3RSEA

Structural and biochemical characterization of two binding sites for nucleation promoting factor wasp-vca on arp2/3 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
414
structure length
396
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 121
structure length 396
sequence length 414
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rseA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rseA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3rseA03
1HLUA 2ASOA 4BR4A 4I6MB 3D2EA 2ASMA 5FPMA 4FPAA 5JLFA 4NO7A 5F1XA 5FPNA 3GOIA 3VETA 2E8AA 2UYTA 1Q18A 4CZEA 2P9IA 4BQZA 1ATNA 3H3OB 4IO8A 1K8KA 3QMLA 3C7NB 3ID8A 3QDKA 4K25A 3HSCA 3DJCA 3CQXA 2J4RA 2QWNA 3H3NO 2E2NA 5E26A 4H5NA 1WOQA 5KPTA 4PL8A 4CBWA 3OHRA 3D2FB 3VF4A 3A0IX 2P9NB 3L6QA 4FOIA 5LJVA 3P4IA 3JXUA 3CJBA 2FSJA 3MDQA 4YDUA 4BRNA 2PAVA 2FF6A 3LL3A 4B1VA 5KPRA 2GTDA 1V4TA 2FF3B 4CZHA 4RTFD 1D4XA 3QBWA 4ISGA 4BR2A 4JNEA 1MWKA 4BRQA 2GWKA 3FZHA 2P9IB 1GLBG 4WQ5A 3CERA 2BTFA 5EOYA 1K8KB 2FXUA 2I7NA 2QWRA 1Y64A 1RDWX 3DAWA 3LDOA 1DKGD 1NBWA 3H46O 4JD2A 1CZAN 3WEEA 3L4IA 4EIAA 5KQDA 1HJOA 1JCEA 3ZX3A 2W40A 3FZMA 1YUWA 1HKGA 2NLXA 3I8BA 1E4FT 2ZF5O 2A41A 2FSNA 4A61A 3MMVA 1MDUB 3A5NC 4QS8A 4BC5A 4B9QA 4PL7A 4Y0WA 5AFUA 1NGBA 4DCHA 5BN9A 3JS6A 4BRAA 3FZKA 3D7EO 5AQVA 1NGHA 4QS7A 4H5VA 2OANA 3LDQA 3ENHA 2D1KA 5BREA 1GLEG 1LOTB 2QXLA 2FLOA 4EHUA 3VGMA 4K41A 5E84A 3CJ9A 4PKIA 2CGJA 4BRLA 3H1QA 2P9LB 1NMDA 1NGAA 4WQ4A 5AQJA 5F0XA 4DB3A 3DWLA 1RFQA 2P9PB 1T6CA 4AM7A 3ZX2A 5ADXH 1ZBSA 5FPDA 5AQXA 5EY4A 3VEYA 4MO5A 4CZIA 3LM9A 4CJ7A 4BREA 3O1BA 3F9MA 5AQYA 4NB4A 3ATUA 5AQFA 3R8EA 5EXWA 5F2RA 3QFUA 2HF4A 4FWKA 4M63C 1ATRA 5AZIA 4FL9A 2P9SB 4FWNA 3U9ZA 4B1YB 3S41A 1NWKA 3UE5A 4KBOA 5AQHA 1XQSC 2IVNA 2E1ZA 2V7ZA 2ZWHA 3SMPA 3D2FA 2BUPA 3EKUA 3IMXA 2P9NA 4A2BA 5BRHA 3MN7A 2IIRA 2Q0RA 5AQLA 5BR9A 3BF3A 4EHTA 4DHYA 2GELA 3O5BA 4GY2B 1NLVA 3CQYA 4PKHA 4IJNA 1GLFO 4EFHA 2A3ZA 5AZIB 2H3GX 4M7XA 3AARA 1MA9B 3VPZA 3WXLA 2FSKA 3U9DA 3KVGA 3FGUA 5AR0A 3SJHA 3QB0A 1MWMA 1LCUA 2W41A 1Z05A 1NGCA 2VCPA 4FO0A 1KAXA 2D0OA 2QWQA 3IFRA 2YI1A 4K42A 3A5MC 5ELZA 2QWOA 3LM2A 2YCHA 5JLHA 5AQUA 3CJ1A 2YHWA 4B1WB 2AP1A 2E20A 3EKSA 3B8AX 3O8MA 3HM8A 3ENOA 4CI6A 2F9WA 5JICA 2P9KA 1HUXA 1P8ZA 3R9PA 4FWLA 4HWIA 5KQ8A 3LDPA 1J6ZA 4BR5A 4IZ9A 2A42A 2QWMA 4O8KA 1Z6RA 3FZFA 3A8YA 5BPMA 3EL2A 4F9OA 2Q2RA 3TPQA 3UB5A 3O6WA 1SZ2A 2D4WA 1GLLO 1QQOA 3HZ6A 4BVPA 5B8HA 2P9LA 3CETA 3HI0A 2E88A 3O4WA 4H0PA 4JHDA 5LY3A 2P9PA 2V51B 3ULEA 4CZFA 3AAQA 1NM1A 3VERA 5AQZA 2QW9A 2P9KB 3SK3A 5AQOA 3VEOA 1GLDG 4C23A 2CGKA 3MN9A 4EAHD 5JMVA 4BGAA 1HX1A 4H0VB 5AQMA 2QWLA 4B1XB 2I7PA 4FPBA 4GNIA 2AA4A 4B1ZA 3EN9A 3DXMB 3VEXA 3MN6A 1QQMA 2P9SA 3VOVA 3UKUA 4CZKA 3SLCA 3QFPA 2PBDA 2CH6A 3ZEUA 3UKRA 4JHDB 3ULEB 1XUPO 3R6MA 3CJCA 2Q36A 1T6DA 4FWPA 2QWPA 3U8XA 1OKJA 1BOTO 2D0PA 4XEIA 3IUCA 1X3NA 4FOEA 1U2VA 2Q0UA 2GUPA 3O1WA 1YVNA 2HMPA 3BF1A 1HKCA 3VF6A 1BU6O 4BR7A 3H1VX 3AAPA 1S22A 1R59O 4CZGA 4CZLA 3GBTA 5AQIA 3A5LC 3UKUB 2CGLA 4BRGA 1KAYA 4XH4A 3HTVA 3ZEUB 1ZC6A 3VESA 2ITMA 2Q97A 3UKRB 4AM6A 2HF3A 5AQWA 4BQLA 1H1VA 1QZ5A 3QICA 4CZJA 1QQNA 5AQQA 2QM1A 5ADXA 1TYQB 3VEZA 5BPLA 2GEMA 2ASPA 5TKYA 3CJ7A 3HBTA 5EX5A 1U2VB 1NGFA 1SAZA 2YJEA 1TUYA 5KPZA 1NGJA 3U4LA 4ISFA 3RSEA 3BUZB 3EO3A 4H0TB 4B1UB 1IG8A 3H45C 1IJJA 3QBXA 1HKBA 4BR0A 3I33A 3EZWA 2A40A 3GL1A 4LC9B 2IVOA 3BP8A 5AQTA 3ZETA 4H0OA 4A2AA 1YXQA 2V52B 3CJAA 1XC3A 3VEWA 5AQNA 3GG4A 2P9UB 3LDNA 4MO4A 1V4SA 2E1YA 2YJFA 4Z94A 2ZGYA 4H5TA 2A5XA 1WUAA 4PKGA 1C0GA 2E2OA 1TUUA 3ATVA 3O80A 3RSEB 4A62A 5BN8A 1X9JA 3GDQA 2VYPA 4MLEA 1DGKN 3G25A 5AZJB 3WXKA 4JAXA 5EVZA 1QHAA 3O08A 1DEJA 4L3QA 5AQPA 3MCPA 3ZETB 2E2QA 5AFUH 2HOEA 1S3XA 4BRCA 3D2EB 1BUPA 1HPMA 4CZMA 3DXKA 3DXMA 4FWOA 3VENA 4BRIA 3W3DA 4YDUC 3TU5A 5CE3A 5FPEA 3VGKA 4BC3A 3CI5A 4E1JA 4FSVA 4RWTA 4H5RA 1T44A 3ZX0A 3J8AA 1ATSA 1BDGA 5BRFA 2V7YA 4CBUA 2ZGZA 1GLJO 3L0QA 4WQ5C 4M7YA 3C0BA 1BG3A 1JCFA 3CHWA 5BRDA 4IWVA 2F9TA 3CIPA 1G99A 4BG9A 4CBXA 4HTLA 4FWMA 4WYBA 1NGGA 1YAGA 4J8FA 3MN5A 2E2PA 2KHOA 1JCGA 4BGBA 3DXKB 1BA0A 4BRHA 3VGLA 4BC4A 1KXPA 3FFKB 4BRKA 4IXCA 4BRFA 2YHXA 4BRMA 1BA1A 2GWJA 2A6AA 1BO5O 3M1FA 4BC2A 4BROA 4H03B 4IJAA 4K43A 3WT0A 3GE1A 3WQUA 1NGEA 4FWRA 5AQGA 4CD1A 1BWFO 4JD2B 3WEEB 1TYQA 3H6EA 2Q31A 3VF2A 4BVOA 1E4GT 2NRHA 3VEVA 3FR0A 3MK6A 5BPNA 4QS9A 2DPNA 4DQ8A 1NGIA 2WUSA 3W0LA 3KZBA 1ZXOA 3FE1A 1NGDA 4BR9A 4BRDA 5AQKA 3WXIA 1GLAG 1RGIA 5AQSA 3SMSA 1ESVA 4JN4A 4WQ4C 1QZ6A 3WXJA 1GLCG 3WQTA 3WUHA 4MLHA 4I6MA 3A5OC 2YHYA 1X3MA 4H0YB 4XH5A 2P9UA 3FLCO 2Q1NA 3BEXA 3M3ZA 4XH1A 4H0XB 2VWBA 4FWSA 2EWSA 1U6ZA 3KHYA 3IDHA 1EQYA 4O5FA 5I9EB 3LDLA 1SQKA 3C7NA 2NZTA 4BRPA 4CD3A 1C0FA 3AY9A 2IVPA 5LJWA 3M6GA 4RCHA 1KAZA 3FZLA 4ISEA 5AZJA 2CH5A 4H5WA 4FWQA 4BG8A 5AQRA
chains in the Genus database with same CATH superfamily
1HLUA 1ZBFA 4RG8A 2UXDK 5KRTA 4DLGA 3QESA 4DV4K 1VSLA 1Q7YO 3D2EA 5JLFA 3P38A 1XWLA 4E7JA 3AVBA 3QNOA 4ELTA 1N33K 2UYTA 4YFUA 3KD1E 4FXDA 3QMLA 3QDKA 3RR7A 3IG1A 4I7FA 2A1RA 1C0MA 2QWNA 3AVAA 5E26A 1CZ9A 4H5NA 4PL8A 4DFJA 2RF2A 3VF4A 3VQ7A 3A0IX 1IO2A 3P4IA 3AVIA 3JXUA 5KGWA 4BRNA 4YDUA 4NXNK 2PAVA 2FF6A 4CZHA 2FF3B 5M1KA 1XNRK 1JXBA 4BE2A 3U3GA 4JNEA 4FLVA 2GWKA 3FZHA 1NK7A 1WSIA 2HBKA 3E9LA 2P9IB 4LSNA 3T19A 1GLBG 4AHTA 3CERA 1KCFA 2I7NA 2HHVA 1RDWX 1K9MO 4JK9A 3VQEA 1BIUA 3LDOA 1J5EK 4DQPA 3F5TA 2O4IA 1CZAN 4EIAA 2UXBK 5KQDA 3NMUA 1HJOA 1QSSA 1JCEA 2YV0X 4N76A 1XNQK 2W40A 3I8BA 3SCXA 1E4FT 5TKWA 2BANA 2A41A 5AJ3K 3HPOA 4FW1A 3MMVA 3HYFA 1MDUB 1C6VA 5C42A 4JKEA 4CEAA 1BIZA 3HXMA 5AQVA 3PSIA 3FFIA 2OANA 3LDQA 4Z4FA 1LAVA 3ENHA 4FZYA 1NOZA 2D1KA 3SQ0A 5BREA 4FJGA 1RDBA 2ATQA 4PA1A 3TAFA 4CERA 3KLHA 1T03A 3SQ1A 5E84A 3CJ9A 4F3TA 3RMCA 2E4LA 1NMDA 1NGAA 4CEQA 1YI2N 4DR1K 3LP1A 3NF8A 3IKMA 4JKFA 3TARA 3CXCM 1ZBSA 4KFBA 2Z1IA 5GAEP 1TL1A 4UQGA 4KI4A 2YHBA 1WSHA 1WSFA 2BE2A 5EY4A 4U7BA 1MU2A 3LM9A 3F9MA 5AQYA 1YJWN 4CESA 5AQFA 3V9SA 4O5BA 5EXWA 5F2RA 3NH1A 4FWKA 3KD5E 5E41A 4FL9A 2P9SB 1Q86O 1SKWA 3DM2A 4Q5VA 4B1YB 3UE5A 4KBOA 5AQHA 3TWHA 1R0AA 2IVNA 4YOYA 1A5XA 3OVNA 2BUPA 4NCGA 2P9NA 4A2BA 3G10A 4Y1DA 5I42A 2HSTA 3L2WA 4NCAA 1J54A 3BF3A 4A5BA 4EHTA 2BDPA 4DTSA 4BE1A 4V19S 2OPSA 3O5BA 3PO4A 1YF5L 1NLVA 3CQYA 3AO1A 4JRQA 4PKHA 4IJNA 1GLFO 4EFHA 2UU9K 5AZIB 3ZSWA 4F2RA 4B9MA 3TR8A 4E7LA 5J2NA 4JKBA 2YKMA 3AARA 4E1MA 1MA9B 3VPZA 1E3MA 3V6DA 3WXLA 2C1IA 3KVGA 3SJHA 1ZBLA 1OH7A 4PY5A 1JLBA 2W41A 3QERA 1N34K 1KAXA 2YI1A 1W0HA 4ID1A 3LM2A 4Y1CA 4JI6K 3OY9A 4KHPK 1NKBA 2P1JA 1WSJA 2OTJN 3B8AX 3HM8A 4MDAA 3HRGA 3SQ2A 4ZTJA 4FWLA 3LDPA 4Z4EA 4CGHA 2KFZA 4DTPA 1S72N 3HOSA 2QWMA 3BY5A 4GV3A 3FZFA 1U45A 1XMOK 4OKEA 3TTDA 2Q2RA 2D5RA 1EX4A 5D3GA 3AVGA 3O6WA 4FVMA 1QQOA 3CM5A 3CETA 4B3MK 4DQSA 2E88A 1RBTA 3AV9A 1B92A 1C0UA 4FM0A 2V51B 1NM1A 3VQ6A 5FLXO 1BI4B 3V9UA 3J7ZO 4WFBL 2CGKA 4EAHD 2AJQA 3NH2A 2IDOA 4N5SA 5AQMA 2QWLA 3KJVA 2HBMA 4FPBA 4OX9K 4BE7B 4B1ZA 4M45A 3SPZA 4IOCL 3OYAA 1NMNA 1KVBA 3I55N 3VOVA 3NHGA 4CZKA 3SLCA 3NGYA 2D0BA 2WC9A 3D0PA 5M1NA 3UKRA 3QEWA 2QK9A 1ASWA 2Q36A 1T6DA 5DMRA 2HMIA 2W6LA 5GADP 4FWPA 3SYZA 3I8DA 1FW6A 4KO0A 1ZBUA 1K8AO 3T7ZA 1JL1A 2GUPA 2Q0UA 3O1WA 2OZMA 3HVTA 3BF1A 1TAQA 3VQ4A 3BZKA 3WNHA 3AAPA 3L2UA 3N4QA 1R59O 4JI8K 2UUAK 1NJIO 4CF9A 3L8BA 3RVCA 1ZC6A 2Q97A 3OW2M 3CPEA 3NF9A 1QZ5A 3QICA 1CXQA 4IEIA 3K5LA 4FLTA 4HTUA 1TYQB 2YX6A 3VEZA 1WBDA 5BPLA 1NK0A 2Q3SA 3CJ7A 1SAZA 4ILJA 4JV5K 3U4LA 4ISFA 3RSEA 2HHQA 3KK7A 3EO3A 4B1UB 1REVA 3KWIA 4H4OA 2UXCK 2D0CA 4YORA 4CK3A 1TK8A 1N32K 3ZCMA 4LC9B 2IVOA 2KQ2A 5AQTA 4H0OA 3NGIA 2V52B 1KVAA 3KKRA 5JVHL 1VQ5N 2P51A 4LD0A 4FVUA 4JK8A 2B5JA 3KK1A 2YJFA 4RW7A 4FJ7A 2ZGYA 4H5TA 1NU0A 1S1WA 4U67L 2OCEA 4IBNA 4OKKA 4E3SA 5M1QA 5BN8A 1DGKN 3WXKA 1DEJA 1KFDA 3NBPA 3O3HA 5AQPA 3TSUA 4FJJA 2E2QA 5AFUH 1S3XA 4ELUA 4LF6K 4N47A 3NF6A 4I9LA 3DXKA 1LWCA 1I39A 3TU5A 2O8EA 3CI5A 4RWTA 4CGIA 5KI6A 5CR4A 1KRPA 4YY3K 3ZX0A 3J8AA 1ATSA 1BDGA 5BRFA 4IOAL 1OH8A 3E01A 5BRDA 2HBJA 1VRUA 3VQDA 2O8BB 1TK0A 4FWMA 4WYBA 1S9EA 4DSIA 3VN5A 1YAGA 5A2QO 3MN5A 3MXIA 4IFEA 2KHOA 1XC9A 1JCGA 1TKDA 5DM7L 3NF7A 3VGLA 3SI6A 1HJRA 3I56N 1W9HA 4BRKA 4BRFA 4BRMA 4FZXC 1BO5O 3PSFA 2RPIA 3HPHA 3WQUA 1NGEA 4FWRA 1VSIA 3J7YP 3H6EA 4BWJA 4E19A 3M8QA 4C1NK 3VF2A 4OJRA 1E4GT 4JI0K 3FR0A 5BPNA 1NGIA 4A57A 1X1PA 4OGEA 3W0LA 3KZBA 4DV5K 1ZXOA 3K58A 4CJQA 3FE1A 3CYGA 1RBUA 4NLBA 4FJXA 3PIOL 4KHYA 2EX3A 4E89A 4WQ4C 3VQAA 3CM6A 3WQTA 4OVLA 2BH1A 3O4NA 2YHYA 2QKBA 2P9UA 4CHYA 1BCMA 1S5JA 3JSMA 3BEXA 1VSMA 3MECA 3AA3A 2EWSA 3LWLA 4DV0K 3NVMA 3IDHA 3DLLL 3EZ5A 4B3TK 3AVNA 4O5FA 1RT7A 2NZTA 3L3UA 4KHNA 4CD3A 3ZSQA 1C0FA 3M6GA 4ISEA 3ITHA 2O8CA 4IKFA 4YNQA 2XRIA 4BG8A 1Q82O 3OS2A 2F8SA 1WN7A 3SUPA 4DSEA 5FPMA 3QINA 4FPAA 5F1XA 3GOIA 3VETA 5JVGL 3C6AA 3LAMA 1Q18A 4FLWA 4DTMA 1JLEA 2P9IA 1SKRA 1ATNA 2HW3A 3R1XA 4JKDA 4B08A 3AVKA 5LMUK 4C8LA 3C7NB 3K5MA 4K25A 2XY5A 1L3UA 3CQXA 3I0RA 3ENBA 4JEPA 4DR4K 4CBWA 3D2FB 3LANA 1SL1A 1WSGA 3L6QA 1KVCA 1Q9YA 5LJVA 2FSJA 4FM2A 3LZJA 4YOUA 2GTDA 1RBRA 2NRVA 4RTFD 3QBWA 4ISGA 3VQ5A 1N36K 3JYTA 4BRQA 1FJGK 3VQPA 4UY8O 1S9GA 4LFCK 1K8KB 3QNNA 4F3OA 1Y64A 3DAWA 3I0SA 4OPHA 3H46O 3TAQA 3WEEA 2IC3A 4DLEA 1M1KO 2NLXA 2FSNA 3A5NC 5CZ1A 2PYLA 4B9QA 4BC5A 1U49A 4PL7A 4NYNA 4OGCA 5KTQA 2FBYA 3JS6A 3T69A 3CFRA 2O8DB 4B9TA 1QS4A 4BE0A 4B9VA 1HR0K 1NGHA 1VSDA 4H5VA 4DR7K 3CCLN 1IBKK 3WNEA 4M3UA 4B3SK 3DRSA 3NE6A 3WNFA 1GLEG 3OTOK 3Q7BA 1GOCA 3PO5A 4PKIA 3K57A 3O3GA 3AO5A 4O0JA 4WQ4A 5F0XA 4HUEA 3RMDA 1RDAA 3PUFA 4FLYA 2G8VA 1ILYA 4DB3A 1RFQA 3VQQA 2P9PB 2RHKA 1OVYA 3MEGA 4LF7K 4LH5A 3RWUA 4AM7A 5ADXH 3V9WA 2OZSA 4CGJA 5FPDA 5AQXA 2NNWA 4B9UA 2HHSA 4CZIA 4CFBA 4BREA 4HVJA 3CCVN 2E6MA 2ZQBA 4RW6A 4E72A 4WFAL 3EYZA 3R8EA 1C1AA 2NRXA 3QFUA 4B3OA 3MEDA 2HF4A 5HRRA 3DLKA 3NAEA 5LL6Z 3TSQA 1N8RO 1ATRA 5AZIA 2KFNA 5HRPA 4FWNA 3U9ZA 4LSLA 4CJVA 2HHTA 3AA5X 1VQKN 1XQSC 1U48A 1J53A 2V7ZA 3SMPA 4JKCA 1T8EA 3ZSVA 1RTJA 1YTUA 1RT5A 3C94A 3MN7A 4JI2K 3HP6A 1RDCA 5BR9A 4DHYA 1TK5A 4CEFA 3TAEA 4JRPA 2Z1GA 4YOVA 4BECA 3AA2A 3TTCA 1BISA 1BQNA 4IDHA 2H3GX 3ID6A 2FSKA 5AR0A 1Z05A 3CCEN 3K5NA 1KLNA 1C1CA 5M1FA 5C0YA 4I9QA 2YCHA 3THXA 4FK0A 4FJ5A 3PY8A 3CJ1A 3PV8A 2E20A 4CI6A 3SUOA 2F9WA 4A59A 4KTZA 1WBBA 3R9PA 2YNHA 3AVFA 3IS9A 1QHTA 3ZLJA 2JWLA 3ZT3A 2A42A 4O8KA 4CE9A 3A8YA 4Z4GA 3EL2A 4F9OA 3OBWA 3TPQA 3CFPA 1NJYA 2YNIA 1GLLO 3E9OA 1TKZA 2GUIA 3QEXA 3HZ6A 4BVPA 5B8HA 2P9LA 1O13A 3M8RA 3CPWM 3O4WA 3S3MA 5LY3A 3V1RA 1BCOA 4PHTX 2QW9A 2RKIA 3SK3A 1GLDG 4ID5A 3MN9A 1KC8O 5JMVA 1ZYQA 1CLQA 2ZM6K 2I7PA 1RT4A 3DXMB 2HB5A 2QXFA 3KTQA 4M3YA 1IKXA 1LWEA 3OJSA 3DLBA 1U47A 4W5RA 2C1GA 2JWKA 4K8ZA 1YITN 4HUGA 4JHDB 1Q9XA 1XUPO 3R6MA 4E7IA 4CJRA 4M3RA 1W2BM 1X3NA 5FDLA 1HNVA 1JLCA 4M3WA 1YVNA 2PZSA 4LFAK 1HKCA 3VF6A 4DU4A 4BR7A 4AILC 4G9ZA 1DTQA 4CZGA 5AQIA 3UKUB 4OPKA 4AHCA 5JENA 4O4GA 4XH4A 1TVRA 4EP5A 3AO3A 3ZEUB 3VESA 2ITMA 3VQ9A 2HF3A 1W7AA 3ZSRA 4CZJA 3LDSA 5AQQA 2F8TA 3JAMO 3LP3A 1UWBA 4NCBA 3HM9A 2QI2A 1HQEA 2ZJPL 1TKXA 4CIFA 3D6RA 5TKYA 3HBTA 4CHOA 5HOOA 1U2VB 1NGFA 2YJEA 5KPZA 3BUZB 4DFKA 2FBTA 4QCLA 1K73O 4CEZA 3F2KA 2OPQA 3GL1A 3KLGA 3F9KA 1VSEA 3V1OA 1XC3A 1IG9A 3MXMA 5C10A 4KH5A 4MO4A 2WTUA 4Z94A 4FLXA 2DFEA 3THWA 4KTQA 1Q81O 1RBVA 3PLAA 4CCHA 1TUUA 3ATVA 3O80A 3C95A 1FKOA 1X9JA 5AZJB 4JKGB 5EVZA 3G0ZA 3G6EN 3HVRA 1SKSA 4L3QA 3ZT1A 4ELVA 2O8BA 5BR8K 3MCPA 3ZETB 4DU3A 1YJNN 4B9NA 4BRCA 2IGIA 3D2EB 4M41A 1J5OA 3MXJA 4FWOA 3VENA 4IG0A 3QLHA 4BC3A 1NJXA 1SL0A 4AHSA 2HVIA 1UA1A 4DR6K 4DFMA 2OPPA 1VHXA 2ZGZA 4K8XA 4WQ5C 2HHUA 4M7YA 2P5OA 1VQMN 1JCFA 3CHWA 4FJ9A 4IWVA 1VSJA 4ILGB 5T7BA 3THYA 4CF1A 3CIPA 3Q7CA 4LF5K 5FRNA 3BDPA 4CJTA 3OYEA 1NGGA 3ASMA 4LH4A 4AQYK 4J8FA 2E2PA 3NDKA 4J2BA 1EETA 1WAJA 4AHRA 4DU1A 3L2VA 4IXCA 2YHXA 3HSTB 3B6OA 3E1YA 1HNWK 3M1FA 4BC2A 4BROA 2YHAA 3KK3A 3GE1A 4W5QA 1ASVA 5AQGA 1BWFO 1M90O 4CIGA 4CHPA 3DLRA 3NFAA 2KZMA 1YT3A 2Q31A 4BVOA 4QS9A 1SL2A 3AGRA 3V4IA 3K59A 2GX9A 1NK5A 4K0KK 5AQKA 4CJUA 4LY7A 4CFDA 5AQSA 2QKKA 1QZ6A 3VA0A 1VQNN 1GLCG 4LF8K 3WUHA 2O4GA 1UOCA 1RT2A 4H0YB 4CJLA 4J2EA 4XH5A 4KHQA 4H0XB 2G8UA 3O4QA 4CHQA 1EQYA 4C8OA 4O55A 3LDLA 1Q8IA 2NUBA 3C7NA 4BDYA 4I2PA 4BRPA 4LF9K 4AHVA 5LJWA 3ZYYX 4RCHA 5M1OA 1KAZA 3HP9A 1SS6A 3NH0A 2JGUA 4I6MB 2ASMA 3VQBA 5FPNA 4CZEA 4CEEA 1HNZK 4BQZA 4PQUA 3CCRN 3H3OB 4IO8A 1HYSA 1K8KA 4BACA 3RMBA 3ID8A 3SJJA 3J81O 3HSCA 4AF1A 3DJCA 4YOXA 2E2NA 1WOQA 5KPTA 3G71N 5C12A 1HNIA 2P9NB 3S9HA 4Z4IA 3CJBA 3DLEA 1I3AA 1V4TA 4CEDA 4JKHA 1MWKA 1VSHA 3AO4A 4CEOA 2G8FA 4KHSA 2O8DA 4DTRA 1BHLA 4WQ5A 5J2MA 2QWRA 3OYDA 1Z26A 1IKWA 2HNYA 1DKGD 4JD2A 3L4IA 3ZX3A 3RTVA 3FZMA 1HKGA 3HO1A 4DV1K 2VGNA 4E1NA 4IDKA 4WF9L 3K5OA 3KIOA 4HUFA 1C1BA 4CJ4A 5AFUA 5GIPA 4R79A 2QEXN 4DCHA 1DTTA 4CJPA 4H8KA 4N41A 4EP4A 1RNHA 2I5JA 3D7EO 3OYJA 1KTQA 1EO1A 4QS7A 3AA4A 1RBSA 1LOTB 2QXLA 4WE1A 4K41A 4RW8A 1SUQA 3ZSYA 3H1QA 2O8FA 1SV5A 3RRHA 5AQJA 1KD1O 2HVHA 1ITGA 3DWLA 2DTUA 3EE8A 1NK4A 3ZX2A 3VQ8A 1RTDA 2FBVA 1QSYA 1ASUA 4WFNL 3VEYA 4GVEA 3AVLA 4O44A 4IOXA 3AVHA 4CJ7A 3O1BA 4CIEA 5C15A 1NK6A 3ATUA 1L5UA 1XI1A 3CCJN 4M63C 3CC7N 4GV6A 4B3RK 1A5VA 3QETA 3T3FA 4FW2A 1OVQA 1NWKA 4C8NA 1X9SA 1S1VA 4DTNA 4CGFA 4X65K 4CJSA 3AO2A 4DQRA 1VQ6N 3IMXA 4YOTA 1EWQA 3OYBA 2IAJA 5BRHA 4JI4K 1JKHA 5J1EA 2IIRA 5AQLA 4GW6A 1VRTA 3SUNA 4O0IA 4GKJK 1GOBA 4DTXA 1NK9A 3QO9A 3O9SA 2GELA 1EWRA 2E5LK 4JK7A 3VTHA 1RCHA 4GY2B 1LW2A 2Z1HA 4FJMA 3OYLA 3CMAN 4KV8A 3T1YK 3LWMA 4C8MA 4LF4K 1YHQN 3FGUA 3H08A 1HQUA 3QB0A 2DFHA 1LCUA 3CCQN 4K42A 2F7TA 3A5MC 4NYFA 5ELZA 2W42A 1N5YA 1KQSM 5SWMA 4HCBA 2YHWA 1KFSA 4KB1A 2AP1A 2HNZA 3EKSA 3SZ2A 3NVKA 3CG7A 3ENOA 5HL7L 4JS4A 1P8ZA 5GAGP 4Z0UA 4HWIA 4IEEA 1A5WA 4IZ9A 3DRPA 1Z6RA 3QIOA 5BPMA 1S6QA 3CQ8A 1NKCA 1QE1A 4DR3K 4BY9C 2D0AA 1L3TA 4Q0BA 4W5OA 5LMNK 4FJIA 3HI0A 2E6LA 4KRFA 1W97L 4CEBA 2EHGA 4JHDA 4E7HA 4CZFA 1NKEA 3AAQA 5HROA 5AQZA 4DV6K 2UUBK 2P9KB 4ICLA 3IAYA 3O9TA 2VWKA 4KI6A 1JJ2M 2VG5A 4B1XB 4DF8A 5MLCQ 3MN6A 1UAXA 1KLMA 1QQMA 2P9SA 3UKUA 2ETJA 4B9SA 2PBDA 1RTIA 1DLOA 3HJFA 3ZEUA 4DWIA 4DFPA 3P31A 1RDDA 3ULEB 3CJCA 4DQIA 2VG6A 3DOKA 1L3SA 3ZT4A 2QWPA 3U8XA 2VWJA 1RT3A 1U2VA 3CYMA 3U3YA 2XY8A 3SUQA 2OTLN 3SV4A 1BU6O 2OYQA 3LP0A 4C1NI 4O8UA 4WCEL 4CGDA 1S22A 5H1SQ 4CZLA 3GBTA 3A5LC 2CGLA 1KAYA 3CCUN 3DLGA 1JL2A 1WNSA 1HNXK 2F96A 5DK5A 1P90A 5AQWA 4BQLA 5DM6L 1QQNA 3MWTA 4DV3K 5ADXA 1QSLA 1BGXT 1CXUA 2ASPA 4DSKA 3SBTA 1CZBA 2X74A 5EX5A 2RE2A 1NGJA 3MX5A 2KKZA 4H0TB 5KGXA 1IG8A 5CYQA 3D45A 3QBXA 1NG9A 4BR0A 3I33A 3OYMA 3EZWA 3BP8A 3ZETA 1YVUA 4KH4A 1YXQA 3N4PA 2GBZA 2HNDA 3DYAA 3VEWA 5AQNA 3GG4A 2P9UB 3CFOA 1TKTA 5HRSA 3AVMA 4ZHRA 3M8PA 2B6AA 3OYNA 4B9LA 3THVA 2FBXA 1XHXA 1EXQA 1C0GA 4W5NA 3LPTA 2E2OA 4DTOA 3LP2A 4A62A 1IBLK 2O8CB 3GDQA 2R7YA 1BI4A 2WFBA 4MLEA 4ZTFA 4JAXA 3KK2A 3PX0A 1VQPN 4FJNA 3MCAB 3V9XA 3DMJA 1YTAA 5KRSA 5I3UA 5HRNA 2OPRA 1BUPA 1HPMA 4CZMA 3TABA 3W3DA 3CF5L 1VQLN 3T1HK 4FSVA 1T44A 3ZSXA 4Z4HA 1B9FA 3IRXA 1IKYA 2V7YA 4CHZA 4CBUA 3SV3A 1GLJO 2ZJQL 3C0BA 2W6KA 2NRZA 4FK4A 3L2RA 4J2AA 2HHIA 3WXMB 1S6PA 4CBXA 1T3VA 4KREA 4BGBA 3RR8A 4BRHA 3K9KA 4GMJB 5C24A 4NXMK 2ZD1A 1LV5A 1TAUA 1KXPA 4R5PA 3TAGA 3FFKB 1LWFA 4H03B 4IJAA 4K43A 3WT0A 4CF0A 4LFBK 4CF2A 2ITGA 3L4QA 5CYMA 3HT3A 3WEEB 1TYQA 4OPJA 2A1SA 3HL8A 4X66K 1XMQK 1UA0A 1OH5A 2FC0A 3MK6A 3EY1A 1I94K 4IFYA 2UUCK 2DPNA 3UIQA 3B6PA 2F4VK 1ZBIA 1FK9A 1HYVA 2WUSA 4OO1J 2KTQA 1DT9A 4BRDA 1NGDA 3WXIA 1GLAG 3ZT2A 1VAZA 3OBYA 1ESVA 4JN4A 1VQ4N 4MLHA 4I6MA 1X3MA 3RRGA 5JS2A 2Q1NA 3QEVA 3M3ZA 3LAKA 3CCSN 4XH1A 4F8RA 3ALYA 2VWBA 1JLGA 3KHYA 2WOMA 4FCYA 2G8KA 1T7PA 1FKPA 4OLAA 5I9EB 2GV9A 1JLAA 5C2FA 2HBLA 3FZLA 3VA3A 2CH5A 5M1PA 4H5WA 4FWQA 5AQRA 4JI3K 2ASOA 4BR4A 1D8YA 1QTMA 4JS5A 4NO7A 3OYCA 2E8AA 4DSJA 3SQ4A 4GKKK 4CECA 4CJ5A 1N6QA 2VGMA 3PX4A 1NJZA 3T1AA 2J4RA 3H3NO 4KAZA 4B8CA 1NNEA 3ZT0A 3OHRA 4FOIA 3MDQA 1EKEA 4CJ3A 2LSNA 3LL3A 1QQCA 2IS3A 4B1VA 5KPRA 4BR2A 1D4XA 4GVMA 3TAMA 4QAGA 3F73A 3MX2A 4DUZK 3K9JA 2BTFA 5EOYA 2FXUA 2HHXA 3QEPA 3P1GA 3NCIA 3EE9A 4CJWA 4JI1K 1NBWA 2XY7A 2WBNA 3PIPL 1YUWA 2HHWA 3TAPA 4RW4A 2ZF5O 4A61A 5EU7A 4FJLA 5CY4A 4QS8A 3CCMN 4DUYK 4Y0WA 1NGBA 4YOWA 2QTDA 1HPZA 3THXB 2XHBA 5BN9A 4MQ3A 4BRAA 1O1WA 4W5TA 3C6UA 3FZKA 4ILHA 3V9ZA 3J7AP 5HLFA 1BL3A 1WLJA 3OA9A 2FLOA 4EHUA 1JLQA 3VGMA 3RMAA 3OYFA 1YJ9N 5HP1A 2CGJA 4BRLA 2P9LB 3MWPA 2P5GA 3L2QA 4AHUA 1T6CA 3KKSA 2NRTA 5C2DA 1IBMK 1HYZA 1WAFA 4MO5A 3ULDA 2Y1JA 5CHIA 1RT6A 4EZ6A 3BZCA 4NB4A 2QA4N 2XY6A 3V1QA 2VQFK 4NLCA 3G4SN 4DV2K 4I2QA 2YNFA 4CW7B 4L8RB 4A5AA 3S41A 3VQCA 4N56A 3OYKA 2E1ZA 2ZWHA 3D2FA 2BGGA 3EKUA 3J80O 2YKNA 1C0TA 1ZBHA 1JXEA 2Q0RA 1X9MA 2YNGA 4IO9L 4CJEA 3CC4N 1D9FA 1T05A 4DMNA 3SAFA 4DS4A 3AVCA 2B4JA 5GIOA 4FK2A 1U4BA 1J9AA 4CK2A 2A3ZA 5FROA 4DTUA 4M7XA 1IV0A 4DTJA 4B8AB 3U9DA 3DLHA 1MWMA 1HMVA 4FO0A 1NGCA 2VCPA 2D0OA 3VTIA 2QWQA 3IFRA 3MEEA 4DR2K 1L3VA 1U04A 2QWOA 3BGRA 5JLHA 1IKVA 3KWGA 4KH6A 5AQUA 3S3OA 4B1WB 4KHUA 3O8MA 5SZTA 1QVGM 5JICA 2P9KA 4KTWA 1HUXA 3DI6A 4F4KA 5K14A 5KQ8A 4FZZA 1J6ZA 4HHTA 4DSFA 4BR5A 4TSXA 3PX6A 4CJKA 4XJXA 3UB5A 1D9DA 5GINA 3NGZA 4BWMA 1B9DA 1SZ2A 2D4WA 4DG1A 4GV9A 1TV6A 4KHWA 4M3TA 2HHHK 1S1UA 1F21A 4H0PA 4FJ8A 2PYJA 3HPGA 3THWB 3CD6N 2P9PA 3ULEA 1JLFA 3VERA 4PWDA 5AQOA 3VEOA 3V81A 4C23A 3M8SA 4KKOA 3SNNA 4BGAA 1HX1A 3LPUA 1VQ8N 4H0VB 4CFCA 3K0SA 4AH9A 4FLZA 3P83D 4GNIA 3WNGA 2AA4A 3EN9A 3OYGA 4C8KA 4MFBA 3VEXA 1RT1A 4YHHK 1RTHA 3QFPA 2X6SA 2CH6A 3ZSZA 1TGOA 2Y1IA 3QEIA 1RDUA 5J2QA 1X9WA 4DQQA 1OKJA 1BOTO 2D0PA 4XEIA 3THYB 4OPAA 3IUCA 1VK0A 4KPYA 4FOEA 5JS1A 3P5JA 2HMPA 4IG3A 3H1VX 5HBMA 3KLEA 4BRGA 4EZ9A 4M42A 4HCCA 5CZ2A 3HTVA 3UKRB 4AM6A 1H1VA 1HRHA 4JLHA 2NRRA 1TL3A 2QM1A 4OKJA 3C65A 1IH7A 2G8WA 2GEMA 2WONA 3OYHA 1RILA 2PY5A 4CVNE 3E9PA 1VSKA 1KSPA 1TUYA 2DY4A 3LZIA 4X64K 3H45C 3L3VA 1IJJA 4CJFA 3TI0A 2KZZA 1YIJN 2NRWA 4E7KA 1HKBA 4F2SA 1VQ9N 4CF8A 5C25A 2A40A 3O9UA 1S1TA 5GAHP 4A2AA 4J2DA 2G8IA 1OH6A 3CJAA 4IFVA 4FM1A 4OLBA 3LDNA 3M5RA 3OJUA 3S5TA 1QVFM 1V4SA 2G8HA 2E1YA 3O3FA 4BDZA 2A5XA 1FXXA 3TANA 1WUAA 3U6FA 4PKGA 1WB9A 1GOAA 3RSEB 4BDPA 3LALA 4DS5A 2VYPA 3TTFA 1VQ7N 3G25A 1Z25A 1K6YA 2DFFA 3SBGA 1XHZA 3OS0A 1QHAA 3O08A 2VG7A 4CHNA 4M3XA 1VQON 2HOEA 2Z1JA 4KB0A 3EEQA 3DXMA 3KLIA 4JI5K 4BRIA 4E0DA 4DKWA 5J2PA 4YDUC 3CC2N 3E66A 5CE3A 3SAHA 5FPEA 3C6TA 3VGKA 4RW9A 4DR5K 4E1JA 2XO7A 4H5RA 4JYAK 2PFUA 3SAGA 1LW0A 4M3ZA 3L0QA 3DRRA 4FLUA 1BG3A 4DF4A 2F9TA 4FJHA 1NJWA 2X78A 1G99A 4BG9A 4BEBA 4HTLA 3TSPA 3A2FA 3HK2A 3OS1A 3DXKB 1BA0A 5IWAK 1BQMA 1EP4A 1D5AA 1NK8A 4JI7K 1VSFA 4BC4A 2O8EB 2ZE2A 1BA1A 2GWJA 2A6AA 2KW4A 2ZJRL 2OA8A 4FYDA 2IOCA 1G15A 4CD1A 4JD2B 4CGGA 4Z4CA 2VQEK 3VEVA 2NRHA 4DSLA 4DQ8A 4G1QA 4PUOA 3DOLA 4CFAA 5FRMA 3O9RA 4BR9A 3VMFB 2X6NA 4FJKA 1RGIA 3ISNC 3KLFA 1S1XA 3S3NA 3SMSA 5IT9O 1Y97A 3WXJA 3A5OC 2KLAA 3FLCO 3R3LA 3AGKA 4MDBA 3K2PA 4FWSA 1U6ZA 3MAQA 4DV7K 3CMEN 3ZSOA 3OYIA 3SPYA 4XIUA 4H4MA 1LAWA 1SQKA 4CK1A 2W00A 3AY9A 3QIPA 2IVPA 4QOZB 3O9QA 4X62K 1WSEA 3C6HA 2O8FB 2JLEA 3P39A 4JKAA 5AZJA 3AVJA 3HOTA 2RN2A 4JKGA 1NOYA
chains in the Genus database with same CATH topology
1HLUA 1Q82O 2ASOA 4BR4A 4I6MB 1Q7YO 3D2EA 2ASMA 5FPMA 4FPAA 5JLFA 3P38A 4NO7A 5F1XA 5FPNA 3GOIA 3VETA 2E8AA 2UYTA 3C6AA 5JVGL 1Q18A 4CZEA 2P9IA 4BQZA 3CCRN 1ATNA 3H3OB 3R1XA 4IO8A 4JKDA 1K8KA 3QMLA 3C7NB 3ID8A 3QDKA 2VGMA 4K25A 3HSCA 4AF1A 3DJCA 3CQXA 2J4RA 3ENBA 4YOXA 2QWNA 3H3NO 4JEPA 2E2NA 5E26A 4H5NA 1WOQA 5KPTA 4PL8A 4CBWA 3G71N 3OHRA 5C12A 3D2FB 3VF4A 3A0IX 2P9NB 3L6QA 4FOIA 5LJVA 3P4IA 3JXUA 3CJBA 2FSJA 3MDQA 4YDUA 4BRNA 2PAVA 2FF6A 3LL3A 4B1VA 4YOUA 5KPRA 2GTDA 1V4TA 2FF3B 4CZHA 2NRVA 5M1KA 4RTFD 1D4XA 3QBWA 4ISGA 4JKHA 4BR2A 4JNEA 1MWKA 4BRQA 2GWKA 3FZHA 4UY8O 2HBKA 3E9LA 2P9IB 3MX2A 3K9JA 1GLBG 4WQ5A 3CERA 2BTFA 5EOYA 1K8KB 2FXUA 2I7NA 2QWRA 1Y64A 1RDWX 3DAWA 1K9MO 4JK9A 3EE9A 3LDOA 4OPHA 3F5TA 1DKGD 1NBWA 3H46O 4JD2A 1CZAN 3WEEA 3L4IA 4EIAA 5KQDA 3NMUA 1HJOA 2WBNA 1JCEA 1M1KO 3ZX3A 3PIPL 2W40A 1YUWA 1HKGA 2NLXA 3FZMA 3I8BA 1E4FT 2VGNA 5TKWA 2ZF5O 2A41A 2FSNA 4A61A 4WF9L 3MMVA 1MDUB 3A5NC 4QS8A 4BC5A 4B9QA 3CCMN 4PL7A 4Y0WA 5AFUA 1NGBA 4YOWA 2QTDA 4JKEA 5GIPA 4R79A 2QEXN 4DCHA 5BN9A 3JS6A 3T69A 4BRAA 3FZKA 4ILHA 3D7EO 5AQVA 1NGHA 1EO1A 4QS7A 4H5VA 2OANA 3LDQA 3CCLN 3ENHA 2D1KA 5BREA 3OA9A 1GLEG 1LOTB 2QXLA 2FLOA 3Q7BA 4EHUA 3VGMA 4K41A 1YJ9N 5E84A 3CJ9A 4PKIA 2CGJA 4BRLA 3H1QA 2P9LB 1NMDA 1NGAA 3MWPA 4WQ4A 5AQJA 5F0XA 1YI2N 1KD1O 1ILYA 4DB3A 3DWLA 1RFQA 2P9PB 1T6CA 2RHKA 1OVYA 3IKMA 3EE8A 4JKFA 2NRTA 3ZX2A 4AM7A 5ADXH 3CXCM 1ZBSA 5C2DA 5FPDA 5AQXA 2NNWA 5GAEP 5EY4A 4WFNL 3VEYA 4GVEA 4U7BA 4MO5A 4CZIA 3LM9A 4IOXA 4CJ7A 5CHIA 4BREA 3O1BA 3CCVN 3F9MA 5AQYA 1YJWN 4NB4A 4WFAL 5C15A 2QA4N 3ATUA 5AQFA 3R8EA 5EXWA 2NRXA 3QFUA 5F2RA 4NLCA 3G4SN 2HF4A 4FWKA 3CCJN 4M63C 3CC7N 4GV6A 3TSQA 1N8RO 1ATRA 5AZIA 4FL9A 2P9SB 4A5AA 1Q86O 4FWNA 3U9ZA 4B1YB 3S41A 1NWKA 3UE5A 4KBOA 5AQHA 1VQKN 1XQSC 2IVNA 4YOYA 2E1ZA 2V7ZA 2ZWHA 4JKCA 3D2FA 2BUPA 3SMPA 3EKUA 1VQ6N 3IMXA 2P9NA 4YOTA 4A2BA 5BRHA 3MN7A 2HSTA 2IIRA 2Q0RA 5AQLA 5BR9A 3BF3A 1VQ7N 4A5BA 4IO9L 3CC4N 4EHTA 4DHYA 3O9SA 2GELA 3SAFA 4JK7A 3VTHA 5GIOA 3O5BA 4YOVA 1YF5L 1NLVA 3CQYA 4GY2B 4BECA 4PKHA 4IJNA 3TTCA 1GLFO 4EFHA 3CMAN 2A3ZA 5AZIB 4IDHA 2H3GX 4M7XA 4JKBA 3AARA 1YHQN 1MA9B 3VPZA 3WXLA 3ID6A 2FSKA 2C1IA 3U9DA 3KVGA 3FGUA 5AR0A 3SJHA 3QB0A 1MWMA 1LCUA 2W41A 1Z05A 1NGCA 2VCPA 4FO0A 1KAXA 3CCEN 2D0OA 3VTIA 2QWQA 3IFRA 3CCQN 2YI1A 4K42A 2F7TA 3A5MC 5ELZA 5M1FA 2QWOA 5C0YA 3LM2A 2YCHA 1KQSM 5JLHA 4KH6A 3KWGA 5AQUA 3CJ1A 2YHWA 4B1WB 2AP1A 2E20A 3EKSA 3NVKA 2OTJN 3B8AX 3O8MA 3HM8A 3ENOA 4CI6A 1QVGM 2F9WA 4MDAA 2P9KA 5JICA 5HL7L 1HUXA 3HRGA 4A59A 1P8ZA 5GAGP 3R9PA 4FWLA 4HWIA 5KQ8A 3LDPA 4IEEA 1J6ZA 2JWLA 1S72N 4BR5A 4IZ9A 2A42A 3HOSA 2QWMA 4O8KA 1Z6RA 4GV3A 3FZFA 3A8YA 5BPMA 3EL2A 3TTDA 4F9OA 3OBWA 4XJXA 2Q2RA 3TPQA 3UB5A 5GINA 4BY9C 3O6WA 1SZ2A 4GV9A 2D4WA 1GLLO 1QQOA 3E9OA 3HZ6A 4BVPA 5B8HA 2P9LA 1O13A 3CETA 3HI0A 3CPWM 2E88A 3O4WA 1W97L 4H0PA 3CD6N 4JHDA 5LY3A 2P9PA 2V51B 3ULEA 4CZFA 3AAQA 1NM1A 3VERA 5AQZA 4PHTX 2QW9A 2P9KB 3SK3A 5AQOA 3VEOA 1GLDG 3J7ZO 4C23A 4WFBL 2CGKA 3MN9A 1KC8O 4EAHD 5JMVA 4BGAA 1HX1A 1VQ8N 3O9TA 4H0VB 5AQMA 2QWLA 1JJ2M 2HBMA 4B1XB 2I7PA 4FPBA 4BE7B 4GNIA 2AA4A 5MLCQ 4B1ZA 3EN9A 3DXMB 3VEXA 3MN6A 4IOCL 1QQMA 3I55N 2P9SA 3VOVA 3UKUA 4CZKA 3SLCA 3QFPA 2PBDA 2WC9A 2C1GA 2JWKA 2CH6A 3ZEUA 5M1NA 1YITN 3UKRA 4JHDB 3P31A 3ULEB 1XUPO 3R6MA 1RDUA 3CJCA 2Q36A 1T6DA 5GADP 4FWPA 1W2BM 2QWPA 3U8XA 1OKJA 1BOTO 2D0PA 4XEIA 4OPAA 3IUCA 1X3NA 1K8AO 4FOEA 1U2VA 3T7ZA 2Q0UA 2GUPA 3O1WA 1YVNA 2OTLN 2HMPA 3BF1A 1HKCA 3VF6A 1BU6O 4BR7A 4C1NI 4WCEL 4O8UA 3H1VX 3AAPA 4G9ZA 1S22A 3N4QA 5H1SQ 1R59O 4CZGA 4CZLA 3GBTA 5AQIA 3A5LC 3UKUB 2CGLA 4BRGA 1NJIO 1KAYA 3CCUN 4XH4A 3HTVA 3RVCA 3ZEUB 1ZC6A 3VESA 2ITMA 2Q97A 3UKRB 4AM6A 1P90A 2HF3A 5AQWA 3CPEA 4BQLA 3OW2M 1H1VA 1QZ5A 3QICA 4CZJA 5DM6L 4IEIA 2NRRA 1QQNA 5AQQA 2QM1A 3MWTA 5ADXA 1TYQB 3C65A 2YX6A 3VEZA 5BPLA 2GEMA 2QI2A 2ZJPL 2ASPA 3D6RA 5TKYA 3CJ7A 3HBTA 3SBTA 5HOOA 3E9PA 5EX5A 1U2VB 1NGFA 1SAZA 2RE2A 2YJEA 1TUYA 4ILJA 1NGJA 3U4LA 4ISFA 3MX5A 3RSEA 5KPZA 2KKZA 3KK7A 3BUZB 3EO3A 4H0TB 4B1UB 1IG8A 3H45C 3KWIA 1K73O 1IJJA 3F2KA 4YORA 1YIJN 2NRWA 3QBXA 1HKBA 4BR0A 3I33A 1VQ9N 3EZWA 2A40A 3GL1A 3O9UA 4LC9B 2IVOA 3BP8A 5AQTA 3ZETA 4H0OA 4A2AA 5GAHP 4KH4A 1YXQA 2V52B 3CJAA 3N4PA 1XC3A 3VEWA 5AQNA 5JVHL 1VQ5N 3GG4A 2P9UB 3LDNA 5C10A 4FVUA 3M5RA 4JK8A 4KH5A 4MO4A 1QVFM 1V4SA 2E1YA 2YJFA 4Z94A 2ZGYA 4H5TA 2A5XA 4U67L 1WUAA 4PKGA 1C0GA 1Q81O 3PLAA 2E2OA 1TUUA 3ATVA 3O80A 3RSEB 4A62A 5M1QA 5BN8A 1X9JA 3GDQA 2VYPA 2WFBA 1DGKN 3G25A 4MLEA 5AZJB 3SBGA 4JKGB 4JAXA 5EVZA 3WXKA 1QHAA 3O08A 1VQPN 1DEJA 3G6EN 3MCAB 4L3QA 5AQPA 1VQON 3MCPA 3TSUA 2E2QA 5AFUH 2HOEA 3ZETB 1S3XA 1YJNN 4BRCA 3D2EB 1BUPA 1HPMA 4CZMA 3DXKA 3DXMA 4FWOA 3VENA 4BRIA 3W3DA 4DKWA 4YDUC 3CF5L 3TU5A 1VQLN 3CC2N 3E66A 5CE3A 3SAHA 5FPEA 3VGKA 4BC3A 3CI5A 4E1JA 4FSVA 4RWTA 4H5RA 5CR4A 1T44A 3ZX0A 2PFUA 3J8AA 1ATSA 3SAGA 1BDGA 5BRFA 2V7YA 4CBUA 4IOAL 2ZGZA 1GLJO 3L0QA 4WQ5C 2ZJQL 4M7YA 3C0BA 1BG3A 1VQMN 1JCFA 3CHWA 5BRDA 4IWVA 2HBJA 2NRZA 4ILGB 3WXMB 2F9TA 3CIPA 3Q7CA 1G99A 4BG9A 3TTFA 4CBXA 4HTLA 1T3VA 4FWMA 4WYBA 3TSPA 4BEBA 1NGGA 1YAGA 4J8FA 3MN5A 4IFEA 2E2PA 2KHOA 1JCGA 4BGBA 3DXKB 1BA0A 5DM7L 4BRHA 3K9KA 3VGLA 4BC4A 3I56N 1KXPA 3FFKB 4BRKA 4IXCA 4BRFA 2YHXA 4BRMA 1BA1A 2GWJA 2A6AA 1BO5O 3E1YA 3M1FA 4BC2A 4BROA 4H03B 2ZJRL 4IJAA 4K43A 3WT0A 3GE1A 3WQUA 1NGEA 3L4QA 4FWRA 5AQGA 4CD1A 1BWFO 1M90O 4JD2B 3WEEB 1TYQA 3H6EA 4C1NK 2Q31A 3VF2A 4BVOA 1E4GT 2NRHA 3VEVA 3FR0A 3MK6A 5BPNA 4QS9A 2DPNA 3AGRA 4DQ8A 1NGIA 4A57A 2WUSA 3W0LA 3KZBA 4OO1J 3O9RA 1ZXOA 2GX9A 1DT9A 3FE1A 1NGDA 4BR9A 4BRDA 5AQKA 3WXIA 1GLAG 3VMFB 1RGIA 4NLBA 1VAZA 5AQSA 3OBYA 3SMSA 3PIOL 1ESVA 4JN4A 4WQ4C 1QZ6A 3WXJA 1VQNN 1VQ4N 1GLCG 3WQTA 3WUHA 4MLHA 4I6MA 2BH1A 3A5OC 2YHYA 1X3MA 2KLAA 4H0YB 4XH5A 2P9UA 3FLCO 3R3LA 2Q1NA 3AGKA 3BEXA 3M3ZA 4MDBA 3CCSN 4XH1A 4H0XB 2VWBA 4FWSA 2EWSA 1U6ZA 3KHYA 3CMEN 3NVMA 3IDHA 1EQYA 3DLLL 4O5FA 5I9EB 3LDLA 1SQKA 3C7NA 2NZTA 4BRPA 4CD3A 2W00A 1C0FA 3AY9A 2IVPA 5LJWA 5C2FA 3M6GA 3ZYYX 2HBLA 3O9QA 4RCHA 5M1OA 1KAZA 3C6HA 3FZLA 4ISEA 3P39A 2CH5A 4JKAA 5AZJA 5M1PA 3HOTA 4JKGA 4H5WA 4FWQA 4BG8A 5AQRA 1SS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLU A;  2ASO A;  4BR4 A;  4I6M B;  3D2E A;  2ASM A;  5FPM A;  4FPA A;  5JLF A;  4NO7 A;  5F1X A;  5FPN A;  3GOI A;  3VET A;  2E8A A;  2UYT A;  1Q18 A;  4CZE A;  2P9I A;  4BQZ A;  1ATN A;  3H3O B;  4IO8 A;  1K8K A;  3QML A;  3C7N B;  3ID8 A;  3QDK A;  4K25 A;  3HSC A;  3DJC A;  3CQX A;  2J4R A;  2QWN A;  3H3N O;  2E2N A;  5E26 A;  4H5N A;  1WOQ A;  5KPT A;  4PL8 A;  4CBW A;  3OHR A;  3D2F B;  3VF4 A;  3A0I X;  2P9N B;  3L6Q A;  4FOI A;  5LJV A;  3P4I A;  3JXU A;  3CJB A;  2FSJ A;  3MDQ A;  4YDU A;  4BRN A;  2PAV A;  2FF6 A;  3LL3 A;  4B1V A;  5KPR A;  2GTD A;  1V4T A;  2FF3 B;  4CZH A;  4RTF D;  1D4X A;  3QBW A;  4ISG A;  4BR2 A;  4JNE A;  1MWK A;  4BRQ A;  2GWK A;  3FZH A;  2P9I B;  1GLB G;  4WQ5 A;  3CER A;  2BTF A;  5EOY A;  1K8K B;  2FXU A;  2I7N A;  2QWR A;  1Y64 A;  1RDW X;  3DAW A;  3LDO A;  1DKG D;  1NBW A;  3H46 O;  4JD2 A;  1CZA N;  3WEE A;  3L4I A;  4EIA A;  5KQD A;  1HJO A;  1JCE A;  3ZX3 A;  2W40 A;  3FZM A;  1YUW A;  1HKG A;  2NLX A;  3I8B A;  1E4F T;  2ZF5 O;  2A41 A;  2FSN A;  4A61 A;  3MMV A;  1MDU B;  3A5N C;  4QS8 A;  4BC5 A;  4B9Q A;  4PL7 A;  4Y0W A;  5AFU A;  1NGB A;  4DCH A;  5BN9 A;  3JS6 A;  4BRA A;  3FZK A;  3D7E O;  5AQV A;  1NGH A;  4QS7 A;  4H5V A;  2OAN A;  3LDQ A;  3ENH A;  2D1K A;  5BRE A;  1GLE G;  1LOT B;  2QXL A;  2FLO A;  4EHU A;  3VGM A;  4K41 A;  5E84 A;  3CJ9 A;  4PKI A;  2CGJ A;  4BRL A;  3H1Q A;  2P9L B;  1NMD A;  1NGA A;  4WQ4 A;  5AQJ A;  5F0X A;  4DB3 A;  3DWL A;  1RFQ A;  2P9P B;  1T6C A;  4AM7 A;  3ZX2 A;  5ADX H;  1ZBS A;  5FPD A;  5AQX A;  5EY4 A;  3VEY A;  4MO5 A;  4CZI A;  3LM9 A;  4CJ7 A;  4BRE A;  3O1B A;  3F9M A;  5AQY A;  4NB4 A;  3ATU A;  5AQF A;  3R8E A;  5EXW A;  5F2R A;  3QFU A;  2HF4 A;  4FWK A;  4M63 C;  1ATR A;  5AZI A;  4FL9 A;  2P9S B;  4FWN A;  3U9Z A;  4B1Y B;  3S41 A;  1NWK A;  3UE5 A;  4KBO A;  5AQH A;  1XQS C;  2IVN A;  2E1Z A;  2V7Z A;  2ZWH A;  3SMP A;  3D2F A;  2BUP A;  3EKU A;  3IMX A;  2P9N A;  4A2B A;  5BRH A;  3MN7 A;  2IIR A;  2Q0R A;  5AQL A;  5BR9 A;  3BF3 A;  4EHT A;  4DHY A;  2GEL A;  3O5B A;  4GY2 B;  1NLV A;  3CQY A;  4PKH A;  4IJN A;  1GLF O;  4EFH A;  2A3Z A;  5AZI B;  2H3G X;  4M7X A;  3AAR A;  1MA9 B;  3VPZ A;  3WXL A;  2FSK A;  3U9D A;  3KVG A;  3FGU A;  5AR0 A;  3SJH A;  3QB0 A;  1MWM A;  1LCU A;  2W41 A;  1Z05 A;  1NGC A;  2VCP A;  4FO0 A;  1KAX A;  2D0O A;  2QWQ A;  3IFR A;  2YI1 A;  4K42 A;  3A5M C;  5ELZ A;  2QWO A;  3LM2 A;  2YCH A;  5JLH A;  5AQU A;  3CJ1 A;  2YHW A;  4B1W B;  2AP1 A;  2E20 A;  3EKS A;  3B8A X;  3O8M A;  3HM8 A;  3ENO A;  4CI6 A;  2F9W A;  5JIC A;  2P9K A;  1HUX A;  1P8Z A;  3R9P A;  4FWL A;  4HWI A;  5KQ8 A;  3LDP A;  1J6Z A;  4BR5 A;  4IZ9 A;  2A42 A;  2QWM A;  4O8K A;  1Z6R A;  3FZF A;  3A8Y A;  5BPM A;  3EL2 A;  4F9O A;  2Q2R A;  3TPQ A;  3UB5 A;  3O6W A;  1SZ2 A;  2D4W A;  1GLL O;  1QQO A;  3HZ6 A;  4BVP A;  5B8H A;  2P9L A;  3CET A;  3HI0 A;  2E88 A;  3O4W A;  4H0P A;  4JHD A;  5LY3 A;  2P9P A;  2V51 B;  3ULE A;  4CZF A;  3AAQ A;  1NM1 A;  3VER A;  5AQZ A;  2QW9 A;  2P9K B;  3SK3 A;  5AQO A;  3VEO A;  1GLD G;  4C23 A;  2CGK A;  3MN9 A;  4EAH D;  5JMV A;  4BGA A;  1HX1 A;  4H0V B;  5AQM A;  2QWL A;  4B1X B;  2I7P A;  4FPB A;  4GNI A;  2AA4 A;  4B1Z A;  3EN9 A;  3DXM B;  3VEX A;  3MN6 A;  1QQM A;  2P9S A;  3VOV A;  3UKU A;  4CZK A;  3SLC A;  3QFP A;  2PBD A;  2CH6 A;  3ZEU A;  3UKR A;  4JHD B;  3ULE B;  1XUP O;  3R6M A;  3CJC A;  2Q36 A;  1T6D A;  4FWP A;  2QWP A;  3U8X A;  1OKJ A;  1BOT O;  2D0P A;  4XEI A;  3IUC A;  1X3N A;  4FOE A;  1U2V A;  2Q0U A;  2GUP A;  3O1W A;  1YVN A;  2HMP A;  3BF1 A;  1HKC A;  3VF6 A;  1BU6 O;  4BR7 A;  3H1V X;  3AAP A;  1S22 A;  1R59 O;  4CZG A;  4CZL A;  3GBT A;  5AQI A;  3A5L C;  3UKU B;  2CGL A;  4BRG A;  1KAY A;  4XH4 A;  3HTV A;  3ZEU B;  1ZC6 A;  3VES A;  2ITM A;  2Q97 A;  3UKR B;  4AM6 A;  2HF3 A;  5AQW A;  4BQL A;  1H1V A;  1QZ5 A;  3QIC A;  4CZJ A;  1QQN A;  5AQQ A;  2QM1 A;  5ADX A;  1TYQ B;  3VEZ A;  5BPL A;  2GEM A;  2ASP A;  5TKY A;  3CJ7 A;  3HBT A;  5EX5 A;  1U2V B;  1NGF A;  1SAZ A;  2YJE A;  1TUY A;  5KPZ A;  1NGJ A;  3U4L A;  4ISF A;  3RSE A;  3BUZ B;  3EO3 A;  4H0T B;  4B1U B;  1IG8 A;  3H45 C;  1IJJ A;  3QBX A;  1HKB A;  4BR0 A;  3I33 A;  3EZW A;  2A40 A;  3GL1 A;  4LC9 B;  2IVO A;  3BP8 A;  5AQT A;  3ZET A;  4H0O A;  4A2A A;  1YXQ A;  2V52 B;  3CJA A;  1XC3 A;  3VEW A;  5AQN A;  3GG4 A;  2P9U B;  3LDN A;  4MO4 A;  1V4S A;  2E1Y A;  2YJF A;  4Z94 A;  2ZGY A;  4H5T A;  2A5X A;  1WUA A;  4PKG A;  1C0G A;  2E2O A;  1TUU A;  3ATV A;  3O80 A;  3RSE B;  4A62 A;  5BN8 A;  1X9J A;  3GDQ A;  2VYP A;  4MLE A;  1DGK N;  3G25 A;  5AZJ B;  3WXK A;  4JAX A;  5EVZ A;  1QHA A;  3O08 A;  1DEJ A;  4L3Q A;  5AQP A;  3MCP A;  3ZET B;  2E2Q A;  5AFU H;  2HOE A;  1S3X A;  4BRC A;  3D2E B;  1BUP A;  1HPM A;  4CZM A;  3DXK A;  3DXM A;  4FWO A;  3VEN A;  4BRI A;  3W3D A;  4YDU C;  3TU5 A;  5CE3 A;  5FPE A;  3VGK A;  4BC3 A;  3CI5 A;  4E1J A;  4FSV A;  4RWT A;  4H5R A;  1T44 A;  3ZX0 A;  3J8A A;  1ATS A;  1BDG A;  5BRF A;  2V7Y A;  4CBU A;  2ZGZ A;  1GLJ O;  3L0Q A;  4WQ5 C;  4M7Y A;  3C0B A;  1BG3 A;  1JCF A;  3CHW A;  5BRD A;  4IWV A;  2F9T A;  3CIP A;  1G99 A;  4BG9 A;  4CBX A;  4HTL A;  4FWM A;  4WYB A;  1NGG A;  1YAG A;  4J8F A;  3MN5 A;  2E2P A;  2KHO A;  1JCG A;  4BGB A;  3DXK B;  1BA0 A;  4BRH A;  3VGL A;  4BC4 A;  1KXP A;  3FFK B;  4BRK A;  4IXC A;  4BRF A;  2YHX A;  4BRM A;  1BA1 A;  2GWJ A;  2A6A A;  1BO5 O;  3M1F A;  4BC2 A;  4BRO A;  4H03 B;  4IJA A;  4K43 A;  3WT0 A;  3GE1 A;  3WQU A;  1NGE A;  4FWR A;  5AQG A;  4CD1 A;  1BWF O;  4JD2 B;  3WEE B;  1TYQ A;  3H6E A;  2Q31 A;  3VF2 A;  4BVO A;  1E4G T;  2NRH A;  3VEV A;  3FR0 A;  3MK6 A;  5BPN A;  4QS9 A;  2DPN A;  4DQ8 A;  1NGI A;  2WUS A;  3W0L A;  3KZB A;  1ZXO A;  3FE1 A;  1NGD A;  4BR9 A;  4BRD A;  5AQK A;  3WXI A;  1GLA G;  1RGI A;  5AQS A;  3SMS A;  1ESV A;  4JN4 A;  4WQ4 C;  1QZ6 A;  3WXJ A;  1GLC G;  3WQT A;  3WUH A;  4MLH A;  4I6M A;  3A5O C;  2YHY A;  1X3M A;  4H0Y B;  4XH5 A;  2P9U A;  3FLC O;  2Q1N A;  3BEX A;  3M3Z A;  4XH1 A;  4H0X B;  2VWB A;  4FWS A;  2EWS A;  1U6Z A;  3KHY A;  3IDH A;  1EQY A;  4O5F A;  5I9E B;  3LDL A;  1SQK A;  3C7N A;  2NZT A;  4BRP A;  4CD3 A;  1C0F A;  3AY9 A;  2IVP A;  5LJW A;  3M6G A;  4RCH A;  1KAZ A;  3FZL A;  4ISE A;  5AZJ A;  2CH5 A;  4H5W A;  4FWQ A;  4BG8 A;  5AQR A; 
#chains in the Genus database with same CATH topology
 1HLU A;  1ZBF A;  4RG8 A;  2UXD K;  5KRT A;  4DLG A;  3QES A;  4DV4 K;  1VSL A;  1Q7Y O;  3D2E A;  5JLF A;  3P38 A;  1XWL A;  4E7J A;  3AVB A;  3QNO A;  4ELT A;  1N33 K;  2UYT A;  4YFU A;  3KD1 E;  4FXD A;  3QML A;  3QDK A;  3RR7 A;  3IG1 A;  4I7F A;  2A1R A;  1C0M A;  2QWN A;  3AVA A;  5E26 A;  1CZ9 A;  4H5N A;  4PL8 A;  4DFJ A;  2RF2 A;  3VF4 A;  3VQ7 A;  3A0I X;  1IO2 A;  3P4I A;  3AVI A;  3JXU A;  5KGW A;  4BRN A;  4YDU A;  4NXN K;  2PAV A;  2FF6 A;  4CZH A;  2FF3 B;  5M1K A;  1XNR K;  1JXB A;  4BE2 A;  3U3G A;  4JNE A;  4FLV A;  2GWK A;  3FZH A;  1NK7 A;  1WSI A;  2HBK A;  3E9L A;  2P9I B;  4LSN A;  3T19 A;  1GLB G;  4AHT A;  3CER A;  1KCF A;  2I7N A;  2HHV A;  1RDW X;  1K9M O;  4JK9 A;  3VQE A;  1BIU A;  3LDO A;  1J5E K;  4DQP A;  3F5T A;  2O4I A;  1CZA N;  4EIA A;  2UXB K;  5KQD A;  3NMU A;  1HJO A;  1QSS A;  1JCE A;  2YV0 X;  4N76 A;  1XNQ K;  2W40 A;  3I8B A;  3SCX A;  1E4F T;  5TKW A;  2BAN A;  2A41 A;  5AJ3 K;  3HPO A;  4FW1 A;  3MMV A;  3HYF A;  1MDU B;  1C6V A;  5C42 A;  4JKE A;  4CEA A;  1BIZ A;  3HXM A;  5AQV A;  3PSI A;  3FFI A;  2OAN A;  3LDQ A;  4Z4F A;  1LAV A;  3ENH A;  4FZY A;  1NOZ A;  2D1K A;  3SQ0 A;  5BRE A;  4FJG A;  1RDB A;  2ATQ A;  4PA1 A;  3TAF A;  4CER A;  3KLH A;  1T03 A;  3SQ1 A;  5E84 A;  3CJ9 A;  4F3T A;  3RMC A;  2E4L A;  1NMD A;  1NGA A;  4CEQ A;  1YI2 N;  4DR1 K;  3LP1 A;  3NF8 A;  3IKM A;  4JKF A;  3TAR A;  3CXC M;  1ZBS A;  4KFB A;  2Z1I A;  5GAE P;  1TL1 A;  4UQG A;  4KI4 A;  2YHB A;  1WSH A;  1WSF A;  2BE2 A;  5EY4 A;  4U7B A;  1MU2 A;  3LM9 A;  3F9M A;  5AQY A;  1YJW N;  4CES A;  5AQF A;  3V9S A;  4O5B A;  5EXW A;  5F2R A;  3NH1 A;  4FWK A;  3KD5 E;  5E41 A;  4FL9 A;  2P9S B;  1Q86 O;  1SKW A;  3DM2 A;  4Q5V A;  4B1Y B;  3UE5 A;  4KBO A;  5AQH A;  3TWH A;  1R0A A;  2IVN A;  4YOY A;  1A5X A;  3OVN A;  2BUP A;  4NCG A;  2P9N A;  4A2B A;  3G10 A;  4Y1D A;  5I42 A;  2HST A;  3L2W A;  4NCA A;  1J54 A;  3BF3 A;  4A5B A;  4EHT A;  2BDP A;  4DTS A;  4BE1 A;  4V19 S;  2OPS A;  3O5B A;  3PO4 A;  1YF5 L;  1NLV A;  3CQY A;  3AO1 A;  4JRQ A;  4PKH A;  4IJN A;  1GLF O;  4EFH A;  2UU9 K;  5AZI B;  3ZSW A;  4F2R A;  4B9M A;  3TR8 A;  4E7L A;  5J2N A;  4JKB A;  2YKM A;  3AAR A;  4E1M A;  1MA9 B;  3VPZ A;  1E3M A;  3V6D A;  3WXL A;  2C1I A;  3KVG A;  3SJH A;  1ZBL A;  1OH7 A;  4PY5 A;  1JLB A;  2W41 A;  3QER A;  1N34 K;  1KAX A;  2YI1 A;  1W0H A;  4ID1 A;  3LM2 A;  4Y1C A;  4JI6 K;  3OY9 A;  4KHP K;  1NKB A;  2P1J A;  1WSJ A;  2OTJ N;  3B8A X;  3HM8 A;  4MDA A;  3HRG A;  3SQ2 A;  4ZTJ A;  4FWL A;  3LDP A;  4Z4E A;  4CGH A;  2KFZ A;  4DTP A;  1S72 N;  3HOS A;  2QWM A;  3BY5 A;  4GV3 A;  3FZF A;  1U45 A;  1XMO K;  4OKE A;  3TTD A;  2Q2R A;  2D5R A;  1EX4 A;  5D3G A;  3AVG A;  3O6W A;  4FVM A;  1QQO A;  3CM5 A;  3CET A;  4B3M K;  4DQS A;  2E88 A;  1RBT A;  3AV9 A;  1B92 A;  1C0U A;  4FM0 A;  2V51 B;  1NM1 A;  3VQ6 A;  5FLX O;  1BI4 B;  3V9U A;  3J7Z O;  4WFB L;  2CGK A;  4EAH D;  2AJQ A;  3NH2 A;  2IDO A;  4N5S A;  5AQM A;  2QWL A;  3KJV A;  2HBM A;  4FPB A;  4OX9 K;  4BE7 B;  4B1Z A;  4M45 A;  3SPZ A;  4IOC L;  3OYA A;  1NMN A;  1KVB A;  3I55 N;  3VOV A;  3NHG A;  4CZK A;  3SLC A;  3NGY A;  2D0B A;  2WC9 A;  3D0P A;  5M1N A;  3UKR A;  3QEW A;  2QK9 A;  1ASW A;  2Q36 A;  1T6D A;  5DMR A;  2HMI A;  2W6L A;  5GAD P;  4FWP A;  3SYZ A;  3I8D A;  1FW6 A;  4KO0 A;  1ZBU A;  1K8A O;  3T7Z A;  1JL1 A;  2GUP A;  2Q0U A;  3O1W A;  2OZM A;  3HVT A;  3BF1 A;  1TAQ A;  3VQ4 A;  3BZK A;  3WNH A;  3AAP A;  3L2U A;  3N4Q A;  1R59 O;  4JI8 K;  2UUA K;  1NJI O;  4CF9 A;  3L8B A;  3RVC A;  1ZC6 A;  2Q97 A;  3OW2 M;  3CPE A;  3NF9 A;  1QZ5 A;  3QIC A;  1CXQ A;  4IEI A;  3K5L A;  4FLT A;  4HTU A;  1TYQ B;  2YX6 A;  3VEZ A;  1WBD A;  5BPL A;  1NK0 A;  2Q3S A;  3CJ7 A;  1SAZ A;  4ILJ A;  4JV5 K;  3U4L A;  4ISF A;  3RSE A;  2HHQ A;  3KK7 A;  3EO3 A;  4B1U B;  1REV A;  3KWI A;  4H4O A;  2UXC K;  2D0C A;  4YOR A;  4CK3 A;  1TK8 A;  1N32 K;  3ZCM A;  4LC9 B;  2IVO A;  2KQ2 A;  5AQT A;  4H0O A;  3NGI A;  2V52 B;  1KVA A;  3KKR A;  5JVH L;  1VQ5 N;  2P51 A;  4LD0 A;  4FVU A;  4JK8 A;  2B5J A;  3KK1 A;  2YJF A;  4RW7 A;  4FJ7 A;  2ZGY A;  4H5T A;  1NU0 A;  1S1W A;  4U67 L;  2OCE A;  4IBN A;  4OKK A;  4E3S A;  5M1Q A;  5BN8 A;  1DGK N;  3WXK A;  1DEJ A;  1KFD A;  3NBP A;  3O3H A;  5AQP A;  3TSU A;  4FJJ A;  2E2Q A;  5AFU H;  1S3X A;  4ELU A;  4LF6 K;  4N47 A;  3NF6 A;  4I9L A;  3DXK A;  1LWC A;  1I39 A;  3TU5 A;  2O8E A;  3CI5 A;  4RWT A;  4CGI A;  5KI6 A;  5CR4 A;  1KRP A;  4YY3 K;  3ZX0 A;  3J8A A;  1ATS A;  1BDG A;  5BRF A;  4IOA L;  1OH8 A;  3E01 A;  5BRD A;  2HBJ A;  1VRU A;  3VQD A;  2O8B B;  1TK0 A;  4FWM A;  4WYB A;  1S9E A;  4DSI A;  3VN5 A;  1YAG A;  5A2Q O;  3MN5 A;  3MXI A;  4IFE A;  2KHO A;  1XC9 A;  1JCG A;  1TKD A;  5DM7 L;  3NF7 A;  3VGL A;  3SI6 A;  1HJR A;  3I56 N;  1W9H A;  4BRK A;  4BRF A;  4BRM A;  4FZX C;  1BO5 O;  3PSF A;  2RPI A;  3HPH A;  3WQU A;  1NGE A;  4FWR A;  1VSI A;  3J7Y P;  3H6E A;  4BWJ A;  4E19 A;  3M8Q A;  4C1N K;  3VF2 A;  4OJR A;  1E4G T;  4JI0 K;  3FR0 A;  5BPN A;  1NGI A;  4A57 A;  1X1P A;  4OGE A;  3W0L A;  3KZB A;  4DV5 K;  1ZXO A;  3K58 A;  4CJQ A;  3FE1 A;  3CYG A;  1RBU A;  4NLB A;  4FJX A;  3PIO L;  4KHY A;  2EX3 A;  4E89 A;  4WQ4 C;  3VQA A;  3CM6 A;  3WQT A;  4OVL A;  2BH1 A;  3O4N A;  2YHY A;  2QKB A;  2P9U A;  4CHY A;  1BCM A;  1S5J A;  3JSM A;  3BEX A;  1VSM A;  3MEC A;  3AA3 A;  2EWS A;  3LWL A;  4DV0 K;  3NVM A;  3IDH A;  3DLL L;  3EZ5 A;  4B3T K;  3AVN A;  4O5F A;  1RT7 A;  2NZT A;  3L3U A;  4KHN A;  4CD3 A;  3ZSQ A;  1C0F A;  3M6G A;  4ISE A;  3ITH A;  2O8C A;  4IKF A;  4YNQ A;  2XRI A;  4BG8 A;  1Q82 O;  3OS2 A;  2F8S A;  1WN7 A;  3SUP A;  4DSE A;  5FPM A;  3QIN A;  4FPA A;  5F1X A;  3GOI A;  3VET A;  5JVG L;  3C6A A;  3LAM A;  1Q18 A;  4FLW A;  4DTM A;  1JLE A;  2P9I A;  1SKR A;  1ATN A;  2HW3 A;  3R1X A;  4JKD A;  4B08 A;  3AVK A;  5LMU K;  4C8L A;  3C7N B;  3K5M A;  4K25 A;  2XY5 A;  1L3U A;  3CQX A;  3I0R A;  3ENB A;  4JEP A;  4DR4 K;  4CBW A;  3D2F B;  3LAN A;  1SL1 A;  1WSG A;  3L6Q A;  1KVC A;  1Q9Y A;  5LJV A;  2FSJ A;  4FM2 A;  3LZJ A;  4YOU A;  2GTD A;  1RBR A;  2NRV A;  4RTF D;  3QBW A;  4ISG A;  3VQ5 A;  1N36 K;  3JYT A;  4BRQ A;  1FJG K;  3VQP A;  4UY8 O;  1S9G A;  4LFC K;  1K8K B;  3QNN A;  4F3O A;  1Y64 A;  3DAW A;  3I0S A;  4OPH A;  3H46 O;  3TAQ A;  3WEE A;  2IC3 A;  4DLE A;  1M1K O;  2NLX A;  2FSN A;  3A5N C;  5CZ1 A;  2PYL A;  4B9Q A;  4BC5 A;  1U49 A;  4PL7 A;  4NYN A;  4OGC A;  5KTQ A;  2FBY A;  3JS6 A;  3T69 A;  3CFR A;  2O8D B;  4B9T A;  1QS4 A;  4BE0 A;  4B9V A;  1HR0 K;  1NGH A;  1VSD A;  4H5V A;  4DR7 K;  3CCL N;  1IBK K;  3WNE A;  4M3U A;  4B3S K;  3DRS A;  3NE6 A;  3WNF A;  1GLE G;  3OTO K;  3Q7B A;  1GOC A;  3PO5 A;  4PKI A;  3K57 A;  3O3G A;  3AO5 A;  4O0J A;  4WQ4 A;  5F0X A;  4HUE A;  3RMD A;  1RDA A;  3PUF A;  4FLY A;  2G8V A;  1ILY A;  4DB3 A;  1RFQ A;  3VQQ A;  2P9P B;  2RHK A;  1OVY A;  3MEG A;  4LF7 K;  4LH5 A;  3RWU A;  4AM7 A;  5ADX H;  3V9W A;  2OZS A;  4CGJ A;  5FPD A;  5AQX A;  2NNW A;  4B9U A;  2HHS A;  4CZI A;  4CFB A;  4BRE A;  4HVJ A;  3CCV N;  2E6M A;  2ZQB A;  4RW6 A;  4E72 A;  4WFA L;  3EYZ A;  3R8E A;  1C1A A;  2NRX A;  3QFU A;  4B3O A;  3MED A;  2HF4 A;  5HRR A;  3DLK A;  3NAE A;  5LL6 Z;  3TSQ A;  1N8R O;  1ATR A;  5AZI A;  2KFN A;  5HRP A;  4FWN A;  3U9Z A;  4LSL A;  4CJV A;  2HHT A;  3AA5 X;  1VQK N;  1XQS C;  1U48 A;  1J53 A;  2V7Z A;  3SMP A;  4JKC A;  1T8E A;  3ZSV A;  1RTJ A;  1YTU A;  1RT5 A;  3C94 A;  3MN7 A;  4JI2 K;  3HP6 A;  1RDC A;  5BR9 A;  4DHY A;  1TK5 A;  4CEF A;  3TAE A;  4JRP A;  2Z1G A;  4YOV A;  4BEC A;  3AA2 A;  3TTC A;  1BIS A;  1BQN A;  4IDH A;  2H3G X;  3ID6 A;  2FSK A;  5AR0 A;  1Z05 A;  3CCE N;  3K5N A;  1KLN A;  1C1C A;  5M1F A;  5C0Y A;  4I9Q A;  2YCH A;  3THX A;  4FK0 A;  4FJ5 A;  3PY8 A;  3CJ1 A;  3PV8 A;  2E20 A;  4CI6 A;  3SUO A;  2F9W A;  4A59 A;  4KTZ A;  1WBB A;  3R9P A;  2YNH A;  3AVF A;  3IS9 A;  1QHT A;  3ZLJ A;  2JWL A;  3ZT3 A;  2A42 A;  4O8K A;  4CE9 A;  3A8Y A;  4Z4G A;  3EL2 A;  4F9O A;  3OBW A;  3TPQ A;  3CFP A;  1NJY A;  2YNI A;  1GLL O;  3E9O A;  1TKZ A;  2GUI A;  3QEX A;  3HZ6 A;  4BVP A;  5B8H A;  2P9L A;  1O13 A;  3M8R A;  3CPW M;  3O4W A;  3S3M A;  5LY3 A;  3V1R A;  1BCO A;  4PHT X;  2QW9 A;  2RKI A;  3SK3 A;  1GLD G;  4ID5 A;  3MN9 A;  1KC8 O;  5JMV A;  1ZYQ A;  1CLQ A;  2ZM6 K;  2I7P A;  1RT4 A;  3DXM B;  2HB5 A;  2QXF A;  3KTQ A;  4M3Y A;  1IKX A;  1LWE A;  3OJS A;  3DLB A;  1U47 A;  4W5R A;  2C1G A;  2JWK A;  4K8Z A;  1YIT N;  4HUG A;  4JHD B;  1Q9X A;  1XUP O;  3R6M A;  4E7I A;  4CJR A;  4M3R A;  1W2B M;  1X3N A;  5FDL A;  1HNV A;  1JLC A;  4M3W A;  1YVN A;  2PZS A;  4LFA K;  1HKC A;  3VF6 A;  4DU4 A;  4BR7 A;  4AIL C;  4G9Z A;  1DTQ A;  4CZG A;  5AQI A;  3UKU B;  4OPK A;  4AHC A;  5JEN A;  4O4G A;  4XH4 A;  1TVR A;  4EP5 A;  3AO3 A;  3ZEU B;  3VES A;  2ITM A;  3VQ9 A;  2HF3 A;  1W7A A;  3ZSR A;  4CZJ A;  3LDS A;  5AQQ A;  2F8T A;  3JAM O;  3LP3 A;  1UWB A;  4NCB A;  3HM9 A;  2QI2 A;  1HQE A;  2ZJP L;  1TKX A;  4CIF A;  3D6R A;  5TKY A;  3HBT A;  4CHO A;  5HOO A;  1U2V B;  1NGF A;  2YJE A;  5KPZ A;  3BUZ B;  4DFK A;  2FBT A;  4QCL A;  1K73 O;  4CEZ A;  3F2K A;  2OPQ A;  3GL1 A;  3KLG A;  3F9K A;  1VSE A;  3V1O A;  1XC3 A;  1IG9 A;  3MXM A;  5C10 A;  4KH5 A;  4MO4 A;  2WTU A;  4Z94 A;  4FLX A;  2DFE A;  3THW A;  4KTQ A;  1Q81 O;  1RBV A;  3PLA A;  4CCH A;  1TUU A;  3ATV A;  3O80 A;  3C95 A;  1FKO A;  1X9J A;  5AZJ B;  4JKG B;  5EVZ A;  3G0Z A;  3G6E N;  3HVR A;  1SKS A;  4L3Q A;  3ZT1 A;  4ELV A;  2O8B A;  5BR8 K;  3MCP A;  3ZET B;  4DU3 A;  1YJN N;  4B9N A;  4BRC A;  2IGI A;  3D2E B;  4M41 A;  1J5O A;  3MXJ A;  4FWO A;  3VEN A;  4IG0 A;  3QLH A;  4BC3 A;  1NJX A;  1SL0 A;  4AHS A;  2HVI A;  1UA1 A;  4DR6 K;  4DFM A;  2OPP A;  1VHX A;  2ZGZ A;  4K8X A;  4WQ5 C;  2HHU A;  4M7Y A;  2P5O A;  1VQM N;  1JCF A;  3CHW A;  4FJ9 A;  4IWV A;  1VSJ A;  4ILG B;  5T7B A;  3THY A;  4CF1 A;  3CIP A;  3Q7C A;  4LF5 K;  5FRN A;  3BDP A;  4CJT A;  3OYE A;  1NGG A;  3ASM A;  4LH4 A;  4AQY K;  4J8F A;  2E2P A;  3NDK A;  4J2B A;  1EET A;  1WAJ A;  4AHR A;  4DU1 A;  3L2V A;  4IXC A;  2YHX A;  3HST B;  3B6O A;  3E1Y A;  1HNW K;  3M1F A;  4BC2 A;  4BRO A;  2YHA A;  3KK3 A;  3GE1 A;  4W5Q A;  1ASV A;  5AQG A;  1BWF O;  1M90 O;  4CIG A;  4CHP A;  3DLR A;  3NFA A;  2KZM A;  1YT3 A;  2Q31 A;  4BVO A;  4QS9 A;  1SL2 A;  3AGR A;  3V4I A;  3K59 A;  2GX9 A;  1NK5 A;  4K0K K;  5AQK A;  4CJU A;  4LY7 A;  4CFD A;  5AQS A;  2QKK A;  1QZ6 A;  3VA0 A;  1VQN N;  1GLC G;  4LF8 K;  3WUH A;  2O4G A;  1UOC A;  1RT2 A;  4H0Y B;  4CJL A;  4J2E A;  4XH5 A;  4KHQ A;  4H0X B;  2G8U A;  3O4Q A;  4CHQ A;  1EQY A;  4C8O A;  4O55 A;  3LDL A;  1Q8I A;  2NUB A;  3C7N A;  4BDY A;  4I2P A;  4BRP A;  4LF9 K;  4AHV A;  5LJW A;  3ZYY X;  4RCH A;  5M1O A;  1KAZ A;  3HP9 A;  1SS6 A;  3NH0 A;  2JGU A;  4I6M B;  2ASM A;  3VQB A;  5FPN A;  4CZE A;  4CEE A;  1HNZ K;  4BQZ A;  4PQU A;  3CCR N;  3H3O B;  4IO8 A;  1HYS A;  1K8K A;  4BAC A;  3RMB A;  3ID8 A;  3SJJ A;  3J81 O;  3HSC A;  4AF1 A;  3DJC A;  4YOX A;  2E2N A;  1WOQ A;  5KPT A;  3G71 N;  5C12 A;  1HNI A;  2P9N B;  3S9H A;  4Z4I A;  3CJB A;  3DLE A;  1I3A A;  1V4T A;  4CED A;  4JKH A;  1MWK A;  1VSH A;  3AO4 A;  4CEO A;  2G8F A;  4KHS A;  2O8D A;  4DTR A;  1BHL A;  4WQ5 A;  5J2M A;  2QWR A;  3OYD A;  1Z26 A;  1IKW A;  2HNY A;  1DKG D;  4JD2 A;  3L4I A;  3ZX3 A;  3RTV A;  3FZM A;  1HKG A;  3HO1 A;  4DV1 K;  2VGN A;  4E1N A;  4IDK A;  4WF9 L;  3K5O A;  3KIO A;  4HUF A;  1C1B A;  4CJ4 A;  5AFU A;  5GIP A;  4R79 A;  2QEX N;  4DCH A;  1DTT A;  4CJP A;  4H8K A;  4N41 A;  4EP4 A;  1RNH A;  2I5J A;  3D7E O;  3OYJ A;  1KTQ A;  1EO1 A;  4QS7 A;  3AA4 A;  1RBS A;  1LOT B;  2QXL A;  4WE1 A;  4K41 A;  4RW8 A;  1SUQ A;  3ZSY A;  3H1Q A;  2O8F A;  1SV5 A;  3RRH A;  5AQJ A;  1KD1 O;  2HVH A;  1ITG A;  3DWL A;  2DTU A;  3EE8 A;  1NK4 A;  3ZX2 A;  3VQ8 A;  1RTD A;  2FBV A;  1QSY A;  1ASU A;  4WFN L;  3VEY A;  4GVE A;  3AVL A;  4O44 A;  4IOX A;  3AVH A;  4CJ7 A;  3O1B A;  4CIE A;  5C15 A;  1NK6 A;  3ATU A;  1L5U A;  1XI1 A;  3CCJ N;  4M63 C;  3CC7 N;  4GV6 A;  4B3R K;  1A5V A;  3QET A;  3T3F A;  4FW2 A;  1OVQ A;  1NWK A;  4C8N A;  1X9S A;  1S1V A;  4DTN A;  4CGF A;  4X65 K;  4CJS A;  3AO2 A;  4DQR A;  1VQ6 N;  3IMX A;  4YOT A;  1EWQ A;  3OYB A;  2IAJ A;  5BRH A;  4JI4 K;  1JKH A;  5J1E A;  2IIR A;  5AQL A;  4GW6 A;  1VRT A;  3SUN A;  4O0I A;  4GKJ K;  1GOB A;  4DTX A;  1NK9 A;  3QO9 A;  3O9S A;  2GEL A;  1EWR A;  2E5L K;  4JK7 A;  3VTH A;  1RCH A;  4GY2 B;  1LW2 A;  2Z1H A;  4FJM A;  3OYL A;  3CMA N;  4KV8 A;  3T1Y K;  3LWM A;  4C8M A;  4LF4 K;  1YHQ N;  3FGU A;  3H08 A;  1HQU A;  3QB0 A;  2DFH A;  1LCU A;  3CCQ N;  4K42 A;  2F7T A;  3A5M C;  4NYF A;  5ELZ A;  2W42 A;  1N5Y A;  1KQS M;  5SWM A;  4HCB A;  2YHW A;  1KFS A;  4KB1 A;  2AP1 A;  2HNZ A;  3EKS A;  3SZ2 A;  3NVK A;  3CG7 A;  3ENO A;  5HL7 L;  4JS4 A;  1P8Z A;  5GAG P;  4Z0U A;  4HWI A;  4IEE A;  1A5W A;  4IZ9 A;  3DRP A;  1Z6R A;  3QIO A;  5BPM A;  1S6Q A;  3CQ8 A;  1NKC A;  1QE1 A;  4DR3 K;  4BY9 C;  2D0A A;  1L3T A;  4Q0B A;  4W5O A;  5LMN K;  4FJI A;  3HI0 A;  2E6L A;  4KRF A;  1W97 L;  4CEB A;  2EHG A;  4JHD A;  4E7H A;  4CZF A;  1NKE A;  3AAQ A;  5HRO A;  5AQZ A;  4DV6 K;  2UUB K;  2P9K B;  4ICL A;  3IAY A;  3O9T A;  2VWK A;  4KI6 A;  1JJ2 M;  2VG5 A;  4B1X B;  4DF8 A;  5MLC Q;  3MN6 A;  1UAX A;  1KLM A;  1QQM A;  2P9S A;  3UKU A;  2ETJ A;  4B9S A;  2PBD A;  1RTI A;  1DLO A;  3HJF A;  3ZEU A;  4DWI A;  4DFP A;  3P31 A;  1RDD A;  3ULE B;  3CJC A;  4DQI A;  2VG6 A;  3DOK A;  1L3S A;  3ZT4 A;  2QWP A;  3U8X A;  2VWJ A;  1RT3 A;  1U2V A;  3CYM A;  3U3Y A;  2XY8 A;  3SUQ A;  2OTL N;  3SV4 A;  1BU6 O;  2OYQ A;  3LP0 A;  4C1N I;  4O8U A;  4WCE L;  4CGD A;  1S22 A;  5H1S Q;  4CZL A;  3GBT A;  3A5L C;  2CGL A;  1KAY A;  3CCU N;  3DLG A;  1JL2 A;  1WNS A;  1HNX K;  2F96 A;  5DK5 A;  1P90 A;  5AQW A;  4BQL A;  5DM6 L;  1QQN A;  3MWT A;  4DV3 K;  5ADX A;  1QSL A;  1BGX T;  1CXU A;  2ASP A;  4DSK A;  3SBT A;  1CZB A;  2X74 A;  5EX5 A;  2RE2 A;  1NGJ A;  3MX5 A;  2KKZ A;  4H0T B;  5KGX A;  1IG8 A;  5CYQ A;  3D45 A;  3QBX A;  1NG9 A;  4BR0 A;  3I33 A;  3OYM A;  3EZW A;  3BP8 A;  3ZET A;  1YVU A;  4KH4 A;  1YXQ A;  3N4P A;  2GBZ A;  2HND A;  3DYA A;  3VEW A;  5AQN A;  3GG4 A;  2P9U B;  3CFO A;  1TKT A;  5HRS A;  3AVM A;  4ZHR A;  3M8P A;  2B6A A;  3OYN A;  4B9L A;  3THV A;  2FBX A;  1XHX A;  1EXQ A;  1C0G A;  4W5N A;  3LPT A;  2E2O A;  4DTO A;  3LP2 A;  4A62 A;  1IBL K;  2O8C B;  3GDQ A;  2R7Y A;  1BI4 A;  2WFB A;  4MLE A;  4ZTF A;  4JAX A;  3KK2 A;  3PX0 A;  1VQP N;  4FJN A;  3MCA B;  3V9X A;  3DMJ A;  1YTA A;  5KRS A;  5I3U A;  5HRN A;  2OPR A;  1BUP A;  1HPM A;  4CZM A;  3TAB A;  3W3D A;  3CF5 L;  1VQL N;  3T1H K;  4FSV A;  1T44 A;  3ZSX A;  4Z4H A;  1B9F A;  3IRX A;  1IKY A;  2V7Y A;  4CHZ A;  4CBU A;  3SV3 A;  1GLJ O;  2ZJQ L;  3C0B A;  2W6K A;  2NRZ A;  4FK4 A;  3L2R A;  4J2A A;  2HHI A;  3WXM B;  1S6P A;  4CBX A;  1T3V A;  4KRE A;  4BGB A;  3RR8 A;  4BRH A;  3K9K A;  4GMJ B;  5C24 A;  4NXM K;  2ZD1 A;  1LV5 A;  1TAU A;  1KXP A;  4R5P A;  3TAG A;  3FFK B;  1LWF A;  4H03 B;  4IJA A;  4K43 A;  3WT0 A;  4CF0 A;  4LFB K;  4CF2 A;  2ITG A;  3L4Q A;  5CYM A;  3HT3 A;  3WEE B;  1TYQ A;  4OPJ A;  2A1S A;  3HL8 A;  4X66 K;  1XMQ K;  1UA0 A;  1OH5 A;  2FC0 A;  3MK6 A;  3EY1 A;  1I94 K;  4IFY A;  2UUC K;  2DPN A;  3UIQ A;  3B6P A;  2F4V K;  1ZBI A;  1FK9 A;  1HYV A;  2WUS A;  4OO1 J;  2KTQ A;  1DT9 A;  4BRD A;  1NGD A;  3WXI A;  1GLA G;  3ZT2 A;  1VAZ A;  3OBY A;  1ESV A;  4JN4 A;  1VQ4 N;  4MLH A;  4I6M A;  1X3M A;  3RRG A;  5JS2 A;  2Q1N A;  3QEV A;  3M3Z A;  3LAK A;  3CCS N;  4XH1 A;  4F8R A;  3ALY A;  2VWB A;  1JLG A;  3KHY A;  2WOM A;  4FCY A;  2G8K A;  1T7P A;  1FKP A;  4OLA A;  5I9E B;  2GV9 A;  1JLA A;  5C2F A;  2HBL A;  3FZL A;  3VA3 A;  2CH5 A;  5M1P A;  4H5W A;  4FWQ A;  5AQR A;  4JI3 K;  2ASO A;  4BR4 A;  1D8Y A;  1QTM A;  4JS5 A;  4NO7 A;  3OYC A;  2E8A A;  4DSJ A;  3SQ4 A;  4GKK K;  4CEC A;  4CJ5 A;  1N6Q A;  2VGM A;  3PX4 A;  1NJZ A;  3T1A A;  2J4R A;  3H3N O;  4KAZ A;  4B8C A;  1NNE A;  3ZT0 A;  3OHR A;  4FOI A;  3MDQ A;  1EKE A;  4CJ3 A;  2LSN A;  3LL3 A;  1QQC A;  2IS3 A;  4B1V A;  5KPR A;  4BR2 A;  1D4X A;  4GVM A;  3TAM A;  4QAG A;  3F73 A;  3MX2 A;  4DUZ K;  3K9J A;  2BTF A;  5EOY A;  2FXU A;  2HHX A;  3QEP A;  3P1G A;  3NCI A;  3EE9 A;  4CJW A;  4JI1 K;  1NBW A;  2XY7 A;  2WBN A;  3PIP L;  1YUW A;  2HHW A;  3TAP A;  4RW4 A;  2ZF5 O;  4A61 A;  5EU7 A;  4FJL A;  5CY4 A;  4QS8 A;  3CCM N;  4DUY K;  4Y0W A;  1NGB A;  4YOW A;  2QTD A;  1HPZ A;  3THX B;  2XHB A;  5BN9 A;  4MQ3 A;  4BRA A;  1O1W A;  4W5T A;  3C6U A;  3FZK A;  4ILH A;  3V9Z A;  3J7A P;  5HLF A;  1BL3 A;  1WLJ A;  3OA9 A;  2FLO A;  4EHU A;  1JLQ A;  3VGM A;  3RMA A;  3OYF A;  1YJ9 N;  5HP1 A;  2CGJ A;  4BRL A;  2P9L B;  3MWP A;  2P5G A;  3L2Q A;  4AHU A;  1T6C A;  3KKS A;  2NRT A;  5C2D A;  1IBM K;  1HYZ A;  1WAF A;  4MO5 A;  3ULD A;  2Y1J A;  5CHI A;  1RT6 A;  4EZ6 A;  3BZC A;  4NB4 A;  2QA4 N;  2XY6 A;  3V1Q A;  2VQF K;  4NLC A;  3G4S N;  4DV2 K;  4I2Q A;  2YNF A;  4CW7 B;  4L8R B;  4A5A A;  3S41 A;  3VQC A;  4N56 A;  3OYK A;  2E1Z A;  2ZWH A;  3D2F A;  2BGG A;  3EKU A;  3J80 O;  2YKN A;  1C0T A;  1ZBH A;  1JXE A;  2Q0R A;  1X9M A;  2YNG A;  4IO9 L;  4CJE A;  3CC4 N;  1D9F A;  1T05 A;  4DMN A;  3SAF A;  4DS4 A;  3AVC A;  2B4J A;  5GIO A;  4FK2 A;  1U4B A;  1J9A A;  4CK2 A;  2A3Z A;  5FRO A;  4DTU A;  4M7X A;  1IV0 A;  4DTJ A;  4B8A B;  3U9D A;  3DLH A;  1MWM A;  1HMV A;  4FO0 A;  1NGC A;  2VCP A;  2D0O A;  3VTI A;  2QWQ A;  3IFR A;  3MEE A;  4DR2 K;  1L3V A;  1U04 A;  2QWO A;  3BGR A;  5JLH A;  1IKV A;  3KWG A;  4KH6 A;  5AQU A;  3S3O A;  4B1W B;  4KHU A;  3O8M A;  5SZT A;  1QVG M;  5JIC A;  2P9K A;  4KTW A;  1HUX A;  3DI6 A;  4F4K A;  5K14 A;  5KQ8 A;  4FZZ A;  1J6Z A;  4HHT A;  4DSF A;  4BR5 A;  4TSX A;  3PX6 A;  4CJK A;  4XJX A;  3UB5 A;  1D9D A;  5GIN A;  3NGZ A;  4BWM A;  1B9D A;  1SZ2 A;  2D4W A;  4DG1 A;  4GV9 A;  1TV6 A;  4KHW A;  4M3T A;  2HHH K;  1S1U A;  1F21 A;  4H0P A;  4FJ8 A;  2PYJ A;  3HPG A;  3THW B;  3CD6 N;  2P9P A;  3ULE A;  1JLF A;  3VER A;  4PWD A;  5AQO A;  3VEO A;  3V81 A;  4C23 A;  3M8S A;  4KKO A;  3SNN A;  4BGA A;  1HX1 A;  3LPU A;  1VQ8 N;  4H0V B;  4CFC A;  3K0S A;  4AH9 A;  4FLZ A;  3P83 D;  4GNI A;  3WNG A;  2AA4 A;  3EN9 A;  3OYG A;  4C8K A;  4MFB A;  3VEX A;  1RT1 A;  4YHH K;  1RTH A;  3QFP A;  2X6S A;  2CH6 A;  3ZSZ A;  1TGO A;  2Y1I A;  3QEI A;  1RDU A;  5J2Q A;  1X9W A;  4DQQ A;  1OKJ A;  1BOT O;  2D0P A;  4XEI A;  3THY B;  4OPA A;  3IUC A;  1VK0 A;  4KPY A;  4FOE A;  5JS1 A;  3P5J A;  2HMP A;  4IG3 A;  3H1V X;  5HBM A;  3KLE A;  4BRG A;  4EZ9 A;  4M42 A;  4HCC A;  5CZ2 A;  3HTV A;  3UKR B;  4AM6 A;  1H1V A;  1HRH A;  4JLH A;  2NRR A;  1TL3 A;  2QM1 A;  4OKJ A;  3C65 A;  1IH7 A;  2G8W A;  2GEM A;  2WON A;  3OYH A;  1RIL A;  2PY5 A;  4CVN E;  3E9P A;  1VSK A;  1KSP A;  1TUY A;  2DY4 A;  3LZI A;  4X64 K;  3H45 C;  3L3V A;  1IJJ A;  4CJF A;  3TI0 A;  2KZZ A;  1YIJ N;  2NRW A;  4E7K A;  1HKB A;  4F2S A;  1VQ9 N;  4CF8 A;  5C25 A;  2A40 A;  3O9U A;  1S1T A;  5GAH P;  4A2A A;  4J2D A;  2G8I A;  1OH6 A;  3CJA A;  4IFV A;  4FM1 A;  4OLB A;  3LDN A;  3M5R A;  3OJU A;  3S5T A;  1QVF M;  1V4S A;  2G8H A;  2E1Y A;  3O3F A;  4BDZ A;  2A5X A;  1FXX A;  3TAN A;  1WUA A;  3U6F A;  4PKG A;  1WB9 A;  1GOA A;  3RSE B;  4BDP A;  3LAL A;  4DS5 A;  2VYP A;  3TTF A;  1VQ7 N;  3G25 A;  1Z25 A;  1K6Y A;  2DFF A;  3SBG A;  1XHZ A;  3OS0 A;  1QHA A;  3O08 A;  2VG7 A;  4CHN A;  4M3X A;  1VQO N;  2HOE A;  2Z1J A;  4KB0 A;  3EEQ A;  3DXM A;  3KLI A;  4JI5 K;  4BRI A;  4E0D A;  4DKW A;  5J2P A;  4YDU C;  3CC2 N;  3E66 A;  5CE3 A;  3SAH A;  5FPE A;  3C6T A;  3VGK A;  4RW9 A;  4DR5 K;  4E1J A;  2XO7 A;  4H5R A;  4JYA K;  2PFU A;  3SAG A;  1LW0 A;  4M3Z A;  3L0Q A;  3DRR A;  4FLU A;  1BG3 A;  4DF4 A;  2F9T A;  4FJH A;  1NJW A;  2X78 A;  1G99 A;  4BG9 A;  4BEB A;  4HTL A;  3TSP A;  3A2F A;  3HK2 A;  3OS1 A;  3DXK B;  1BA0 A;  5IWA K;  1BQM A;  1EP4 A;  1D5A A;  1NK8 A;  4JI7 K;  1VSF A;  4BC4 A;  2O8E B;  2ZE2 A;  1BA1 A;  2GWJ A;  2A6A A;  2KW4 A;  2ZJR L;  2OA8 A;  4FYD A;  2IOC A;  1G15 A;  4CD1 A;  4JD2 B;  4CGG A;  4Z4C A;  2VQE K;  3VEV A;  2NRH A;  4DSL A;  4DQ8 A;  4G1Q A;  4PUO A;  3DOL A;  4CFA A;  5FRM A;  3O9R A;  4BR9 A;  3VMF B;  2X6N A;  4FJK A;  1RGI A;  3ISN C;  3KLF A;  1S1X A;  3S3N A;  3SMS A;  5IT9 O;  1Y97 A;  3WXJ A;  3A5O C;  2KLA A;  3FLC O;  3R3L A;  3AGK A;  4MDB A;  3K2P A;  4FWS A;  1U6Z A;  3MAQ A;  4DV7 K;  3CME N;  3ZSO A;  3OYI A;  3SPY A;  4XIU A;  4H4M A;  1LAW A;  1SQK A;  4CK1 A;  2W00 A;  3AY9 A;  3QIP A;  2IVP A;  4QOZ B;  3O9Q A;  4X62 K;  1WSE A;  3C6H A;  2O8F B;  2JLE A;  3P39 A;  4JKA A;  5AZJ A;  3AVJ A;  3HOT A;  2RN2 A;  4JKG A;  1NOY A; 
#chains in the Genus database with same CATH homology
 1HLU A;  1Q82 O;  2ASO A;  4BR4 A;  4I6M B;  1Q7Y O;  3D2E A;  2ASM A;  5FPM A;  4FPA A;  5JLF A;  3P38 A;  4NO7 A;  5F1X A;  5FPN A;  3GOI A;  3VET A;  2E8A A;  2UYT A;  3C6A A;  5JVG L;  1Q18 A;  4CZE A;  2P9I A;  4BQZ A;  3CCR N;  1ATN A;  3H3O B;  3R1X A;  4IO8 A;  4JKD A;  1K8K A;  3QML A;  3C7N B;  3ID8 A;  3QDK A;  2VGM A;  4K25 A;  3HSC A;  4AF1 A;  3DJC A;  3CQX A;  2J4R A;  3ENB A;  4YOX A;  2QWN A;  3H3N O;  4JEP A;  2E2N A;  5E26 A;  4H5N A;  1WOQ A;  5KPT A;  4PL8 A;  4CBW A;  3G71 N;  3OHR A;  5C12 A;  3D2F B;  3VF4 A;  3A0I X;  2P9N B;  3L6Q A;  4FOI A;  5LJV A;  3P4I A;  3JXU A;  3CJB A;  2FSJ A;  3MDQ A;  4YDU A;  4BRN A;  2PAV A;  2FF6 A;  3LL3 A;  4B1V A;  4YOU A;  5KPR A;  2GTD A;  1V4T A;  2FF3 B;  4CZH A;  2NRV A;  5M1K A;  4RTF D;  1D4X A;  3QBW A;  4ISG A;  4JKH A;  4BR2 A;  4JNE A;  1MWK A;  4BRQ A;  2GWK A;  3FZH A;  4UY8 O;  2HBK A;  3E9L A;  2P9I B;  3MX2 A;  3K9J A;  1GLB G;  4WQ5 A;  3CER A;  2BTF A;  5EOY A;  1K8K B;  2FXU A;  2I7N A;  2QWR A;  1Y64 A;  1RDW X;  3DAW A;  1K9M O;  4JK9 A;  3EE9 A;  3LDO A;  4OPH A;  3F5T A;  1DKG D;  1NBW A;  3H46 O;  4JD2 A;  1CZA N;  3WEE A;  3L4I A;  4EIA A;  5KQD A;  3NMU A;  1HJO A;  2WBN A;  1JCE A;  1M1K O;  3ZX3 A;  3PIP L;  2W40 A;  1YUW A;  1HKG A;  2NLX A;  3FZM A;  3I8B A;  1E4F T;  2VGN A;  5TKW A;  2ZF5 O;  2A41 A;  2FSN A;  4A61 A;  4WF9 L;  3MMV A;  1MDU B;  3A5N C;  4QS8 A;  4BC5 A;  4B9Q A;  3CCM N;  4PL7 A;  4Y0W A;  5AFU A;  1NGB A;  4YOW A;  2QTD A;  4JKE A;  5GIP A;  4R79 A;  2QEX N;  4DCH A;  5BN9 A;  3JS6 A;  3T69 A;  4BRA A;  3FZK A;  4ILH A;  3D7E O;  5AQV A;  1NGH A;  1EO1 A;  4QS7 A;  4H5V A;  2OAN A;  3LDQ A;  3CCL N;  3ENH A;  2D1K A;  5BRE A;  3OA9 A;  1GLE G;  1LOT B;  2QXL A;  2FLO A;  3Q7B A;  4EHU A;  3VGM A;  4K41 A;  1YJ9 N;  5E84 A;  3CJ9 A;  4PKI A;  2CGJ A;  4BRL A;  3H1Q A;  2P9L B;  1NMD A;  1NGA A;  3MWP A;  4WQ4 A;  5AQJ A;  5F0X A;  1YI2 N;  1KD1 O;  1ILY A;  4DB3 A;  3DWL A;  1RFQ A;  2P9P B;  1T6C A;  2RHK A;  1OVY A;  3IKM A;  3EE8 A;  4JKF A;  2NRT A;  3ZX2 A;  4AM7 A;  5ADX H;  3CXC M;  1ZBS A;  5C2D A;  5FPD A;  5AQX A;  2NNW A;  5GAE P;  5EY4 A;  4WFN L;  3VEY A;  4GVE A;  4U7B A;  4MO5 A;  4CZI A;  3LM9 A;  4IOX A;  4CJ7 A;  5CHI A;  4BRE A;  3O1B A;  3CCV N;  3F9M A;  5AQY A;  1YJW N;  4NB4 A;  4WFA L;  5C15 A;  2QA4 N;  3ATU A;  5AQF A;  3R8E A;  5EXW A;  2NRX A;  3QFU A;  5F2R A;  4NLC A;  3G4S N;  2HF4 A;  4FWK A;  3CCJ N;  4M63 C;  3CC7 N;  4GV6 A;  3TSQ A;  1N8R O;  1ATR A;  5AZI A;  4FL9 A;  2P9S B;  4A5A A;  1Q86 O;  4FWN A;  3U9Z A;  4B1Y B;  3S41 A;  1NWK A;  3UE5 A;  4KBO A;  5AQH A;  1VQK N;  1XQS C;  2IVN A;  4YOY A;  2E1Z A;  2V7Z A;  2ZWH A;  4JKC A;  3D2F A;  2BUP A;  3SMP A;  3EKU A;  1VQ6 N;  3IMX A;  2P9N A;  4YOT A;  4A2B A;  5BRH A;  3MN7 A;  2HST A;  2IIR A;  2Q0R A;  5AQL A;  5BR9 A;  3BF3 A;  1VQ7 N;  4A5B A;  4IO9 L;  3CC4 N;  4EHT A;  4DHY A;  3O9S A;  2GEL A;  3SAF A;  4JK7 A;  3VTH A;  5GIO A;  3O5B A;  4YOV A;  1YF5 L;  1NLV A;  3CQY A;  4GY2 B;  4BEC A;  4PKH A;  4IJN A;  3TTC A;  1GLF O;  4EFH A;  3CMA N;  2A3Z A;  5AZI B;  4IDH A;  2H3G X;  4M7X A;  4JKB A;  3AAR A;  1YHQ N;  1MA9 B;  3VPZ A;  3WXL A;  3ID6 A;  2FSK A;  2C1I A;  3U9D A;  3KVG A;  3FGU A;  5AR0 A;  3SJH A;  3QB0 A;  1MWM A;  1LCU A;  2W41 A;  1Z05 A;  1NGC A;  2VCP A;  4FO0 A;  1KAX A;  3CCE N;  2D0O A;  3VTI A;  2QWQ A;  3IFR A;  3CCQ N;  2YI1 A;  4K42 A;  2F7T A;  3A5M C;  5ELZ A;  5M1F A;  2QWO A;  5C0Y A;  3LM2 A;  2YCH A;  1KQS M;  5JLH A;  4KH6 A;  3KWG A;  5AQU A;  3CJ1 A;  2YHW A;  4B1W B;  2AP1 A;  2E20 A;  3EKS A;  3NVK A;  2OTJ N;  3B8A X;  3O8M A;  3HM8 A;  3ENO A;  4CI6 A;  1QVG M;  2F9W A;  4MDA A;  2P9K A;  5JIC A;  5HL7 L;  1HUX A;  3HRG A;  4A59 A;  1P8Z A;  5GAG P;  3R9P A;  4FWL A;  4HWI A;  5KQ8 A;  3LDP A;  4IEE A;  1J6Z A;  2JWL A;  1S72 N;  4BR5 A;  4IZ9 A;  2A42 A;  3HOS A;  2QWM A;  4O8K A;  1Z6R A;  4GV3 A;  3FZF A;  3A8Y A;  5BPM A;  3EL2 A;  3TTD A;  4F9O A;  3OBW A;  4XJX A;  2Q2R A;  3TPQ A;  3UB5 A;  5GIN A;  4BY9 C;  3O6W A;  1SZ2 A;  4GV9 A;  2D4W A;  1GLL O;  1QQO A;  3E9O A;  3HZ6 A;  4BVP A;  5B8H A;  2P9L A;  1O13 A;  3CET A;  3HI0 A;  3CPW M;  2E88 A;  3O4W A;  1W97 L;  4H0P A;  3CD6 N;  4JHD A;  5LY3 A;  2P9P A;  2V51 B;  3ULE A;  4CZF A;  3AAQ A;  1NM1 A;  3VER A;  5AQZ A;  4PHT X;  2QW9 A;  2P9K B;  3SK3 A;  5AQO A;  3VEO A;  1GLD G;  3J7Z O;  4C23 A;  4WFB L;  2CGK A;  3MN9 A;  1KC8 O;  4EAH D;  5JMV A;  4BGA A;  1HX1 A;  1VQ8 N;  3O9T A;  4H0V B;  5AQM A;  2QWL A;  1JJ2 M;  2HBM A;  4B1X B;  2I7P A;  4FPB A;  4BE7 B;  4GNI A;  2AA4 A;  5MLC Q;  4B1Z A;  3EN9 A;  3DXM B;  3VEX A;  3MN6 A;  4IOC L;  1QQM A;  3I55 N;  2P9S A;  3VOV A;  3UKU A;  4CZK A;  3SLC A;  3QFP A;  2PBD A;  2WC9 A;  2C1G A;  2JWK A;  2CH6 A;  3ZEU A;  5M1N A;  1YIT N;  3UKR A;  4JHD B;  3P31 A;  3ULE B;  1XUP O;  3R6M A;  1RDU A;  3CJC A;  2Q36 A;  1T6D A;  5GAD P;  4FWP A;  1W2B M;  2QWP A;  3U8X A;  1OKJ A;  1BOT O;  2D0P A;  4XEI A;  4OPA A;  3IUC A;  1X3N A;  1K8A O;  4FOE A;  1U2V A;  3T7Z A;  2Q0U A;  2GUP A;  3O1W A;  1YVN A;  2OTL N;  2HMP A;  3BF1 A;  1HKC A;  3VF6 A;  1BU6 O;  4BR7 A;  4C1N I;  4WCE L;  4O8U A;  3H1V X;  3AAP A;  4G9Z A;  1S22 A;  3N4Q A;  5H1S Q;  1R59 O;  4CZG A;  4CZL A;  3GBT A;  5AQI A;  3A5L C;  3UKU B;  2CGL A;  4BRG A;  1NJI O;  1KAY A;  3CCU N;  4XH4 A;  3HTV A;  3RVC A;  3ZEU B;  1ZC6 A;  3VES A;  2ITM A;  2Q97 A;  3UKR B;  4AM6 A;  1P90 A;  2HF3 A;  5AQW A;  3CPE A;  4BQL A;  3OW2 M;  1H1V A;  1QZ5 A;  3QIC A;  4CZJ A;  5DM6 L;  4IEI A;  2NRR A;  1QQN A;  5AQQ A;  2QM1 A;  3MWT A;  5ADX A;  1TYQ B;  3C65 A;  2YX6 A;  3VEZ A;  5BPL A;  2GEM A;  2QI2 A;  2ZJP L;  2ASP A;  3D6R A;  5TKY A;  3CJ7 A;  3HBT A;  3SBT A;  5HOO A;  3E9P A;  5EX5 A;  1U2V B;  1NGF A;  1SAZ A;  2RE2 A;  2YJE A;  1TUY A;  4ILJ A;  1NGJ A;  3U4L A;  4ISF A;  3MX5 A;  3RSE A;  5KPZ A;  2KKZ A;  3KK7 A;  3BUZ B;  3EO3 A;  4H0T B;  4B1U B;  1IG8 A;  3H45 C;  3KWI A;  1K73 O;  1IJJ A;  3F2K A;  4YOR A;  1YIJ N;  2NRW A;  3QBX A;  1HKB A;  4BR0 A;  3I33 A;  1VQ9 N;  3EZW A;  2A40 A;  3GL1 A;  3O9U A;  4LC9 B;  2IVO A;  3BP8 A;  5AQT A;  3ZET A;  4H0O A;  4A2A A;  5GAH P;  4KH4 A;  1YXQ A;  2V52 B;  3CJA A;  3N4P A;  1XC3 A;  3VEW A;  5AQN A;  5JVH L;  1VQ5 N;  3GG4 A;  2P9U B;  3LDN A;  5C10 A;  4FVU A;  3M5R A;  4JK8 A;  4KH5 A;  4MO4 A;  1QVF M;  1V4S A;  2E1Y A;  2YJF A;  4Z94 A;  2ZGY A;  4H5T A;  2A5X A;  4U67 L;  1WUA A;  4PKG A;  1C0G A;  1Q81 O;  3PLA A;  2E2O A;  1TUU A;  3ATV A;  3O80 A;  3RSE B;  4A62 A;  5M1Q A;  5BN8 A;  1X9J A;  3GDQ A;  2VYP A;  2WFB A;  1DGK N;  3G25 A;  4MLE A;  5AZJ B;  3SBG A;  4JKG B;  4JAX A;  5EVZ A;  3WXK A;  1QHA A;  3O08 A;  1VQP N;  1DEJ A;  3G6E N;  3MCA B;  4L3Q A;  5AQP A;  1VQO N;  3MCP A;  3TSU A;  2E2Q A;  5AFU H;  2HOE A;  3ZET B;  1S3X A;  1YJN N;  4BRC A;  3D2E B;  1BUP A;  1HPM A;  4CZM A;  3DXK A;  3DXM A;  4FWO A;  3VEN A;  4BRI A;  3W3D A;  4DKW A;  4YDU C;  3CF5 L;  3TU5 A;  1VQL N;  3CC2 N;  3E66 A;  5CE3 A;  3SAH A;  5FPE A;  3VGK A;  4BC3 A;  3CI5 A;  4E1J A;  4FSV A;  4RWT A;  4H5R A;  5CR4 A;  1T44 A;  3ZX0 A;  2PFU A;  3J8A A;  1ATS A;  3SAG A;  1BDG A;  5BRF A;  2V7Y A;  4CBU A;  4IOA L;  2ZGZ A;  1GLJ O;  3L0Q A;  4WQ5 C;  2ZJQ L;  4M7Y A;  3C0B A;  1BG3 A;  1VQM N;  1JCF A;  3CHW A;  5BRD A;  4IWV A;  2HBJ A;  2NRZ A;  4ILG B;  3WXM B;  2F9T A;  3CIP A;  3Q7C A;  1G99 A;  4BG9 A;  3TTF A;  4CBX A;  4HTL A;  1T3V A;  4FWM A;  4WYB A;  3TSP A;  4BEB A;  1NGG A;  1YAG A;  4J8F A;  3MN5 A;  4IFE A;  2E2P A;  2KHO A;  1JCG A;  4BGB A;  3DXK B;  1BA0 A;  5DM7 L;  4BRH A;  3K9K A;  3VGL A;  4BC4 A;  3I56 N;  1KXP A;  3FFK B;  4BRK A;  4IXC A;  4BRF A;  2YHX A;  4BRM A;  1BA1 A;  2GWJ A;  2A6A A;  1BO5 O;  3E1Y A;  3M1F A;  4BC2 A;  4BRO A;  4H03 B;  2ZJR L;  4IJA A;  4K43 A;  3WT0 A;  3GE1 A;  3WQU A;  1NGE A;  3L4Q A;  4FWR A;  5AQG A;  4CD1 A;  1BWF O;  1M90 O;  4JD2 B;  3WEE B;  1TYQ A;  3H6E A;  4C1N K;  2Q31 A;  3VF2 A;  4BVO A;  1E4G T;  2NRH A;  3VEV A;  3FR0 A;  3MK6 A;  5BPN A;  4QS9 A;  2DPN A;  3AGR A;  4DQ8 A;  1NGI A;  4A57 A;  2WUS A;  3W0L A;  3KZB A;  4OO1 J;  3O9R A;  1ZXO A;  2GX9 A;  1DT9 A;  3FE1 A;  1NGD A;  4BR9 A;  4BRD A;  5AQK A;  3WXI A;  1GLA G;  3VMF B;  1RGI A;  4NLB A;  1VAZ A;  5AQS A;  3OBY A;  3SMS A;  3PIO L;  1ESV A;  4JN4 A;  4WQ4 C;  1QZ6 A;  3WXJ A;  1VQN N;  1VQ4 N;  1GLC G;  3WQT A;  3WUH A;  4MLH A;  4I6M A;  2BH1 A;  3A5O C;  2YHY A;  1X3M A;  2KLA A;  4H0Y B;  4XH5 A;  2P9U A;  3FLC O;  3R3L A;  2Q1N A;  3AGK A;  3BEX A;  3M3Z A;  4MDB A;  3CCS N;  4XH1 A;  4H0X B;  2VWB A;  4FWS A;  2EWS A;  1U6Z A;  3KHY A;  3CME N;  3NVM A;  3IDH A;  1EQY A;  3DLL L;  4O5F A;  5I9E B;  3LDL A;  1SQK A;  3C7N A;  2NZT A;  4BRP A;  4CD3 A;  2W00 A;  1C0F A;  3AY9 A;  2IVP A;  5LJW A;  5C2F A;  3M6G A;  3ZYY X;  2HBL A;  3O9Q A;  4RCH A;  5M1O A;  1KAZ A;  3C6H A;  3FZL A;  4ISE A;  3P39 A;  2CH5 A;  4JKA A;  5AZJ A;  5M1P A;  3HOT A;  4JKG A;  4H5W A;  4FWQ A;  4BG8 A;  5AQR A;  1SS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...