 4R8RA 2GFQA 4Z99A 1B0PA 1GPUA 4AFNA 2C83A 3BZUA 1ONSA 4RCVA 1PKEA 5K9ZA 2APJA 1NXVA 1BE0A 3KOUA 4S2UA 5EJMA 2I76A 1P0CA 2AJLI 2RGRA 1VECA 2I3DA 1Y63A 4TXMA 2FF7A 1J00A 2JATA 3U3RA 4YJ2B 3ABRB 2BGIA 4ENVA 2XNCA 1K06A 1RM4A 1U2DC 3ZU4A 2RH4A 3IYLW 1V11A 1ADFA 1YB4A 5COBA 2IHYA 3VFDA 2ZRGA 4YASA 3DAPA 4DQDA 1AZSC 4JBXA 3EEYA 2AN1A 4JOCA 4OF4A 4J0GA 3I58A 5EHXA 2RGCA 4DARA 1G21E 1Q7TA 4RMIA 2ZIWB 1M0TA 1UXKA 1EXMA 1ZK0A 3OFJA 5LYJA 1M7BA 1Z0ZA 2INGX 2QTGA 4Q00A 4EG8A 3OZXA 1XCGB 2H65A 2X77A 4KFUA 5ECYA 4FKBA 4C2BA 3PWSA 4FYJA 3OD5A 5LP6F 2OM2A 1PEDA 2EG5A 3LGSA 4GPD1 4I6JA 1PLKA 4XQEA 1KQOA 3NUZA 4LW8A 3JQRA 1G6OA 4KDCA 1WCIB 1C7JA 1DWOA 5B58T 4CDGA 3EZNA 3R8FA 3WNCA 2HWYA 4C0XA 3BL5A 2NACA 3NTRA 1Q11A 1RKUA 1SRQA 3LE8A 4P82A 1GRRA 1YIOA 4Y8VA 3TIIA 2GNAA 3Q6MA 3FHOA 4DLNA 3O8RA 3KXLA 3TW0A 3TXXA 3I2KA 3NC4A 5H4GA 3NEAA 1MORA 2ZIUB 5FBRB 4MV9A 1NF2A 1L5NA 5T3UA 3V42A 5TPWB 1NZDA 4IV8A 3SSNA 5BT8A 3PD0A 4NQZA 5AK5A 1A71A 1MXFA 1JHZA 3P4UA 1LWNA 4WAUA 1LLUA 5IN4A 3H0EA 2Q7OE 4J91A 5YASA 1NBIA 3KR1A 3KV3O 1TTQB 1ECBA 1O2DA 1Q19A 1Q50A 4CV1A 1SUEA 2PFSA 1YZFA 5LUAA 4B3BA 4AN1A 5KPJA 2QTRA 3LNCA 16PKA 2ZYDA 4OQPA 4QJ5A 5B1DA 1YK1A 4Q9JA 4TQGA 5KB3A 3HUDA 1ADJA 1RHQA 3FWHA 4JR1A 1FXUA 1LX7A 1UFQA 3C98A 1TKAA 3BXZA 2PTHA 3DUFB 1Y1TA 2OXEA 3HU5A 4MV7A 3T61A 1HTTA 1QDLB 4AF7A 3CX4A 3V6LA 1UBOS 4YC7A 5JZVA 1OE0A 4GSKA 5IKXA 3C8MA 4LPSA 1XQWA 3B78A 1ATZA 1Z7WA 1WUJS 3JY6A 4ALKA 4PVCA 3M9WA 5K1ZA 3PDIB 3S2IA 3DKIA 1BN6A 2PFGA 4OO3A 1ORVA 1PWZA 4PPYA 3V6MA 4ALLA 5HSGA 1DE0A 3EWNA 4S1OA 1OXMA 4LE1A 3SGLA 1KI3A 4KHPB 4W5QA 2O5VA 1JXQA 3D3JA 1T9GR 3UQZA 4QA9A 4JUBA 3U3XA 4C6SA 3TNDA 5KNCD 1VDMA 3EVFA 3OICA 1CUUA 4AY5A 4ND3A 1NOJA 5H80A 1BA3A 1Z7BA 2DUUA 2PL1A 3EXHA 1X1SA 2FR8A 2GN6A 3BJMA 3DEZA 4I8IA 4UULA 4YRIA 2IX3A 1C2TA 3UWSA 3BOSA 4B45A 1Y81A 3SMQA 3URKA 5C37A 3G6KA 2NTYC 2Y0DA 3O8QA 3OOSA 2N9UA 5BVHB 3I5YA 3MBOA 3NT4A 4GSYA 1Q0PA 3EW7A 4EPXA 1TM1E 2AXEA 4V0LA 5EIXA 3O4IA 1P9NA 5ADVA 6NULA 3A1VA 4MHOA 1Y7LA 2VRBA 4M1SA 5DV9A 1L5KA 3ICQB 3BCRA 2WWYA 4BVEA 1FQJA 2V4UA 1N6RA 5IT5A 1TUBA 1A2QA 1N9GA 4NG4A 1G8MA 2HSDA 2Y0EA 4KBYA 4Q47A 1U31A 1SG0A 1ZVMA 2WC1A 2I6TA 3DTYA 2HREA 4TRRA 5E7JA 3WE7A 3D3KA 1K5HA 3HBFA 2OAP1 2HGZA 5EZQA 1FDIA 1AVTA 4POOA 1XCPA 1GNSA 2FGKA 3KZVA 2O8EA 2KX7A 3GLQA 1ORHA 3GB9A 3OOHA 4WLNA 3OZ7A 4QDKA 1FTGA 2GXSA 5F9HA 2HMTA 4XDYA 2CV1A 3N28A 2JGIA 6YASA 3U80A 2HCBA 5HFNA 4JH0A 1JVSA 3GFFA 1P39A 2YDYA 4NH4A 4Q0MA 2ZZKA 4NJEA 4BNVA 4Q7LA 1ZJJA 5BWOA 1YBHA 2ZCUA 3DFMA 1EGHA 2R6DA 3RAPR 3D0RA 1RYYA 4AZ0B 1U4NA 3LKZA 4URFA 3VR5H 3K1YA 3IEKA 4B7CA 1L4NA 1PK8A 2QLLA 3ES9A 4YJHA 2A1TR 1BDMA 1L9XA 2D0PB 5KNBH 2CF5A 2YWDA 4N8DA 3PT9A 3PK0A 1I3LA 1OAKA 4KRXA 1XAIA 2FDXA 4UEJA 4C4OA 1XAHA 4CWAA 4F91B 1MAAA 4BAZA 5HCIA 1Z6ZA 5CXQA 4D4KA 4RQUA 4BQOA 3HPQA 4MR9A 3VO2A 4BLUA 4EHHA 1K9SA 3ZDQA 2R44A 2F3RA 3DZDA 4GNRA 3JPWA 4PSCA 5IKMA 3ZPXA 5KYYA 1ULHA 3CF6R 4DZZA 1YWGO 3EFHA 3O0TA 4F1WA 1K7YA 4RGQA 2BR3A 2LDBA 2J0UB 4NENB 4QLBA 1L5WA 4NU8X 2OC4A 3L4JA 4O29A 4IDQA 2XUGA 2JFWA 3CLUD 3K9LA 2IUYA 1ZM9A 3CXRA 3HJNA 3AEKB 2WPDD 2XMSA 3HXPA 1KPGA 3PYXA 4NPHA 4GBGA 4CBVA 1OTHA 1C1XA 3HJGA 3FTDA 3H5LA 4RETA 4XQGA 1CUFA 4G5XA 1AZLA 3DXXA 4LHXA 3DCJA 4YRBA 1YA6A 1E4OA 1KSHA 3QOWA 3R9KA 5CB0A 3C97A 2IW3A 2QD3A 4WACA 4G0ZA 4TMVA 2FZKA 1L5HB 3SK0A 2GJKA 2WSMA 1M1NB 3F8SA 3L0ZA 4HNQA 1NMSA 1Q1BA 2FEXA 1VCMA 2C97A 1A5TA 2O8CB 1AN0A 2BFMA 2GJAA 3QNWA 1XHLA 1TYCA 2ZRBA 1TMYA 3Q12A 4HYYA 3PE6A 4YMSA 4F9TA 1GQSA 3DBLB 3S8YA 2O1XA 4HKTA 4EKYA 1ZVQA 5KINB 4HQLA 4J7UA 2D5IA 2CFSA 5FBLB 1JJVA 3QVUA 2AE1A 3ZVNA 3I1YA 3Q88A 1ODFA 5JANA 1ESNA 3LCVB 1JQKA 1EGMB 3P0FA 3FZQA 1ZIXA 1C7QA 5ALEA 1SUCA 4F84A 4G6ZA 3IILA 5EGSA 1YZNA 2JI9A 3NHSA 4NHEA 4PRKA 2QAJA 4L75A 2NPFA 1N2IA 5LLDA 1VLLA 2CXOA 3A4TA 4E4TA 2GZDA 2QN8A 4Y2HA 2B69A 3CCBA 5HZMA 4DV5B 1SOAA 3TQFA 1U7WA 2CCKA 3STVA 3IEXA 4MRPA 2P9TA 1DJPA 4QZVA 4FDLA 1CCWA 1M1YB 3R7WB 5EHZA 1XJ5A 3TD6A 2Z9CA 1Y8QA 2ZZMA 4E5MA 4F3TA 1JVBA 4NC9A 5IUKC 1OLUB 4Z53A 1XZJA 2QRMA 3B36A 1HK7A 1V37A 1ZH4A 3A4IA 4MK4A 1PR1A 1DCTA 1JI0A 1C2YA 2YUTA 4UEQA 2Q3JA 2R7NA 1KDPA 4RLSA 3GT4A 3IBCA 3THYB 1A9SA 4WXEA 5FBQB 2BV3A 1GLNA 3ED5A 1RM5A 3OPXA 4LE2A 3V7FA 3UG6A 1V5GA 2O14A 2DETA 4CTOA 3DKKA 3VMMA 1NDQA 4DNOA 3PEEA 4RE6A 2NU6B 3RANA 1TM7E 4WKOA 5AW3A 3UOWA 1D2CA 1V8DA 1H2AS 3FMVA 4CM4A 5K45A 5DOVA 2J59A 1MBZA 3HQ4O 3LGXA 4E5UA 3DMFA 1P6UA 4UTXA 4WE3A 4CTJA 1HFEL 3P2KA 2WVGA 4DA8A 5A2QA 1E2LA 4N9QA 4L02A 2QD4A 5IABA 1LWOA 1EBFA 3N7UA 3QU5A 1QBKC 1BVRA 4XLZA 2XYGA 3CF0A 3ZU6A 5JIBA 2J5BA 3D6UA 3U4IA 1R9JA 4D9HA 4WZ6A 1QO9A 4FZ3A 4DQVA 3CVUA 3C3JA 3ZHXA 3SYMA 1RIFA 2VTDA 3PUWA 2V7GA 5TX7A 4GOLD 4YBZA 2ATIA 4PG7A 2D5LA 1R74A 1U8UA 2KLHA 3D6FA 4YQYA 3OM9A 2NADA 4HNAB 1I7NA 3MCUA 4R1NA 1G18A 6ADHA 2NP6A 1X7WA 1NNEA 4CHGA 2AFHE 4UTRA 1L6IA 3QXJA 1ZLXA 2WUFA 3OO0A 4HB2A 4LDJA 2AWOA 2IS1A 3PQ2A 5DX1A 1JH8A 3EULA 1ZOSA 2QIOA 3M3HA 2Z5FA 4OMFG 1LCIA 2R60A 2EKQA 5CLGA 1P9LA 3RYIA 1KJ8A 4AIRA 1R6BX 3K0HA 2NYUA 1ZG3A 1BJKA 2VZ8A 1P6XA 2IK8A 1GNPA 1UP7A 4BO8A 3H1FA 4KUEA 4US0R 2R8YA 4GI1A 4EIWA 2R0QC 2BONA 1U7UA 1QAQA 1PFYA 2VF4X 1T0UA 1MO2A 2REQB 3UMYA 1K7SN 1W44A 2WUEA 4E70A 1YFZA 4ED9A 5EJ5A 3GUZA 1JILA 4OMUA 5BOSB 1JMYA 1H6BA 2FPIA 2M6RA 2VJMA 4FDAA 1EIWA 3PEUA 4EW2A 1I30A 2ZDQA 5JLAA 1VB3A 1WXDA 1U65A 1DRKA 4X3OA 3BFXA 2RH8A 2XF8A 3L1IA 1JKIA 5KQSA 1ACLA 3JAWA 1GAQA 1J9GA 2JGEA 5EYPB 2WJ3A 3LYAA 1ZH8A 4JP5A 2VJQA 5A4IS 3RREA 4YAEA 3DP7A 4I1PA 3TUJC 2XA2A 3N5CA 4C7JA 4N49A 2UXCB 2R1VB 3KFXA 3RC1A 1KY5A 3UVEA 2F62A 2HQRA 3SC2A 1NBOA 3VSBA 3AF4A 4R8VA 2W2VA 4UE3S 2AZDA 2H1LA 2JFBA 2ZJ7A 4YLGA 3G79A 2COUA 2JKZA 5JJ5A 1UWLA 2NO5A 1ZM3A 3P5SA 5AO9A 2JGKA 4BLQA 2V74B 1OWPA 1C14A 1U1CA 2C2OA 2FWBA 2HBYA 3MQFA 3ORYA 4M1MA 3K9FC 3O8NA 2R8RA 1E4EA 3MHPA 4PQRA 3ZN2A 4YRGA 3M5DA 1SC1A 4JGBA 5T8KC 4H59A 2A9JA 1P3Y1 2GYVA 2Z95A 4HK4A 5AJXA 2XUOA 3F3MA 3HO8A 1KS2A 4MWCA 3ID6C 3FAZA 3LJKA 2MSEB 3DBHB 3MMXA 3I53A 3NNSA 1ZJ6A 4LIPD 2NU7B 2PA3A 2CW5A 3GIDA 3R4VA 3EX7C 1RSZA 3T3OA 5FHRA 1Q3KA 1H8ED 3B6KA 3ILYA 3WZMA 4CM3A 1C7FA 4CUJA 5KNCA 4NOKA 2PA0A 3A3YA 3L1HA 3MGBA 3QLUA 4X6YA 1P1KA 4XYGA 3UH1A 1MV8A 1B15A 4L0QA 3D81A 1TJYA 2AA3A 2VSOA 4H77A 1A5ZA 4U2DA 4BVJA 4F12A 5J4HA 1Z56C 4E1AA 3L0PA 4N41A 4M0UA 4ARUA 1ZXXA 1U2QA 2V8BA 2Q2NA 3QKWA 1M7HA 1ZEJA 4AS1A 1DG3A 3TE7A 2G6TA 5IBCA 1UWKA 4YAOA 3TMKA 4U2CA 3VKUA 1DEXA 4BLOA 3WTBA 2PH7A 4B4VA 2JAOA 3PEVA 3WMEA 1MEJA 4RZ3A 2CVHA 2X7HA 4UOQA 3TIVA 5F73A 2OXRA 3WIOA 1U1IA 3F2IA 1HKHA 4Q9KA 2BGGA 1EDEA 3P9SA 4F6RB 2B4QA 1FOEB 3GDFA 1YJQA 1KU6A 1I2BA 3SIWA 3T12A 4AZ3A 1KEPA 5ALXA 1JSRA 1RAEA 1GWNA 2ZE5A 4LSZA 1W46A 3NIFB 1LNQA 2NTJA 4YFYA 3VDQA 4KNVA 1D3AA 1FJ2A 5BRAA 2VHUA 2Q5QA 1BYIA 4URWR 2H8GA 1SCNE 1U0FA 3GLHE 4AUKA 5JZ9A 1B0UA 3EMVA 4JXJA 4UM5A 2F2TA 2ZWMA 1V1MB 1KE2A 3GJTA 4RJKA 3WRXC 1FX0A 3FNEA 3PC7A 2CEKA 1FX1A 5KTRA 2P2NA 2VQEB 5ICGA 5DWQA 3K0CC 4MVJA 3JQAB 5KYXB 3DF9A 1K89A 3LQQA 4KKVA 4ZQIA 2P9GA 3D1VA 4WZBB 3TLYA 1FNNA 5C7OO 5A9TA 4JEIA 3D3WA 4KFTA 4EHAA 3FSGA 3EVAA 5A04A 2WWXA 3P4YA 3RC3A 5HKKA 3N6VA 5CMLA 3OAAA 4HYTA 1FRZA 2Z9BA 4OAQA 1Z5ZA 4YP9A 1JDVA 1PL6A 4ENSA 5EJEA 1PVVA 1UBSB 3CGGA 3N2ZB 2VHJA 4C4YA 1W87A 4Y98A 2W2XA 5BQFA 2XKJE 3HG7A 3PC3A 1JW9B 4KQXA 1R4MA 1LSJA 2Q4OA 3I1JA 2BFOA 4OVKA 3GNTA 1GZSA 3ORFA 5TMEA 5C46F 5CJJA 4ZAGA 5JAHA 2KSQA 2DVMA 1GNLA 3HN6A 4MQ6A 5AXBA 3O8LA 1EUCB 3R7FA 1L7DA 1U5BB 5IPFA 1E62A 1NXTA 3PP8A 1J8VA 3QVGB 1ZXBA 4JVOA 3QU4A 4NNPA 1LPMA 2NTNA 2PQ0A 2W2LD 4E7OA 3GLFE 3EZLA 4F3NA 3R3VA 2J9XB 2XF2A 3VU9B 4I5DA 4RK5A 5H3HA 2ZIAA 4O4HF 5KYGA 3F3KA 3M6IA 1MX1A 2VRNA 2Z8YA 4TKVA 1N2CB 1E77A 2ORED 3QEKA 4UTOA 4I9GA 4WLFA 5IVKA 2SNIE 4EVRA 5JDIC 1A5BB 3ZLJA 4O3FA 4W6ZA 4F06A 4Y1RA 4B3XA 1VZ2A 1XKXA 3C6KA 2VHQA 3KYDB 4CMHA 4KG7A 1VMKA 2H2FA 1T1IA 2C59A 4HNGA 4P3XA 1GSHA 3V32A 4DANA 3J7AC 2HL6A 2Q6OA 2QMOA 1QONA 1T3ZA 3ZGOA 4DQXA 1GV0A 2KYRA 1H6CA 2E0IA 1XQYA 1VI6A 4XKJA 5SV2A 1RS0A 1OI2A 4HI0E 4JU8A 4TWBA 4HDMB 3SJAA 1PR4A 3JPYA 3GHHA 2ETVA 1GUZA 1G38A 3ROGA 1XBTA 2PLNA 1JTEA 4RWZA 2ZSDA 3FTCA 4Q19A 4D8VA 4ILEA 3D0OA 2BDUA 4B35A 5CW1A 2X19A 3K2EA 1V1RA 2EFGA 3FMGA 3TLZA 4IZ6A 2N3ZA 3MELA 1IQ0A 3S3TA 1FYVA 2CVOA 3BS4A 4DMGA 3IE1A 4LGVA 1GKLA 1KVSA 4G5YA 2QUKA 3V3TA 1KP9A 4A0QA 3WYNA 3CHYA 3VQTA 4A91A 5BWNA 4DJDC 2DWUA 4WNIA 4UCXA 4Y2GA 2ZPAA 3WS7A 1A9PA 1CUSA 3N8IA 4ZO7A 1XU4A 3M9LA 4IH9A 1PJBA 1R37A 3RC9A 3D5QA 4PW0A 4MICA 5THKA 2J3JA 3DGFC 3QLVA 4RJIA 3W90A 4HRYA 4D26A 4ENRA 5LKAA 1SVKA 4WCFC 2QLTA 2MYUA 1JT9A 1T3TA 2BSAA 2FOIA 4YPFA 3OIGA 1TEZA 3KOYA 2FW8A 4CU2A 4GMKA 3T8YA 1R5JA 1EFLA 1O03A 3LUAA 4ZAVA 1NG1A 1O8BA 2X0EA 2Q1TA 2NPIA 4KMOA 3ZDDA 4PHGA 2PS1A 1T9ZA 2QW0X 1KQ3A 2ZAMA 4NJOA 4UBOA 3KQLA 1QM5A 3AYXB 4MS4A 4TROA 4OHFA 3B53X 3W0LB 5CFZA 1RCFA 4MUYA 1TEVA 2BHLA 1XPRA 1G4UR 3D2AA 1PL0A 3FRIA 4PXAA 4CIVA 3GXBA 4KGVA 5FR1A 1JPJA 3ASZA 5CLFA 4FWTA 1T2CA 3QI2A 5M29A 1R3UA 4R1SA 1QV9A 5JFGA 1FNSA 4PGFA 2IY9A 2XTZA 3LCCA 1YE8A 4U2GA 5DBEX 3WG9A 4DYDA 3RIXA 4ZCMA 3ZCRA 3GLIB 4IJMA 4ZGWA 1U11A 1UJ2A 3C6BA 2GVZC 3FIJA 5JT1A 4B3TB 1U3DA 5F78A 3ZHRA 4DCCA 3R6TA 2B34A 1QIDA 3HVIA 4CEIA 1Q7RA 2DSNA 3T5TA 4B6EA 2A8YA 3DG9A 3UH0A 3KUDA 1GT91 2AQIA 2GMWA 4YP6A 4HGZA 1FVXA 2ZI7A 3B85A 4PGMA 3U4MA 1DKPA 3F9RA 2G88A 3DM9B 1L7VC 3NNDA 1JQAA 2XXBA 2ID9A 2P65A 2X1HA 1TU3A 3A4NA 4W5HA 3WLIA 5AMXA 1KPHA 2FQWA 3NBZC 1E0SA 4GMDA 4KE7A 5F9MA 3IUPA 1TO1E 3CG4A 1JLKA 2XBUA 3I30X 2J5XA 3S2ZA 5F7XA 1QFYA 1GY8A 1HMPA 2CDCA 3HC7A 4GVXA 3E7XA 5E4TA 3UUFA 5D86A 4OKSA 3ZCPA 1R18A 3CUTA 4YRMA 5CCXA 3R0QA 5FKJA 1V96A 4DADA 1IHXA 4OV6B 2OB1A 2FZCA 4MUNA 5D85A 5A5DA 4NBKA 2HBRA 2GHRA 2YW2A 3I9FA 3DAYA 1N92A 2QTBA 5CVUA 4FLEA 3CEAA 5HOEA 3DPSA 5K6AA 1RAAA 5AW5A 2J3IA 4E6PA 4B3GA 4OXQA 3AMVA 3UOAB 1NASA 1ZIYA 3PUXA 1CY7A 3Q5DA 4L15A 1F14A 3AGQA 2AL7A 3HDJA 4AO7A 3EZYA 3U81A 2ZT7A 4GYJA 4R01A 2QS9A 3ZXSA 5D5QA 1N3LA 2OKGA 4Q05A 1AH2A 1ZHFA 1OI7A 2X7JA 5J4YA 5K6TA 1E1DA 3JVIA 1BAPA 1ZCAA 2C57A 5LD2B 4MA0A 3ONFA 1P60A 1N1MA 2XB2A 3K2BA 1WDMA 5IMSA 3CT4A 2D8AA 2FWIA 3OZCA 4IO1A 3G9UA 3R3UA 1XNJA 1UFKA 5G0UA 3TTWA 5AW1A 2NSDA 4Y2XA 3SICE 1E2IA 4EOGA 1EUZA 2D1SA 2VZ9A 1LPOA 2ODAA 1J2TA 3T52A 1I32A 2P3OA 1PQWA 2RI6A 5EERA 1KBOA 4EMUA 3KQUA 1XDBA 2LBPA 4P31A 3S1AB 1FBNA 2HV9A 4AKEA 1XWIA 1YDGA 4OUDA 5FLEX 1BWSA 2V54A 2EKZA 1KI6A 4H7EA 2A7QA 2ERCA 2RHMA 5ERXA 2WKRA 1I5RA 4O4JF 2H17A 1XR3A 4KDFA 2ZBPA 4UNNA 4BP9A 4N6NA 2LIPA 2AOXA 4CCYB 2CWWA 3QH4A 4FWBA 2WIFA 3L6BA 4NE9A 4B2IA 4LHVA 2MR6A 2G3YA 3FGPA 4PY2A 5G2OA 1RKXA 4DV0B 2ZQYA 3QPVA 1N3YA 2EJTA 1P4RA 5JNUA 3MJHA 3AJDA 4DEYA 3J7TA 2QNBA 1MR3F 3T1TA 1H8EA 2CL5A 1VP9A 3ZE9A 2BPOA 1WX1A 2IIVA 2JH9A 2JANA 4BFUA 4N5MA 5FI0B 1UK6A 3E0QA 3TNJA 4EHJA 8LDHA 3EXFA 1Q84A 1MN6A 2PS3A 2HZBA 2VJLA 1WLSA 4CMKA 3ZTTA 1PFKA 4F6LA 3QXGA 3P2YA 1BFKA 2WABA 4YA6A 4GICA 3H5NA 9MHTA 1NT2A 5E6UA 5CB4F 3HTXA 1RQPA 4AD8A 4DRXB 1JU3A 3SVZA 2VXYA 1VPWA 1CNEA 3H97A 3IPLA 2A78A 1AA9A 1DNPA 4ZZ1A 2CJWA 4CF3A 3GAFA 3MINA 3OLYA 4R5HA 5CLJA 3BGOS 2ZI4A 3UPDA 4RIHA 4YB8A 2ZPTX 4QQ8A 4HGRA 2NU8A 4EUEA 5JWRA 3DLPX 1T1GA 3ENQA 2IE8A 2ID7A 3NIBA 4UQPA 1E7SA 3VMFA 2P41A 3MJVA 3QLJA 4ISCA 5J40A 4A6DA 1Y5LA 1M76A 1O9HA 2WILA 4AY3A 3LXXA 1ADGA 3P9NA 4ZT5A 1UL1X 1U0OC 4B2PA 1X1DA 4JYCA 5ALHA 2V5UA 3A1EA 4KR7A 2Q4BA 3PGVA 1MNAA 1OTYA 1T9HA 3ED1A 3WQHA 5CDTA 4DMMA 2XYRA 1MHTA 3KP1A 5FPQA 4OHWA 2AT1A 1E8DA 4F2DA 3NBAA 3INRA 1F38A 1LKZA 1M1UA 1NR7A 3ONNA 4UMFA 3JTMA 5AI8A 1R64A 1J7KA 5KREA 1UM9B 2C4VA 2C5AA 2PZFA 3FNBA 3BUSA 4E5DA 4YJFA 5CD1A 4LGCA 1SUPA 4Z0NA 1AX9A 3A31A 4Y2QA 3GO4A 4ZC8A 3UK7A 1ZONA 3VXKA 4QJ3A 5EE5B 3A1CA 2G6BA 3LC7O 4FFMA 4I2NA 2X9GA 5LB4A 5JSYA 2GKOA 2NYVA 3R5FA 2QUZA 3PX3A 5LSAA 5IS2A 3IE0A 3B51X 4R0NA 3C7KA 3KR0A 3S8EA 5HA5A 1IATA 4IFIA 4ZYWA 3BMXA 2W70A 2FZEA 1PUJA 1LF0A 5BMVF 2PR2A 1DAOA 1GAJA 3IPCA 3HO1A 2Q3EA 2XWJI 2IEIA 2DZDA 3FXAA 3HB4X 1B41A 2A35A 4L28A 4BP3A 4M3NA 4DOMA 1YAJA 1E94E 1Y8RB 2WUWE 3KL4A 3EYWA 4ECEA 2EQ5A 1K5GA 3AG5A 4BFCA 5LIPA 3QWHA 3W6ZA 3QEBZ 3FN4A 2I7XA 1N1DA 4JA2A 1RJEA 3O8DA 5KUTA 2YJGA 3WLKX 3R9XB 1GTVA 1THTA 3LECA 3OZSA 4G4SO 4QWMA 5CVJA 5ES3A 5C3MA 3C3XA 4F04A 1EFHA 4O4HA 2WK1A 3REQA 2H0QA 4X8LA 2F1KA 1BGWA 4DV2B 1QGDA 4MVJM 2W6JD 4X8OA 3TQOA 3V1LA 5BUZA 4BMPB 3U0BA 3D8HA 2XMRA 2Y1KA 4X3PA 2W2MA 2BGTA 1ZQ1A 5JWHA 2VQFB 4KK4A 2O8NA 2IHZA 1P72A 4B31A 1JDPA 1NQTA 1Z17A 3HL4A 3OURA 5AOVA 4OAPA 3RYCA 1IHYA 1AC5A 3MXTA 2PL5A 1IZ0A 3NVDA 2BRUA 4NBRA 2LDXA 4A36A 1XYYA 5IT0A 1RHJA 2C03A 3DOOA 3C7AA 4IHKA 2HXYA 3LRXA 4BB0A 4LJ9A 1QH0A 5DDIP 4XRRA 4HLUC 3U3JA 1CETA 5CK5A 4CI0B 4P7BA 1EVLA 2NSYA 3OJ0A 4LJ7A 1PX0A 1CEXA 1RPJA 2VXOA 4K9OA 2WJAA 4X6XA 5DWDA 4OLHA 3ROTA 2MSCB 4YECA 4MSUA 3UBMA 3DM5A 3TLGA 1M8GA 2ZYRA 5KIAA 2I03A 5BR8B 4TTIA 4HX2A 4QRIA 4M0FA 4HQOA 4JBWA 1UANA 4RKQA 1YCGA 2IOHA 2V7EA 2Z8YM 1E9CA 4YRRA 3QGMA 2ZUVA 3DBRB 4QNMA 4X1YB 1DOHA 2O8BB 2QMZA 2XAUA 2PQ2A 1QPBA 3TO5A 4ZDJA 4X90A 4RTKA 1JEQB 1U0JA 2HF9A 3OZTA 1O08A 4LZJA 2QZ4A 3BSWA 3L05A 3V1NA 1FJXA 2VR1A 2P68A 1BKDR 1HE4A 2X15A 4LMRA 5JYEA 3IX7A 3AHHA 3U17A 3FLEA 4QUJA 4KO1S 2XQVA 3NORA 4UDOA 4PX3A 4DM3A 5IT4A 4RM3A 4YAUA 3VYSB 2JRLA 3SS9X 5SZIA 1KFEB 4ZP1A 5F3DA 2QZSA 4HRXA 4BLTA 2W6CX 4L5YA 5TB5A 2W4QA 3KJZA 1T36A 3OKPA 1JI3A 4YRSA 2BDEA 2YN0A 5LXTF 4BGEA 1K0FA 3IAUA 4QD3A 3R9IA 1EE9A 1QORA 4GPTA 2B3DA 3QELB 1C8KA 2DFPA 2EF1A 2H9AA 1ZX1A 3CEHA 1DADA 3PVSA 2V97A 2XRFA 5L95A 1HEIA 3JQ6A 2HU7A 3C6MA 3MMZA 1MG5A 4Y1EA 1NBMD 1W88A 2GPTA 3H0CA 4KI0A 4KOAA 5CFOA 2YVUA 3DMHA 3T7RA 3D5TA 1E2FA 3IBYA 2BEVA 2G1KA 4L74A 1G8AA 3UPUA 2C3UA 4YDSA 4MGZR 3Q11A 3GYBA 3W9SA 4C0KA 2PUEA 3NAQA 4IIBA 5EJFA 1NBHA 3D9QX 1RP7A 4PZPA 3DMNA 5EP2A 1TQDA 1AUPA 2JLWA 5LUBA 3VBEA 2EJWA 1HRDA 4L3VA 4WN9B 1F8GA 1TVKB 3QQPA 4IG4A 3HACA 3KAPA 3KPYA 3L8FA 2Z08A 1NC3A 4M55A 2DFVA 1D4FA 2XMZA 5HK8A 1U8ZA 3ZTWA 4EX6A 3DWGA 1WMEA 3S29A 4HAWA 5I48A 2H5IA 1IZYA 2C2KA 4J2OA 1E3IA 5DLQC 4QOSA 3NKLA 5HZHA 2Z2JA 1GITA 2MWMA 4ID3A 4JFRA 1EEXB 3DCYA 3LAWA 2E37A 3JQEA 5ENZA 1NQUA 2R85A 1CJCA 3CNLA 2HSJA 2X5JO 3FFBA 1F4LA 3HDYA 1TFRA 1ULBA 4RW0A 3TNFA 5IW8A 3PF9A 4DXDA 3LQRA 5ERGB 2OVFA 4BBZA 1L4FA 2G5PA 4BRWA 5JVDF 2NGRA 4XWGA 1W4LA 1RHRA 3ZIAD 1Y34E 4O0MA 3W7BA 3QWBA 1ORDA 1I7LA 1WUYA 3A27A 1ODCA 2IPNA 2WUVA 3IOBA 1GZ6A 3M8KA 3P26A 4I1OA 3CUKA 1P18A 1Q92A 1XCMA 2XCLA 4JUAA 1M2VB 4MRMB 5G53C 4TZKA 5IK2D 3REOA 1YZVA 1S01A 3LC0A 2RHGB 1XO1A 3GPBA 3JQ7A 3LRTA 1FMFA 4R0VA 1RI4A 5JMOA 1V7ZA 1X2BA 1ZQ9A 4U7FA 5ALGA 4MKRA 1SUFA 4Z2YA 1L5ZA 3RVQA 3SPXA 2JLQA 5K0GA 1FW6A 3KG2A 4BY9E 1G55A 3PNVA 1CJSA 2XVAA 3OEEA 4ZODA 5B1IA 4Q34A 4U9HS 1O5OA 1X8XA 5CVEA 2EF0A 4D81A 1YRAA 4RKEA 5CA0F 1CBUA 1ADYA 4MIOA 1MD9A 1FNCA 4N5LA 2MR5A 4IDEA 4WK4B 4PN3A 1EVZA 3IP9A 2IHUA 3LH5A 1RM0A 2ZTSA 2DFDA 3EDMA 1PU2A 4LDZA 3WK9A 3RYFA 4O4JA 3GJYA 4QUIA 1C30A 1E2HA 2DWPA 2VYNA 1RRFA 2I3BA 3DBOB 3HKCA 3M6VA 2G9NA 1HURA 3ZKAA 2D7DA 3GJ5A 1ZMRA 5EGNA 1FS5A 2PKQO 3IUBA 3ILSA 4FZJA 2EW8A 4B3CA 1HDOA 1ZH0A 2P2GA 5MN6A 3EUFA 4FZ5A 4TRMA 2QAGA 3AB3A 3IEMA 1SCAA 2QD5A 4YRQA 1C0LA 1Q16A 1JYSA 2EYUA 2GZHA 4FQ7A 4RLFA 4CM8B 4A8HA 4CN9A 4DR5B 3NEJA 2W58A 1JWAB 2WM9B 3DZGA 2OMKA 2PRSA 4NVRA 5DYYA 3V34A 2G4VA 2BP7B 3OF3A 4ZVQA 5IKOA 3JW8A 5K8JB 2Z6AA 3UXYA 4N3BA 3DDWA 1KA9H 3PHHA 1GD1O 1ZDMA 2FQYA 4WESA 4X44A 4DMFA 1YBFA 3TZKA 3FKQA 3BSSA 2Z09A 3W8RA 5CB4A 2B99A 1PHPA 3U5TA 3OTIA 1BFDA 4Z1MD 4TZ0A 2IHVA 1BU8A 3PQEA 1ECLA 4KDRA 5A9SA 3HB5X 3JQFA 2Y93A 1CZUA 3P0JA 3FX2A 4ND8B 1EUQA 1JDZA 2Q7XA 4HRVA 2C1XA 3CLSC 4ENPA 1XRNA 4EJSB 1FXWF 1XZPA 1YASA 2AFIE 1HRKA 1RM3A 3LBFA 5CBKA 3L3BA 4C6HA 1FQWA 2G17A 3U56A 2Q46A 4TSRA 4MKIA 3DQPA 5GWXA 1T0PA 4TS9A 1NI5A 2PUWA 2GTPA 3P45A 1VE1A 1PGPA 3EIHA 1PJRA 5DFAA 2J0UA 3OQMA 3N7AA 1SXJB 3QEMA 4H4EA 4JX9A 1F0PA 3TSZA 2ACEA 2B6HA 2GPYA 1XTJA 2WP8J 3MLBA 3PJEA 3GUCA 4YMTA 3OTWA 3RVOA 1EFVA 2X5OA 1FNMA 1WP9A 3V1MA 5FI3A 3C7CB 5JFTA 3Q0IA 2HF2A 1TCCA 2I65A 1ZK1A 2O57A 4O4LF 5A62A 1JF8A 3BREA 1FMLA 1P4HA 3PCXA 4J1TC 5ELMA 4P58A 1ZS9A 1E2KA 4I46A 5EE1A 1ZWLA 3PNBA 3H9UA 5EKDA 1JSLA 4FOLA 1XZGA 3EEQA 4MQBA 3NXKA 1P7ZA 4WDQA 1BDBA 4C0WA 5LQUA 4HDCA 4XARA 3QXXA 1G5TA 4X1OA 4DJJA 4KXQA 2GPBA 3V4PB 4DA6A 4OK5A 3N07A 3DBLA 4F2WA 1T9GS 2HZ7A 3Q3GE 2SBTA 3KFVA 5DMHA 4QKQA 1OWLA 1Q20A 3U31A 4OY3A 1SXHA 2BIFA 2CLMB 3G5LA 3NHMA 4P4TA 1FDOA 2VRCD 4HGNA 5T4EA 4BB6A 1FDRA 4YMIA 1Y1QA 1R8QA 3M2TA 4KYIB 1UBTS 5FOTA 2RGYA 1P8JA 4LBYA 1JR2A 1XTBA 3PTZA 4P7KA 1JHUA 4OEHA 1M75A 5MN4A 1SCUB 1H6AA 1U9CA 2W6JA 3H3FA 3BK1A 2P3SA 5ILGA 3GEHA 4RNCA 5B57C 4LWPA 3ADPA 5GV7A 1ISHA 4HAIA 2BFEA 2X2FA 1M1YA 1SB9A 2UKDA 3K4HA 3R7WA 4YMGA 2O1EA 2FH5B 3ZWXA 1RZ3A 3QVKA 1W47A 4R9VA 1BEZA 2W2PA