3RSEB

Structural and biochemical characterization of two binding sites for nucleation promoting factor wasp-vca on arp2/3 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
196
structure length
196
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 52
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rseB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3rseB02
2P9IB 2YHYA 5EVZA 5F1XA 3H3OB 4BVOA 4BQZA 1EQYA 1BUPA 2IVPA 5B8HA 3MN9A 4H0OA 2CGLA 1GLCG 4CZHA 1LCUA 5AQTA 1DKGD 2YHXA 5LJVA 3W3DA 4BGBA 1NGCA 4BR0A 3IDHA 2A5XA 1MDUB 2E1ZA 2H3GX 1QQMA 1BG3A 1NGJA 1E4GT 3IUCA 4O5FA 1BA0A 5KPTA 1QQOA 4BG9A 2E2NA 4GY2B 3EKSA 5LJWA 4CBXA 2P9SA 4RTFD 4BR7A 3VPZA 3VF4A 2UYTA 4I6MA 3B8AX 5JLHA 1Q18A 1YXQA 4ISFA 3WEEB 5AQSA 4C23A 1TUUA 5JICA 3DAWA 4H5WA 4BC2A 4JNEA 3EO3A 3MMVA 3O5BA 4K42A 4FOIA 5AFUA 4CD1A 2IIRA 4HTLA 4WQ4C 3VESA 5EOYA 3VEXA 3CIPA 4QS7A 3DWLA 2ASOA 1RDWX 2QWRA 2V51B 4BG8A 1GLBG 3L4IA 3ATVA 5AQVA 3SK3A 2CH5A 2E8AA 2ZGZA 4BRHA 1NBWA 1BDGA 1BO5O 1ZC6A 2CH6A 2F9TA 5ADXH 4H0YB 3FZKA 2OANA 2QWNA 2YCHA 1G99A 3ZETA 4B9QA 2QWQA 3HBTA 3CETA 4XH5A 2YHWA 2BTFA 1NGEA 3I8BA 4EFHA 3IMXA 3U4LA 3CQYA 4BR4A 4M7XA 2KHOA 5AQFA 1ZBSA 1KAZA 1GLJO 4I6MB 3ZX3A 1IG8A 3QDKA 4CD3A 2HF4A 1U6ZA 2DPNA 3L6QA 5FPEA 2VWBA 1C0GA 1NGFA 3KHYA 3VENA 4F9OA 4B1WB 3ID8A 4BROA 5I9EB 1DGKN 2Q0UA 4IZ9A 1V4TA 3ZEUA 4IO8A 1GLFO 4H5NA 4LC9B 1RGIA 3MN7A 4H5RA 3VGMA 1MA9B 5FPMA 3LDPA 4PKGA 3C0BA 4BRLA 5AZJB 2HF3A 1GLDG 5BPNA 3VETA 3J8AA 3WEEA 4CBUA 4H5VA 1U2VB 4FWQA 4BC3A 3UKUB 4FOEA 3VF6A 5FPNA 3BP8A 3QFPA 5BRHA 2V52B 4B1ZA 4H03B 5F2RA 2F9WA 2A41A 3BF1A 4FWNA 4JD2A 4A61A 4BRGA 4A62A 4B1VA 1ATRA 2VCPA 4FWOA 4BRAA 2Q2RA 3CJ1A 3CJ7A 4K25A 1KAXA 1XUPO 3HTVA 5AQRA 5AFUH 3TU5A 2ASMA 1P8ZA 3VF2A 3GL1A 3R9PA 1LOTB 1DEJA 4M7YA 2QWMA 3A5LC 4BRNA 2FF3B 2QWOA 3QBXA 3I33A 4FWRA 4MO4A 4DCHA 3KVGA 4CZMA 1E4FT 3LL3A 3O1BA 4K43A 3LM2A 2A3ZA 2ZF5O 3RSEB 4IJNA 3GE1A 3D2EB 1TYQA 4WYBA 2QWPA 4BR5A 4JHDB 4CZEA 2P9KB 3MN6A 5AQMA 3D7EO 5KPZA 4NO7A 2P9PB 1J6ZA 5ADXA 1YVNA 3OHRA 4H0XB 3LDLA 4WQ5C 3RSEA 5F0XA 2YJEA 1MWMA 3AAQA 1HKCA 4H0PA 2Q31A 3CQXA 1Z6RA 5EY4A 3DXKA 2P9PA 2E2OA 3UKUA 4BRKA 2FXUA 5AQQA 4NB4A 5AQNA 1HJOA 4JD2B 5JLFA 4HWIA 1V4SA 2ZGYA 3D2EA 2GTDA 3R8EA 3AARA 5BPMA 5AZIA 3MK6A 4CZIA 1ESVA 3SLCA 1YAGA 5AQJA 5AQHA 4BREA 4Y0WA 3EKUA 2V7ZA 1QZ6A 3G25A 2GELA 3D2FB 3GG4A 2ASPA 3AY9A 1WUAA 4BGAA 3QICA 4K41A 2ZWHA 2ITMA 3VEOA 4BC5A 5KQ8A 4BRQA 4XH1A 5E26A 4DQ8A 4PL7A 2Q1NA 1X9JA 2HMPA 3JS6A 1NGGA 1IJJA 1JCFA 3UKRA 4FL9A 4DB3A 1Z05A 3EL2A 3A5NC 2W40A 3FGUA 2P9NB 5CE3A 1YUWA 3EZWA 2A42A 4ISGA 3M6GA 1ATNA 2YJFA 3M1FA 3CJBA 3O1WA 3BF3A 2I7PA 2YI1A 4XH4A 5TKYA 1NM1A 3WXLA 5BRFA 2PAVA 3CHWA 4FWMA 4QS9A 4BRFA 3VOVA 3C7NA 3VEYA 3IFRA 4PKHA 2GUPA 3FR0A 4CZGA 2J4RA 3HZ6A 1H1VA 4IWVA 5E84A 5AR0A 1NGHA 2NZTA 3DXKB 1JCGA 3QBWA 2D0PA 1TYQB 3CJAA 2D1KA 5AZIB 2P9KA 3U9ZA 3DXMA 5AQGA 4JN4A 3LDNA 2CGJA 1HX1A 4CJ7A 2QWLA 5AQYA 2GEMA 2GWKA 5KQDA 4FO0A 3ENOA 5AQLA 4BC4A 1HKGA 1NLVA 5BPLA 3H45C 5JMVA 2QXLA 2QM1A 2Q36A 3UE5A 3L0QA 3H1QA 3R6MA 5AQKA 5KPRA 1NGIA 5AQZA 3C7NB 4CBWA 1BU6O 4L3QA 3EN9A 3KZBA 2D4WA 1KXPA 3DXMB 1CZAN 3O6WA 1QHAA 3GBTA 1GLEG 4CZFA 4BVPA 1T6DA 3ZEUB 3VGLA 2I7NA 4BQLA 4MLEA 1BWFO 3O8MA 3VEZA 3CJ9A 1GLLO 4EAHD 1QQNA 3VGKA 5AZJA 3MCPA 1C0FA 4WQ5A 2FF6A 3QMLA 4B1UB 1GLAG 2QW9A 1X3NA 3LDQA 5BREA 4BR9A 2P9SB 2IVOA 2Q97A 2P9UB 2AP1A 3MN5A 3F9MA 4CZLA 2FSKA 4H0TB 1BOTO 4A2BA 3WXJA 3H1VX 2NLXA 2EWSA 1TUYA 2Q0RA 3QFUA 4MO5A 3FZHA 3GOIA 1HPMA 5AQIA 2P9UA 3JXUA 5FPDA 1XC3A 4EIAA 4BR2A 4PL8A 5AQXA 1MWKA 2A40A 2E1YA 3WUHA 2E2QA 3WQUA 3P4IA 4B1YB 4B1XB 4ISEA 1KAYA 4IXCA 3BUZB 1ZXOA 4JHDA 4CZKA 5BN8A 2VYPA 5BR9A 3FZMA 3O80A 4QS8A 1K8KB 3H6EA 3U8XA 1R59O 4O8KA 3ZETB 3WT0A 1D4XA 3ZX0A 3O4WA 3S41A 4EHTA 4XEIA 4EHUA 1XQSC 3AAPA 2FSJA 4M63C 1JCEA 4BRCA 4H5TA 2D0OA 4J8FA 3SMSA 1SZ2A 3A5MC 3QB0A 3D2FA 3H46O 1T6CA 3FZLA 3FFKB 3FZFA 3HM8A 2P9LA 3DJCA 4FPAA 3U9DA 2FSNA 1SAZA 5AQOA 1HUXA 5EXWA 3WXIA 2NRHA 1HKBA 2P9IA 3WXKA 4DHYA 3W0LA 4YDUC 4FSVA 4PKIA 4MLHA 4GNIA 2BUPA 2CGKA 5AQUA 3UKRB 4Z94A 2W41A 3SMPA 4AM6A 4BRDA 2FLOA 3A8YA 1X3MA 5AQWA 3WQTA 1RFQA 3H3NO 3TPQA 3VERA 4WQ4A 4BRPA 2E20A 3UB5A 1HLUA 3VEWA 3LM9A 4RWTA 1ATSA 5BRDA 3A5OC 4JAXA 4BRMA 4IJAA 3FLCO 2AA4A 5BN9A 4FPBA 5ELZA 4FWSA 3CJCA 5EX5A 1BA1A 2A6AA 3HI0A 3SJHA 3A0IX 4BRIA 1S3XA 4FWPA 3ULEA 4KBOA 1S22A 1K8KA 3ZX2A 4AM7A 1NMDA 2E88A 2PBDA 3VEVA 3ULEB 1QZ5A 3ATUA 2WUSA 2HOEA 3GDQA 3HSCA 4RCHA 5LY3A 4H0VB 1NGBA 4E1JA 1SQKA 1NGDA 3CERA 1WOQA 2V7YA 3MDQA 4FWKA 4CI6A 3FE1A 4FWLA 3BEXA 1T44A 2E2PA 1U2VA 1NWKA 5AQPA 4YDUA 4A2AA 2P9NA 2P9LB 1OKJA 3LDOA 3O08A 3ENHA 2IVNA 4CZJA 3CI5A 2GWJA 1NGAA 3M3ZA 1Y64A
chains in the Genus database with same CATH superfamily
1BI4B 2KQ2A 3HVRA 3L2UA 4JS4A 4PQUA 4CF0A 3CCQN 4BVOA 2IVPA 1RTIA 3C94A 4Y1CA 3CCVN 1GLCG 1LCUA 5LJVA 3W3DA 4FM2A 2H3GX 1QQMA 5HOOA 1REVA 4CJWA 1WSGA 1QVGM 2E2NA 4JKCA 1U45A 4GY2B 3D6RA 3EKSA 4CF1A 1SKRA 4RTFD 3AA4A 1S1UA 5JLHA 3KLGA 4ISFA 3CC2N 5FDLA 4YNQA 3PY8A 1RTDA 2G8IA 4DR2K 4CFAA 4OLAA 1R0AA 1S1VA 3SUNA 4W5OA 5C42A 3K2PA 4B9TA 4CEFA 4K42A 4W5NA 5HRSA 4TSXA 3CYGA 1NOZA 1WAJA 4HTLA 4E7IA 3THXB 4KI4A 3HXMA 2AJQA 3V1RA 1GOCA 2FBVA 3OYCA 3L2RA 1EWRA 1GLBG 3L4IA 3ATVA 5CR4A 3LP1A 3OVNA 3DOLA 2ZGZA 4BRHA 1NBWA 1ASUA 4FZXC 2F96A 1BO5O 2CH6A 2F9TA 3SAFA 2HB5A 3QINA 3QEIA 5HBMA 1YJNN 1X9WA 3J7AP 4CGIA 4M3XA 4B9QA 4AHRA 3HBTA 4DQQA 2BTFA 1N32K 5GAEP 3IMXA 4BR4A 1NNEA 3N4QA 3V81A 5AQFA 4HCBA 4CF9A 1BL3A 4LF4K 1IG8A 4EZ6A 1FJGK 4BECA 4WE1A 4OJRA 3QNNA 5C10A 1NGFA 3VENA 3CFRA 3AVJA 5DK5A 5HL7L 4BROA 4IZ9A 1V4TA 5I42A 3ZEUA 1XHXA 3ZSRA 3KWIA 1CLQA 4ILHA 3TSQA 1QSYA 3LWLA 3VGMA 4PUOA 1VSHA 4DSJA 4CBUA 4FWQA 3E1YA 4FK0A 2WBNA 5FPNA 3ZSYA 1XI1A 4FW1A 3QFPA 4IOCL 4AQYK 2LSNA 5F2RA 3O3FA 4FLXA 2A41A 4IEIA 3BF1A 4O4GA 4A61A 4BRGA 4B9LA 2KFZA 4B1VA 2Q2RA 5HP1A 3CJ7A 2P51A 3O4NA 4K25A 1KAXA 3P83D 4RW4A 2ZQBA 5AQRA 4H4MA 4FJMA 1P8ZA 2HHTA 1EO1A 1IV0A 3AVLA 5A2QO 2GUIA 1WSHA 4FWRA 3HOTA 5CY4A 4CZMA 4KAZA 3LM2A 1KLNA 2A3ZA 2ZF5O 3HSTB 2Z1IA 1LAWA 3D2EB 4WYBA 4BR5A 1I94K 5AQMA 2YKNA 4OKJA 5KPZA 4DR3K 2XY7A 3CCUN 1J6ZA 1U48A 4B9SA 2O4IA 1YVNA 4BWMA 4WQ5C 3RSEA 1QQCA 5F0XA 3OS0A 4DUYK 2X6NA 3AAQA 4CIEA 2KZZA 1Q8IA 3T1AA 1ZBHA 3LZIA 5AQQA 4IDHA 2BE2A 4CFCA 1RT1A 1Q81O 2Y1JA 2GTDA 3R8EA 3AARA 3CC7N 1VQ9N 1ESVA 1RBSA 5AQJA 2NRTA 3KLEA 3EKUA 4FJJA 3G25A 4N47A 3D2FB 3GG4A 2ASPA 1J53A 4OPAA 2ZWHA 4BC5A 5KQ8A 2B5JA 1A5WA 3VQQA 5BR8K 3K9JA 1HNWK 4G9ZA 1S1TA 4M3WA 1NGGA 1IJJA 1JCFA 4FL9A 1S9EA 3EL2A 5IWAK 3A5NC 1K8AO 3FGUA 4GV3A 3V4IA 4ZHRA 4IFYA 2HHSA 5HRPA 3O1WA 3BF3A 5J2QA 4C8KA 4XH4A 1CZ9A 2PAVA 4FWMA 2FBTA 4QS9A 4JLHA 4O0JA 4DTPA 4DG1A 3VEYA 4CZGA 1B9FA 2ZJPL 3DXKB 2A1SA 3M8QA 1VSDA 3CJAA 1L3TA 2BH1A 2P9KA 1S1WA 2CGJA 4DS5A 1ZBUA 1HX1A 3S3OA 2RHKA 2QWLA 4O8UA 3OYJA 1K6YA 5JENA 2PY5A 2P5GA 3T69A 3HP9A 1HNXK 3H45C 5JMVA 2HNDA 4FXDA 3UE5A 4AHVA 5AQKA 1SL2A 3C7NB 3DLRA 4L3QA 3KLHA 3RMCA 2D4WA 1M90O 1KXPA 1RDAA 3DXMB 4CHPA 5C24A 3CPEA 3F2KA 3O8MA 3CJ9A 1TKTA 1ZBIA 3LAKA 4CVNE 4ZTFA 1ASVA 3S9HA 1C0FA 1HRHA 3J80O 1DLOA 4CJQA 4B1UB 1BQNA 4YOWA 1X3NA 1EETA 3NVMA 3LDQA 5BREA 3OYEA 2P9SB 1L5UA 3B6OA 2NRVA 2AP1A 3F9MA 1XNQK 4B9VA 2WC9A 1BOTO 1J5EK 4M3UA 4IG0A 4IKFA 3NGZA 1NK8A 3D0PA 3QO9A 2Q0RA 3QFUA 3NH1A 4KB0A 1O13A 5AQIA 1XC3A 4DU3A 1Q86O 1GOAA 1KFSA 1IG9A 4JKAA 4BWJA 1JLFA 3TAEA 4PL8A 2OPRA 1C0MA 1WSFA 1DTTA 3VQDA 4FJNA 3P4IA 4DLGA 1D9FA 3KK1A 1WN7A 1RBVA 1CZBA 2XO7A 4DSLA 1BCOA 3FZMA 1K8KB 2IGIA 4CJ5A 1U04A 1RTJA 2UUAK 3HT3A 1LW2A 3G6EN 3WT0A 2VWJA 1EWQA 2IS3A 1D4XA 3ZX0A 3O4WA 3S41A 3KD1E 4EHTA 4XEIA 4CF8A 1EKEA 1XQSC 4FM0A 2OYQA 4O55A 4CEDA 3AGRA 2O8DA 4LFAK 4J8FA 1SZ2A 1RT7A 4FLWA 3QB0A 4GKKK 1L3UA 3K5MA 2ITGA 3HM8A 2IAJA 3DJCA 1WSEA 3THVA 1HUXA 3LALA 3IG1A 3SQ2A 2NRHA 3RRGA 2F8SA 4DHYA 1YT3A 4YDUC 4FSVA 1BCMA 1JJ2M 4OPKA 1S1XA 2UU9K 4OPHA 4F4KA 4DR7K 1XWLA 3UKRB 3ISNC 4CHYA 3E01A 4A57A 3R3LA 1RT5A 4DSIA 3A8YA 4XJXA 1T7PA 3WQTA 1KTQA 2WOMA 3OYMA 1RFQA 3HVTA 3H3NO 3TPQA 4BRPA 5C0YA 1NK9A 1HLUA 3VEWA 3BY5A 4RWTA 1NKEA 2OZSA 3A5OC 4JEPA 3MAQA 4JAXA 4BRMA 5C12A 3SQ0A 3FLCO 1NU0A 3C6AA 3O9TA 4FWSA 5ELZA 5EX5A 3R1XA 1S3XA 4KBOA 1K8KA 1QSLA 3DOKA 5CZ2A 3ULEB 2YHBA 4N56A 3ATUA 3BZKA 4M45A 2ZE2A 5AJ3K 1JLEA 1SQKA 1NJZA 5FROA 3CERA 3CMAN 1NK7A 1U4BA 1WNSA 4HUFA 4FWKA 3CM5A 1KVAA 3C6HA 4FWLA 3ENBA 4DR5K 1U2VA 2W00A 1VK0A 4A2AA 2P9NA 1OKJA 4FJIA 3ENHA 5TKWA 2VGNA 3CI5A 3M3ZA 1NGAA 2YKMA 1Y64A 3CCLN 2RKIA 1RDUA 3M5RA 5JVGL 1BUPA 3ZSWA 3MN9A 4H0OA 2CGLA 2OTJN 3PSFA 1DKGD 2YHXA 4JI7K 3AA3A 2E1ZA 1NGJA 1IO2A 1E4GT 2DFHA 4O5FA 1BA0A 5KPTA 4F3TA 1J9AA 1HYZA 3T1YK 1RDDA 2QI2A 4FLUA 1QTMA 2UYTA 4I6MA 3B8AX 3L3VA 3WEEB 3L8BA 5AQSA 3ZYYX 2WONA 1RCHA 1VSIA 1ZBFA 3I55N 2B4JA 4CHZA 1LWCA 4X66K 2XY5A 1K9MO 3SQ4A 4CEZA 1SKSA 4CEAA 5GIOA 4KI6A 1VHXA 4FJ7A 1S72N 2IIRA 4NLCA 4BE2A 1VQ7N 1ZBLA 4OX9K 4QS7A 2ASOA 3VTIA 2V51B 4FJ5A 3SBGA 4GW6A 5SZTA 3SK3A 3EY1A 2NRXA 5JVHL 2ZJQL 1IKXA 1BDGA 1HJRA 3OYGA 5ADXH 3L2QA 4H0YB 1BHLA 2OZMA 2OANA 3DRRA 1C1CA 2F8TA 2VQFK 1N33K 2O8CB 2BDPA 3CETA 3CD6N 1VQKN 1NGEA 3I8BA 4EFHA 3U4LA 1VQNN 3ZSVA 4M7XA 3KTQA 2KHOA 1ZBSA 3T19A 1WSJA 4I6MB 4JS5A 3CPWM 2DPNA 3L6QA 1YIJN 5FPEA 1XMOK 4IDKA 3KHYA 3NBPA 3ID8A 5I9EB 3MXIA 4Z4GA 1DGKN 2Q0UA 3ASMA 2XY6A 1TK8A 1GLFO 4H5NA 4JI8K 3PX0A 1RGIA 4H5RA 4PKGA 4DTRA 2HF3A 4N76A 3VETA 4JKFA 3WEEA 3RR8A 3LWMA 4C8OA 1NK6A 3KD5E 3BP8A 4AHUA 5BRHA 4UY8O 4CE9A 4H03B 2F9WA 5GIPA 4JD2A 1RBUA 3J7YP 3ZCMA 5HRRA 3NF6A 2O8FA 4NYFA 2WTUA 4BY9C 3TU5A 3GL1A 3U3GA 1LOTB 4M7YA 3A5LC 3QBXA 4DCHA 4R5PA 3AVGA 4K43A 3VA0A 2VGMA 4L8RB 3FFIA 4JKGA 3LZJA 1TYQA 3AVHA 3MN6A 3ZT1A 4NO7A 2P9PB 1TGOA 4CCHA 3QESA 1VSEA 2X78A 4JKGB 3U3YA 3CG7A 3ZT3A 1HKCA 4YOTA 4H0PA 2Q31A 3SV3A 4LFBK 2IDOA 5EY4A 1NK5A 4BRKA 3TARA 1OVQA 1S6PA 4NB4A 3O4QA 4FLTA 1U47A 1KRPA 2D0BA 4F3OA 1KVBA 1NJXA 3D2EA 5BPMA 1OH6A 5AZIA 3TTFA 3C65A 3ID6A 4LF5K 4Y0WA 4CJTA 3DLKA 4LFCK 4FLZA 1MU2A 2KKZA 2ITMA 4LSLA 3VEOA 4XH1A 5E26A 2HHQA 4DQ8A 4PL7A 4FK2A 4J2AA 2XY8A 1X9JA 4LF9K 3JS6A 3MEGA 4JI1K 2P9NB 3EZWA 2A42A 4ISGA 1ATNA 1KLMA 4J2DA 1P90A 5M1NA 4LF7K 5LL6Z 2I7PA 5M1KA 4B9MA 1S5JA 1I3AA 1NM1A 3WXLA 5KRSA 3IFRA 4PKHA 2GUPA 3FR0A 4QOZB 2J4RA 4IWVA 5AR0A 3JYTA 4DWIA 4CJLA 1SKWA 3DI6A 2D0PA 1TYQB 2HBJA 2DY4A 1TAQA 3U9ZA 3DXMA 2JGUA 4OLBA 3LDNA 3WNEA 2HNZA 1IKYA 1VQ6N 5AQYA 2C1IA 4JK8A 4ICLA 5KRTA 3VQ4A 4FO0A 4BC4A 5AQLA 3E9PA 4JV5K 1VSFA 1VRUA 3CFPA 1K73O 5HRNA 3VQ8A 1RILA 1Z26A 2JWLA 1VSLA 4OKKA 1T3VA 3R6MA 4RG8A 1NGIA 4W5QA 5AQZA 1BU6O 3EN9A 2YHAA 3KZBA 4BE1A 4OO1J 2QK9A 5C2DA 4FVUA 3ZEUB 4MLEA 3M8SA 2HVHA 3AVCA 3MEDA 1XNRK 4W5RA 1YITN 2HBKA 3PO4A 4BE0A 3CCEN 3SBTA 3THYB 2FF6A 3QMLA 1SUQA 4MQ3A 1FXXA 4CECA 3HL8A 3AO3A 2RF2A 3D45A 2JWKA 4CZLA 2FSKA 3VN5A 4E1NA 3TANA 4A2BA 2G8KA 2EWSA 3NVKA 4EZ9A 3FZHA 4OKEA 3CCJN 1HPMA 3O9RA 2P9UA 2VG6A 2O8DB 5AQXA 1RT4A 2A40A 2E1YA 5GAHP 3KKRA 3WUHA 2E2QA 1IBMK 4B3RK 3WQUA 4DV5K 4B1YB 4N5SA 1KAYA 3DLLL 4OPJA 4IXCA 3RMAA 3NF7A 3QERA 4CZKA 5BN8A 3O80A 2YNFA 1WAFA 3P1GA 3H6EA 4E89A 4DF8A 1R59O 3QETA 5GAGP 2RN2A 1TV6A 2WFBA 4DTUA 2Y1IA 4DS4A 3OS2A 4B3OA 4M63C 3HPGA 2G8VA 1JCEA 4BRCA 4H5TA 4AF1A 3LPUA 2VG5A 4CIGA 3NGYA 3H46O 3FFKB 1Q9XA 1U49A 1UAXA 1WLJA 2Z1HA 4CJEA 4F8RA 2D5RA 3OBWA 3T7ZA 5FLXO 3W0LA 3LP0A 4JI0K 4M3TA 2DFEA 1N34K 3K5OA 1QHTA 4JRQA 3H08A 2UXDK 3HP6A 2DFFA 1QE1A 4AHSA 4AM6A 3TAPA 1TKDA 5J1EA 4X64K 5AQWA 2O8BB 1YVUA 3VERA 2E20A 1EXQA 3UB5A 4B3MK 4XIUA 3SYZA 5D3GA 5LMNK 1Q9YA 3Q7BA 4IJAA 3J7ZO 4DR6K 2RPIA 5BN9A 5C15A 1HQEA 3P39A 1BA1A 3HI0A 4DTOA 3QEVA 3SJHA 1BIUA 4DMNA 1LAVA 2UUCK 1JLCA 3HRGA 3WXMB 1ITGA 1RBRA 3KLFA 3K0SA 2PBDA 3PO5A 3K9KA 1TK5A 1QZ5A 3MX5A 2WUSA 3HSCA 4H0VB 5CYMA 4RW8A 3AO2A 3C95A 4DTNA 3RMDA 1NGDA 3E9LA 1E3MA 3MDQA 2V7YA 4YOVA 2RE2A 4CI6A 1SL0A 3ZSXA 2E2PA 3LPTA 3NF9A 5AQPA 4YDUA 3ALYA 1JXEA 2P9LB 4YOUA 3LDOA 2QXFA 3KK7A 1NKCA 2OCEA 4FJHA 4B3SK 2P9IB 4CJUA 3QIOA 2YHYA 3A2FA 3G10A 3IKMA 1IKVA 4CEEA 1EQYA 4CZHA 2QTDA 3E66A 4MDBA 4BGBA 1NGCA 3AO1A 4AILC 3IDHA 2A5XA 1MDUB 1BG3A 3IUCA 1UOCA 4N41A 4G1QA 1HNIA 3K57A 1CXUA 4DR1K 1QQOA 4BG9A 3AVKA 2QA4N 1IBLK 4CBXA 2P9SA 3L2VA 4FLVA 3F73A 1JXBA 1UA0A 2PYLA 3VPZA 3VF4A 3NMUA 1YXQA 2HBMA 3ZT0A 3IAYA 3M8RA 1TUUA 3CYMA 5JICA 3S3NA 3DAWA 4YFUA 1W0HA 4GV9A 4JNEA 3EO3A 3MMVA 4R79A 3G4SN 3KIOA 4FOIA 5AFUA 5J2NA 4CD1A 3V6DA 2C1GA 3NDKA 4WQ4C 3VESA 5EOYA 3TAMA 3VEXA 1Z25A 3DWLA 4DTSA 1RDWX 2OTLN 4ID1A 4BG8A 3ZT4A 5DMRA 4KO0A 4I9LA 3VTHA 1JKHA 2E8AA 3TTCA 3EE9A 5K14A 4WFNL 4DQSA 1W9HA 4KHUA 1HQUA 3MECA 2EX3A 2YCHA 3OYLA 4PHTX 1C0UA 2YHWA 3CM6A 2PFUA 4Y1DA 4CK2A 4X62K 1B9DA 1GLJO 1X1PA 1OH7A 3QDKA 3V9WA 4CD3A 1U6ZA 4IG3A 3RVCA 1FKOA 3AVFA 2VWBA 2O8FB 4F9OA 4DQPA 3NFAA 4IO8A 2W6LA 4DV4K 4DQRA 2A1RA 4LC9B 3MN7A 3G0ZA 3NCIA 2EHGA 1MA9B 4BRLA 3LDPA 5AZJB 4H5VA 4BC3A 3WNHA 3VF6A 1FW6A 3TR8A 3B6PA 2KZMA 4DTXA 4CJ4A 5EU7A 4B1ZA 4CK1A 3V9UA 3CC4N 4FWNA 5KTQA 4A62A 3OYIA 1L3SA 2B6AA 4FWOA 4YOXA 1M1KO 4BRAA 3PX4A 3CJ1A 4KTZA 3OYFA 4BEBA 3OBYA 1S9GA 2FBYA 1DEJA 4B8AB 4BRNA 2FF3B 2QWOA 3KVGA 1HYVA 4V19S 1E4FT 3LL3A 3PUFA 1VQMN 4YOYA 3O1BA 4AHCA 5GINA 5KGXA 4O0IA 5J2PA 3RSEB 4IJNA 3GE1A 4E19A 1RNHA 2QWPA 4JHDB 2P9KB 2JLEA 1Q7YO 3VQAA 1HMVA 5DM7L 5ADXA 3OHRA 3LDLA 1ILYA 3M8PA 2YJEA 1MWMA 1EP4A 2O4GA 1RBTA 3CQXA 4JYAK 1Z6RA 3DXKA 4AH9A 4DV3K 1HJOA 1BQMA 4JD2B 3WNGA 2ZGYA 4I2PA 4I7FA 4GVMA 3MK6A 3AO5A 2Z1GA 3PX6A 4PA1A 1NK0A 2G8UA 2VQEK 3C6UA 2V7ZA 3DYAA 2GELA 3AY9A 3VQPA 4JI3K 1WUAA 4BGAA 4NYNA 4BRQA 2QKBA 2HNYA 2Q1NA 3OY9A 1JLGA 2HMPA 4FM1A 1A5XA 4JK7A 4DF4A 2W40A 1YUWA 2HHHK 1YTAA 1RDCA 3M6GA 5CYQA 2YJFA 3M1FA 3CJBA 5M1FA 1IKWA 4DV6K 2YI1A 4DU1A 5TKYA 1NOYA 5BRFA 5LMUK 1VQLN 4FJ8A 4IOAL 3O9SA 3VOVA 1WSIA 1UWBA 1H1VA 5E84A 1NGHA 2NZTA 3QBWA 2PYJA 4ILGB 3HO1A 4B08A 2GBZA 4FJ9A 4IFEA 5AZIB 3CCSN 3L2WA 5AQGA 4JN4A 3OW2M 4KH4A 4CJ7A 3VQ5A 1N5YA 4KREA 1A5VA 3QNOA 2GEMA 3CFOA 4O44A 2GWKA 4RW7A 5KQDA 3P38A 3ENOA 1HKGA 4ID5A 3P31A 3ZSOA 5BPLA 3VQ7A 1RDBA 3IRXA 3L0QA 5KPRA 4B9UA 3CCMN 4CBWA 3DLGA 4ELTA 4CESA 1JL1A 4JI6K 3KJVA 1GLEG 4CZFA 4BVPA 1T6DA 3VGLA 2I7NA 4BQLA 4FCYA 3SUPA 1LWFA 3VEZA 2DTUA 1GLLO 4EAHD 1QQNA 4E0DA 1JLAA 1ASWA 3VQ6A 1VRTA 3U6FA 3OYKA 4WQ5A 4NCBA 2P5OA 1RTHA 1FKPA 2VWKA 4CIFA 4NXMK 1G15A 2HSTA 2UXBK 4FZYA 4CERA 4H0TB 3WXJA 3QEWA 4K0KK 2FBXA 1TUYA 4M3ZA 3JAMO 5IT9O 1WBBA 2QEXN 2XRIA 4JI5K 3DLEA 1NKBA 3JXUA 3RMBA 4ZTJA 4EIAA 4E1MA 4DSEA 3S3MA 3TTDA 2XHBA 1QS4A 4X65K 3NHGA 4LSNA 4Q5VA 3QEPA 4B9NA 3PIOL 2ETJA 4Q0BA 2W6KA 4B1XB 4DU4A 2HHIA 3AA5X 1KD1O 3L4QA 4CJRA 4CFDA 2GX9A 4CFBA 1ZXOA 4GKJK 1DT9A 2E6LA 2VYPA 1VSMA 3N4PA 4QS8A 1RT3A 4DV2K 4CJKA 3THXA 3C6TA 4O8KA 4KHNA 1OH5A 1JL2A 2HHWA 4YY3K 4IOXA 2E5LK 4DKWA 4DTJA 4EHUA 5H1SQ 1D9DA 4EP5A 1TKZA 2NUBA 3OJSA 4E72A 2OPPA 3O3HA 3T1HK 4E3SA 3FZLA 4Z4IA 3FZFA 5C2FA 2X6SA 4CHQA 3QEXA 3MXMA 3SAGA 3CF5L 1RT2A 3VA3A 1SAZA 4F2SA 3DRPA 3WXIA 1W2BM 3MCAB 3WXKA 2ATQA 4PKIA 4MLHA 2BUPA 2CGKA 2E4LA 3VQ9A 3ITHA 1HYSA 2O8CA 1TAUA 2NNWA 2YX6A 1T05A 3SMPA 2X74A 2FLOA 1X3MA 4H8KA 4I9QA 2BGGA 4FJLA 1C1BA 1ATSA 4IBNA 4HHTA 1SS6A 4FJGA 3WNFA 3UIQA 1IH7A 4CJSA 4FPBA 4BDYA 4DFKA 2A6AA 3SUQA 3K58A 4U7BA 4KHSA 4BRIA 2OPSA 4FWPA 1BGXT 3LANA 3ULEA 1OVYA 3ZX2A 2E6MA 4NCAA 4AM7A 1NMDA 1IBKK 3VEVA 1TL1A 1UA1A 3GDQA 3MX2A 1NGBA 2FC0A 4E1JA 4M3YA 3DMJA 3PV8A 1W97L 1HPZA 1VQ4N 4FVMA 5FRNA 4LH4A 4CEQA 4NXNK 3FE1A 4EP4A 3BEXA 1T44A 3O9QA 1NWKA 1VQ8N 1KSPA 3O08A 3SUOA 2IVNA 4CZJA 3HM9A 4PY5A 2VG7A 3SCXA 3KKSA 2ZM6K 4KKOA 5EVZA 5F1XA 4J2EA 3H3OB 4BQZA 5B8HA 4CJ3A 5CZ1A 1YF5L 5AQTA 3OYHA 4BR0A 1C6VA 3QLHA 3VQEA 4DSKA 1NJWA 3LDSA 4CGJA 4JI2K 5LJWA 4NLBA 2QKKA 4BR7A 2Z1JA 3HPOA 1Q18A 3KWGA 3KK3A 2OPQA 2ZD1A 3AO4A 4C23A 2HBLA 2G8HA 4HTUA 4H5WA 4BC2A 4KHQA 4HVJA 3MWPA 4BDZA 3IS9A 3O5BA 1D5AA 2P1JA 4DSFA 1X9SA 2BANA 4GV6A 3F5TA 2NRRA 3PIPL 3S5TA 3CIPA 3BZCA 2QWRA 2HHXA 1B92A 1KC8O 5AQVA 1DTQA 2CH5A 4B8CA 3I8DA 3BDPA 1ZC6A 1XHZA 2KTQA 4CJVA 1WBDA 3CQ8A 3FZKA 3CXCM 2QWNA 3TAQA 2G8FA 4QAGA 1G99A 3ZETA 3I0RA 5M1OA 1NG9A 2QWQA 4XH5A 3SJJA 4CF2A 4E7LA 3CQYA 2Q3SA 3OA9A 3THWB 1TVRA 1KAZA 3ZX3A 3HK2A 3V9ZA 1TK0A 3AVNA 2HF4A 4CGGA 4CGDA 3NGIA 1L3VA 1C0GA 2YNGA 4C1NK 4B1WB 1BIZA 3DLBA 1BI4A 4FLYA 3SPYA 1HR0K 4CJPA 1N8RO 3OYNA 1VAZA 3LAMA 1XMQK 3MEEA 5FPMA 5BPNA 3C0BA 1GLDG 4FW2A 3J8AA 4KHWA 1U2VB 3UKUB 4FOEA 3DM2A 2I5JA 5C25A 3AVBA 2V52B 2HHVA 1YI2N 1TL3A 1BISA 4LF6K 3EE8A 4M3RA 4DV0K 1ATRA 2VCPA 4NCGA 4JKEA 3JSMA 4LY7A 5KI6A 4IEEA 1VSKA 4MDAA 1XUPO 4M41A 3HTVA 3EYZA 3KK2A 5AFUH 2ASMA 3VF2A 3P5JA 3R9PA 1NK4A 2QWMA 3HOSA 4MO4A 3I33A 1RT6A 3PLAA 4H4OA 4Z0UA 4B3TK 4M42A 3OS1A 3HJFA 4JKDA 4KB1A 3QIPA 4BE7B 1J54A 4CZEA 4ILJA 4CGFA 3D7EO 3V9SA 1KQSM 4WCEL 4WFAL 4CJFA 3ZLJA 4H0XB 4I2QA 4Z4CA 1QSSA 5DM6L 3SZ2A 3AVMA 3SNNA 4KTWA 3EEQA 4OGCA 1J5OA 1LWEA 2P9PA 2E2OA 4CHOA 3UKUA 1NJIO 2FXUA 4Z4EA 2D0CA 2O8BA 5AQNA 4KTQA 4GMJB 4JKHA 5JLFA 4HWIA 1V4SA 1VQ5N 3V9XA 1KCFA 4CZIA 3SLCA 1YAGA 5AQHA 4BREA 4Z4HA 2O8EB 4DUZK 1QZ6A 3TI0A 2YNIA 3QICA 4K41A 4MFBA 4C8NA 4CK3A 4A5AA 4E7JA 3HYFA 3DRSA 3TAFA 1F21A 4OVLA 2GV9A 3UKRA 4DB3A 1Z05A 3O9UA 2W42A 3K59A 2IC3A 5CE3A 1SV5A 2YV0X 4PWDA 4CW7B 1T03A 1GOBA 4KFBA 4JRPA 1N36K 3CHWA 3THYA 4BRFA 3C7NA 4KHYA 4U67L 2NRWA 3HZ6A 2ZJRL 5GADP 1KVCA 1C1AA 1JCGA 3V1OA 5M1QA 3OTOK 2D1KA 2D0AA 1WB9A 2KLAA 4FK4A 1FK9A 1NMNA 4ELVA 4J2BA 1KFDA 4CEOA 1TKXA 4IFVA 3CMEN 2OA8A 3J81O 4HUEA 4FJKA 1NLVA 4IO9L 1NJYA 1X9MA 2QXLA 3EZ5A 4FYDA 2QM1A 2Q36A 3TABA 3H1QA 4HCCA 4DQIA 2HMIA 4F2RA 4JK9A 1CZAN 3O6WA 1QHAA 3GBTA 4E7KA 2O8EA 2KW4A 4DV1K 1BWFO 3SAHA 3VGKA 4FJXA 4CHNA 5AZJA 3MCPA 4WFBL 1I39A 4QCLA 5HLFA 3TWHA 1GLAG 2QW9A 3E9OA 4KHPK 3OYAA 4BR9A 3HPHA 4CGHA 2IVOA 3DLHA 1LV5A 3MWTA 3NH2A 2Q97A 2P9UB 3MN5A 4DFMA 3I0SA 3AA2A 4DFJA 2KFNA 3H1VX 2NLXA 3THWA 1EX4A 4C8LA 3NH0A 4MO5A 3GOIA 1XC9A 4A59A 1JLBA 5FPDA 1OH8A 2NRZA 5KGWA 4YORA 1SL1A 4BR2A 4KH5A 3AVIA 3CCRN 1D8YA 4RW9A 1MWKA 1ZYQA 4KH6A 3OYDA 4O5BA 4ISEA 1CXQA 3BUZB 5HROA 5I3UA 3O3GA 4JKBA 4JHDA 5BR9A 3AVAA 2IOCA 3VQCA 4LD0A 3K5NA 3U8XA 3ZETB 3NF8A 4C1NI 3KLIA 1S6QA 3Q7CA 3NE6A 3PSIA 4ELUA 3BGRA 3AAPA 4W5TA 2PZSA 2FSJA 3AV9A 3MXJA 4DR4K 2UXCK 2D0OA 4GVEA 4OGEA 3SMSA 2G8WA 3TSUA 3RWUA 3A5MC 1HNZK 3D2FA 1T6CA 1HNVA 3SPZA 1YHQN 2P9LA 2HHUA 4FPAA 1Y97A 2FSNA 3U9DA 3RRHA 4K8ZA 4CEBA 5AQOA 1LW0A 5EXWA 3RR7A 4DV7K 1VQON 5JS1A 1HKBA 2P9IA 4FZZA 3SQ1A 2HVIA 4Z4FA 4GNIA 1C0TA 4WF9L 2R7YA 3TAGA 5AQUA 1O1WA 4KRFA 3ZT2A 1JLQA 4Z94A 1VQPN 2W41A 4E7HA 3K5LA 4BRDA 5MLCQ 3VQBA 4C8MA 3OYBA 4WQ4A 3SV4A 4KPYA 3LM9A 4BACA 3SI6A 5FRMA 5BRDA 4YHHK 4A5BA 3NAEA 5M1PA 4K8XA 4LF8K 2F7TA 4UQGA 2AA4A 3ZSZA 3OJUA 2UUBK 3G71N 5JS2A 3CJCA 1YJ9N 1N6QA 3A0IX 1Q82O 4AHTA 3LP2A 5J2MA 1QVFM 2YNHA 1S22A 3RTVA 4BDPA 3F9KA 2F4VK 5CHIA 4HUGA 2E88A 5T7BA 3VMFB 4DTMA 3V1QA 4JI4K 2HOEA 4RCHA 3ULDA 5LY3A 4KV8A 4DFPA 1YTUA 1WOQA 4DLEA 3LP3A 3L3UA 1VSJA 3I56N 2HW3A 3AGKA 4RW6A 5SWMA 5E41A 3ZSQA 3T3FA 3TSPA 4LH5A 1T8EA 1W7AA 1YJWN 2GWJA
chains in the Genus database with same CATH topology
2P9IB 2YHYA 1RDUA 5EVZA 5F1XA 3M5RA 5JVGL 3IKMA 3H3OB 4BVOA 4BQZA 3CCQN 1EQYA 1BUPA 2IVPA 5B8HA 3MN9A 4H0OA 2CGLA 3CCVN 1GLCG 4CZHA 2OTJN 1YF5L 1LCUA 5AQTA 1DKGD 2YHXA 5LJVA 2QTDA 3E66A 4MDBA 3W3DA 1NGCA 4BGBA 4BR0A 3IDHA 2A5XA 1MDUB 2E1ZA 2H3GX 1QQMA 5HOOA 1BG3A 1NGJA 1E4GT 3IUCA 4O5FA 1BA0A 5KPTA 1QQOA 1QVGM 4BG9A 2E2NA 4JKCA 2QA4N 4GY2B 3D6RA 3EKSA 5LJWA 4CBXA 2P9SA 4NLBA 4RTFD 4BR7A 2QI2A 3VPZA 3VF4A 2UYTA 4I6MA 3B8AX 5JLHA 3NMUA 1Q18A 1YXQA 2HBMA 3KWGA 4ISFA 3CC2N 3WEEB 5AQSA 4C23A 1TUUA 3ZYYX 5JICA 2HBLA 3DAWA 3I55N 4GV9A 4H5WA 4BC2A 4JNEA 3MWPA 3EO3A 3MMVA 3O5BA 4R79A 3G4SN 1K9MO 4K42A 4FOIA 5AFUA 5GIOA 4CD1A 2C1GA 1S72N 2IIRA 4HTLA 4NLCA 4WQ4C 3F5TA 3VESA 5EOYA 2NRRA 4GV6A 3PIPL 1VQ7N 3VEXA 3CIPA 4QS7A 3DWLA 2ASOA 3VTIA 1RDWX 2QWRA 2V51B 4BG8A 2OTLN 3SBGA 1GLBG 1KC8O 3L4IA 3ATVA 5CR4A 3VTHA 5AQVA 3SK3A 2CH5A 2E8AA 2ZGZA 3TTCA 3EE9A 1NBWA 2NRXA 4BRHA 2ZJQL 5JVHL 1BDGA 1BO5O 1ZC6A 2CH6A 2F9TA 5ADXH 3SAFA 4WFNL 4H0YB 3FZKA 3CXCM 2OANA 2QWNA 1YJNN 2YCHA 1G99A 3ZETA 4B9QA 4PHTX 5M1OA 2QWQA 3CETA 3HBTA 4XH5A 2YHWA 3CD6N 1VQKN 2BTFA 1NGEA 2PFUA 3I8BA 4EFHA 5GAEP 3IMXA 3U4LA 3CQYA 4BR4A 1VQNN 3N4QA 4M7XA 3OA9A 2KHOA 5AQFA 1ZBSA 1KAZA 1GLJO 4I6MB 3ZX3A 1IG8A 3QDKA 4CD3A 3CPWM 2HF4A 1U6ZA 2DPNA 3L6QA 1YIJN 4BECA 3RVCA 5FPEA 5C10A 2VWBA 1C0GA 1NGFA 3KHYA 3VENA 4C1NK 4F9OA 5HL7L 4B1WB 3ID8A 4BROA 5I9EB 1DGKN 2Q0UA 4IZ9A 1V4TA 3ZEUA 4IO8A 1N8RO 1GLFO 3KWIA 1VAZA 4H5NA 4ILHA 3TSQA 4LC9B 1RGIA 3MN7A 4H5RA 3VGMA 1MA9B 5FPMA 3LDPA 4PKGA 3C0BA 4BRLA 5AZJB 2HF3A 1GLDG 5BPNA 3VETA 3J8AA 4JKFA 3WEEA 4H5VA 1U2VB 4CBUA 4FWQA 4BC3A 3E1YA 3UKUB 4FOEA 2WBNA 3VF6A 2ZJRL 5FPNA 3BP8A 3QFPA 5BRHA 4IOCL 4UY8O 2V52B 4B1ZA 4H03B 5F2RA 1YI2N 2F9WA 2A41A 4IEIA 3CC4N 5GIPA 3EE8A 3BF1A 4FWNA 4JD2A 4A61A 4BRGA 4A62A 4B1VA 1ATRA 2VCPA 4FWOA 4YOXA 4JKEA 1M1KO 4BRAA 4IEEA 2Q2RA 3CJ1A 3CJ7A 4K25A 1KAXA 4MDAA 1XUPO 4BEBA 3HTVA 5AQRA 4BY9C 3OBYA 5AFUH 3TU5A 2ASMA 1P8ZA 3VF2A 3GL1A 3R9PA 1EO1A 1LOTB 1DEJA 4M7YA 2QWMA 3A5LC 4BRNA 2FF3B 2QWOA 3QBXA 3I33A 4FWRA 4MO4A 4DCHA 3KVGA 3HOSA 3HOTA 4CZMA 1E4FT 3LL3A 1VQMN 4YOYA 3PLAA 3O1BA 4K43A 3LM2A 2VGMA 2A3ZA 5GINA 2ZF5O 4JKGA 4JKDA 4IJNA 3RSEB 3GE1A 3D2EB 1TYQA 4WYBA 4BE7B 2QWPA 4BR5A 4JHDB 4CZEA 2P9KB 4ILJA 3MN6A 5AQMA 3D7EO 5KPZA 1Q7YO 1KQSM 4NO7A 4WCEL 4WFAL 2P9PB 5DM7L 3CCUN 1J6ZA 5ADXA 1YVNA 3OHRA 4H0XB 3LDLA 1ILYA 4WQ5C 4JKGB 3RSEA 5F0XA 2YJEA 5DM6L 1MWMA 3AAQA 1HKCA 4YOTA 4H0PA 2Q31A 3CQXA 1Z6RA 5EY4A 3DXKA 2P9PA 2E2OA 3UKUA 4BRKA 1NJIO 2FXUA 5AQQA 4NB4A 5AQNA 1HJOA 4JD2B 4JKHA 4IDHA 5JLFA 4HWIA 1V4SA 2ZGYA 3D2EA 1Q81O 2GTDA 3R8EA 3AARA 5BPMA 1VQ5N 3CC7N 5AZIA 3MK6A 3TTFA 1ESVA 4CZIA 3C65A 3SLCA 1VQ9N 1YAGA 3ID6A 5AQJA 5AQHA 2NRTA 4BREA 4Y0WA 3EKUA 2V7ZA 1QZ6A 3G25A 2GELA 3D2FB 3GG4A 2ASPA 2KKZA 3AY9A 1WUAA 4BGAA 4OPAA 3QICA 4K41A 2ZWHA 2ITMA 3VEOA 4BC5A 5KQ8A 4BRQA 4XH1A 5E26A 4A5AA 4DQ8A 3K9JA 4PL7A 2Q1NA 4G9ZA 1X9JA 2HMPA 3JS6A 1NGGA 1IJJA 1JCFA 3UKRA 4FL9A 4DB3A 1Z05A 3O9UA 4JK7A 3EL2A 3A5NC 1K8AO 2W40A 3FGUA 2P9NB 5CE3A 1YUWA 3EZWA 4GV3A 2A42A 4ISGA 3M6GA 1ATNA 2YJFA 1P90A 3CJBA 3M1FA 5M1FA 5M1NA 3O1WA 3BF3A 2I7PA 5M1KA 2YI1A 4XH4A 5TKYA 1NM1A 3WXLA 5BRFA 2PAVA 3CHWA 1VQLN 4FWMA 4QS9A 4IOAL 3O9SA 4BRFA 3VOVA 3C7NA 3VEYA 3IFRA 4PKHA 2GUPA 3FR0A 4CZGA 2J4RA 2NRWA 3HZ6A 1H1VA 4IWVA 5E84A 5AR0A 4U67L 5GADP 2ZJPL 1NGHA 2NZTA 3DXKB 1JCGA 3QBWA 4ILGB 2D0PA 1TYQB 5M1QA 3CJAA 4IFEA 2HBJA 2D1KA 5AZIB 2BH1A 3CCSN 2P9KA 2KLAA 3U9ZA 3DXMA 5AQGA 4JN4A 3OW2M 3LDNA 2CGJA 4KH4A 1HX1A 4CJ7A 2RHKA 2QWLA 1VQ6N 3CMEN 5AQYA 4O8UA 2GEMA 2C1IA 2GWKA 4JK8A 5KQDA 3P38A 4FO0A 3ENOA 5AQLA 3E9PA 1HKGA 3T69A 4BC4A 3P31A 1K73O 1NLVA 5BPLA 3H45C 4IO9L 5JMVA 2QXLA 2QM1A 2JWLA 2Q36A 3UE5A 1T3VA 3H1QA 3L0QA 3R6MA 5AQKA 5KPRA 1NGIA 3CCMN 5AQZA 3C7NB 4CBWA 1BU6O 4L3QA 3EN9A 3KZBA 2D4WA 1M90O 1KXPA 3DXMB 4OO1J 5C2DA 4JK9A 1CZAN 4FVUA 3O6WA 1QHAA 3CPEA 3GBTA 3F2KA 1GLEG 4CZFA 4BVPA 1T6DA 3ZEUB 3VGLA 2I7NA 4BQLA 4MLEA 1BWFO 3O8MA 3VEZA 3CJ9A 1GLLO 4EAHD 1QQNA 3SAHA 1YITN 3VGKA 2HBKA 5AZJA 3MCPA 3CCEN 1C0FA 4WQ5A 3SBTA 4WFBL 2FF6A 3QMLA 4B1UB 1GLAG 2QW9A 4YOWA 1X3NA 3E9OA 3NVMA 3LDQA 5BREA 4BR9A 2P9SB 2IVOA 3MWTA 2NRVA 2P9UB 2AP1A 2Q97A 3F9MA 3MN5A 2HSTA 2JWKA 4CZLA 2WC9A 2FSKA 4H0TB 1BOTO 4A2BA 3WXJA 3H1VX 2NLXA 2EWSA 3NVKA 1TUYA 2Q0RA 3QFUA 4MO5A 3FZHA 3GOIA 2QEXN 3CCJN 1O13A 1HPMA 3O9RA 5AQIA 2P9UA 4A59A 3JXUA 5FPDA 1XC3A 2NRZA 1Q86O 4EIAA 4YORA 3TTDA 4JKAA 4BR2A 4KH5A 3CCRN 4PL8A 5AQXA 1MWKA 2A40A 2E1YA 5GAHP 3PIOL 3WUHA 4KH6A 2E2QA 3WQUA 3P4IA 4B1YB 4B1XB 4ISEA 1KAYA 3DLLL 1KD1O 3L4QA 4IXCA 3BUZB 2GX9A 1ZXOA 1DT9A 4JKBA 4JHDA 4CZKA 2VYPA 5BN8A 5BR9A 3FZMA 3O80A 3N4PA 4QS8A 1K8KB 3H6EA 3U8XA 1R59O 4O8KA 5GAGP 3ZETB 3G6EN 3WT0A 2WFBA 4IOXA 4C1NI 1D4XA 3ZX0A 3O4WA 3Q7CA 3S41A 4DKWA 4EHTA 4XEIA 4EHUA 5H1SQ 1XQSC 3AAPA 2FSJA 3AGRA 4M63C 1JCEA 4BRCA 4H5TA 2D0OA 4GVEA 4J8FA 3SMSA 1SZ2A 4AF1A 3TSUA 3A5MC 3QB0A 3D2FA 3H46O 1T6CA 3FZLA 3FFKB 3FZFA 3HM8A 5C2FA 1YHQN 2P9LA 3DJCA 3SAGA 4FPAA 3U9DA 2FSNA 3CF5L 1SAZA 5AQOA 1HUXA 5EXWA 3WXIA 1W2BM 1VQON 3MCAB 2NRHA 1HKBA 2P9IA 3OBWA 3WXKA 3T7ZA 4DHYA 3W0LA 4YDUC 4FSVA 4PKIA 1JJ2M 4MLHA 4GNIA 2BUPA 2CGKA 4WF9L 4OPHA 5AQUA 3UKRB 4Z94A 1VQPN 2NNWA 2W41A 2YX6A 3SMPA 4AM6A 4A57A 3R3LA 4BRDA 2FLOA 3A8YA 1X3MA 5AQWA 5MLCQ 4XJXA 3WQTA 1RFQA 3H3NO 3TPQA 3VERA 4WQ4A 4BRPA 5C0YA 2E20A 3UB5A 1HLUA 3VEWA 3LM9A 4RWTA 1ATSA 5BRDA 3A5OC 4JEPA 4JAXA 1SS6A 4A5BA 5M1PA 4BRMA 5C12A 3Q7BA 4IJAA 3J7ZO 2F7TA 3FLCO 2AA4A 5BN9A 5C15A 4FPBA 3G71N 3C6AA 3O9TA 3P39A 3CJCA 4FWSA 1BA1A 2A6AA 3HI0A 5ELZA 3R1XA 5EX5A 1YJ9N 3SJHA 3A0IX 1Q82O 4U7BA 4BRIA 1S3XA 4FWPA 3ULEA 1QVFM 4KBOA 1OVYA 1K8KA 1S22A 3HRGA 3WXMB 3ZX2A 4AM7A 5CHIA 1NMDA 2E88A 2PBDA 3VEVA 3ULEB 3K9KA 3VMFB 1QZ5A 3MX5A 3ATUA 2WUSA 2HOEA 3GDQA 3HSCA 3MX2A 4RCHA 5LY3A 4H0VB 1NGBA 4E1JA 1SQKA 1NGDA 3E9LA 3CERA 3CMAN 1W97L 1WOQA 2V7YA 3MDQA 4FWKA 4YOVA 1VQ4N 2RE2A 4CI6A 3I56N 3FE1A 3C6HA 3AGKA 3BEXA 4FWLA 3ENBA 1T44A 2E2PA 1U2VA 2W00A 3O9QA 1NWKA 5AQPA 1VQ8N 4YDUA 4A2AA 2P9NA 2P9LB 3TSPA 1OKJA 4YOUA 3LDOA 3O08A 3ENHA 2IVNA 3KK7A 1YJWN 5TKWA 2VGNA 3CI5A 4CZJA 2GWJA 1NGAA 3M3ZA 1Y64A 3CCLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9I B;  2YHY A;  5EVZ A;  5F1X A;  3H3O B;  4BVO A;  4BQZ A;  1EQY A;  1BUP A;  2IVP A;  5B8H A;  3MN9 A;  4H0O A;  2CGL A;  1GLC G;  4CZH A;  1LCU A;  5AQT A;  1DKG D;  2YHX A;  5LJV A;  3W3D A;  4BGB A;  1NGC A;  4BR0 A;  3IDH A;  2A5X A;  1MDU B;  2E1Z A;  2H3G X;  1QQM A;  1BG3 A;  1NGJ A;  1E4G T;  3IUC A;  4O5F A;  1BA0 A;  5KPT A;  1QQO A;  4BG9 A;  2E2N A;  4GY2 B;  3EKS A;  5LJW A;  4CBX A;  2P9S A;  4RTF D;  4BR7 A;  3VPZ A;  3VF4 A;  2UYT A;  4I6M A;  3B8A X;  5JLH A;  1Q18 A;  1YXQ A;  4ISF A;  3WEE B;  5AQS A;  4C23 A;  1TUU A;  5JIC A;  3DAW A;  4H5W A;  4BC2 A;  4JNE A;  3EO3 A;  3MMV A;  3O5B A;  4K42 A;  4FOI A;  5AFU A;  4CD1 A;  2IIR A;  4HTL A;  4WQ4 C;  3VES A;  5EOY A;  3VEX A;  3CIP A;  4QS7 A;  3DWL A;  2ASO A;  1RDW X;  2QWR A;  2V51 B;  4BG8 A;  1GLB G;  3L4I A;  3ATV A;  5AQV A;  3SK3 A;  2CH5 A;  2E8A A;  2ZGZ A;  4BRH A;  1NBW A;  1BDG A;  1BO5 O;  1ZC6 A;  2CH6 A;  2F9T A;  5ADX H;  4H0Y B;  3FZK A;  2OAN A;  2QWN A;  2YCH A;  1G99 A;  3ZET A;  4B9Q A;  2QWQ A;  3HBT A;  3CET A;  4XH5 A;  2YHW A;  2BTF A;  1NGE A;  3I8B A;  4EFH A;  3IMX A;  3U4L A;  3CQY A;  4BR4 A;  4M7X A;  2KHO A;  5AQF A;  1ZBS A;  1KAZ A;  1GLJ O;  4I6M B;  3ZX3 A;  1IG8 A;  3QDK A;  4CD3 A;  2HF4 A;  1U6Z A;  2DPN A;  3L6Q A;  5FPE A;  2VWB A;  1C0G A;  1NGF A;  3KHY A;  3VEN A;  4F9O A;  4B1W B;  3ID8 A;  4BRO A;  5I9E B;  1DGK N;  2Q0U A;  4IZ9 A;  1V4T A;  3ZEU A;  4IO8 A;  1GLF O;  4H5N A;  4LC9 B;  1RGI A;  3MN7 A;  4H5R A;  3VGM A;  1MA9 B;  5FPM A;  3LDP A;  4PKG A;  3C0B A;  4BRL A;  5AZJ B;  2HF3 A;  1GLD G;  5BPN A;  3VET A;  3J8A A;  3WEE A;  4CBU A;  4H5V A;  1U2V B;  4FWQ A;  4BC3 A;  3UKU B;  4FOE A;  3VF6 A;  5FPN A;  3BP8 A;  3QFP A;  5BRH A;  2V52 B;  4B1Z A;  4H03 B;  5F2R A;  2F9W A;  2A41 A;  3BF1 A;  4FWN A;  4JD2 A;  4A61 A;  4BRG A;  4A62 A;  4B1V A;  1ATR A;  2VCP A;  4FWO A;  4BRA A;  2Q2R A;  3CJ1 A;  3CJ7 A;  4K25 A;  1KAX A;  1XUP O;  3HTV A;  5AQR A;  5AFU H;  3TU5 A;  2ASM A;  1P8Z A;  3VF2 A;  3GL1 A;  3R9P A;  1LOT B;  1DEJ A;  4M7Y A;  2QWM A;  3A5L C;  4BRN A;  2FF3 B;  2QWO A;  3QBX A;  3I33 A;  4FWR A;  4MO4 A;  4DCH A;  3KVG A;  4CZM A;  1E4F T;  3LL3 A;  3O1B A;  4K43 A;  3LM2 A;  2A3Z A;  2ZF5 O;  3RSE B;  4IJN A;  3GE1 A;  3D2E B;  1TYQ A;  4WYB A;  2QWP A;  4BR5 A;  4JHD B;  4CZE A;  2P9K B;  3MN6 A;  5AQM A;  3D7E O;  5KPZ A;  4NO7 A;  2P9P B;  1J6Z A;  5ADX A;  1YVN A;  3OHR A;  4H0X B;  3LDL A;  4WQ5 C;  3RSE A;  5F0X A;  2YJE A;  1MWM A;  3AAQ A;  1HKC A;  4H0P A;  2Q31 A;  3CQX A;  1Z6R A;  5EY4 A;  3DXK A;  2P9P A;  2E2O A;  3UKU A;  4BRK A;  2FXU A;  5AQQ A;  4NB4 A;  5AQN A;  1HJO A;  4JD2 B;  5JLF A;  4HWI A;  1V4S A;  2ZGY A;  3D2E A;  2GTD A;  3R8E A;  3AAR A;  5BPM A;  5AZI A;  3MK6 A;  4CZI A;  1ESV A;  3SLC A;  1YAG A;  5AQJ A;  5AQH A;  4BRE A;  4Y0W A;  3EKU A;  2V7Z A;  1QZ6 A;  3G25 A;  2GEL A;  3D2F B;  3GG4 A;  2ASP A;  3AY9 A;  1WUA A;  4BGA A;  3QIC A;  4K41 A;  2ZWH A;  2ITM A;  3VEO A;  4BC5 A;  5KQ8 A;  4BRQ A;  4XH1 A;  5E26 A;  4DQ8 A;  4PL7 A;  2Q1N A;  1X9J A;  2HMP A;  3JS6 A;  1NGG A;  1IJJ A;  1JCF A;  3UKR A;  4FL9 A;  4DB3 A;  1Z05 A;  3EL2 A;  3A5N C;  2W40 A;  3FGU A;  2P9N B;  5CE3 A;  1YUW A;  3EZW A;  2A42 A;  4ISG A;  3M6G A;  1ATN A;  2YJF A;  3M1F A;  3CJB A;  3O1W A;  3BF3 A;  2I7P A;  2YI1 A;  4XH4 A;  5TKY A;  1NM1 A;  3WXL A;  5BRF A;  2PAV A;  3CHW A;  4FWM A;  4QS9 A;  4BRF A;  3VOV A;  3C7N A;  3VEY A;  3IFR A;  4PKH A;  2GUP A;  3FR0 A;  4CZG A;  2J4R A;  3HZ6 A;  1H1V A;  4IWV A;  5E84 A;  5AR0 A;  1NGH A;  2NZT A;  3DXK B;  1JCG A;  3QBW A;  2D0P A;  1TYQ B;  3CJA A;  2D1K A;  5AZI B;  2P9K A;  3U9Z A;  3DXM A;  5AQG A;  4JN4 A;  3LDN A;  2CGJ A;  1HX1 A;  4CJ7 A;  2QWL A;  5AQY A;  2GEM A;  2GWK A;  5KQD A;  4FO0 A;  3ENO A;  5AQL A;  4BC4 A;  1HKG A;  1NLV A;  5BPL A;  3H45 C;  5JMV A;  2QXL A;  2QM1 A;  2Q36 A;  3UE5 A;  3L0Q A;  3H1Q A;  3R6M A;  5AQK A;  5KPR A;  1NGI A;  5AQZ A;  3C7N B;  4CBW A;  1BU6 O;  4L3Q A;  3EN9 A;  3KZB A;  2D4W A;  1KXP A;  3DXM B;  1CZA N;  3O6W A;  1QHA A;  3GBT A;  1GLE G;  4CZF A;  4BVP A;  1T6D A;  3ZEU B;  3VGL A;  2I7N A;  4BQL A;  4MLE A;  1BWF O;  3O8M A;  3VEZ A;  3CJ9 A;  1GLL O;  4EAH D;  1QQN A;  3VGK A;  5AZJ A;  3MCP A;  1C0F A;  4WQ5 A;  2FF6 A;  3QML A;  4B1U B;  1GLA G;  2QW9 A;  1X3N A;  3LDQ A;  5BRE A;  4BR9 A;  2P9S B;  2IVO A;  2Q97 A;  2P9U B;  2AP1 A;  3MN5 A;  3F9M A;  4CZL A;  2FSK A;  4H0T B;  1BOT O;  4A2B A;  3WXJ A;  3H1V X;  2NLX A;  2EWS A;  1TUY A;  2Q0R A;  3QFU A;  4MO5 A;  3FZH A;  3GOI A;  1HPM A;  5AQI A;  2P9U A;  3JXU A;  5FPD A;  1XC3 A;  4EIA A;  4BR2 A;  4PL8 A;  5AQX A;  1MWK A;  2A40 A;  2E1Y A;  3WUH A;  2E2Q A;  3WQU A;  3P4I A;  4B1Y B;  4B1X B;  4ISE A;  1KAY A;  4IXC A;  3BUZ B;  1ZXO A;  4JHD A;  4CZK A;  5BN8 A;  2VYP A;  5BR9 A;  3FZM A;  3O80 A;  4QS8 A;  1K8K B;  3H6E A;  3U8X A;  1R59 O;  4O8K A;  3ZET B;  3WT0 A;  1D4X A;  3ZX0 A;  3O4W A;  3S41 A;  4EHT A;  4XEI A;  4EHU A;  1XQS C;  3AAP A;  2FSJ A;  4M63 C;  1JCE A;  4BRC A;  4H5T A;  2D0O A;  4J8F A;  3SMS A;  1SZ2 A;  3A5M C;  3QB0 A;  3D2F A;  3H46 O;  1T6C A;  3FZL A;  3FFK B;  3FZF A;  3HM8 A;  2P9L A;  3DJC A;  4FPA A;  3U9D A;  2FSN A;  1SAZ A;  5AQO A;  1HUX A;  5EXW A;  3WXI A;  2NRH A;  1HKB A;  2P9I A;  3WXK A;  4DHY A;  3W0L A;  4YDU C;  4FSV A;  4PKI A;  4MLH A;  4GNI A;  2BUP A;  2CGK A;  5AQU A;  3UKR B;  4Z94 A;  2W41 A;  3SMP A;  4AM6 A;  4BRD A;  2FLO A;  3A8Y A;  1X3M A;  5AQW A;  3WQT A;  1RFQ A;  3H3N O;  3TPQ A;  3VER A;  4WQ4 A;  4BRP A;  2E20 A;  3UB5 A;  1HLU A;  3VEW A;  3LM9 A;  4RWT A;  1ATS A;  5BRD A;  3A5O C;  4JAX A;  4BRM A;  4IJA A;  3FLC O;  2AA4 A;  5BN9 A;  4FPB A;  5ELZ A;  4FWS A;  3CJC A;  5EX5 A;  1BA1 A;  2A6A A;  3HI0 A;  3SJH A;  3A0I X;  4BRI A;  1S3X A;  4FWP A;  3ULE A;  4KBO A;  1S22 A;  1K8K A;  3ZX2 A;  4AM7 A;  1NMD A;  2E88 A;  2PBD A;  3VEV A;  3ULE B;  1QZ5 A;  3ATU A;  2WUS A;  2HOE A;  3GDQ A;  3HSC A;  4RCH A;  5LY3 A;  4H0V B;  1NGB A;  4E1J A;  1SQK A;  1NGD A;  3CER A;  1WOQ A;  2V7Y A;  3MDQ A;  4FWK A;  4CI6 A;  3FE1 A;  4FWL A;  3BEX A;  1T44 A;  2E2P A;  1U2V A;  1NWK A;  5AQP A;  4YDU A;  4A2A A;  2P9N A;  2P9L B;  1OKJ A;  3LDO A;  3O08 A;  3ENH A;  2IVN A;  4CZJ A;  3CI5 A;  2GWJ A;  1NGA A;  3M3Z A;  1Y64 A; 
#chains in the Genus database with same CATH topology
 1BI4 B;  2KQ2 A;  3HVR A;  3L2U A;  4JS4 A;  4PQU A;  4CF0 A;  3CCQ N;  4BVO A;  2IVP A;  1RTI A;  3C94 A;  4Y1C A;  3CCV N;  1GLC G;  1LCU A;  5LJV A;  3W3D A;  4FM2 A;  2H3G X;  1QQM A;  5HOO A;  1REV A;  4CJW A;  1WSG A;  1QVG M;  2E2N A;  4JKC A;  1U45 A;  4GY2 B;  3D6R A;  3EKS A;  4CF1 A;  1SKR A;  4RTF D;  3AA4 A;  1S1U A;  5JLH A;  3KLG A;  4ISF A;  3CC2 N;  5FDL A;  4YNQ A;  3PY8 A;  1RTD A;  2G8I A;  4DR2 K;  4CFA A;  4OLA A;  1R0A A;  1S1V A;  3SUN A;  4W5O A;  5C42 A;  3K2P A;  4B9T A;  4CEF A;  4K42 A;  4W5N A;  5HRS A;  4TSX A;  3CYG A;  1NOZ A;  1WAJ A;  4HTL A;  4E7I A;  3THX B;  4KI4 A;  3HXM A;  2AJQ A;  3V1R A;  1GOC A;  2FBV A;  3OYC A;  3L2R A;  1EWR A;  1GLB G;  3L4I A;  3ATV A;  5CR4 A;  3LP1 A;  3OVN A;  3DOL A;  2ZGZ A;  4BRH A;  1NBW A;  1ASU A;  4FZX C;  2F96 A;  1BO5 O;  2CH6 A;  2F9T A;  3SAF A;  2HB5 A;  3QIN A;  3QEI A;  5HBM A;  1YJN N;  1X9W A;  3J7A P;  4CGI A;  4M3X A;  4B9Q A;  4AHR A;  3HBT A;  4DQQ A;  2BTF A;  1N32 K;  5GAE P;  3IMX A;  4BR4 A;  1NNE A;  3N4Q A;  3V81 A;  5AQF A;  4HCB A;  4CF9 A;  1BL3 A;  4LF4 K;  1IG8 A;  4EZ6 A;  1FJG K;  4BEC A;  4WE1 A;  4OJR A;  3QNN A;  5C10 A;  1NGF A;  3VEN A;  3CFR A;  3AVJ A;  5DK5 A;  5HL7 L;  4BRO A;  4IZ9 A;  1V4T A;  5I42 A;  3ZEU A;  1XHX A;  3ZSR A;  3KWI A;  1CLQ A;  4ILH A;  3TSQ A;  1QSY A;  3LWL A;  3VGM A;  4PUO A;  1VSH A;  4DSJ A;  4CBU A;  4FWQ A;  3E1Y A;  4FK0 A;  2WBN A;  5FPN A;  3ZSY A;  1XI1 A;  4FW1 A;  3QFP A;  4IOC L;  4AQY K;  2LSN A;  5F2R A;  3O3F A;  4FLX A;  2A41 A;  4IEI A;  3BF1 A;  4O4G A;  4A61 A;  4BRG A;  4B9L A;  2KFZ A;  4B1V A;  2Q2R A;  5HP1 A;  3CJ7 A;  2P51 A;  3O4N A;  4K25 A;  1KAX A;  3P83 D;  4RW4 A;  2ZQB A;  5AQR A;  4H4M A;  4FJM A;  1P8Z A;  2HHT A;  1EO1 A;  1IV0 A;  3AVL A;  5A2Q O;  2GUI A;  1WSH A;  4FWR A;  3HOT A;  5CY4 A;  4CZM A;  4KAZ A;  3LM2 A;  1KLN A;  2A3Z A;  2ZF5 O;  3HST B;  2Z1I A;  1LAW A;  3D2E B;  4WYB A;  4BR5 A;  1I94 K;  5AQM A;  2YKN A;  4OKJ A;  5KPZ A;  4DR3 K;  2XY7 A;  3CCU N;  1J6Z A;  1U48 A;  4B9S A;  2O4I A;  1YVN A;  4BWM A;  4WQ5 C;  3RSE A;  1QQC A;  5F0X A;  3OS0 A;  4DUY K;  2X6N A;  3AAQ A;  4CIE A;  2KZZ A;  1Q8I A;  3T1A A;  1ZBH A;  3LZI A;  5AQQ A;  4IDH A;  2BE2 A;  4CFC A;  1RT1 A;  1Q81 O;  2Y1J A;  2GTD A;  3R8E A;  3AAR A;  3CC7 N;  1VQ9 N;  1ESV A;  1RBS A;  5AQJ A;  2NRT A;  3KLE A;  3EKU A;  4FJJ A;  3G25 A;  4N47 A;  3D2F B;  3GG4 A;  2ASP A;  1J53 A;  4OPA A;  2ZWH A;  4BC5 A;  5KQ8 A;  2B5J A;  1A5W A;  3VQQ A;  5BR8 K;  3K9J A;  1HNW K;  4G9Z A;  1S1T A;  4M3W A;  1NGG A;  1IJJ A;  1JCF A;  4FL9 A;  1S9E A;  3EL2 A;  5IWA K;  3A5N C;  1K8A O;  3FGU A;  4GV3 A;  3V4I A;  4ZHR A;  4IFY A;  2HHS A;  5HRP A;  3O1W A;  3BF3 A;  5J2Q A;  4C8K A;  4XH4 A;  1CZ9 A;  2PAV A;  4FWM A;  2FBT A;  4QS9 A;  4JLH A;  4O0J A;  4DTP A;  4DG1 A;  3VEY A;  4CZG A;  1B9F A;  2ZJP L;  3DXK B;  2A1S A;  3M8Q A;  1VSD A;  3CJA A;  1L3T A;  2BH1 A;  2P9K A;  1S1W A;  2CGJ A;  4DS5 A;  1ZBU A;  1HX1 A;  3S3O A;  2RHK A;  2QWL A;  4O8U A;  3OYJ A;  1K6Y A;  5JEN A;  2PY5 A;  2P5G A;  3T69 A;  3HP9 A;  1HNX K;  3H45 C;  5JMV A;  2HND A;  4FXD A;  3UE5 A;  4AHV A;  5AQK A;  1SL2 A;  3C7N B;  3DLR A;  4L3Q A;  3KLH A;  3RMC A;  2D4W A;  1M90 O;  1KXP A;  1RDA A;  3DXM B;  4CHP A;  5C24 A;  3CPE A;  3F2K A;  3O8M A;  3CJ9 A;  1TKT A;  1ZBI A;  3LAK A;  4CVN E;  4ZTF A;  1ASV A;  3S9H A;  1C0F A;  1HRH A;  3J80 O;  1DLO A;  4CJQ A;  4B1U B;  1BQN A;  4YOW A;  1X3N A;  1EET A;  3NVM A;  3LDQ A;  5BRE A;  3OYE A;  2P9S B;  1L5U A;  3B6O A;  2NRV A;  2AP1 A;  3F9M A;  1XNQ K;  4B9V A;  2WC9 A;  1BOT O;  1J5E K;  4M3U A;  4IG0 A;  4IKF A;  3NGZ A;  1NK8 A;  3D0P A;  3QO9 A;  2Q0R A;  3QFU A;  3NH1 A;  4KB0 A;  1O13 A;  5AQI A;  1XC3 A;  4DU3 A;  1Q86 O;  1GOA A;  1KFS A;  1IG9 A;  4JKA A;  4BWJ A;  1JLF A;  3TAE A;  4PL8 A;  2OPR A;  1C0M A;  1WSF A;  1DTT A;  3VQD A;  4FJN A;  3P4I A;  4DLG A;  1D9F A;  3KK1 A;  1WN7 A;  1RBV A;  1CZB A;  2XO7 A;  4DSL A;  1BCO A;  3FZM A;  1K8K B;  2IGI A;  4CJ5 A;  1U04 A;  1RTJ A;  2UUA K;  3HT3 A;  1LW2 A;  3G6E N;  3WT0 A;  2VWJ A;  1EWQ A;  2IS3 A;  1D4X A;  3ZX0 A;  3O4W A;  3S41 A;  3KD1 E;  4EHT A;  4XEI A;  4CF8 A;  1EKE A;  1XQS C;  4FM0 A;  2OYQ A;  4O55 A;  4CED A;  3AGR A;  2O8D A;  4LFA K;  4J8F A;  1SZ2 A;  1RT7 A;  4FLW A;  3QB0 A;  4GKK K;  1L3U A;  3K5M A;  2ITG A;  3HM8 A;  2IAJ A;  3DJC A;  1WSE A;  3THV A;  1HUX A;  3LAL A;  3IG1 A;  3SQ2 A;  2NRH A;  3RRG A;  2F8S A;  4DHY A;  1YT3 A;  4YDU C;  4FSV A;  1BCM A;  1JJ2 M;  4OPK A;  1S1X A;  2UU9 K;  4OPH A;  4F4K A;  4DR7 K;  1XWL A;  3UKR B;  3ISN C;  4CHY A;  3E01 A;  4A57 A;  3R3L A;  1RT5 A;  4DSI A;  3A8Y A;  4XJX A;  1T7P A;  3WQT A;  1KTQ A;  2WOM A;  3OYM A;  1RFQ A;  3HVT A;  3H3N O;  3TPQ A;  4BRP A;  5C0Y A;  1NK9 A;  1HLU A;  3VEW A;  3BY5 A;  4RWT A;  1NKE A;  2OZS A;  3A5O C;  4JEP A;  3MAQ A;  4JAX A;  4BRM A;  5C12 A;  3SQ0 A;  3FLC O;  1NU0 A;  3C6A A;  3O9T A;  4FWS A;  5ELZ A;  5EX5 A;  3R1X A;  1S3X A;  4KBO A;  1K8K A;  1QSL A;  3DOK A;  5CZ2 A;  3ULE B;  2YHB A;  4N56 A;  3ATU A;  3BZK A;  4M45 A;  2ZE2 A;  5AJ3 K;  1JLE A;  1SQK A;  1NJZ A;  5FRO A;  3CER A;  3CMA N;  1NK7 A;  1U4B A;  1WNS A;  4HUF A;  4FWK A;  3CM5 A;  1KVA A;  3C6H A;  4FWL A;  3ENB A;  4DR5 K;  1U2V A;  2W00 A;  1VK0 A;  4A2A A;  2P9N A;  1OKJ A;  4FJI A;  3ENH A;  5TKW A;  2VGN A;  3CI5 A;  3M3Z A;  1NGA A;  2YKM A;  1Y64 A;  3CCL N;  2RKI A;  1RDU A;  3M5R A;  5JVG L;  1BUP A;  3ZSW A;  3MN9 A;  4H0O A;  2CGL A;  2OTJ N;  3PSF A;  1DKG D;  2YHX A;  4JI7 K;  3AA3 A;  2E1Z A;  1NGJ A;  1IO2 A;  1E4G T;  2DFH A;  4O5F A;  1BA0 A;  5KPT A;  4F3T A;  1J9A A;  1HYZ A;  3T1Y K;  1RDD A;  2QI2 A;  4FLU A;  1QTM A;  2UYT A;  4I6M A;  3B8A X;  3L3V A;  3WEE B;  3L8B A;  5AQS A;  3ZYY X;  2WON A;  1RCH A;  1VSI A;  1ZBF A;  3I55 N;  2B4J A;  4CHZ A;  1LWC A;  4X66 K;  2XY5 A;  1K9M O;  3SQ4 A;  4CEZ A;  1SKS A;  4CEA A;  5GIO A;  4KI6 A;  1VHX A;  4FJ7 A;  1S72 N;  2IIR A;  4NLC A;  4BE2 A;  1VQ7 N;  1ZBL A;  4OX9 K;  4QS7 A;  2ASO A;  3VTI A;  2V51 B;  4FJ5 A;  3SBG A;  4GW6 A;  5SZT A;  3SK3 A;  3EY1 A;  2NRX A;  5JVH L;  2ZJQ L;  1IKX A;  1BDG A;  1HJR A;  3OYG A;  5ADX H;  3L2Q A;  4H0Y B;  1BHL A;  2OZM A;  2OAN A;  3DRR A;  1C1C A;  2F8T A;  2VQF K;  1N33 K;  2O8C B;  2BDP A;  3CET A;  3CD6 N;  1VQK N;  1NGE A;  3I8B A;  4EFH A;  3U4L A;  1VQN N;  3ZSV A;  4M7X A;  3KTQ A;  2KHO A;  1ZBS A;  3T19 A;  1WSJ A;  4I6M B;  4JS5 A;  3CPW M;  2DPN A;  3L6Q A;  1YIJ N;  5FPE A;  1XMO K;  4IDK A;  3KHY A;  3NBP A;  3ID8 A;  5I9E B;  3MXI A;  4Z4G A;  1DGK N;  2Q0U A;  3ASM A;  2XY6 A;  1TK8 A;  1GLF O;  4H5N A;  4JI8 K;  3PX0 A;  1RGI A;  4H5R A;  4PKG A;  4DTR A;  2HF3 A;  4N76 A;  3VET A;  4JKF A;  3WEE A;  3RR8 A;  3LWM A;  4C8O A;  1NK6 A;  3KD5 E;  3BP8 A;  4AHU A;  5BRH A;  4UY8 O;  4CE9 A;  4H03 B;  2F9W A;  5GIP A;  4JD2 A;  1RBU A;  3J7Y P;  3ZCM A;  5HRR A;  3NF6 A;  2O8F A;  4NYF A;  2WTU A;  4BY9 C;  3TU5 A;  3GL1 A;  3U3G A;  1LOT B;  4M7Y A;  3A5L C;  3QBX A;  4DCH A;  4R5P A;  3AVG A;  4K43 A;  3VA0 A;  2VGM A;  4L8R B;  3FFI A;  4JKG A;  3LZJ A;  1TYQ A;  3AVH A;  3MN6 A;  3ZT1 A;  4NO7 A;  2P9P B;  1TGO A;  4CCH A;  3QES A;  1VSE A;  2X78 A;  4JKG B;  3U3Y A;  3CG7 A;  3ZT3 A;  1HKC A;  4YOT A;  4H0P A;  2Q31 A;  3SV3 A;  4LFB K;  2IDO A;  5EY4 A;  1NK5 A;  4BRK A;  3TAR A;  1OVQ A;  1S6P A;  4NB4 A;  3O4Q A;  4FLT A;  1U47 A;  1KRP A;  2D0B A;  4F3O A;  1KVB A;  1NJX A;  3D2E A;  5BPM A;  1OH6 A;  5AZI A;  3TTF A;  3C65 A;  3ID6 A;  4LF5 K;  4Y0W A;  4CJT A;  3DLK A;  4LFC K;  4FLZ A;  1MU2 A;  2KKZ A;  2ITM A;  4LSL A;  3VEO A;  4XH1 A;  5E26 A;  2HHQ A;  4DQ8 A;  4PL7 A;  4FK2 A;  4J2A A;  2XY8 A;  1X9J A;  4LF9 K;  3JS6 A;  3MEG A;  4JI1 K;  2P9N B;  3EZW A;  2A42 A;  4ISG A;  1ATN A;  1KLM A;  4J2D A;  1P90 A;  5M1N A;  4LF7 K;  5LL6 Z;  2I7P A;  5M1K A;  4B9M A;  1S5J A;  1I3A A;  1NM1 A;  3WXL A;  5KRS A;  3IFR A;  4PKH A;  2GUP A;  3FR0 A;  4QOZ B;  2J4R A;  4IWV A;  5AR0 A;  3JYT A;  4DWI A;  4CJL A;  1SKW A;  3DI6 A;  2D0P A;  1TYQ B;  2HBJ A;  2DY4 A;  1TAQ A;  3U9Z A;  3DXM A;  2JGU A;  4OLB A;  3LDN A;  3WNE A;  2HNZ A;  1IKY A;  1VQ6 N;  5AQY A;  2C1I A;  4JK8 A;  4ICL A;  5KRT A;  3VQ4 A;  4FO0 A;  4BC4 A;  5AQL A;  3E9P A;  4JV5 K;  1VSF A;  1VRU A;  3CFP A;  1K73 O;  5HRN A;  3VQ8 A;  1RIL A;  1Z26 A;  2JWL A;  1VSL A;  4OKK A;  1T3V A;  3R6M A;  4RG8 A;  1NGI A;  4W5Q A;  5AQZ A;  1BU6 O;  3EN9 A;  2YHA A;  3KZB A;  4BE1 A;  4OO1 J;  2QK9 A;  5C2D A;  4FVU A;  3ZEU B;  4MLE A;  3M8S A;  2HVH A;  3AVC A;  3MED A;  1XNR K;  4W5R A;  1YIT N;  2HBK A;  3PO4 A;  4BE0 A;  3CCE N;  3SBT A;  3THY B;  2FF6 A;  3QML A;  1SUQ A;  4MQ3 A;  1FXX A;  4CEC A;  3HL8 A;  3AO3 A;  2RF2 A;  3D45 A;  2JWK A;  4CZL A;  2FSK A;  3VN5 A;  4E1N A;  3TAN A;  4A2B A;  2G8K A;  2EWS A;  3NVK A;  4EZ9 A;  3FZH A;  4OKE A;  3CCJ N;  1HPM A;  3O9R A;  2P9U A;  2VG6 A;  2O8D B;  5AQX A;  1RT4 A;  2A40 A;  2E1Y A;  5GAH P;  3KKR A;  3WUH A;  2E2Q A;  1IBM K;  4B3R K;  3WQU A;  4DV5 K;  4B1Y B;  4N5S A;  1KAY A;  3DLL L;  4OPJ A;  4IXC A;  3RMA A;  3NF7 A;  3QER A;  4CZK A;  5BN8 A;  3O80 A;  2YNF A;  1WAF A;  3P1G A;  3H6E A;  4E89 A;  4DF8 A;  1R59 O;  3QET A;  5GAG P;  2RN2 A;  1TV6 A;  2WFB A;  4DTU A;  2Y1I A;  4DS4 A;  3OS2 A;  4B3O A;  4M63 C;  3HPG A;  2G8V A;  1JCE A;  4BRC A;  4H5T A;  4AF1 A;  3LPU A;  2VG5 A;  4CIG A;  3NGY A;  3H46 O;  3FFK B;  1Q9X A;  1U49 A;  1UAX A;  1WLJ A;  2Z1H A;  4CJE A;  4F8R A;  2D5R A;  3OBW A;  3T7Z A;  5FLX O;  3W0L A;  3LP0 A;  4JI0 K;  4M3T A;  2DFE A;  1N34 K;  3K5O A;  1QHT A;  4JRQ A;  3H08 A;  2UXD K;  3HP6 A;  2DFF A;  1QE1 A;  4AHS A;  4AM6 A;  3TAP A;  1TKD A;  5J1E A;  4X64 K;  5AQW A;  2O8B B;  1YVU A;  3VER A;  2E20 A;  1EXQ A;  3UB5 A;  4B3M K;  4XIU A;  3SYZ A;  5D3G A;  5LMN K;  1Q9Y A;  3Q7B A;  4IJA A;  3J7Z O;  4DR6 K;  2RPI A;  5BN9 A;  5C15 A;  1HQE A;  3P39 A;  1BA1 A;  3HI0 A;  4DTO A;  3QEV A;  3SJH A;  1BIU A;  4DMN A;  1LAV A;  2UUC K;  1JLC A;  3HRG A;  3WXM B;  1ITG A;  1RBR A;  3KLF A;  3K0S A;  2PBD A;  3PO5 A;  3K9K A;  1TK5 A;  1QZ5 A;  3MX5 A;  2WUS A;  3HSC A;  4H0V B;  5CYM A;  4RW8 A;  3AO2 A;  3C95 A;  4DTN A;  3RMD A;  1NGD A;  3E9L A;  1E3M A;  3MDQ A;  2V7Y A;  4YOV A;  2RE2 A;  4CI6 A;  1SL0 A;  3ZSX A;  2E2P A;  3LPT A;  3NF9 A;  5AQP A;  4YDU A;  3ALY A;  1JXE A;  2P9L B;  4YOU A;  3LDO A;  2QXF A;  3KK7 A;  1NKC A;  2OCE A;  4FJH A;  4B3S K;  2P9I B;  4CJU A;  3QIO A;  2YHY A;  3A2F A;  3G10 A;  3IKM A;  1IKV A;  4CEE A;  1EQY A;  4CZH A;  2QTD A;  3E66 A;  4MDB A;  4BGB A;  1NGC A;  3AO1 A;  4AIL C;  3IDH A;  2A5X A;  1MDU B;  1BG3 A;  3IUC A;  1UOC A;  4N41 A;  4G1Q A;  1HNI A;  3K57 A;  1CXU A;  4DR1 K;  1QQO A;  4BG9 A;  3AVK A;  2QA4 N;  1IBL K;  4CBX A;  2P9S A;  3L2V A;  4FLV A;  3F73 A;  1JXB A;  1UA0 A;  2PYL A;  3VPZ A;  3VF4 A;  3NMU A;  1YXQ A;  2HBM A;  3ZT0 A;  3IAY A;  3M8R A;  1TUU A;  3CYM A;  5JIC A;  3S3N A;  3DAW A;  4YFU A;  1W0H A;  4GV9 A;  4JNE A;  3EO3 A;  3MMV A;  4R79 A;  3G4S N;  3KIO A;  4FOI A;  5AFU A;  5J2N A;  4CD1 A;  3V6D A;  2C1G A;  3NDK A;  4WQ4 C;  3VES A;  5EOY A;  3TAM A;  3VEX A;  1Z25 A;  3DWL A;  4DTS A;  1RDW X;  2OTL N;  4ID1 A;  4BG8 A;  3ZT4 A;  5DMR A;  4KO0 A;  4I9L A;  3VTH A;  1JKH A;  2E8A A;  3TTC A;  3EE9 A;  5K14 A;  4WFN L;  4DQS A;  1W9H A;  4KHU A;  1HQU A;  3MEC A;  2EX3 A;  2YCH A;  3OYL A;  4PHT X;  1C0U A;  2YHW A;  3CM6 A;  2PFU A;  4Y1D A;  4CK2 A;  4X62 K;  1B9D A;  1GLJ O;  1X1P A;  1OH7 A;  3QDK A;  3V9W A;  4CD3 A;  1U6Z A;  4IG3 A;  3RVC A;  1FKO A;  3AVF A;  2VWB A;  2O8F B;  4F9O A;  4DQP A;  3NFA A;  4IO8 A;  2W6L A;  4DV4 K;  4DQR A;  2A1R A;  4LC9 B;  3MN7 A;  3G0Z A;  3NCI A;  2EHG A;  1MA9 B;  4BRL A;  3LDP A;  5AZJ B;  4H5V A;  4BC3 A;  3WNH A;  3VF6 A;  1FW6 A;  3TR8 A;  3B6P A;  2KZM A;  4DTX A;  4CJ4 A;  5EU7 A;  4B1Z A;  4CK1 A;  3V9U A;  3CC4 N;  4FWN A;  5KTQ A;  4A62 A;  3OYI A;  1L3S A;  2B6A A;  4FWO A;  4YOX A;  1M1K O;  4BRA A;  3PX4 A;  3CJ1 A;  4KTZ A;  3OYF A;  4BEB A;  3OBY A;  1S9G A;  2FBY A;  1DEJ A;  4B8A B;  4BRN A;  2FF3 B;  2QWO A;  3KVG A;  1HYV A;  4V19 S;  1E4F T;  3LL3 A;  3PUF A;  1VQM N;  4YOY A;  3O1B A;  4AHC A;  5GIN A;  5KGX A;  4O0I A;  5J2P A;  3RSE B;  4IJN A;  3GE1 A;  4E19 A;  1RNH A;  2QWP A;  4JHD B;  2P9K B;  2JLE A;  1Q7Y O;  3VQA A;  1HMV A;  5DM7 L;  5ADX A;  3OHR A;  3LDL A;  1ILY A;  3M8P A;  2YJE A;  1MWM A;  1EP4 A;  2O4G A;  1RBT A;  3CQX A;  4JYA K;  1Z6R A;  3DXK A;  4AH9 A;  4DV3 K;  1HJO A;  1BQM A;  4JD2 B;  3WNG A;  2ZGY A;  4I2P A;  4I7F A;  4GVM A;  3MK6 A;  3AO5 A;  2Z1G A;  3PX6 A;  4PA1 A;  1NK0 A;  2G8U A;  2VQE K;  3C6U A;  2V7Z A;  3DYA A;  2GEL A;  3AY9 A;  3VQP A;  4JI3 K;  1WUA A;  4BGA A;  4NYN A;  4BRQ A;  2QKB A;  2HNY A;  2Q1N A;  3OY9 A;  1JLG A;  2HMP A;  4FM1 A;  1A5X A;  4JK7 A;  4DF4 A;  2W40 A;  1YUW A;  2HHH K;  1YTA A;  1RDC A;  3M6G A;  5CYQ A;  2YJF A;  3M1F A;  3CJB A;  5M1F A;  1IKW A;  4DV6 K;  2YI1 A;  4DU1 A;  5TKY A;  1NOY A;  5BRF A;  5LMU K;  1VQL N;  4FJ8 A;  4IOA L;  3O9S A;  3VOV A;  1WSI A;  1UWB A;  1H1V A;  5E84 A;  1NGH A;  2NZT A;  3QBW A;  2PYJ A;  4ILG B;  3HO1 A;  4B08 A;  2GBZ A;  4FJ9 A;  4IFE A;  5AZI B;  3CCS N;  3L2W A;  5AQG A;  4JN4 A;  3OW2 M;  4KH4 A;  4CJ7 A;  3VQ5 A;  1N5Y A;  4KRE A;  1A5V A;  3QNO A;  2GEM A;  3CFO A;  4O44 A;  2GWK A;  4RW7 A;  5KQD A;  3P38 A;  3ENO A;  1HKG A;  4ID5 A;  3P31 A;  3ZSO A;  5BPL A;  3VQ7 A;  1RDB A;  3IRX A;  3L0Q A;  5KPR A;  4B9U A;  3CCM N;  4CBW A;  3DLG A;  4ELT A;  4CES A;  1JL1 A;  4JI6 K;  3KJV A;  1GLE G;  4CZF A;  4BVP A;  1T6D A;  3VGL A;  2I7N A;  4BQL A;  4FCY A;  3SUP A;  1LWF A;  3VEZ A;  2DTU A;  1GLL O;  4EAH D;  1QQN A;  4E0D A;  1JLA A;  1ASW A;  3VQ6 A;  1VRT A;  3U6F A;  3OYK A;  4WQ5 A;  4NCB A;  2P5O A;  1RTH A;  1FKP A;  2VWK A;  4CIF A;  4NXM K;  1G15 A;  2HST A;  2UXB K;  4FZY A;  4CER A;  4H0T B;  3WXJ A;  3QEW A;  4K0K K;  2FBX A;  1TUY A;  4M3Z A;  3JAM O;  5IT9 O;  1WBB A;  2QEX N;  2XRI A;  4JI5 K;  3DLE A;  1NKB A;  3JXU A;  3RMB A;  4ZTJ A;  4EIA A;  4E1M A;  4DSE A;  3S3M A;  3TTD A;  2XHB A;  1QS4 A;  4X65 K;  3NHG A;  4LSN A;  4Q5V A;  3QEP A;  4B9N A;  3PIO L;  2ETJ A;  4Q0B A;  2W6K A;  4B1X B;  4DU4 A;  2HHI A;  3AA5 X;  1KD1 O;  3L4Q A;  4CJR A;  4CFD A;  2GX9 A;  4CFB A;  1ZXO A;  4GKJ K;  1DT9 A;  2E6L A;  2VYP A;  1VSM A;  3N4P A;  4QS8 A;  1RT3 A;  4DV2 K;  4CJK A;  3THX A;  3C6T A;  4O8K A;  4KHN A;  1OH5 A;  1JL2 A;  2HHW A;  4YY3 K;  4IOX A;  2E5L K;  4DKW A;  4DTJ A;  4EHU A;  5H1S Q;  1D9D A;  4EP5 A;  1TKZ A;  2NUB A;  3OJS A;  4E72 A;  2OPP A;  3O3H A;  3T1H K;  4E3S A;  3FZL A;  4Z4I A;  3FZF A;  5C2F A;  2X6S A;  4CHQ A;  3QEX A;  3MXM A;  3SAG A;  3CF5 L;  1RT2 A;  3VA3 A;  1SAZ A;  4F2S A;  3DRP A;  3WXI A;  1W2B M;  3MCA B;  3WXK A;  2ATQ A;  4PKI A;  4MLH A;  2BUP A;  2CGK A;  2E4L A;  3VQ9 A;  3ITH A;  1HYS A;  2O8C A;  1TAU A;  2NNW A;  2YX6 A;  1T05 A;  3SMP A;  2X74 A;  2FLO A;  1X3M A;  4H8K A;  4I9Q A;  2BGG A;  4FJL A;  1C1B A;  1ATS A;  4IBN A;  4HHT A;  1SS6 A;  4FJG A;  3WNF A;  3UIQ A;  1IH7 A;  4CJS A;  4FPB A;  4BDY A;  4DFK A;  2A6A A;  3SUQ A;  3K58 A;  4U7B A;  4KHS A;  4BRI A;  2OPS A;  4FWP A;  1BGX T;  3LAN A;  3ULE A;  1OVY A;  3ZX2 A;  2E6M A;  4NCA A;  4AM7 A;  1NMD A;  1IBK K;  3VEV A;  1TL1 A;  1UA1 A;  3GDQ A;  3MX2 A;  1NGB A;  2FC0 A;  4E1J A;  4M3Y A;  3DMJ A;  3PV8 A;  1W97 L;  1HPZ A;  1VQ4 N;  4FVM A;  5FRN A;  4LH4 A;  4CEQ A;  4NXN K;  3FE1 A;  4EP4 A;  3BEX A;  1T44 A;  3O9Q A;  1NWK A;  1VQ8 N;  1KSP A;  3O08 A;  3SUO A;  2IVN A;  4CZJ A;  3HM9 A;  4PY5 A;  2VG7 A;  3SCX A;  3KKS A;  2ZM6 K;  4KKO A;  5EVZ A;  5F1X A;  4J2E A;  3H3O B;  4BQZ A;  5B8H A;  4CJ3 A;  5CZ1 A;  1YF5 L;  5AQT A;  3OYH A;  4BR0 A;  1C6V A;  3QLH A;  3VQE A;  4DSK A;  1NJW A;  3LDS A;  4CGJ A;  4JI2 K;  5LJW A;  4NLB A;  2QKK A;  4BR7 A;  2Z1J A;  3HPO A;  1Q18 A;  3KWG A;  3KK3 A;  2OPQ A;  2ZD1 A;  3AO4 A;  4C23 A;  2HBL A;  2G8H A;  4HTU A;  4H5W A;  4BC2 A;  4KHQ A;  4HVJ A;  3MWP A;  4BDZ A;  3IS9 A;  3O5B A;  1D5A A;  2P1J A;  4DSF A;  1X9S A;  2BAN A;  4GV6 A;  3F5T A;  2NRR A;  3PIP L;  3S5T A;  3CIP A;  3BZC A;  2QWR A;  2HHX A;  1B92 A;  1KC8 O;  5AQV A;  1DTQ A;  2CH5 A;  4B8C A;  3I8D A;  3BDP A;  1ZC6 A;  1XHZ A;  2KTQ A;  4CJV A;  1WBD A;  3CQ8 A;  3FZK A;  3CXC M;  2QWN A;  3TAQ A;  2G8F A;  4QAG A;  1G99 A;  3ZET A;  3I0R A;  5M1O A;  1NG9 A;  2QWQ A;  4XH5 A;  3SJJ A;  4CF2 A;  4E7L A;  3CQY A;  2Q3S A;  3OA9 A;  3THW B;  1TVR A;  1KAZ A;  3ZX3 A;  3HK2 A;  3V9Z A;  1TK0 A;  3AVN A;  2HF4 A;  4CGG A;  4CGD A;  3NGI A;  1L3V A;  1C0G A;  2YNG A;  4C1N K;  4B1W B;  1BIZ A;  3DLB A;  1BI4 A;  4FLY A;  3SPY A;  1HR0 K;  4CJP A;  1N8R O;  3OYN A;  1VAZ A;  3LAM A;  1XMQ K;  3MEE A;  5FPM A;  5BPN A;  3C0B A;  1GLD G;  4FW2 A;  3J8A A;  4KHW A;  1U2V B;  3UKU B;  4FOE A;  3DM2 A;  2I5J A;  5C25 A;  3AVB A;  2V52 B;  2HHV A;  1YI2 N;  1TL3 A;  1BIS A;  4LF6 K;  3EE8 A;  4M3R A;  4DV0 K;  1ATR A;  2VCP A;  4NCG A;  4JKE A;  3JSM A;  4LY7 A;  5KI6 A;  4IEE A;  1VSK A;  4MDA A;  1XUP O;  4M41 A;  3HTV A;  3EYZ A;  3KK2 A;  5AFU H;  2ASM A;  3VF2 A;  3P5J A;  3R9P A;  1NK4 A;  2QWM A;  3HOS A;  4MO4 A;  3I33 A;  1RT6 A;  3PLA A;  4H4O A;  4Z0U A;  4B3T K;  4M42 A;  3OS1 A;  3HJF A;  4JKD A;  4KB1 A;  3QIP A;  4BE7 B;  1J54 A;  4CZE A;  4ILJ A;  4CGF A;  3D7E O;  3V9S A;  1KQS M;  4WCE L;  4WFA L;  4CJF A;  3ZLJ A;  4H0X B;  4I2Q A;  4Z4C A;  1QSS A;  5DM6 L;  3SZ2 A;  3AVM A;  3SNN A;  4KTW A;  3EEQ A;  4OGC A;  1J5O A;  1LWE A;  2P9P A;  2E2O A;  4CHO A;  3UKU A;  1NJI O;  2FXU A;  4Z4E A;  2D0C A;  2O8B A;  5AQN A;  4KTQ A;  4GMJ B;  4JKH A;  5JLF A;  4HWI A;  1V4S A;  1VQ5 N;  3V9X A;  1KCF A;  4CZI A;  3SLC A;  1YAG A;  5AQH A;  4BRE A;  4Z4H A;  2O8E B;  4DUZ K;  1QZ6 A;  3TI0 A;  2YNI A;  3QIC A;  4K41 A;  4MFB A;  4C8N A;  4CK3 A;  4A5A A;  4E7J A;  3HYF A;  3DRS A;  3TAF A;  1F21 A;  4OVL A;  2GV9 A;  3UKR A;  4DB3 A;  1Z05 A;  3O9U A;  2W42 A;  3K59 A;  2IC3 A;  5CE3 A;  1SV5 A;  2YV0 X;  4PWD A;  4CW7 B;  1T03 A;  1GOB A;  4KFB A;  4JRP A;  1N36 K;  3CHW A;  3THY A;  4BRF A;  3C7N A;  4KHY A;  4U67 L;  2NRW A;  3HZ6 A;  2ZJR L;  5GAD P;  1KVC A;  1C1A A;  1JCG A;  3V1O A;  5M1Q A;  3OTO K;  2D1K A;  2D0A A;  1WB9 A;  2KLA A;  4FK4 A;  1FK9 A;  1NMN A;  4ELV A;  4J2B A;  1KFD A;  4CEO A;  1TKX A;  4IFV A;  3CME N;  2OA8 A;  3J81 O;  4HUE A;  4FJK A;  1NLV A;  4IO9 L;  1NJY A;  1X9M A;  2QXL A;  3EZ5 A;  4FYD A;  2QM1 A;  2Q36 A;  3TAB A;  3H1Q A;  4HCC A;  4DQI A;  2HMI A;  4F2R A;  4JK9 A;  1CZA N;  3O6W A;  1QHA A;  3GBT A;  4E7K A;  2O8E A;  2KW4 A;  4DV1 K;  1BWF O;  3SAH A;  3VGK A;  4FJX A;  4CHN A;  5AZJ A;  3MCP A;  4WFB L;  1I39 A;  4QCL A;  5HLF A;  3TWH A;  1GLA G;  2QW9 A;  3E9O A;  4KHP K;  3OYA A;  4BR9 A;  3HPH A;  4CGH A;  2IVO A;  3DLH A;  1LV5 A;  3MWT A;  3NH2 A;  2Q97 A;  2P9U B;  3MN5 A;  4DFM A;  3I0S A;  3AA2 A;  4DFJ A;  2KFN A;  3H1V X;  2NLX A;  3THW A;  1EX4 A;  4C8L A;  3NH0 A;  4MO5 A;  3GOI A;  1XC9 A;  4A59 A;  1JLB A;  5FPD A;  1OH8 A;  2NRZ A;  5KGW A;  4YOR A;  1SL1 A;  4BR2 A;  4KH5 A;  3AVI A;  3CCR N;  1D8Y A;  4RW9 A;  1MWK A;  1ZYQ A;  4KH6 A;  3OYD A;  4O5B A;  4ISE A;  1CXQ A;  3BUZ B;  5HRO A;  5I3U A;  3O3G A;  4JKB A;  4JHD A;  5BR9 A;  3AVA A;  2IOC A;  3VQC A;  4LD0 A;  3K5N A;  3U8X A;  3ZET B;  3NF8 A;  4C1N I;  3KLI A;  1S6Q A;  3Q7C A;  3NE6 A;  3PSI A;  4ELU A;  3BGR A;  3AAP A;  4W5T A;  2PZS A;  2FSJ A;  3AV9 A;  3MXJ A;  4DR4 K;  2UXC K;  2D0O A;  4GVE A;  4OGE A;  3SMS A;  2G8W A;  3TSU A;  3RWU A;  3A5M C;  1HNZ K;  3D2F A;  1T6C A;  1HNV A;  3SPZ A;  1YHQ N;  2P9L A;  2HHU A;  4FPA A;  1Y97 A;  2FSN A;  3U9D A;  3RRH A;  4K8Z A;  4CEB A;  5AQO A;  1LW0 A;  5EXW A;  3RR7 A;  4DV7 K;  1VQO N;  5JS1 A;  1HKB A;  2P9I A;  4FZZ A;  3SQ1 A;  2HVI A;  4Z4F A;  4GNI A;  1C0T A;  4WF9 L;  2R7Y A;  3TAG A;  5AQU A;  1O1W A;  4KRF A;  3ZT2 A;  1JLQ A;  4Z94 A;  1VQP N;  2W41 A;  4E7H A;  3K5L A;  4BRD A;  5MLC Q;  3VQB A;  4C8M A;  3OYB A;  4WQ4 A;  3SV4 A;  4KPY A;  3LM9 A;  4BAC A;  3SI6 A;  5FRM A;  5BRD A;  4YHH K;  4A5B A;  3NAE A;  5M1P A;  4K8X A;  4LF8 K;  2F7T A;  4UQG A;  2AA4 A;  3ZSZ A;  3OJU A;  2UUB K;  3G71 N;  5JS2 A;  3CJC A;  1YJ9 N;  1N6Q A;  3A0I X;  1Q82 O;  4AHT A;  3LP2 A;  5J2M A;  1QVF M;  2YNH A;  1S22 A;  3RTV A;  4BDP A;  3F9K A;  2F4V K;  5CHI A;  4HUG A;  2E88 A;  5T7B A;  3VMF B;  4DTM A;  3V1Q A;  4JI4 K;  2HOE A;  4RCH A;  3ULD A;  5LY3 A;  4KV8 A;  4DFP A;  1YTU A;  1WOQ A;  4DLE A;  3LP3 A;  3L3U A;  1VSJ A;  3I56 N;  2HW3 A;  3AGK A;  4RW6 A;  5SWM A;  5E41 A;  3ZSQ A;  3T3F A;  3TSP A;  4LH5 A;  1T8E A;  1W7A A;  1YJW N;  2GWJ A; 
#chains in the Genus database with same CATH homology
 2P9I B;  2YHY A;  1RDU A;  5EVZ A;  5F1X A;  3M5R A;  5JVG L;  3IKM A;  3H3O B;  4BVO A;  4BQZ A;  3CCQ N;  1EQY A;  1BUP A;  2IVP A;  5B8H A;  3MN9 A;  4H0O A;  2CGL A;  3CCV N;  1GLC G;  4CZH A;  2OTJ N;  1YF5 L;  1LCU A;  5AQT A;  1DKG D;  2YHX A;  5LJV A;  2QTD A;  3E66 A;  4MDB A;  3W3D A;  1NGC A;  4BGB A;  4BR0 A;  3IDH A;  2A5X A;  1MDU B;  2E1Z A;  2H3G X;  1QQM A;  5HOO A;  1BG3 A;  1NGJ A;  1E4G T;  3IUC A;  4O5F A;  1BA0 A;  5KPT A;  1QQO A;  1QVG M;  4BG9 A;  2E2N A;  4JKC A;  2QA4 N;  4GY2 B;  3D6R A;  3EKS A;  5LJW A;  4CBX A;  2P9S A;  4NLB A;  4RTF D;  4BR7 A;  2QI2 A;  3VPZ A;  3VF4 A;  2UYT A;  4I6M A;  3B8A X;  5JLH A;  3NMU A;  1Q18 A;  1YXQ A;  2HBM A;  3KWG A;  4ISF A;  3CC2 N;  3WEE B;  5AQS A;  4C23 A;  1TUU A;  3ZYY X;  5JIC A;  2HBL A;  3DAW A;  3I55 N;  4GV9 A;  4H5W A;  4BC2 A;  4JNE A;  3MWP A;  3EO3 A;  3MMV A;  3O5B A;  4R79 A;  3G4S N;  1K9M O;  4K42 A;  4FOI A;  5AFU A;  5GIO A;  4CD1 A;  2C1G A;  1S72 N;  2IIR A;  4HTL A;  4NLC A;  4WQ4 C;  3F5T A;  3VES A;  5EOY A;  2NRR A;  4GV6 A;  3PIP L;  1VQ7 N;  3VEX A;  3CIP A;  4QS7 A;  3DWL A;  2ASO A;  3VTI A;  1RDW X;  2QWR A;  2V51 B;  4BG8 A;  2OTL N;  3SBG A;  1GLB G;  1KC8 O;  3L4I A;  3ATV A;  5CR4 A;  3VTH A;  5AQV A;  3SK3 A;  2CH5 A;  2E8A A;  2ZGZ A;  3TTC A;  3EE9 A;  1NBW A;  2NRX A;  4BRH A;  2ZJQ L;  5JVH L;  1BDG A;  1BO5 O;  1ZC6 A;  2CH6 A;  2F9T A;  5ADX H;  3SAF A;  4WFN L;  4H0Y B;  3FZK A;  3CXC M;  2OAN A;  2QWN A;  1YJN N;  2YCH A;  1G99 A;  3ZET A;  4B9Q A;  4PHT X;  5M1O A;  2QWQ A;  3CET A;  3HBT A;  4XH5 A;  2YHW A;  3CD6 N;  1VQK N;  2BTF A;  1NGE A;  2PFU A;  3I8B A;  4EFH A;  5GAE P;  3IMX A;  3U4L A;  3CQY A;  4BR4 A;  1VQN N;  3N4Q A;  4M7X A;  3OA9 A;  2KHO A;  5AQF A;  1ZBS A;  1KAZ A;  1GLJ O;  4I6M B;  3ZX3 A;  1IG8 A;  3QDK A;  4CD3 A;  3CPW M;  2HF4 A;  1U6Z A;  2DPN A;  3L6Q A;  1YIJ N;  4BEC A;  3RVC A;  5FPE A;  5C10 A;  2VWB A;  1C0G A;  1NGF A;  3KHY A;  3VEN A;  4C1N K;  4F9O A;  5HL7 L;  4B1W B;  3ID8 A;  4BRO A;  5I9E B;  1DGK N;  2Q0U A;  4IZ9 A;  1V4T A;  3ZEU A;  4IO8 A;  1N8R O;  1GLF O;  3KWI A;  1VAZ A;  4H5N A;  4ILH A;  3TSQ A;  4LC9 B;  1RGI A;  3MN7 A;  4H5R A;  3VGM A;  1MA9 B;  5FPM A;  3LDP A;  4PKG A;  3C0B A;  4BRL A;  5AZJ B;  2HF3 A;  1GLD G;  5BPN A;  3VET A;  3J8A A;  4JKF A;  3WEE A;  4H5V A;  1U2V B;  4CBU A;  4FWQ A;  4BC3 A;  3E1Y A;  3UKU B;  4FOE A;  2WBN A;  3VF6 A;  2ZJR L;  5FPN A;  3BP8 A;  3QFP A;  5BRH A;  4IOC L;  4UY8 O;  2V52 B;  4B1Z A;  4H03 B;  5F2R A;  1YI2 N;  2F9W A;  2A41 A;  4IEI A;  3CC4 N;  5GIP A;  3EE8 A;  3BF1 A;  4FWN A;  4JD2 A;  4A61 A;  4BRG A;  4A62 A;  4B1V A;  1ATR A;  2VCP A;  4FWO A;  4YOX A;  4JKE A;  1M1K O;  4BRA A;  4IEE A;  2Q2R A;  3CJ1 A;  3CJ7 A;  4K25 A;  1KAX A;  4MDA A;  1XUP O;  4BEB A;  3HTV A;  5AQR A;  4BY9 C;  3OBY A;  5AFU H;  3TU5 A;  2ASM A;  1P8Z A;  3VF2 A;  3GL1 A;  3R9P A;  1EO1 A;  1LOT B;  1DEJ A;  4M7Y A;  2QWM A;  3A5L C;  4BRN A;  2FF3 B;  2QWO A;  3QBX A;  3I33 A;  4FWR A;  4MO4 A;  4DCH A;  3KVG A;  3HOS A;  3HOT A;  4CZM A;  1E4F T;  3LL3 A;  1VQM N;  4YOY A;  3PLA A;  3O1B A;  4K43 A;  3LM2 A;  2VGM A;  2A3Z A;  5GIN A;  2ZF5 O;  4JKG A;  4JKD A;  4IJN A;  3RSE B;  3GE1 A;  3D2E B;  1TYQ A;  4WYB A;  4BE7 B;  2QWP A;  4BR5 A;  4JHD B;  4CZE A;  2P9K B;  4ILJ A;  3MN6 A;  5AQM A;  3D7E O;  5KPZ A;  1Q7Y O;  1KQS M;  4NO7 A;  4WCE L;  4WFA L;  2P9P B;  5DM7 L;  3CCU N;  1J6Z A;  5ADX A;  1YVN A;  3OHR A;  4H0X B;  3LDL A;  1ILY A;  4WQ5 C;  4JKG B;  3RSE A;  5F0X A;  2YJE A;  5DM6 L;  1MWM A;  3AAQ A;  1HKC A;  4YOT A;  4H0P A;  2Q31 A;  3CQX A;  1Z6R A;  5EY4 A;  3DXK A;  2P9P A;  2E2O A;  3UKU A;  4BRK A;  1NJI O;  2FXU A;  5AQQ A;  4NB4 A;  5AQN A;  1HJO A;  4JD2 B;  4JKH A;  4IDH A;  5JLF A;  4HWI A;  1V4S A;  2ZGY A;  3D2E A;  1Q81 O;  2GTD A;  3R8E A;  3AAR A;  5BPM A;  1VQ5 N;  3CC7 N;  5AZI A;  3MK6 A;  3TTF A;  1ESV A;  4CZI A;  3C65 A;  3SLC A;  1VQ9 N;  1YAG A;  3ID6 A;  5AQJ A;  5AQH A;  2NRT A;  4BRE A;  4Y0W A;  3EKU A;  2V7Z A;  1QZ6 A;  3G25 A;  2GEL A;  3D2F B;  3GG4 A;  2ASP A;  2KKZ A;  3AY9 A;  1WUA A;  4BGA A;  4OPA A;  3QIC A;  4K41 A;  2ZWH A;  2ITM A;  3VEO A;  4BC5 A;  5KQ8 A;  4BRQ A;  4XH1 A;  5E26 A;  4A5A A;  4DQ8 A;  3K9J A;  4PL7 A;  2Q1N A;  4G9Z A;  1X9J A;  2HMP A;  3JS6 A;  1NGG A;  1IJJ A;  1JCF A;  3UKR A;  4FL9 A;  4DB3 A;  1Z05 A;  3O9U A;  4JK7 A;  3EL2 A;  3A5N C;  1K8A O;  2W40 A;  3FGU A;  2P9N B;  5CE3 A;  1YUW A;  3EZW A;  4GV3 A;  2A42 A;  4ISG A;  3M6G A;  1ATN A;  2YJF A;  1P90 A;  3CJB A;  3M1F A;  5M1F A;  5M1N A;  3O1W A;  3BF3 A;  2I7P A;  5M1K A;  2YI1 A;  4XH4 A;  5TKY A;  1NM1 A;  3WXL A;  5BRF A;  2PAV A;  3CHW A;  1VQL N;  4FWM A;  4QS9 A;  4IOA L;  3O9S A;  4BRF A;  3VOV A;  3C7N A;  3VEY A;  3IFR A;  4PKH A;  2GUP A;  3FR0 A;  4CZG A;  2J4R A;  2NRW A;  3HZ6 A;  1H1V A;  4IWV A;  5E84 A;  5AR0 A;  4U67 L;  5GAD P;  2ZJP L;  1NGH A;  2NZT A;  3DXK B;  1JCG A;  3QBW A;  4ILG B;  2D0P A;  1TYQ B;  5M1Q A;  3CJA A;  4IFE A;  2HBJ A;  2D1K A;  5AZI B;  2BH1 A;  3CCS N;  2P9K A;  2KLA A;  3U9Z A;  3DXM A;  5AQG A;  4JN4 A;  3OW2 M;  3LDN A;  2CGJ A;  4KH4 A;  1HX1 A;  4CJ7 A;  2RHK A;  2QWL A;  1VQ6 N;  3CME N;  5AQY A;  4O8U A;  2GEM A;  2C1I A;  2GWK A;  4JK8 A;  5KQD A;  3P38 A;  4FO0 A;  3ENO A;  5AQL A;  3E9P A;  1HKG A;  3T69 A;  4BC4 A;  3P31 A;  1K73 O;  1NLV A;  5BPL A;  3H45 C;  4IO9 L;  5JMV A;  2QXL A;  2QM1 A;  2JWL A;  2Q36 A;  3UE5 A;  1T3V A;  3H1Q A;  3L0Q A;  3R6M A;  5AQK A;  5KPR A;  1NGI A;  3CCM N;  5AQZ A;  3C7N B;  4CBW A;  1BU6 O;  4L3Q A;  3EN9 A;  3KZB A;  2D4W A;  1M90 O;  1KXP A;  3DXM B;  4OO1 J;  5C2D A;  4JK9 A;  1CZA N;  4FVU A;  3O6W A;  1QHA A;  3CPE A;  3GBT A;  3F2K A;  1GLE G;  4CZF A;  4BVP A;  1T6D A;  3ZEU B;  3VGL A;  2I7N A;  4BQL A;  4MLE A;  1BWF O;  3O8M A;  3VEZ A;  3CJ9 A;  1GLL O;  4EAH D;  1QQN A;  3SAH A;  1YIT N;  3VGK A;  2HBK A;  5AZJ A;  3MCP A;  3CCE N;  1C0F A;  4WQ5 A;  3SBT A;  4WFB L;  2FF6 A;  3QML A;  4B1U B;  1GLA G;  2QW9 A;  4YOW A;  1X3N A;  3E9O A;  3NVM A;  3LDQ A;  5BRE A;  4BR9 A;  2P9S B;  2IVO A;  3MWT A;  2NRV A;  2P9U B;  2AP1 A;  2Q97 A;  3F9M A;  3MN5 A;  2HST A;  2JWK A;  4CZL A;  2WC9 A;  2FSK A;  4H0T B;  1BOT O;  4A2B A;  3WXJ A;  3H1V X;  2NLX A;  2EWS A;  3NVK A;  1TUY A;  2Q0R A;  3QFU A;  4MO5 A;  3FZH A;  3GOI A;  2QEX N;  3CCJ N;  1O13 A;  1HPM A;  3O9R A;  5AQI A;  2P9U A;  4A59 A;  3JXU A;  5FPD A;  1XC3 A;  2NRZ A;  1Q86 O;  4EIA A;  4YOR A;  3TTD A;  4JKA A;  4BR2 A;  4KH5 A;  3CCR N;  4PL8 A;  5AQX A;  1MWK A;  2A40 A;  2E1Y A;  5GAH P;  3PIO L;  3WUH A;  4KH6 A;  2E2Q A;  3WQU A;  3P4I A;  4B1Y B;  4B1X B;  4ISE A;  1KAY A;  3DLL L;  1KD1 O;  3L4Q A;  4IXC A;  3BUZ B;  2GX9 A;  1ZXO A;  1DT9 A;  4JKB A;  4JHD A;  4CZK A;  2VYP A;  5BN8 A;  5BR9 A;  3FZM A;  3O80 A;  3N4P A;  4QS8 A;  1K8K B;  3H6E A;  3U8X A;  1R59 O;  4O8K A;  5GAG P;  3ZET B;  3G6E N;  3WT0 A;  2WFB A;  4IOX A;  4C1N I;  1D4X A;  3ZX0 A;  3O4W A;  3Q7C A;  3S41 A;  4DKW A;  4EHT A;  4XEI A;  4EHU A;  5H1S Q;  1XQS C;  3AAP A;  2FSJ A;  3AGR A;  4M63 C;  1JCE A;  4BRC A;  4H5T A;  2D0O A;  4GVE A;  4J8F A;  3SMS A;  1SZ2 A;  4AF1 A;  3TSU A;  3A5M C;  3QB0 A;  3D2F A;  3H46 O;  1T6C A;  3FZL A;  3FFK B;  3FZF A;  3HM8 A;  5C2F A;  1YHQ N;  2P9L A;  3DJC A;  3SAG A;  4FPA A;  3U9D A;  2FSN A;  3CF5 L;  1SAZ A;  5AQO A;  1HUX A;  5EXW A;  3WXI A;  1W2B M;  1VQO N;  3MCA B;  2NRH A;  1HKB A;  2P9I A;  3OBW A;  3WXK A;  3T7Z A;  4DHY A;  3W0L A;  4YDU C;  4FSV A;  4PKI A;  1JJ2 M;  4MLH A;  4GNI A;  2BUP A;  2CGK A;  4WF9 L;  4OPH A;  5AQU A;  3UKR B;  4Z94 A;  1VQP N;  2NNW A;  2W41 A;  2YX6 A;  3SMP A;  4AM6 A;  4A57 A;  3R3L A;  4BRD A;  2FLO A;  3A8Y A;  1X3M A;  5AQW A;  5MLC Q;  4XJX A;  3WQT A;  1RFQ A;  3H3N O;  3TPQ A;  3VER A;  4WQ4 A;  4BRP A;  5C0Y A;  2E20 A;  3UB5 A;  1HLU A;  3VEW A;  3LM9 A;  4RWT A;  1ATS A;  5BRD A;  3A5O C;  4JEP A;  4JAX A;  1SS6 A;  4A5B A;  5M1P A;  4BRM A;  5C12 A;  3Q7B A;  4IJA A;  3J7Z O;  2F7T A;  3FLC O;  2AA4 A;  5BN9 A;  5C15 A;  4FPB A;  3G71 N;  3C6A A;  3O9T A;  3P39 A;  3CJC A;  4FWS A;  1BA1 A;  2A6A A;  3HI0 A;  5ELZ A;  3R1X A;  5EX5 A;  1YJ9 N;  3SJH A;  3A0I X;  1Q82 O;  4U7B A;  4BRI A;  1S3X A;  4FWP A;  3ULE A;  1QVF M;  4KBO A;  1OVY A;  1K8K A;  1S22 A;  3HRG A;  3WXM B;  3ZX2 A;  4AM7 A;  5CHI A;  1NMD A;  2E88 A;  2PBD A;  3VEV A;  3ULE B;  3K9K A;  3VMF B;  1QZ5 A;  3MX5 A;  3ATU A;  2WUS A;  2HOE A;  3GDQ A;  3HSC A;  3MX2 A;  4RCH A;  5LY3 A;  4H0V B;  1NGB A;  4E1J A;  1SQK A;  1NGD A;  3E9L A;  3CER A;  3CMA N;  1W97 L;  1WOQ A;  2V7Y A;  3MDQ A;  4FWK A;  4YOV A;  1VQ4 N;  2RE2 A;  4CI6 A;  3I56 N;  3FE1 A;  3C6H A;  3AGK A;  3BEX A;  4FWL A;  3ENB A;  1T44 A;  2E2P A;  1U2V A;  2W00 A;  3O9Q A;  1NWK A;  5AQP A;  1VQ8 N;  4YDU A;  4A2A A;  2P9N A;  2P9L B;  3TSP A;  1OKJ A;  4YOU A;  3LDO A;  3O08 A;  3ENH A;  2IVN A;  3KK7 A;  1YJW N;  5TKW A;  2VGN A;  3CI5 A;  4CZJ A;  2GWJ A;  1NGA A;  3M3Z A;  1Y64 A;  3CCL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...