3RSCA

Crystal structure of calg2, calicheamicin glycosyltransferase, tdp and calicheamicin t0 bound form
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
397
structure length
397
Chain Sequence
HMAHLLIVNVASHGLILPTLTVVTELVRRGHRVSYVTAGGFAEPVRAAGATVVPYQSEIIDADAAEVFGSDDLGVRPHLMYLRENVSVLRATAEALDGDVPDLVLYDDFPFIAGQLLAARWRRPAVRLSAAFASNEHYSFSQDMVTLAGTIDPLDLPVFRDTLRDLLAEHGLSRSVVDCWNHVEQLNLVFVPKAFQIAGDTFDDRFVFVGPCFDDRRFLGEWTRPADDLPVVLVSLGTTFNDRPGFFRDCARAFDGQPWHVVMTLGGQVDPAALGDLPPNVEAHRWVPHVKVLEQATVCVTHGGMGTLMEALYWGRPLVVVPQSFDVQPMARRVDQLGLGAVLPGEKADGDTLLAAVGAVAADPALLARVEAMRGHVRRAGGAARAADAVEAYLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase/antibiotic
molecule keywords CalG2
total genus 141
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3rscA02
1B4DA 3OT5A 3T3EA 4CDRA 2G9VA 5DU2A 2JZCA 3NAZA 3SYRA 2VCHA 3L7AA 1UZUA 1HLFA 2AV6A 4YI5A 3AMVA 4N3BA 3T3IA 1P2BA 3MBOA 4BQEA 3G2IA 1FC0A 3MS7A 9GPBA 3E3LA 1C50A 3T3DA 5IKOA 3CEMA 3FROA 3ZCUA 3BCRA 3L01A 4XIFA 1FS4A 3ZCVA 2XA9A 3S28A 4GPBA 4CTMA 2GM9A 4X6LA 4CTOA 5BNWA 2PQ6A 4GYWA 4F97A 1Y8ZA 2IEIA 3IA7A 1K06A 3DDWA 1JG6A 3CUUA 3CEHA 3GPBA 1NVKA 4EKEA 3HBMA 2X0DA 1H5UA 3ZCTA 4GYYA 5D00A 1LWOA 4X7MA 3T7DA 1L6IA 1P29A 1JIVA 3C4QA 2PRIA 3RSZA 3NP7A 4HWGA 2QN7A 4YI3A 4G2TA 3OY2A 1FTWA 1KTIA 2QLNA 5TMDA 5IKPA 1FU4A 5JTUA 1BX3A 3UYKA 4F9FA 3BEOA 3NC4A 2QZSA 2JJMA 1SXPA 3MRTA 4MI6A 2PYIA 3TAXA 3T3HA 2QRGA 7GPBA 4REMA 5LQDA 1E4OA 1EXVA 3EBOA 2VCEA 2GEJA 2YJNA 2R4TA 2X6RA 3Q3IA 2IV3A 3BCUA 1JEJA 4X7PA 4MI9A 2QRMA 1YA6A 4KQMA 5GPBA 1PNVA 2ZB2A 3S29A 4FKZA 3IAAA 1WW2A 4RIEA 3L7CA 6GPBA 2O6LA 5TMBA 1WUTA 3CUVA 2GPNA 1L5RA 1AXRA 4NEQA 1NLMA 3BD8A 3ZCQA 4Z5XA 2BGTA 3HBNA 2R66A 4LEIA 1EM6A 2VG8A 3G2KA 2FF5A 4N39A 3S0JA 1ABBA 2VSNA 3S2UA 2X0FA 3S27A 4RBNA 2QRQA 1P2GA 3BCSA 2Q6VA 2F3UA 4MHSA 2OFFA 3O3CA 1E1YA 1NZFA 1Y6GA 3BDAA 2H1HA 1PSWA 5D01A 3MTDA 1NOKA 2SKCA 4BFCA 2QLLA 3MQFA 1GGNA 2QN2A 2G9RA 2SKEA 1P4HA 4M83A 3VUEA 4BQFA 4EL0A 1WV1A 1F6DA 3TSAA 5JTTA 4MHOA 4N9WA 1A8IA 3CUTA 1AHPA 1L7XA 1JIXA 3MRVA 1LWNA 3NB0A 3HBFA 4RELA 5TMEA 3SYMA 3CUWA 3UYLA 2ECPA 1C8KA 2QLMA 2C9ZA 3ZCRA 1WV0A 1P4JA 2G9QA 3D1JA 3Q3HA 1K08A 4NC9A 3E3NA 2R4UA 4CTNA 3PE3A 4N3AA 3C48A 3OKPA 4KQ1A 2SKDA 3OTHA 1FU8A 2QRHA 2F3PA 3ZCSA 4MICA 1RRVA 3MSCA 2XGOA 2QN8A 1FU7A 2QRPA 5DXFA 1WW3A 1QM5A 2F3QA 2FETA 2FFRA 1IXYA 3ZCPA 1WUYA 2QN3A 1IIRA 1Z6QA 2C4MA 4LDPA 4RIHA 4RIIA 1L5WA 3MRXA 3RHZA 2AZDA 2IW1A 3DZCA 2XA1A 4XI9A 3WADA 2XGMA 3H4IA 3EBPA 2JLBA 4EKYA 2R60A 2R68A 2IYAA 3OTIA 3G2JA 2IUYA 4W6QA 5TVGA 4EL5A 1GZ5A 2AMVA 4HLNA 2PYDA 3H4TA 1O6CA 2AW3A 3MS2A 3MTBA 4RIGA 4M60A 4WACA 2GT1A 4X7RA 1RZUA 3RT1A 2QN9A 3WAGA 2BFWA 2XCIA 4AMBA 2HY7A 3MS4A 1JG7A 3C4VA 3L7BA 4NESA 1L5VA 3OKCA 2XCUA 1GG8A 1P2DA 2QNBA 3Q3EA 3E3OA 4M7PA 3L79A 3VUFA 3NP9A 3HBJA 1RZVA 2GPAA 2XMPA 2PRJA 3DD1A 2QN1A 1GPYA 4GZ3A 5ENZA 3RSCA 1NZDA 4AY6A 2IYFA 4YUAA 2GPBA 4GZ5A 5I45A 4GZ6A 1L5QA 1F0KA 3QKWA 3CX4A 1FTQA 1Z62A 2GEKA 4WADA 5HXAA 2VSYA 1P4GA 3VDMA 2ACWA 2X6QA 2F3SA 4MI3A 4KQ2A 2X0EA 3D0QA 3G2NA 3D0RA 4N3CA 1NOIA 2G9UA 3DDSA 1L5SA 1UQUA 1XC7A 2P6PA 1JIUA 3QHPA 1XL0A 4F96A 4FZRA 4WHMA 4PQGA 3G2HA 1XV5A 3VDNB 2IEGA 1Y6FA 5C1DA 2H1FA 1PN3A 3OY7A 3CEJA 1M5RA 3T5TA 2ACVA 2BGUA 3BD7A 3T3GA 3G2LA 1Z8DA 4AN4A 2XA2A 1FA9A 3MTAA 3MT8A 2XGSA 3OKAA 3PE4A 1Z6PA 1XKXA 1NOJA 3NPAA 8GPBA 1XL1A 2C1ZA 1C8LA 4RENA 1GPBA 1V4VA 1VGVA 3OTGA 4BQIA 1GFZA 3L7DA 2ATIA 3MT9A 1YGPA 5DLDA 3CV3A 1QKJA 4EJ2A 3NCHA 1FTYA 2F9FA 4QLBA 2C1XA 4MRAA 1UQTA 3TOVA 4RIFA 2KS6A 1XOIA 2WTXA 3CUYA 1GPAA 4L22A 1J39A 3WC4A 2ASVA 3MT7A 1C3JA 2BISA 4AY5A 3COPA 2GJ4A 1SXQA 2IV7A 4AMGA 1PYGA 3GUHA 3BD6A
chains in the Genus database with same CATH superfamily
1KI7A 3ABZA 2F59A 4RDCA 3WKEA 1UKBA 3OA2A 3QQPA 2EFGA 1WABA 2G9VA 3B1YA 4RMHA 3V7WA 3WYDA 4DABA 3EXHA 3VHXB 2XUGA 2AFIE 3DBIA 5CM8B 2GHQA 3ADPA 2A5JA 3MG9A 3QMPA 1L5FA 4FSHA 1B6SA 5GONA 3CUSA 4HZIA 1W25A 4RHFA 3N8IA 2XWQA 3A1TA 4M0MA 5HIMA 2HB6A 3SFZA 4KODA 4ARVA 5CB4F 5FAKA 2B35A 4E21A 4YXFA 3GLGA 4GI7A 4JGGA 1K7FB 1UBTS 4DMFA 1BKSB 2PUBA 3JZMA 3VZDA 1W29A 5AUPB 1FC0A 3EZGA 1CU1A 4ZMSA 4AKEA 1BFUA 2VXOA 2ZSFA 3U31A 4EY7A 4LV8B 1UBKS 1RQPA 4FT2A 1CUAA 3H7AA 3B5JA 5BWOA 2HDOA 2PS0A 2YQ4A 4CM8B 1LPAB 1GGVA 4AWAA 2RKBA 1U2GA 3UK2A 2VP4A 5HFNA 3ZH2A 4C2BA 1I9CA 1GZVA 3NOOA 3OQIA 1DP4A 4Z4IA 5BMVB 2FW6A 4DV2B 2NTNA 2GPWA 1CJCA 1L7DA 1I3OA 4X6LA 4JU8A 4AF7A 2H2GA 2AN1A 2LDXA 3OO0A 4EDFA 3KOOA 2QU7A 4R6WA 4WLUA 5T4BA 4NU5A 1QE3A 2VDLB 4M1WA 4NDAA 3VR5H 3NZEA 3FB4A 4N76A 1ZJJA 2AYYA 3HH8A 1D0IA 4EGAA 1K06A 2HIHA 3GPCA 3PGXA 2AFVA 1ECLA 2XYRA 1KORA 4TM8A 2J3IA 1W35A 1K97A 1EHYA 4GDMA 4MYCA 4ZCSA 1C2YA 1GAWA 3CUUA 3UK7A 4EELA 3LDHA 5L4NA 1X2BA 1S2GA 3JWPA 4NP6A 2DH6A 2PD3A 4LQCA 2IZZA 3O4FA 1NVEA 3VPGA 2O8EB 3KCQA 2AXPA 3S99A 4X3OA 4FUQA 2HXSA 4EEZA 4AG3A 1YQGA 3AUKA 3QVXA 1M75A 1BE8A 3ACCA 3DH0A 3LIIA 4HFMA 5KTYA 4NYJR 1RRCA 2II6A 2QTGA 2H1CA 1VJRA 2DFTA 2RJOA 2H8GA 3GFVA 5JC1A 3ZLTA 3DEAA 3KB1A 3WB0A 4CM9A 1QQ7A 1HNXB 3CX8A 1VIDA 5K2MA 5AM2A 2J0EA 3TLBA 5K20A 3IQDB 4V0OA 4V0NA 4H18A 5JSQA 4YHHB 5HDQA 4XB6B 4EY3A 4PSCA 1GLGA 2EV9A 2IP4A 1BMTA 1RVV1 1W5BA 1Q0HA 1Q6YA 3FW1A 3PWSA 1XWIA 2G6BA 3S1AB 2ZI7A 1MB0A 3AJ8A 4DJTA 5IVHA 4G81A 1Y89A 3UYKA 4QJIA 1ULUA 2YR0A 2EF0A 2P3LA 1NA5A 1XMXA 4K9SA 1WXIA 2EJTA 2BV3A 4JB3A 5KCZA 1DAKA 1ISMA 1C1DB 1RRPA 1SXJA 2B61A 2PKXA 4N03A 4CM3A 4JWTA 2PVSA 4UUAA 1IHDA 4ZC8A 2LNDA 3IV6A 5DNVA 4XGKA 1Y5LA 7GPBA 3FLEA 1N5JA 2WPDD 4WXHA 5I7HA 4BKUA 1Z5VA 1P6QA 1XPJA 4CN8A 3AO0B 3MJCA 5DZSA 3EUWA 1JNYA 1E2GA 3LM8A 4GXTA 3NEJA 4K9OA 1S5PA 2YWJA 1J6UA 3LY8A 2BGMA 2FUNB 2WAYA 4HC4A 4HQNA 3N2LA 4YUYA 2OHIA 1N8NA 4KH0A 4NAUA 4TOIA 2JHFA 4U6QA 4I7EA 2EKZA 3OQ6A 4DM3A 2P9GA 5A6SA 1HZJA 3K9QO 3W79A 3QUCA 5GZ3A 1GKUB 3OIGA 1BU8A 3F5SA 2I2XB 3WGIA 5DF1A 2XH8A 3EWIA 5LP6F 2BZ1A 4CM5A 2WTMA 5FI1B 1L7BA 4FFSA 4MWEA 5BYBA 2IEYA 2NPFA 5KWEA 1JEJA 2ZTMA 4NBWA 3FJ1A 2VK8A 3GDWA 5BMOA 3A9RA 2AZTA 2NUPA 4IVNA 2ZRDA 5IBQA 2FRXA 1N2CE 2JHGA 3DCIA 3QXHA 2QY9A 4DQDA 2XNSA 3TL2A 1XGKA 1YAJA 4GX1A 2AFHE 3RRJA 3ZWPA 4F8JA 3VNAA 1W5AA 3VTAA 5ADUS 1D2CA 2CJWA 1U5BA 2OBYA 3DT8A 3T7EA 5KNBH 3OU7A 2RGDA 4DR6B 2RI6A 2A5LA 1PW5A 2ABWA 5HKLA 4CFYA 1XU4A 3JVDA 4GR4A 5JQGF 3UPTA 3ZVKA 2FOXA 1ULZA 4UEOA 1J8MF 4DIDA 2JJ1A 2JLRA 1XEFA 4Z5XA 5IWAB 1UBEA 1C7QA 1X7YA 4LEIA 2C4WA 4R40A 5EPOA 5ILQA 3ZU4A 2QQFA 2MR6A 4QYIA 5CTJA 3WSVA 4EW1A 3T3OA 1KHTA 1ZX1A 3H17A 2AJDA 4OH7A 2VPYA 8LDHA 2WSYB 2FDRA 2PKQO 2ID8A 2VSNA 3CVUA 4EF6A 1AKQA 1QO9A 5KPDA 4JA2A 1BG6A 4NK4A 2YVAA 4DCGA 4RXMA 2DQSA 4D92A 2VJYA 5LXTA 1AE1A 1J70A 2DFVA 4RU1A 2QR3A 5ESXA 4PBTA 4YV1A 5LIRA 3S1SA 1EVYA 4MQLA 4II7A 1TXGA 1GU1A 5AKZA 4AB1A 4I9GA 3I9JA 3DJFA 2Q0XA 4Q1BA 5TS2A 5ABPA 4AX4A 1AIPA 1YDFA 3RVRA 1UJ4A 2RAVA 2VA9A 5HZKA 3SBXA 3UC9A 4KQFA 2ZITA 4KXLA 4KAXA 5EAIA 1BDMA 2E89A 1DINA 3FPCA 3PFFA 4S12A 3U60B 4OOEA 3ROPA 1LJUA 3ENQA 2YN4A 2N9UA 4RTSA 4Y6LA 4BWVA 3GMTA 4YJ3B 3SJCA 2E6UX 2PXCA 3HR4A 3QV1A 4O4JF 3T8YA 1ZU5A 1IN7A 4DOMA 2JNWA 3D0OA 1HKUA 2O8NA 2XTMA 4MQEA 1RW4A 3G5MA 5CIWA 5KOHB 4E5KA 2PLAA 1U8FO 1XZIA 2VQEB 1VYTA 2BR3A 1KOGA 4QNNA 2WB4A 1PX0A 3WIUA 4LMRA 2MHCA 2PX5A 3ZHYA 1POWA 3AWDA 5C32A 1CF4A 3RVNA 2I91A 4M8IA 4X9XA 3Q15C 3UMRA 2ECPA 4D3XA 1TIBA 3RIXA 4YRFA 2B30A 4X64B 1Y5IA 3A31A 4CEJB 2EC5A 3EG9B 1TYDE 4E5SA 2PXAA 1IONA 3LFTA 1RHQA 1GSAA 1KI9A 1UBMS 4P5PA 4NNJA 5GY7A 5IAKA 3VAYA 1HFEL 3FSRA 4JOQA 3L6UA 4WXPA 1M34A 4IH9A 1QYXA 1U9CA 1SCKA 3PE3A 5THXA 1QU2A 3TLAA 3C48A 1FVXA 3E7XA 2P2GA 5G0TA 1E1DA 1B73A 2R11A 1NKSA 1DCTA 2BFFB 2CXSA 3ZE1B 3V4RA 3LQFA 5LUBA 4EAQA 2XVAA 3DAFA 3IBGA 1XDGA 2Z09A 3T3MB 2ODEA 2WSSA 2MSCB 4H17A 3PR3A 5CCDA 4QOSA 1JHOA 4ZYLA 5LDDC 3LOQA 3JAKA 1L7RA 3Q5EA 1LPMA 1L9KA 3AJ9A 4MUGA 3UMFA 4F7DA 4H1WA 4WFQA 1JKXA 3KAPA 3MSCA 4JU9A 4LXYA 4N48A 4QE3A 5BSKA 3ZI7A 5JQWA 4NVRA 3V34A 1TF2A 4B3CA 3L84A 3IEUA 3WMGA 4IP0A 3MOGA 1E4EA 3NJ8A 1LA2A 2WJ4A 4IWYA 1AKNA 3FWZA 3PVZA 2AFHB 2QX8A 3K9CA 3ZDYB 1W36C 3U56A 3RUIA 1ZP6A 1N7JA 3RHZA 2D5CA 3RVPA 3W3AD 1JLLA 1Q1ZA 4H7PA 5TPZD 4A5OA 5CB4B 6PFKA 5IZCC 1XNRB 2NUTB 5U4QA 2YWRA 1N6IA 2YASA 4PYIA 4U39A 2W6QA 1GEGA 2H4JA 1C7RA 3FTDA 2FLWA 5MN5A 5JBQA 4BO1A 1KKMA 3JQAD 3IELA 3K8YA 3GROA 2JCSA 2ZBVA 3T3PB 2AXEA 4S1WA 2QJRA 1Z5ZA 4DDUA 3EJ6A 1DCMA 1IDN1 3RREA 1A9TA 2B4RO 4A82A 4BLRA 2WG0A 2J0VA 1FRFS 4PRYA 1N3YA 3VPHA 4D99A 2VHQA 4F5DA 3TVDA 3H1AA 4G26A 3EY4A 1CXZA 2VHUA 3PNKA 4WCFB 5CNIA 3VYWA 4HDNA 1JWLA 3GRRA 1QP0A 4Q15A 4M0LA 2AW3A 5JDIC 1H5NA 4MPRA 3V3TA 5TGZA 4Z9XA 2BP7A 2HJRA 4J2OA 4X8LA 4M9ZA 4C0BA 3E8MA 1TT5A 3LS2A 1M1YA 2Q6IA 1CK4A 2X2EA 1S1CA 4HDOB 4X7RA 1AMNA 3I76A 2HW8A 2QN9A 1NM5A 1C3LA 3WL3A 1FTSA 4V0MA 3HKEB 4OQFA 4K6OA 1DI0A 3AR7A 3KEFA 4Y9UA 2WZDA 3I2FA 3L7BA 3H11B 4COOA 3O4RA 1QJ4A 1KDRA 2ZRNA 1W94A 1PT6A 3WBKA 2WQ6A 1I8TA 1WR8A 3QUAA 1V41E 2X0IA 2HJHA 3CLTC 3RVSA 2V6IA 3M6IA 4EFMA 4PWZA 4RJ2A 3E3OA 4B46A 4NIMA 10MHA 4PZAA 3M6LA 5C8YF 3CF0A 1U7WA 5IBPA 2V65A 1XUOA 3TI7A 2OD7A 3KOYA 4O33A 4OYHA 2DC1A 4OYYA 2PMBA 3PD0A 4Y2XA 1SKMA 3T0IA 1YV9A 2ZRPA 3H19A 1V0JA 3TR0A 5ICEA 4FGLA 2PE5A 1GPYA 4MNTA 1SKQA 4WXMA 2HNBA 3T0FA 4Q24A 5P8WA 4ALKA 1WNFA 4J0EA 1ODCA 4K88A 1PLJA 2GPBA 3U2QA 2EKLA 3AC0A 2BE7A 2HEIA 1W76A 2D8MA 2D3WA 1OIXA 1XZCA 4NAVA 3TECE 1FDIA 4BFYA 3FNHA 3ROXA 3W2FA 1IHYA 1QIDA 1O4WA 2R7LA 3FPGA 1AA6A 2AUNA 4EGQA 2IZ7A 3ESYA 1DKNA 2JGIA 4KIJA 4RE5A 1T5TA 4UCXA 5J63A 4BLPA 4RJTA 4YAFA 3STWA 3MVEA 1WMSA 1P1CA 1LPNA 3TFOA 1LNSA 1TJ4A 2ZLBA 4KQ2A 4V0SA 1BE1A 1T2VA 2W43A 4TMXA 2A7XA 4B47A 1B0UA 1O6ZA 4HDMA 4JP3A 4CKZA 1L4KA 3EIEA 1ZL2A 3A0UA 4FNAA 5IX8A 3ZWDA 5CIQA 1N92A 1X80A 3LSTA 4I1RA 5TEWA 1X80B 1ZPDA 1KS9A 3MFQA 5HEKA 3VYTB 5KNLA 5E9AA 5DASA 4ZAVA 3M6FA 4C05A 5KOJA 1M0WA 1CCWA 2YVLA 1P45A 3CEAA 5NULA 5IANA 4F8EA 4JXXA 4QBKA 4XZ3A 1IM8A 3AJRA 4KN5A 4XUEA 1PJTA 3O92A 4CIDA 5K0CA 5G2OA 4YQEA 3TCNA 4FZRA 3BFKA 4I5DA 4P22A 5EPUA 3I5AA 3WISA 4NCBA 3VC2A 5EJMA 1M2JA 3RHFA 4C88A 2BVNA 1FDWA 1YRLA 2G5CA 1IHPA 4ND4A 2ZW9A 4OIMA 4RQUA 1XZFA 2R6ZA 1KAQA 3OZTA 3T4UA 3SX2A 3EXEB 1KARA 1PQPA 3SEZA 3K72B 2DY0A 2D7CA 3FA2A 3U4AA 2QL6A 4KRYA 5ALLA 3ROMA 3A9UA 4ENUA 2Z56A 2Z3VA 4W4TA 1SKBA 3SDBA 3S70A 2ZZKA 1CUCA 2NYAA 5C3MA 5JU6A 3O2JA 3OEHA 2BF4A 3L7IA 4Y1RB 1PGQA 2IYSA 3PITA 1QGOA 4J75A 4RLQA 4FDMA 4OLAA 1IK4A 2XA2A 5K6AC 4LWQA 1QLHA 3QVWA 3Q2IA 3GLKA 3Q5DA 1LEHA 3TJZA 3BWDD 1SVNA 1IFXA 4RSMA 2QVZX 4G5OA 1G5QA 3MD9A 3ZV5A 2CLOB 8GPBA 5EE3A 3NASA 1N32B 5BN4A 2UZ1A 2XE7A 3AVYA 4WNAA 4B3GA 4RENA 1WPQA 5JAUA 1WX1A 4RCZA 3VVMA 4YMUA 3RFCA 1TB4A 4CV3A 2OCDA 3GLSA 3S2IA 5DULA 4NU6A 4ARZB 3ZHSA 3N0VA 5EP3A 5M29A 1US8A 3GGDA 4O0LA 4OQPA 1JEQA 2YWBA 1SKYB 4F4CA 1GFZA 2KB0A 3SKVA 2ZJ4A 1E5TA 1EK1A 4FYYA 4FJ1A 4TRJA 1ACMA 3GFPA 4XR4A 3TQFA 3UJAA 4JITA 1AGYA 4U7HA 4EJ2A 2L17A 3W5SA 4JB8A 1Z4KA 1T6XA 2RGAA 2QZJA 1JSCA 4A2WA 1P7ZA 2R62A 4FB4A 4M0UA 2H4HA 3A27A 4GOJA 2WHYA 4WGFA 4ND7A 5AK3A 4B87A 3OCCA 5B30A 3AY7A 1UBJS 1GUFA 4IIGA 1KZYC 5IASA 2OHOA 3E35A 2G77B 2WTXA 1MCZA 3FHLA 1KDVA 3RADC 4RKQA 1AQ6A 3M4ZA 4L22A 4TM7A 3SKYA 1DE0A 3L7MA 4AIIA 4D9IA 5JXIA 4RTNA 1JZQA 3V2HA 2K5UA 3IV9A 1GU7A 4XJSA 2IU0A 2HA4A 2FEMA 5AHWA 3WWCA 5INTA 4IF6A 3BDIA 2VIIA 1G5TA 2CZGA 3PIIA 1NG9A 4QICA 4QUEA 1DEKA 1NUSA 1T4CB 5BYKA 4E46A 1D6MA 2PZLA 2CGEA 3HMKA 4MMXB 1FRVA 1AQIA 3IR7A 2O0LA 3D6HA 4FFBB 3AB3A 1NBWB 3PC3A 2PH1A 5A1JA 1U2DA 2HGSA 3FYHA 3IKLA 5CG2A 1I7SB 2Z58A 3TF5A 2O20A 3ENKA 4JXJA 3L8EA 2P4UA 3ZKWB 2R7KA 3IT0A 3RW9A 1BJTA 4YI5A 3ZVRA 5IXSA 3D8BA 4JLUA 2MJLA 4F1KA 5B6PA 1TMYA 4ND1A 2QMEA 1ZD2P 3KLMX 3O3MB 4L8LA 4XQ9A 2ANCA 5EQDA 3UVEA 4WLEA 4YFYA 4BB0A 4F84A 2Z5VA 4BDTA 4DNXA 1TF7A 3GL9A 1J24A 3LYAA 3G13A 4GDFA 3AM3A 4IFBA 5FL7D 1CY7A 1OILA 3E3LA 5EVCA 5KOHA 4C7XA 4JNKA 1K9SA 3VZRA 4ZYUA 2C5EA 3K1AA 4HEJA 3L1JA 1JIKA 4LYHA 4PRLA 4Y0VA 4YDRA 2W6JD 5ALEA 4YCMA 5CGZA 5KQMA 1FVHA 1Z0ZA 4I6EA 4LSMA 4OK6A 4AQYB 1C3EA 1S8AA 2GCPA 4LBWA 4G5RA 3HJRA 5IN5A 2X22A 1P1IA 4CQMA 4TYPA 4BL5A 2ZYIA 4P92A 4HVLA 3I9FA 3JWGA 2GEUA 3CISA 3V00A 4LTNA 1R66A 3CQ9A 3IO5A 4B3MB 2UZ3A 3OZFA 3ZPXA 4R31A 1XJCA 3LUBA 3DC2A 1Q19A 1WXGA 3HZOA 3RNLA 1DQSA 3KDPA 1TUIA 2Y0DA 1EWRA 6CHYA 1CRZA 2Y66A 3QXGA 4GHWA 3LY7A 1OLUB 5FWAA 3WYNA 4P5EA 3UT0A 5EVJA 2IP2A 3C2QA 3O1LA 1B15A 3TMYA 3DMGA 4FDTA 1T5HX 2QUIA 3DVAB 3HBMA 3TEJA 1L4YA 2AOTA 2X0DA 4S24A 1XCMA 4G4SP 1WZNA 3WSTA 4A73A 4UAVA 1I3KA 5D00A 2PVPA 2QZ4A 2VJAA 4OIFA 4H7EA 4ZEXA 4CMHA 4YRBA 2ZJBA 7AT1A 1DZIA 4QOJA 1V25A 2FV8A 3FCXA 1XLTA 1RZ3A 2JFHA 4L6IA 2W93A 4FHZA 2PIDA 4YRMA 3H1GA 3A2MA 3O74A 4HWGA 5HKAA 3DPUA 3A6PC 5FDFA 1Z2CA 4FYMA 2YCLA 121PA 2FZCA 4XSHA 2BKUA 5D6NA 4U7DA 1WBDA 1RAIA 5IJXA 5JZSA 1SC3A 2RG1A 4O8CA 2X14A 4O29A 5TF4A 3I5XA 1UEIA 1PJQA 3KFLA 3LCRA 4BUZA 2NUAA 3HCEA 2ZRGA 2H1LA 4MSUA 2VLBA 4I1SA 3L6EA 5K03A 2C42A 4OY3A 1QHSA 2ZYHA 5JS7A 4BMXA 4ZHSA 4D4JA 4EHBA 3TINA 3WV5A 2ERYA 3HU1A 1QG0A 3ZV7A 2FSFA 1BGXT 2JFXA 4YRQA 1AV6A 2IOQA 3KQPA 4AJJA 3ZWBA 4UC0A 3PLAE 5KTMA 2A30A 4RMGA 4F4FA 5BRJA 3ZUPA 2ATVA 3PUIA 1X70A 2O2JA 4NENA 5IDYA 4PAQA 2HZBA 4C7MA 4IQGA 1P0QA 3PUVA 4KXNA 1PFGA 1QFYA 2X6RA 4YDQA 2IV3A 1Y3AA 2ZSHA 3FIUA 4FLFA 4HNAA 1Z74A 5LQSA 4RULA 2IOFA 4H77A 3E22A 2ZRFA 3RRMA 3R5XA 3WLOA 1AS3A 2XMCA 1QFXA 3Q3VA 5GPBA 4QZVA 3VNRA 2VC2B 2CWDA 1M6WA 3ADKA 4RYDA 1H2FA 1ECFA 1SVWA 4UFOA 1C1YA 2XMSA 2KX7A 5DSZA 4BIIA 1AO0A 2GF0A 1ADYA 2I03A 3OLCX 3OPMA 3PFKA 2AE1A 2PWYA 4DEXA 3TZBA 1KRHA 1TEVA 4B7UA 2C7BA 1VLZA 1XAHA 2FR1A 1YDHA 4HRYA 4PC1A 1Z3CA 4ZQHA 1SU7A 2PL9A 3ESXA 1RBYA 2QRVA 4RGBA 4BZQA 2FFAA 3L8YA 4NPHA 3L46A 3PA8A 4L07A 3EPJA 2C4NA 2IV2X 821PA 1ADGA 1E3IA 1KO7A 4XFJA 1C9NA 3TB4A 4CG3A 3BWMA 2EFCB 3DWEX 1YCHA 4IDCA 3ROGA 5DP2A 2I2CA 1VG0B 1CE8B 4W5QA 4A4DA 1KEEA 3K6RA 2IUUA 1DG9A 5HFAA 4NJEB 5E9QA 3TFQA 2WSLA 1JTFA 5F52A 3W5JA 2QF7A 3DKVA 3W8RA 3GH3A 4QPJC 5FUXA 3PEFA 1P2GA 3BCSA 4ARCA 2CNKA 3ROEA 1O96B 1E0JA 2G07A 4BEJA 2ZS9A 4RX1A 4C06A 1NLYA 1C1DA 1SXJB 3UMBA 3JQQA 4W5TA 1HUQA 2V7UA 1A9PA 1EPUA 3UAZA 2JDIA 1X8LA 1DDIA 2DBZA 3CVOA 4HWOA 4PPFA 4PXSA 4XDZA 5IUJC 3O26A 4AZ0A 5LFAA 4BEVA 4P7KA 3IIKA 1CJMA 4L76A 3VO1A 5HIAA 3GBSA 4JGBA 3UN1A 1SQ6A 4DJJA 2EX4A 2HK9A 4BVKA 2Z9BA 5KNDA 2WHQA 4UREA 5A4KA 4DLNA 1H4QA 1KZGB 3E2MA 3FTNA 4RCYA 4M83A 5G1NA 1H6DA 1EP1B 5ICFA 1KGDA 4B73A 4BCCA 2ORVA 2WIGA 1HFWA 1NJSA 2O0MA 1GFSA 1YHNA 3ILXA 4BNZA 3AL0C 3WHIA 2NMVA 1V4NA 4J7CA 4BVHA 4EKNB 4CG2A 4FWTA 2GK3A 4OI4A 3OQ1A 4JJEA 3ESRA 4IIVA 4ZEVA 2PYZA 3AEQA 2ZDHA 3TZKA 5JEDA 4C0WA 4AP9A 4DMGA 1M9NA 2BEUA 4IKEA 1GPH1 2YRFA 3PI6A 4G9GA 3BXPA 3WQQA 3WGOA 2QS9A 1YB4A 5IC6A 5LYYA 2FP3A 1FBNA 5TY0A 5TSDA 2IHBA 4G5QA 1G8HA 3UK6A 5IKMA 3NONA 3LXRA 3TR6A 3F7MA 4MCAA 3NYQA 2PRKA 3VDQA 2Z9CA 2XCQA 1KMMA 2FGJA 4NDNE 4JLPA 4I1IA 2C9MA 4OA8A 2GVDC 3KWMA 1YZ3A 4AC9A 3Q3GE 2XRMA 4LZJA 1LQ2A 4GD3Q 2W6MA 2OYSA 1DG3A 1X1QA 3FBWA 1C7FA 1N5IA 4II2A 3LBNA 3A4MA 2YNMC 3L1UA 2R7NA 4F85A 3CONA 4X66B 1ZVQA 4GX2A 1Q1EA 3F97A 3QNWA 4N3NA 3WL5A 4C0SA 4ZYVA 3V7FA 3A4NA 3TNLA 2ZVQX 3ND5A 4PG5A 3VPBA 4MROA 5EHXA 5JS1A 1UC9A 5B5SA 5FUMA 2APJA 1XXHB 1HE3A 1S4QA 1TNDA 1WKVA 4Q00A 1NMYA 1FYXA 3P4UA 5JCPA 2XYGA 3TG2A 1RHJA 2CY0A 2HMYB 4X91A 1D9XA 3IEKA 1IBSA 1RRVA 1NJ6A 4MICA 4TKLA 4NMHA 4EPVA 2GHRA 2C2WA 3HKBA 3IE0A 3SJAA 2VHWA 3TRFA 3B5EA 2Q0QA 3KV1A 5I9SA 4DHWA 2YBEA 4UTNA 1IG0A 1IXYA 1DJQA 3WGZA 2YUTA 3A3KA 5EIXA 3BK2A 2XXAB 4WNIA 5A4FS 1A76A 1HKHA 3EXIB 4G9EA 3J7TA 1QRSA 4YQYA 2YWHA 5K3CA 3E0QA 1XFAA 2I1LA 1GD1O 1PWHA 1T2FA 3CU5A 5EKUA 3KC2A 2SECE 3IDFA 3QWAA 4ZDKA 2HU2A 1NJ5A 4Q3LA 5FWDA 3KXLA 3LDAA 3NT4A 1YNOA 1OWLA 2X4DA 4OGGA 2NYRA 1W93A 3U3KA 1W88A 4AMYA 3KVNA 4HWTA 3MIZA 4OJMX 5DTEA 3UUWA 3MUEA 1GYQA 1KK2A 1RI3A 2CXUA 3EZXA 2QUHA 3IS3A 1FFYA 3K94A 1Y5RA 3KQQA 4OFZA 5K05A 4WN9B 2XRFA 3AY3A 5HZMA 3D3NA 4N5HX 3EVAA 3SZRA 3ZDDA 3KJHA 4J3FA 4UVEA 1MX1A 4MKGA 3DQZA 1Y3BE 1E1LA 3IXLA 1Z7WA 2WWVD 2JI4A 2FHSA 4CKBA 1T8YA 1UBRS 4Q18A 1KMNA 3FSGA 1X1BA 2PYDA 4F4UA 1UMBB 3AV0B 2CLCX 4UVIA 4AJOA 4D3SA 1HSOA 4M1QA 2QSYA 4ZI7F 4OGKA 2WG2A 3K2IA 3NH6A 2WSMA 1SIWA 1DHTA 3H9QA 2JG3A 3I12A 2BT4A 3CN9A 4I50F 3EXG2 1ZQ1A 3I32A 4ZOEA 3AVTA 4OLFA 2XQFA 4P32A 1QHEA 1PFUA 2IA5A 2B92A 3I2JA 4UD6A 1P9OA 5EMLA 3IH5A 4KRXA 4UAGA 4DCMA 1YAHA 1UBNA 1WULS 4OP3A 1NUUA 5MF6A 3PHJA 4PG8A 1LI4A 2EX0A 2C0PA 2NTVA 4RA9A 3EGWA 1YHZA 1XZLA 3DDCA 3E18A 2AN5A 4MUAA 4F72A 3U6KA 2V7GA 2G1UA 2QNBA 3L4BA 3P7MA 4G1FA 1Z28A 3T5BA 5C31A 4YMLA 4CEIB 3NIDB 2ON6A 3DBLB 3ENWA 5E0OA 3QENA 7ADHA 4BAZA 4CEHA 2OMKA 3ZJ5A 2HK8A 1LK5A 2WUEA 2XKBA 2CL6X 2XNDD 3HBJA 1U0NA 3AXTA 1ONPA 2JBAA 2ZAYA 3D4LA 1NURA 1YC5A 3DD1A 4G2NA 4CPDA 2FG5A 2YXDA 1JBKA 1J90A 4KAAA 4YLGA 4TKUA 3EPRA 4ER0A 2E49A 2IK8A 2D1YA 2ZWMA 1T13A 3GP3A 3Q1KA 3KSUA 4QU9A 3P0HA 3K70B 4IMJB 4BV8A 1JHRA 1KEZA 4RVFA 4CRWB 2I71A 3QLUC 5HJEA 2CXOA 3MLAA 4UTVA 4ZJUA 3OECA 3MYRA 3FCSB 3RU9A 2GEKA 3VSEA 1J20A 2WV7A 3BOSA 3OH8A 2WQZA 4WNYA 1Y9ZA 4PO8A 5AVQA 2IZ6A 1ECGA 4PRZA 2OBLA 1D8AA 1EAMA 5D3MB 8ADHA 4WLVA 1GAQA 4Y9TA 1EUZA 1U8YA 3TYXA 2HU8A 3ECAA 4RXTA 5I4KA 4RKFA 4COKA 3SY8A 3RVLA 2LP4Y 3W9UA 4RNCA 2C4TA 3PENA 3D0QA 2BZSA 3ETJA 4HNHA 2B78A 2JIRA 2PH7A 3T9AA 1W19A 5JFOA 1X7HA 4RHXA 1PFYA 3FFTA 4NSNA 1H1LA 2OWDA 3DFUA 4G89A 4ONEA 4U5XA 1NXTA 2EZ4A 1ADCA 1CFZA 3L1HA 2OKGA 2ZT8A 4FS3A 4GOLD 2WKQA 4R2WA 1JKJA 3AR5A 2FUEA 2ZIGA 4QM7A 3FNRA 3DOCA 1X1DA 3A6JA 4DKXA 4PIPA 1GQFA 2XYVA 2GPYA 4C6HA 1E2EA 4V1CA 3ECSA 1FPQA 2X1LA 5JS6A 3ZE2B 3NUQA 1W73A 3B20A 3BE4A 5ALJA 3LKBA 4OGFA 1N33B 2W90A 2Q9CA 1F4VA 2X77A 2P0YA 3QKRB 2F00A 2PLNA 2NVUA 2QTFA 4Y2VA 1M5RA 2X8LA 1HOTA 1ZXBA 3PKIA 3PQEA 1YDGA 4JIGA 3WLKX 1YS9A 3JZFA 4AZWA 1PU2A 1H6BA 1W4CA 4LYDA 5EEHA 3Q87B 1HDGO 2WRZA 1KZHA 1MX9A 2PEYA 4BO0A 4E5NA 5LMCA 2WKWA 2JKYA 4LOHA 4UE3S 4YJ3F 1EHCA 4D4MA 4QOEA 3GLQA 1K6IA 4NKRA 4OQMA 5CYPA 4WECA 1X3SA 3FDZB 3ZEIA 4CW7A 5CDHA 1LRKA 4G23A 1BCRA 1ISPA 1P1BA 3LQYA 1NOJA 4TKMA 3SYNA 4RD4A 5I51A 2XBMA 4L9WA 1B8PA 1MUUA 1YFJA 2QM8A 2ZTLA 1OVMA 1DU4A 1GCGA 2QW0X 4YV7A 1CZLA 5B57C 2IXBA 3LO5A 5H7XA 1U1FA 4C6SA 2NNWB 1WO8A 2Q21A 3OUTA 3SDZA 1VGVA 3F7OA 2JIQA 1T9AA 5JSUA 2B7BA 2E1PA 3RKRA 4R8KA 2ONYA 2A6PA 4TV8B 4CT4B 2F9LA 1GCAA 4XLLA 2DY1A 3AKCA 3BULA 4NZPA 1P73A 4URYR 4PM4A 1R8SA 5DLDA 3WOVA 2FQWA 3LC7O 3DHYA 5IPFA 4I5FA 4X5OA 3RH0A 4CV2A 2JLSA 1VL2A 4WA8A 4KLZA 2ZRHA 4ND8B 5A2GA 3H5OA 3TRDA 2V55B 1QB7A 1XQVA 3NNSA 1XZDA 1TJ5A 4GOND 1I10A 4D4LA 2F62A 3GJ4A 1VC2A 1MZVA 2ASVA 3A4LA 1RQ7A 3T15A 1RFGE 5C7YA 1U0EA 1BCSB 4OSEA 1FQJA 1DPGA 1KMQA 2ZJ5A 4K26A 4REQA 4CL2A 3OQNA 1CR2A 3FCUB 2IS2A 1GQRA 3O8NA 2IOYA 3BE5A 4OFBA 4KR7A 1AUVA 3AEYA 2GARA 5U1PA 3RT7A 4HDRB 5JSKA 1RMQA 1EDBA 1ZAKA 3OT5A 3CH5A 4CMKA 2CB0A 3N2KB 5DU2A 5IP5A 1SUDA 4XGRA 1YKGA 2IYYA 2R1UA 1A77A 4ZZ0A 1TK3A 4KVZA 1PL7A 2QZZA 3I9KA 2GI4A 4WW0A 2IGBA 3LP5A 1E3DA 2DPYA 3AVPA 3OTQA 5AVZA 2JATA 4RDIA 2BYTA 1BYUA 3U1VA 1U5CA 1F7UA 2X9NA 2I7VA 1SUFA 5CNMA 2XVMA 1NT2A 2B2CA 2ZE8A 3G2IA 2C2XA 3AVWA 2C1EA 4LOKA 3GFQA 3MMNA 8MHTA 4KGVA 3MS7A 1RWQA 1X8XA 2OORA 4GKKB 1SB8A 2PRZA 4B4VA 1QWOA 2C9CA 1SR8A 3B3GA 4B32A 1G20A 3SKXA 3V6MA 1EJ6A 2A9FA 3ZLBA 2C31A 2ZJAA 2P2YA 2B6HA 1US8B 4M76B 1IIBA 2HV8A 3P27A 4FE3A 1KDYA 4B85A 4CR8A 4KK4A 5KYXA 3I92A 3O75A 5EKTA 4AJ4A 2NXNA 1VL8A 3DOIA 3TTXA 1HMPA 1Z0JA 2D0IA 3HU2A 5AUQA 5LA6A 4B3IA 3WAKA 4BGEA 4CZ2A 2CVHA 3FYCA 1PIWA 4CTMA 1MVLA 3BMOB 2EARA 3W1EA 3SZOA 3CLRC 4QEKA 1WY5A 4LQLA 3FNEA 4BX0A 1EESA 4IG9A 1L6RA 2I62A 1WWKA 1BFDA 3WIEA 3EPHA 5CVDA 4TT3A 2ODWA 1SXJC 1UBUS 5CM2Z 3DB2A 2B1GA 3M8KA 1UBCA 2IE0A 1CR6A 1QOZA 2ZYRA 4MW4A 3V1TC 4LZNA 3I73A 4MTLA 2Y05A 1C7JA 5HRAA 3ZW9A 5D51S 3F1KA 4D8XA 4AJEA 1AKVA 2AHRA 4QTYA 4I19A 3LKDA 3U4GA 4LDAA 3PQ6A 3FZYA 3HV2A 4L5CA 4BLTA 2PD6A 3CH4B 1PS8A 1Z8FA 5HBGA 3BQ9A 4LHXA 5ER9A 3VJMA 4MLZA 1FCJA 2FOLA 3AW9A 3IPAA 5L95A 4GYYA 3S1LA 1W1WA 3QZUA 4RFLA 1B26A 4ZI2A 5TF0A 4PU0A 4B4KA 1NVAA 1QF7A 2PBFA 3VVBA 2XOXA 3K0SA 1G8AA 2BBSA 1YFZA 1P29A 2Q5CA 4PCVA 4F6RA 3C4QA 2AL7A 4RACA 2JGKA 1F0PA 1M2WA 2CVPA 2CFTA 2O5VA 1A5BB 1B14A 5AJZA 1YS2X 1XRMA 2I3DA 4P31A 4QRIA 4EVQA 1PZXA 4JBGA 3ICOA 3NRJA 5HUJA 1UFQA 4B35A 1Z6GA 3EE6A 4Y2PA 5TRTA 1T6ZA 4Z4CA 1NKVA 3TLXA 4D9MA 1Y1KE 4FYVA 5EXXA 3M5CA 2AIRA 3K4QA 1VFNA 4C0HA 4MIYA 3GP8A 2YYYA 3R8XA 4M7OA 1R9MA 2V7QD 3AV3A 5ALHA 5EOVA 4C4AA 4EX7A 1IVSA 1TYZA 2G9NA 1U0SY 3C7KA 1N6OA 1EE9A 4GGMX 3NFYA 4QU0A 4O2BF 2CDNA 3TX2A 2QUZA 4LHYA 3R3HA 3AEXA 1I9GA 3DBLA 4DLTA 3ZJTA 1MT3A 3AHGA 2EG5A 1USIA 1WUJS 2ADFA 2MTBA 3SM9A 1Y1QA 4XGQA 2DWUA 1R0RE 2EAUA 2HAEA 2XDAA 1E7WA 2L18A 4IDGA 2MU1A 2QPTA 2VQFB 2GYVA 1VJGA 4PZ0A 5LP6A 4IM7A 4JDPA 2C97A 4EHKA 5A62A 2H51A 4J7UA 1G0NA 3RS7A 1T8PA 3A11A 4G41A 4PSDA 4FT4A 5EY5B 5TT1A 3R74A 3N76A 3W1VA 3G2PA 4GVPA 1VMKA 5AWFC 1SUWA 2ZQ5A 5DTQA 1XVAA 2R7MA 1GVNB 3FKJA 2J30A 2H48A 4LXIA 4NZ9A 4YRPA 4CKWA 1J8YF 1SG0A 3L7CA 2V4ZA 2JLVA 4Z86A 5TMBA 3VKVA 4YREA 1MB4A 4J7AA 3FWYA 3U7HB 2VRBA 1XA0A 4N47A 1XJ5A 1JPVA 4ZVUA 5K6TA 3IERA 2JIMA 4QLOA 5AVTA 5F7ZA 1XQWA 1WQ1R 2EP5A 4YV2A 1ZOIA 4QTZA 3R0QA 3ENZA 1G21B 4GI3A 4ZVNA 3HO6A 5C34B 1G8YA 1V8BA 1R10A 2VG8A 3FPKA 1WEHA 1PG0A 2E37A 3G2KA 3K0HA 1XCGB 4KBFA 4DCCA 3N6VA 4EKIA 3RC8A 2O2EA 1EGQA 2LUOA 3LUHA 4HZUA 4B7XA 5BVGB 2AMFA 5F9FA 4HB4A 1CUWA 1OYOA 1X7WA 2R6FA 4D2IA 3WL7A 4QIHA 1SEVA 3V4SA 3MJFA 1DEAA 1JAIA 1T5LA 2Q8QA 3JYNA 4GECA 4QVGA 2W7TA 5SZIA 4RA9B 4WSOA 2C57A 4TVBA 5SZKB 2QUKA 1Z12A 3IUQA 4JYAB 2HEGA 4U7JA 1V8DA 1AHHA 3I23A 1JE0A 1JXMA 2HWXA 2PJDA 3FGPA 3JPWA 1WHTA 1Y6GA 2CC2A 3E84A 1QH1B 1IHUA 4AD8A 5EE5B 3F6SA 2IJGX 3GW8A 2C0QA 3E27A 4TQUS 4NS1A 3PF9A 3W5AA 3B53X 1PL0A 1T6BY 4FONA 3TOSA 1HX7A 2FR0A 4FR0A 4RJIA 3V4VB 1EBFA 2WP0A 1MAWA 2D5LA 2FF7A 4JT9A 3NBYC 4TL9A 5JRZA 4YPVA 1H3EA 1OWNA 4UEWA 2GZAA 2ZROA 1DRWA 2SKEA 1JR3D 3IPYA 4O4HF 4YP5A 4MR9A 3FVWA 3VUEA 5A0VA 1K8XB 4TMTA 1MRNA 3PQCA 3V48A 5KNCD 3AG6A 3JQRA 3PC7A 3MJRA 4J9VA 2H4FA 1NQWA 1FLAA 2Y27A 2IZ1A 4B34A 4UHKA 3X2SA 1XQ6A 2PFGA 4UHDA 2R6CA 1VCNA 3CUTA 3Q8WA 2O8BA 3C1UA 4JOCA 3BBPA 2PJUA 4B7ZA 3HBFA 3DE6X 1T8SA 2W2PA 1O9BA 2L42A 4M1YA 5AHKA 2G1PA 4CODB 1G2OA 2CD7A 2JEZA 3DMHA 4LMBA 3K5PA 4KQXA 2FMTA 1J5XA 4LVCA 2GBLC 2O4CA 3D4NA 3QMVA 1RJ9B 1NF2A 2AF4C 1ZHOA 2VWPA 4TMVA 3G88A 5ITZA 1PTJA 2EWMA 1LD3A 2AG1A 1C81A 1V6SA 4DG5A 2W58A 1TGVA 1RDFA 3AILA 4C2UA 1FS6A 5BR1A 5KQGA 3X1KA 3U9SA 5KNCA 1HZZA 2YMQA 3CC8A 4CTNA 3D5QA 3HV0A 3LUCA 4FDLA 1IAVA 4KJZA 4ZCLA 4D6XA 2FZGA 4P2BA 4UASA 4F60A 1R00A 4H4DA 4BNMA 5ALPA 1J8QA 3L0OA 4P3YA 4Y7CA 5G1OA 4ZCPA 3OTHA 2IIPA 3ESCA 2NAPA 5C4IA 2V4UA 4NQRA 3RS9A 5L8VA 1PX2A 4D8UA 4E3WA 4G36A 4I6JA 9MHTA 3LUGA 4QUDA 4MA5A 3U3ZA 1N8KA 1DRJA 1G2IA 3N58A 2WIKA 4JYCA 4OQNA 5EIAA 1CVIA 3KIPA 2PGLA 2HPZA 2JH3A 5E0KB 6YASA 4H7JA 1QG6A 1IBMB 2FETA 2GILA 5HE8A 2O0HA 3I3SR 2FJUA 4TXLA 3RBXA 3WL6A 4C76A 4OG2A 5IYZB 4TS1A 3TD2A 2AWNA 3UAWA 1PFVA 1W4ZA 1ZI9A 1OASA 1Z6QA 4KWCA 5B1DA 1IY1A 3DE4X 2NTJA 4BNJA 4DJFC 4ZYXA 1JECA 3R23A 4QYMA 2Q1YA 1SBCA 2WZCA 5CJ2A 3PJDA 4EX6A 1IWOA 2HA7A 4Z2YA 3PUWA 3QKTA 1HEIA 4ZODA 3RF7A 3UM9A 4K9PA 4BVEA 1JQ5A 2E4ZA 4ZQGA 5BURA 1JHUA 3AU8A 3E2PA 4M6WB 2QP3A 4G0XA 4PZLA 1IY0A 3U4HA 1U02A 3GUZA 3LUDA 1YMVA 4LYEA 4PS0A 3TKYA 2QX7A 1IK6A 3ORRA 4BZPA 4Q3DA 3L8DA 3RB8A 5JSZA 3R6LA 2XAAA 3ZY5A 2UZ0A 1WL8A 1HQCA 5JE8A 1J8FA 4IGIA 4B6GA 1U2PA 5FI3A 1WA5A 3AZOA 4KYVA 3VKWA 1RPZA 1TZJA 2AMVA 5DM70 2ID4A 2D59A 2EZ9A 2Q1SA 3RM3A 4BAUA 2QD4A 3R5SA 1O1YA 5CYOA 3RRXA 1WAMA 2XUPA 1CQJB 4X00A 2FR8A 3II6X 2N46A 2CXPA 3EVEA 5HG0A 1BEZA 2KQUA 5AICA 4OVKA 1T0UA 3IFSA 3QITA 3JALB 1UP7A 5EA2A 1OQAA 3H4VA 1DS6A 2FQXA 4ND5A 1V5IA 4CL3A 1G64A 4E4YA 1KOJA 1NQXA 3PEVA 1I7DA 3HUDA 2BFFA 4JNCA 2VXCA 4L4ZA 5DGTA 3IHLA 4U6NA 2NUPB 3LP8A 3T1NA 1P1JA 4MAAA 2P35A 1JG7A 3Q1LA 1QV9A 2QB5A 3NHBA 4H60A 1YDWA 2ZAIA 1ANKA 2XT0A 3R3VA 3GT4A 4ZK6A 4LX8A 1CRWG 4G5FA 4IX9A 2CVZA 2NOAA 4IWXA 4Q3KA 1E5LA 5JJKA 1U94A 2WBLC 3HKBB 1L5HB 5BNFA 5IBCA 2I1QA 1CUUA 1RI2A 4EPYA 4F0JA 4G4SO 4YT4A 1KK3A 2EFJA 2A8YA 1R1DA 4D5GA 4AN1A 2R79A 2GMWA 1YZTA 4AYTA 3EWAA 4UFPA 1BN6A 5KTKA 1GV0A 2XVZA 2XY4A 2BM1A 4J76A 4KMOA 3N7TA 4UMVA 3H42B 4PNZA 3HYNA 1NBIA 3KWFA 5CLQA 4EW3A 4UM7A 4GZ3A 1HDEA 5GZ1A 1Y6ZA 5CEEA 4D4GA 4OKIA 1KETA 4DLSA 3I42A 5KYYB 4C7OB 4MA0A 2IIVA 3L0DA 3WIVA 4MQEB 3WNVA 1SD5A 2PLRA 2RI0A 1R2QA 3F78A 1ECBA 5B1EA 1UOEA 4MKFA 1L4GA 2FFJA 4RS3A 1IY2A 5DW3A 3O3NB 2C8JA 1U2TA 2GB4A 4IQ8A 3WGNA 5KTOA 1BDHA 2PD4A 3ZK7A 3HP1A 4C04A 2UXDB 3ZTYA 3D3JA 3NM6B 4WT7A 4D6YA 5BR8B 3JR7A 1IWPB 2XYHA 3GLTA 1N4DA 1OI4A 2B82A 3DZKA 1MT0A 1DAMA 3UKDA 4WJLA 1YVDA 2NO5A 1IUOA 3D0RA 2NTEA 3KJFA 4CN9A 3HJAA 2AOWA 1PDWA 4K2HA 5FOQA 3SLGA 2JAXA 2YICA 5ESDA 3GEDA 3L4BC 3WQHA 1UQUA 1XZQA 1ABEA 3G9QA 1N6LA 3GLUA 4A36A 1VHQA 1PRYA 2JJ2A 5DO9A 5FBHA 2O8FA 3SQWA 1XC7A 4V3BA 2HC9A 4BB5A 4LRYA 1SIBE 1U6KA 3HEBA 4Y8VA 3CZPA 4HDSB 1RI1A 2VZLA 3NBQA 4WZAB 3AR3A 3SBEA 3TQSA 1QXSA 2P0EA 4BVLA 4FB5A 1SU6A 4QGFA 4X1IB 5AK5A 1YOBA 4ESVA 2OB1A 3NWEA 1Y5MA 5KSWB 2OQ2A 1GRCA 2PUHA 4LV6A 3C3YA 1OWOA 4NV0A 3ABQB 2DB3A 3MGAA 3JATB 3RDPA 3RC3A 1XV5A 1KKUA 2XMRA 4KGXA 3N2GB 2NZYA 1Y6FA 1T6NA 1G5RA 3CURA 4YDSA 1QDUA 3CEJA 2QT1A 2VWGA 3DLAA 3MRSA 5FWYB 1NVFA 3CPEA 3SJZA 3BTVA 4FN5A 1GNVA 2BGUA 2G67A 2ZSIA 1CR1A 1Z4JA 3JQBC 5GM2A 3T3GA 5H9VA 4CIAA 3IBTA 1YCDA 4UDOA 4P4SA 5AKGA 5HF8A 1FQWA 1OLOA 3OZSA 1DV2A 4QFDA 2C54A 2XTAA 3PQDA 3FE2A 1JH8A 3RK0A 4BLVA 2QIOA 3DYBA 4QTUB 1KE1A 3NHWA 5EIBC 3RI3A 1O9GA 3R24A 4NH0A 4ZQIA 1NC3A 1OLUA 1L1EA 3IAM6 3R7WA 3SVZA 3TLCA 4CI9A 2MYNA 2WWWA 4N0QA 4TTAA 1QOPB 1LPOA 1WDTA 3VO9A 1L3IA 2FMXA 2CE7A 2Z4RA 4MZDA 2ZETA 4W63A 4X20B 5F35A 2Z6UA 2GF2A 5JCJD 2ZWOA 4J29A 4OI1A 3EX7C 1J5PA 2JARA 5JAOA 1W8IA 2AZ4A 4IX1A 1FL9A 4H3HB 1UXIA 5EWMA 5K1ZA 4ER3A 3MT9A 4PGHA 3QBDA 2X6TA 5DOZA 5FLYA 4DNFA 4BZWA 2IOFK 1A9XA 4C0LA 4Q9HA 3AKZA 1MF7A 1RBQA 1JU4A 1SG9A 2IY9A 4HUQB 3X1ZA 2FSUA 1VZ2A 2J0UA 1SPXA 3HY3A 3IKJA 3NEAA 1BVRA 2GKGA 2L82A 3MCUA 3VZBA 3ZHUA 1PT7A 4DXDA 3A28A 4XIYA 4MVCA 1ZUD1 1JHMA 1TTHA 3URMA 1HBJA 4PR0A 1KMHB 3GQBB 4QXQA 4A16A 4GRDA 1RI4A 2B83A 2XUQA 3QF7A 5J5CA 5BNIA 2ZB7A 3HB7A 1HXHA 2WAAA 4EH1A 2EJCA 5L4SA 1QIJA 4NBTA 3PGMA 1BWQA 3V80A 2AOTB 4B40A 3GCWA 2HCJB 2P4HX 3FBGA 1A3CA 4IIBA 2C96A 3H6GA 3ITDA 3SICE 5JY6A 2BI8A 1B4DA 3ER6A 4S1NA 2XE8A 3UWSA 4BVBA 5FTNA 2C99A 1NPYA 2VYVD 4KQCA 4MPTA 3RLIA 1OU0A 3W7VA 2GYYA 1R88A 4WBNA 4IJ5A 1MBZA 4NYIR 4P4NA 2AOXA 2AR7A 4EHHA 3ETHA 2VXYA 1LBSA 2Q5OA 1VYUA 1RU3A 1H2ZA 2PK3A 3A36A 4CL8A 2IPAB 4C7VA 2YIVX 3BZWA 5FULA 2RARA 1QVVA 2DXIA 1DIAA 3OC6A 3FKQA 2GFHA 2VDQB 1K75A 1Y8QA 1FMFA 4MVJF 2HUPA 1ESEA 5B58C 4MYSA 4LJYA 1CQIB 4C3UA 3ABSB 2Q1XA 1YKSA 3KPJA 1T2UA 2HU7A 5JSFA 4J9UE 3PJRA 1TAGA 3DO6A 4AO7A 4JEMA 4DV5B 4C14A 2FR8C 4K9RA 5IJ9A 5JZVA 4NQZA 5JQGB 4HGRA 3OSUA 5DN6D 2O2HA 5THQA 4HFJA 4JP1A 3FROA 1SVMA 3CSSA 4LRTB 1ECCA 5CPBA 1J8DA 1Q3TA 4WCDA 3WGJA 1TUBB 2YC2C 1I7QB 5LZ4A 3SLRA 2O9JA 3M1YA 2DBVO 4UEQA 3TJMA 1E2DA 1MENA 1F6WA 1H9BA 1TCCA 3OPXA 2I29A 2XRYA 4J0DA 3IA7A 4R0VA 3WGHA 1I6LA 2PT5A 1I3CA 2O2GA 2P9FA 4QX6A 3P96A 1XRRA 1YSCA 3RAEC 2DEUA 4FFWA 1J23A 5I8PA 1AZLA 3OZDA 1OZAA 2RONA 3INTA 4Q05A 3RS0A 4RZXA 3P9XA 4J0KA 1R0WA 2G7ZA 4DCNA 2F4VB 1KY5A 2Q46A 1MW8X 3COJA 3INRA 1FLNA 4DS3A 4E2XA 1WMDA 2PO5A 4E88A 5KYXB 3BA1A 5C1IA 3GLGE 1NAHA 5KBYA 1P39A 1CWUA 1SWWA 2V03A 1R0BA 3E81A 4QD3A 2A92A 4WZBE 1L5NA 2FRDA 2BW0A 3FPFA 2HWUA 1KFKB 3I8SA 1EWYA 1BAPA 1VPTA 1Y1LA 3FOBA 4L9RA 4LYJA 4D0GA 3RO7A 4B9AA 3ASZA 1N5DA 4EJSC 2ZPAA 5AJYA 2GRJA 2A9OA 4K8RB 3H3JA 5T4HA 5ADVA 1JWAB 2DSNA 3DTNA 4TRMA 5BUSA 3HM2A 4ML3A 4XLZA 3VSAA 4YLYA 4YI3A 4G2TA 5JHHB 1J2EA 3EFOA 1GTG1 2FWRA 1GZ3A 2GK4A 2VJLA 2YX1A 4UEJA 5JFTA 2PKYX 4HGPA 1NU8A 1H4SA 1O0CA 1ZKDA 4YP1A 3BL5A 5H68A 2QAGA 5EHIA 5EL0A 3T6KA 1TZ2A 5B4UA 5HTOA 3ABOB 3UW3A 5C8DA 5H1YA 1QX3A 3LY5A 4F9FA 2O6HA 1P9NA 1M8PA 4V3CA 4O2BB 3V1KA 1YZVA 4TMFA 3MRTA 1RXSA 1U1CA 3C1TA 4BNUA 4H15A 5AKIA 5K5EA 1Y63A 4OJYA 5K0ZA 4QHYA 5LQDA 1XA4A 1JI3A 1J2RA 3E9MA 1NQ5A 2BEJA 1T8TA 5CXSA 5ICGA 4OUDA 4OHZA 4JVOA 3IGFA 4PZYA 1JQJC 2V98A 1T0IA 4K6FA 3F73A 1W4RA 2CXXA 4D3ZA 3MJDA 4BE7B 3UMMA 4KHPB 4EMTA 1QGZA 5B36A 5HM6A 4UPEA 4LG1A 3PNYA 1X0XA 5H82A 4PN3A 4IUDS 2OUKA 3H5WA 1JHYA 4FX2A 2P4SA 2Q27A 2R8PA 1PWXA 1RMYA 1VBFA 4JCOA 7MHTA 1HY3A 3K6JA 2HLDD 3BF7A 2DFKB 1E3EA 2IUSA 5JPDA 4U7GA 1AXEA 4QASA 4E31A 3ORFA 4NWIA 1Z0SA 2H3EA 1LFDB 5E7IA 1FFSA 5AM5A 2JIZD 3OEED 3T35A 4EGCB 2JGRA 5ANRB 1XG5A 2JGNA 3OJCA 1WSAA 4FKZA 5FR2A 2LZ0A 2X8WA 3SHTA 2POCA 3D2LA 5EHNA 3JZDA 2GUWA 2LW7A 1ZOSA 2G17A 1CD5A 1LRLA 2RHGB 2YFKA 4A10A 4FS8A 1CJKC 3HWSA 5CXXA 4Z3DA 1Y9AA 3SHOA 3X3HA 3QIVA 1VYVA 4I3GA 1U8EA 1T8RA 3RS8A 3TW8B 4J0GA 1PBTA 5ICCA 2D2XA 4R9VA 1O2DA 4LCEA 3RJ5A 5PNTA 1YR1A 3DWFA 4J94A 1U2GC 3RRNA 1T2CA 1NQVA 4EKDA 3VR0A 1N6HA 5BNZA 4JVLA 2DAPA 3LC0A 3TLEA 3JQFC 3CVWA 1MAHA 2B7CA 2FKAA 1RYYA 2HDHA 4M87A 1MX5A 3CR3C 1TZBA 4I50A 5IUKC 5G40A 4HAXA 3ZE9A 3UTCA 3QWIA 3SF8A 2DPGA 3RG2A 2ERCA 4B2YA 4MHSA 2HJVA 4RZ2A 2GCOA 3FPHA 2DCMA 1JG3A 3SNKA 2FZLA 5CDUA 5JJBA 4X62B 1W34A 1JXQA 2OY0A 3IE2A 1JYSA 2H1HA 3MYYA 5D01A 3K9GA 3P9QA 2TECE 3A05A 4IY1A 5HIJA 1UWKA 4P4LA 2JGEA 2QLLA 3E0XA 1NVXQ 2VPIA 3IT1A 4ZEOA 4FX5A 4YJFA 4C6RA 2GBIA 4ZVSA 4KZPA 1E64A 3D6NB 1E9DA 3ILYA 1QCCA 1TEXA 1WPGA 5DGIA 3TMKA 4AJHA 4M0FA 4PICA 1SQSA 2HCFA 2ONZA 4FFLA 5E1DA 4BWGA 4D4IA 3USZA 2W2MA 2RB5A 2ZJ0A 4P93A 1R37A 1Z6TA 4WWHA 3ZNPA 3ZBTA 2PX0A 4L8YA 2KLBA 4OL0A 3B12A 4L6AA 5AKXA 1Z83A 3ICPA 3KSMA 4PPNA 4U4AA 3GMIA 4ZPJA 3TPCA 3U44B 2P77A 3UAYA 1UPCA 4DM4A 2GM3A 2XUHA 1AHPA 1NN5A 4RQBA 4R1NA 1ORWA 2AR0A 1BOOA 1ZU4A 4XJTA 5DHRA 2BGGA 1JAYA 2IUTA 5TMEA 2P2SA 2JA1A 1NKTA 4MRNA 1RRFA 1WP9A 1TKRA 3AVUA 2IW3A 1W36B 1P2TA 3E3AA 2VKQA 3BL8A 5AXAA 1UKYA 4LWZA 4YEDA 5DCYA 2H18A 1QCZA 1G8GA 3BWYA 4MQ6A 4CEJA 5BWBA 4HS9A 1Y4SA 2AI2A 3G0HA 4LE1A 1Z2NX 4MQ5A 3KSBC 1Z88A 2I3GA 4MUEA 2QJTA 1A7KA 4FK8A 3FR7A 1VPEA 3O7WA 1W5EA 1PJZA 2OHJA 2HCBA 2WYUA 3RR2A 4RPJA 2I4TA 2NZJA 3FFAA 1PDOA 4ZU1X 2AQ8A 3F0TA 1O6BA 4NU8X 1V4BA 4YJHA 3KYDA 2JKVA 4INAA 3UMVA 1QK5A 1YUNA 3PCXA 1DJMA 2IEAA 3AOGA 4MPJA 4N9QA 3FN4A 2PKWA 2FXVA 3R3ZA 4IILA 4QVKA 4IO0A 1U0TA 3W3AA 1U63A 3WICA 1QG2A 2I6XA 5LLTA 1RC8A 1OH5A 1URPA 4EY8A 1QHHB 3AFMA 4X54A 2OENG 3M34A 1J0BA 1F1BA 4JBWA 5JNSA 4RCVA 1S96A 1CTQA 2BGKA 5F76A 4OQZA 4XIJA 5D3MA 4Y9DA 3O84A 5T3UA 3HO8A 1CZKA 4YAKA 1ZH2A 2PX4A 4DCTA 3T34A 1BROA 1JEOA 3NCTA 5IKXA 1E77A 2PFKA 2YZKA 1AF7A 1ML4A 2C5LA 3B9RA 4QOIA 1Y3FE 2P8JA 1ID1A 4IVPA 4XCXA 4ZEWA 5BWCA 3RFVA 1GTL1 1YRYE 1WKBA 2VP0A 4ZOAA 3UB3A 4QARA 1RJWA 1KI6A 3Q6NA 2E4XA 2J5KA 3G6WA 4D41A 2IDKA 5KSZA 2MIIA 1CQWA 1YK0A 3HFRA 2WB2A 1JLLB 3E9CA 4ARBA 4BATA 1MQ9A 1TT5B 5CFNA 3C3MA 5JD3A 4KFTA 3EF3A 1BMDA 1OLSA 5K0SA 1H3FA 3W06A 1W44A 4CMIA 4PSVA 3H4IA 1B3RA 3E23A 1J21A 3NGMA 3OICA 5AVYA 3KUXA 3NT5A 3U37A 1N2CA 1A50B 1NV8A 3JQBA 4U0KA 2ZM6B 1N34B 2G08A 1EVIA 1S7CA 2R6R1 4H7HA 4W1PA 2UXCB 3BVPA 1GGMA 3JD1A 4TVKA 4DSOA 4WBNB 1VPLA 1VM6A 1VE7A 3D4OA 4CMJA 2W6IA 2QP9X 3K2EA 2IHZA 4MKHA 1JLSA 2Q2WA 2NSLA 4LJ9A 3RVDA 3ZIDA 4BNWA 2C7GA 3E58A 1WZUA 3DVRX 4RESA 1CT9A 1V47A 2DYKA 2QTMA 2EW2A 1ONOA 2CV1A 4IL5A 1G3UA 4FR5A 3L0BA 4NZYA 4PC2A 5KOJB 4IIJB 1X1AA 3AI3A 4ZVRA 1TX4B 3B89A 3Q3JB 4IOKA 1DJNA 1SCAA 3I52A 1WBJB 3DE0X 1NLZA 5EMNA 5EMMA 3WL4A 4C4YA 1Q11A 3MQ4A 2FN8A 4ZDJA 1RZUA 2FA9A 2OV8A 3QFSA 2O8VA 4UKDA 3Q8LA 2BFWA 1NVMB 3THOA 2EEPA 4YNBA 2FI1A 3PQ5A 4YRJA 3MS4A 4F5YA 1FBTA 1PS0A 4ED9A 4O2AF 1UM9B 3VU3A 2ZYUX 3PEEA 4D46A 3W05A 4XD7D 2OLKA 5KYWA 2I1WA 1CY0A 2A5FA 3DR3A 2PWPA 1DXHA 4FYHA 3WLFA 4HQKA 2JANA 5AXCA 1QCYA 1EI9A 5KVVA 5U9CA 5H80A 4E07A 4YXWA 3M1LA 4MR8A 1QH9A 1X8JA 3PICA 3UOGA 5HQJA 3W2HA 4P4UA 2BFCA 1IL0A 2FUCA 2V4MA 3AEUB 4DIFA 1R4NA 2VYND 4PSAA 4W5JA 3DAYA 5CDSA 4HLUC 4FI3C 1SUSA 2D4AA 5EMJA 4Q02A 1Y4DE 4O63O 3NBMA 5DJ5A 1PK9A 3V4FA 2DWOA 2TRSB 1Z7YA 4PFSA 2A4KA 3FXAA 3ANTA 3ZW7A 1ACLA 1ZK4A 1JE1A 1C7EA 1RSZA 1OFTA 1KO8A 2R44A 2C2HA 3E7WA 4XGIA 5C9ZA 3KKZA 5JYEA 3V6LA 1IC6A 4N41A 3AJAA 3VNSA 2VUUA 3FPJA 3HYLA 2FAXA 3OQHA 2VK2A 3G5TA 4HO1X 1XK7A 4NE7A 5K0GA 2OXCA 3Q7QA 3DPIA 5DGHA 3UMJA 3V7NA 1VE6A 2CJPA 3JSAA 4FTWA 4NK5A 3WLMA 5H81A 1TCAA 4CE6A 5JCXA 2HMSA 4Q12A 3DE1X 4BUCA 5KQSA 2H63A 1BJKA 3FI9A 5EQTA 5IVDA 4DR5B 1EG2A 2K4MA 3EGEA 2Q5QA 1ZUIA 2BFNA 4N01A 3HK2A 3A9SA 3OC0A 4R8SA 5TMPA 4NI5A 1D1QA 2HBYA 5AT1A 2PXXA 1F2TB 3I9MA 1UDRA 1DAEA 5L3SB 3Q88A 5LLDA 2IH5A 4Q6WA 3X2FA 2IXDA 3C5HA 2B5VA 3B6EA 4FSDA 2YS6A 4A0HA 5FWXB 1A97A 1P3JA 2CHGA 5F78A 4BN0A 5BRAA 1HT1E 4ZOLA 5HZHA 2IHNA 1GKIA 4TZ0A 5KYVA 1CRPA 3KVRA 4X85A 1Q95A 1GEEA 3LPMA 4OB6A 3ZN2A 1JJ7A 1WPRA 4PIVA 4E08A 4ENQA 1QLWA 2N3ZA 1FFHA 1SO8A 4J0FA 5KAPA 4MWCA 2EBWA 3I4LA 1QVAA 2NU6B 2PL1A 1JQ3A 3I0MA 4LDJA 3FNIA 2V6FA 5EUBA 3FYTA 2I55A 2HK6A 4URZR 4X71A 5FHRA 2HSGA 1X7ZA 2QMOA 2Z3ZA 3FX2A 2WT9A 4D3DA 4JB0A 4HL6A 4TWZA 4PQRA 4D6PA 3K16A 1MFZA 3D6JA 3DYIA 4AFNA 1MHPA 2F67A 4L74A 4O4LF 2OCBA 4RVHA 4KR6A 1J0XO 4HNGA 3M82A 3OWHA 4HZGA 4J4TA 4N5DA 2H9IA 4DLBA 1LC0A 2PSDA 4GICA 2ACVA 2DLNA 2BY4A 4C6TA 2X9VA 3TCXB 5C7IO 1D2MA 4BXOB 4G9BA 4BZXA 3Q8KA 2WK1A 4O4HB 3WL8A 3MT8A 3DFIA 2XGSA 2EJUA 1CEEA 3CF4G 4KBYA 1NL3A 2NPIA 3I45A 3ANYB 1AOXA 3DF9A 2HF2A 3HKDA 3PNBA 4MLCA 4HDAA 4TSFA 3I2YX 3VR2A 2XKKA 2ZRJA 1XL1A 3UT5A 4HNQA 2X0JA 3EVNA 1ZMTA 3ON5A 2VJBA 2VA8A 3ZWQA 3PBKA 3IOBA 3V8RA 1MTOA 2GETA 3TW4A 5KKCA 4GGOA 1UAYA 3EMKA 4HYYA 3P2YA 3K05A 2PUGA 1CETA 1WCWA 3GOHA 3L7KA 4H6XA 5GZ6A 3FUTA 2WIJA 2IDJA 4R3WA 4CLRA 3D7KA 4NCJA 2OM2A 1YKFA 2ZIAA 3EDOA 4IJUA 4NCIA 3F8WA 4BKRA 2VDMB 5LKAA 1FTYA 2V0CA 2FU5C 1G8MA 1M2FA 5L53A 2QRJA 1GGKA 3H1TA 1YDMA 3T9CA 3ZNNA 4IGAA 1MOZA 2C1XA 2NACA 3JYOA 3VO8A 3IR6A 4KPFC 1EDDA 5JXWA 2DTEA 2J4DA 4Q3OA 4RK1A 2FX5A 3ZZTA 4YALA 3EZYA 3WMWA 3ZD6A 3CUYA 3TZHA 7ABPA 1OXTA 1R8XA 3BB4A 4PO9A 3PI7A 4F71A 2H5LA 4GFDA 1C3VA 1Q1GA 4Q3EA 5T5QA 3LBAA 5E9WA 1HWYA 4IUBS 4HDSA 3WYGA 3WWEA 2Y1KA 1QTQA 5LZ2A 5E7JA 1Z47A 4I4IA 3NVAA 2Z2KA 4PX2A 4TTSA 1LX6A 3BD6A 3PX3A 4K81B 4WUTA 3I30X 3F6CA 3L7OA 4IZHA 3LWBA 1T1GA 2WF6A 3IHTA 4CLOB 3DE3X 1BNCA 2VTBA 4RD1A 4RORA 3K9WA 4YQZA 4ZYZA 4LJ7A 1DC5A 1M2HA 1N7HA 2Y77A 2GCEA 5GONB 1FXSA 2IYRA 1NI4B 1IRIA 2DUWA 3ME5A 2NQ8A 2FQQA 4X1KB 5IT9A 4ZFNA 3OTOB 3EVGA 1OH8A 2GJ9A 4LJRA 3HB9A 1HL3A 4B0OA 2GWRA 4BXOA 1BXZA 1NMSA 4FCTA 3GK3A 5D1NA 3BEDA 5DIZA 1SXGA 2FJPA 3WLRA 1RRGA 4DUZB 4DFDA 1Z68A 2EQAA 1P2BA 1E7QA 1XIVA 2NPOA 2VO1A 3LK7A 4R1LA 4ZKEA 5A02A 1Q2UA 5KSYA 4WY2A 4BBPA 4BY9E 5IULC 3SVTA 4D9EA 1C8BA 1W85A 3AHJA 2EX1A 2FUG6 5CP8A 3RT9A 1VG1A 1WSBA 3TEFA 5A03A 5IEJA 4RMIA 3RVOA 3RRBA 5D5HA 4UCFA 4XOIA 1HR0B 2YL2A 3TTWA 1SRQA 4OREX 1GUAA 4AG6A 2JRCA 3BTOA 1K6XA 3AKYA 3H9UA 3R5KA 4RHUA 4WK6A 4XWYA 4B76A 3W5CA 3AUAA 3QA3E 2PLWA 2BRUA 1EAYA 2C9YA 5B53A 5F64A 5BWMA 1MRZA 2FLVA 4Q93A 1NONA 1MDFA 1YBMA 2B9EA 4Z54A 3HUEA 3LL7A 3JRNA 4HEA6 4E94A 1XSEA 4TYMA 2V6GA 3GG9A 2XBUA 3T38A 2OHFA 1QYIA 2XDWA 2PANA 2PKQP 4MVJM 4RK7A 3K9BA 3ZDZB 4UXHA 1NW3A 1TMOA 3JD2A 3N3AC 3ZX5A 4C20A 4MVJA 1NQOA 2Q3LA 2BEVB 3PHIA 5D5PA 1JZSA 5BYJA 5F1OA 3FYDA 4BP9A 3OWOA 4WKNA 5LPNA 2W6OA 1E2LA 5EUCA 4Z4HA 1W47A 4J03A 3JWJA 1FMTA 1LQTA 3GGJA 5T57A 3VTZA 5DEOA 1K5GA 4X44A 3HWWA 1CULC 1QPBA 1BJRE 2BDUA 2GZHA 2QN6A 1PAUA 2Z9DA 1KI4A 2JGDB 5G02A 5DM60 2P9JA 5CCEA 1K2WA 4GXQA 4AECA 5I01A 2Y2VA 3AL3A 4F56A 2WVJA 3FJYA 4MO2A 4ZVPA 1G0OA 1E7RA 3FNFA 4XQGA 2CNLA 3N05A 4G1CA 4MZXA 3ZWMA 4EZIA 2FZ4A 1RHKA 1NASA 2WZQA 3AFIA 4FGJA 5JMTA 4OLHA 3F7TA 5SZHB 4A03A 3H5IA 3M6VA 4KG7A 3HFGA 4PLTA 3S5UA 1Y5NA 3BH6A 4MVJH 3QOFA 2W42A 3ZJ4A 2LKDA 1VSBA 3N75A 3L0YA 4OD0A 4HVCA 1KTIA 1U8AA 1QVWA 2WFZA 2Y1LA 2EZTA 1C29B 1HRDA 1SBQA 4ZRNA 5C8ZA 1VA4A 3L3BA 3QELA 3FCCA 3OBIA 4BB9A 4R2IA 2IHUA 2VSFA 2GTPA 5BN4B 2XD9A 1YASA 2NG1A 4G1VA 4MOWA 2HT6A 2FN3A 3EEIA 2J07A 4IRUB 1XQYA 1S8OA 4JUIA 1I1NA 1CEQA 4X92A 3T7IA 4DR7B 3I3OA 5AW5A 3TEMA 5K0LA 1YOVB 1LV8A 1YQQA 4XRRA 4JLAA 5NLLA 1VJ0A 1Y6JA 2OGWA 3QYFA 1X7XA 3GUVA 2QTNA 1O03A 2JS7A 4L4SA 2VNHA 4A6EA 3O73A 3GJRA 4G4IA 1QV7A 3OVMA 3URKA 2P6MA 4Y2RA 4CM6A 4UD2A 2W6ID 2GCIA 1GUDA 2BFCB 2YQ5A 3AEUA 3IVXA 4GSLA 4L5YA 1QAMA 5ALFA 5HS6A 5LJIA 4M3NA 1FYFA 1DAFA 2PXHA 3G2OA 2HLHA 1NFRA 2J7KA 3JS5A 3A1DA 3WIOA 1NBHA 1Y7HA 2Q5HA 2QQGA 5E2BA 4FLEA 2O1SA 3PC4A 3GH1A 4DLRA 4YRGA 1I5EA 1KIFA 2FFBA 3T5PA 3ZDAA 2C4KA 2AFIA 4IHKA 1OI2A 2DBRA 3JRWA 1CB0A 5DM2A 4E14A 2ONJA 3LMKA 4Q7KA 4TKVB 3C5EA 2ZCVA 4RDXA 3H2ZA 4JX9A 3CWZA 4A15A 3HL0A 1FRQA 1CIVA 1GQ2A 1OAKA 2FWPA 1PW7A 2KHZA 4CHGA 4ECEA 1AMOA 4XPIB 2W0SA 1Q83A 1SK9A 3OU6A 5M3BA 5HM8A 3EBLA 4KX3A 3QJYA 2PSHA 4XM2A 3ZE6A 5IAJA 3JQDA 3ZQ4A 5A6VA 2PS1A 3RQIA 4OJQA 4UNRA 3K5WA 5DNUA 4ZJPA 4O3MA 1PUIA 2C3UA 3FVTA 3BD8A 1T0PA 2J31A 2WV9A 3JVUA 4PAGA 4Z4QA 4EARA 3OCZA 4CQMD 3DW3X 4NBLA 3DFFA 4NMWA 4A9AA 1OR8A 4KYUA 4KPEC 3ORHA 3LHKA 2QLBA 2ODQA 2Z2YA 5F1YA 4WAUA 3S6JA 4CKYA 4QM6A 2IZ0A 3Q10A 3K0AB 4WOBA 1ABBA 4QVIA 4L28A 4RVSA 4JQYA 2P9CA 4TV9F 2FZEA 4PG7A 1MV8A 1N1MA 1UC8A 4H1TA 4P3NA 4CM9D 2IYUA 2FPWA 1T34A 3IVCA 4MGHA 5H83A 2V74B 2F3UA 3AM1A 1TMGE 1WHSB 4HPJB 1E58A 1EUDB 3EB9A 4HS4A 2PZMA 1IHXA 3NBZC 1N6KA 1KSHA 3G17A 3SDSA 4C43A 5EWJA 1E3SA 1W48A 3A4IA 1VJ5A 4K1XA 3U81A 3T06B 3LJKA 4JQOA 4CETA 3DAPA 2X3FA 2VDVE 2ANBA 3AYZB 1M6VB 1XF9A 1VI5A 2H9YA 4UPDA 3AGQA 2H06A 2WSIA 4BFZA 1L4FA 5F2NA 1M67A 3CE9A 3QVLA 5HYVA 4GBMA 4R1OA 1ZIDA 2Q28A 4JQZA 3EIWA 3COVA 2H07A 3AKDA 3KPVA 1GQYA 4TSFD 4M0EA 1ZC3A 3R7SA 1YI8A 3AESB 3C3CA 2DHQA 1JKFA 1RCFA 2D0OB 2Y93A 1ORVA 3GFFA 2PTGA 2C4UA 4OMUA 4KTVE 4U2CA 4ZVKA 4I3HA 1NBEA 5I8WA 2MSLA 1Z5PA 1Y33E 3DDHA 5GV8A 1GAEO 5A4MS 1S3FA 3JCZA 2ADOA 4C4XA 4ZO7A 1SHKA 2P6RA 2J3MA 3R75A 4C4RA 2XWSA 2VNJA 4TQAA 4AMVA 2Q5FA 4JOSA 4KAJA 3PX2A 1PG5A 1VSTA 3OX3A 1FB5A 5C5IA 4EKGA 4N6OA 4WFIA 3VNQA 4ZVMA 1AO3A 4MUJA 3B3QA 2CJFA 4N18A 4HLUA 4TS4A 4BVJA 3P32A 5LNK1 3GWGA 4M36A 1FE8A 4YP7A 4DDMA 4TV8F 2OZKA 1FFDA 5F3RA 2IF0A 4L9SA 4U0JA 3TIGA 3A4VA 1GA6A 2QLMA 2C9ZA 3GLVA 3M4NA 3ZWKA 3WNBA 1UWVA 2XXJA 1K08A 1I0ZA 4IXWA 1Q12A 4WLOA 4DQ0A 4ZIRA 1XX6A 3FMOB 5LD2C 3LRPA 3B1XA 2R4UA 3DC7A 4ZYYA 1P80A 3KLOA 4UAUA 2VH1A 3KZNA 1PSDA 2J9ZB 3SYLA 1NF9A 2EBHX 3RBVA 1JSZA 4TMWA 1I2AA 1NVTA 3OKPA 2D2EA 3ST7A 3U1TA 3ZHQA 2PZJA 4JC4A 4LF6B 1ODTC 4UTXA 1XRNA 3OCVA 2NT4A 4HD8A 5F73A 5IT4A 1EVQA 3R5FA 3ZY6A 5LQNA 2JASA 2PSSA 1WXHA 4R2KA 2GX6A 4RYLA 2OZPA 3TL6A 4F8YA 5KU7A 4CUJA 5H9WA 3JQ7B 4XB1A 4RD2A 3R77A 4RMJA 1QNLA 3QE2A 2PN1A 5F1PA 3TQOA 5ED0A 5ENDA 4B4UA 2WTAA 2BFMA 3ED5A 3THXA 2AN4A 2V0GA 4PXYA 2D1SA 2IWRA 1M6YA 2FEWB 2G1AA 2HDNB 3LHFA 1JILA 1XRQA 2C59A 4K8OA 3RTBA 3SS7X 3BFVA 5JZBA 1IATA 1MIHA 3DZDA 2JFVA 1CDOA 2YH2A 3DQQA 4JP5A 2D5AA 1P5RA 5DHUA 4JLOA 4MUFA 2NX2A 221PA 3HB5X 4RTMA 4DLLA 2HCTA 5KDDA 4C07A 1PD0A 1Y48E 1Y4UA 4PTYA 4DY6A 1Q0ZA 5AW7A 1G9SA 1AH2A 1ES9A 3IPCA 3VH1A 4MV3A 1NP6A 4REOA 1TVEA 2PUWA 1OFUX 1KI2A 3AR9A 3I01M 1ZG3A 9ATCA 2QTAA 1YHYA 1ZY2A 4DSUA 2CK3A 4BFVA 3I6ZA 1F48A 1PP4A 1L4HA 4K9MA 1K8QA 5KWSA 1R0ZA 3N28A 3ZZUA 3K70C 3BBLA 5K99A 2XGGA 3LUPA 4EA6A 3FRIA 1IN4A 2BZ0A 4B3DA 4KR2A 5BN3B 4K1LA 4LDZA 1RD4A 2A0UA 3C6KA 3IP6A 1M1NA 1N7IA 2BP7B 2VDNB 2GPJA 2QTTA 2X0KA 4RIGA 5KYUB 1RKUA 3VVLA 2UVQA 4ID3A 4C0KA 2C5GA 1MO3A 2VHXA 1XJ0A 3DLBA 4JSTA 1G16A 4RA6B 1JL3A 1QHHA 3IXMA 3WHKA 4AMBA 4EFNA 5FBVB 1CBUA 3F47A 2HH9A 1YK1A 1VL0A 1TUEA 3I37X 1N36B 2O7SA 4MP3A 3AOEC 5HTKA 2JJQA 5JNTA 4IF4A 3CN7A 3GEPA 1GADO 3AVQA 4LKOA 1I2CA 1P77A 2Q8NA 2VTVA 4Q4JB 4CUZA 1W6UA 1W2HA 4KXQA 3WA7A 4JI7B 1F0NA 1AKMA 2HJ9A 1GFWA 4WZAE 2JCBA 4Y2GA 2FPGA 3F8SA 3LCCA 2JLAA 1JFFB 2YYAA 1HPLA 1K63A 3CNBA 3MTQA 3WKAA 1B6GA 1JDBB 2BMWA 2HMVA 3ZX4A 1P5FA 3A32A 2I2DA 2WWXA 5EZSA 4HQFA 1QIFA 3TM5A 1OA1A 2QDXA 3HY6A 4ME6A 1AB5A 1O9HA 2VTDA 2BHLA 4CL0A 3AIIA 4RFSA 4EYEA 4HH3C 4DB2A 3G0DA 2AJTA 2FSGA 3AHHA 5FNVF 2IYFA 2W2KA 3HJCA 2HMWA 3BYZA 5AIAA 3ZQKA 1ISHA 3KJEA 4GZ6A 2I7XA 1QQAA 5CA0A 3M9XA 4QU8A 5J4YA 1MAVA 2OFXA 2R3SA 2ZS7A 4HHEA 4WY8A 4KVGA 2PSEA 3K9LA 3L18A 4PO1A 1GQOA 3O94A 5A3JA 3ZWXA 1DOHA 4UE6A 4H3VA 5J2UA 1G19A 3HS3A 1TOAA 2HQBA 4WX2B 5TB5A 2R751 4TRRA 1KFJB 2X6QA 1QGED 5DFAA 3F4BA 3Q12A 2I54A 1CKEA 1E1RD 4RL4A 4EY4A 3H2GA 5HIKA 2GM5A 5EIWA 4PFQA 3EFHA 3B3FA 3ND6A 4CF7A 3B60A 1XTIA 2PU5A 4G86A 2AX4A 1DTSA 2INGX 3PHGA 1MC5A 4HGQA 4BFTA 1E9CA 3RK1A 4MWOA 1WB4A 3RLFA 3G9ZA 1YZYA 3GJSA 3AONB 4RZQA 1H6CA 1Q7BA 2H2WA 3P45A 1JR3E 4FOOA 3NATA 1GPNA 3G8BA 4ICIA 4KGDA 3QUBA 4WCVA 5BV8A 4H27A 3RG8A 3PEUA 2EDAA 5D87A 2FRVA 3P4YA 3UJ3X 5HJ7A 1HYBA 1CNFA 1RKQA 2WD7B 5K09A 1USKA 3IAS6 4DWVA 3U5TA 2HA6A 4MW9A 4DSTA 3WIDA 3SOPA 3ZYCA 3P9NA 3PVSA 4GZLA 1E1RA 5C1DA 3KR2A 1PN3A 3V1LA 2WE8A 4DQVA 1L7EA 4W7HA 2OPBA 3B85A 2KJQA 1Z39A 4P7JA 2AJLI 2COEA 1CY8A 1KNXA 2XSZD 4UFNA 3TS1A 4YV0A 2VHYA 2OLJA 3UV3A 2ES4A 3QEBZ 3GI1A 4Y1RA 5CCXA 3KKMA 3SC2A 2H2DA 2JEYA 2XDQB 1E0DA 4DUGA 4NZNA 4D57A 2BBTA 4LXXA 1SURA 4ZZ1A 1FA9A 1BKDR 1SZPA 1XRJA 2A35A 2ZYWX 1MFPA 3WMXA 1ZC4A 3UJCA 4B7AA 2GDJA 5C4MA 1IZ8A 2AC4A 1IPEA 1XKXA 2F8LA 4CWAA 1OA0A 2EATA 1P3Y1 1VG9B 3A6GA 3PZRA