3RSEB

Structural and biochemical characterization of two binding sites for nucleation promoting factor wasp-vca on arp2/3 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
196
structure length
196
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 52
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rseB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3rseB02
4BVOA 1MDUB 4FSVA 4H5TA 4QS9A 1TUUA 1T44A 2Q36A 3DAWA 2P9IA 4FWQA 3U9DA 2NZTA 3HSCA 4BRQA 2P9SB 3IUCA 1IJJA 3DWLA 1JCFA 3H3OB 4FOEA 2A40A 4K41A 4E1JA 4BRMA 2FXUA 1NBWA 2P9UB 3UKUB 2HMPA 4CD1A 4YDUA 1YAGA 2NRHA 2VCPA 3GG4A 5AQLA 5EVZA 5F1XA 2P9NB 4EHUA 4H0OA 5KQ8A 3FE1A 5AQOA 3AARA 5FPMA 2VYPA 3CQYA 3IDHA 4CBXA 4BQZA 3D2FB 4CD3A 4H0XB 5AQHA 3RSEA 5AQKA 4B9QA 2FF3B 4BRLA 1YXQA 3HZ6A 1BA0A 4BRHA 3GOIA 2Q0UA 3M3ZA 3VESA 3AAQA 3O1BA 3R6MA 1NGIA 3DJCA 4FL9A 1X3NA 2A6AA 1NGHA 2D0PA 3BF1A 5KQDA 1ZBSA 1C0FA 2FSJA 2V51B 4H0TB 4IWVA 4F9OA 2A42A 4JHDA 5BR9A 4BVPA 4QS8A 2D1KA 1MWMA 2V52B 2QXLA 1TYQB 5ADXA 1U2VB 1KXPA 3W0LA 2QWQA 3QFPA 4RTFD 3FZFA 3HTVA 3KHYA 3VF4A 5BN8A 2A41A 3FZHA 3M1FA 2IVNA 3CETA 3ULEA 4BR2A 4RWTA 1BU6O 4RCHA 3VEYA 4A2AA 2GUPA 3BF3A 2YI1A 1HKBA 5F2RA 4FWKA 4B1YB 3H46O 5BRHA 2QWRA 1K8KA 1QQNA 3UB5A 4BR5A 2P9LA 2YHXA 1QZ6A 5AQYA 3RSEB 2PAVA 4M7YA 5EY4A 4BGAA 5BRFA 3CHWA 3UKRB 1ZXOA 1GLBG 2E2PA 2Q2RA 3J8AA 3JS6A 1ZC6A 2YJFA 3SMSA 3WXKA 3FZKA 4BROA 5AQMA 1RDWX 2E20A 4H03B 3FR0A 3QBWA 2YHWA 1OKJA 3O08A 5EXWA 4WYBA 3LM9A 2P9SA 1DEJA 5JLFA 1HUXA 4H5VA 3VGLA 2YCHA 3LDNA 1U6ZA 5KPZA 2P9UA 4FOIA 3UKUA 2E2QA 3DXKB 5AQRA 2Q97A 3VF6A 3FLCO 5LJVA 5AFUH 1ESVA 1NWKA 2P9PB 5JMVA 1XQSC 4CZLA 4B1XB 4CZMA 3FGUA 4IZ9A 1GLAG 3KZBA 2P9LB 3QDKA 1XUPO 1YUWA 3GL1A 4BREA 4GNIA 5AQGA 5AFUA 1NLVA 3ATUA 3O5BA 1TUYA 3LL3A 3IMXA 1DGKN 4NB4A 5EOYA 4B1ZA 5AQNA 1S22A 2AA4A 3L4IA 5AZJB 2QW9A 3VEVA 1C0GA 3EZWA 3L0QA 1NGJA 1J6ZA 2E1YA 1BA1A 2E88A 2GELA 5LY3A 3ZX0A 1JCEA 3ZX2A 1BDGA 2QWPA 2P9KA 4CZIA 1IG8A 1TYQA 1U2VA 3GBTA 5BPLA 4BRKA 2GTDA 3MN5A 2DPNA 2ZGZA 1X9JA 4DB3A 4CZFA 3H3NO 2KHOA 2HF3A 3VEOA 3WXJA 4B1VA 3ZETB 1XC3A 4HWIA 4BC2A 4AM7A 3TU5A 3VPZA 2E2OA 3WEEB 1V4SA 2CGKA 4EHTA 2E2NA 4FWRA 2FLOA 3FZMA 4BR9A 4BC4A 3H1VX 3EKSA 2D4WA 3U4LA 2BUPA 1KAYA 3CJ7A 4FPBA 5AQSA 3HM8A 1QHAA 4Z94A 1SZ2A 3UKRA 2FSNA 2I7NA 5BRDA 3A8YA 4H5RA 3U8XA 2V7YA 2ASOA 4L3QA 1BUPA 4FO0A 3CJBA 5ADXH 3ENOA 5AQZA 1V4TA 5E84A 2Q0RA 5BREA 4CZHA 5CE3A 1NMDA 1RGIA 3S41A 3I33A 4IXCA 2QWOA 4XH1A 2P9KB 1QQMA 3JXUA 4BRFA 3VENA 5AQIA 3GE1A 2F9TA 3MN6A 3A5LC 5AQQA 5AQFA 4BRNA 3GDQA 1RFQA 3DXKA 3A5OC 3CERA 5AQPA 4FWMA 1GLEG 3WUHA 2P9PA 4KBOA 1KAXA 4JNEA 2CGLA 4I6MA 3VEZA 2GWKA 4JN4A 3CJCA 2A3ZA 2IVPA 3D7EO 5B8HA 3VGKA 3AAPA 5AZJA 4MO5A 4XH4A 1HKGA 5ELZA 2E8AA 3DXMB 2OANA 4JAXA 1NGGA 5EX5A 3ATVA 4XEIA 3VF2A 3W3DA 3UE5A 3MDQA 3WT0A 4C23A 3OHRA 3LDOA 4BGBA 3FFKB 3TPQA 3MMVA 2I7PA 1LCUA 5JICA 3A5MC 2WUSA 4A61A 3ZETA 4K25A 3QFUA 5I9EB 3C7NA 4BRPA 2UYTA 3WEEA 3EN9A 2Q31A 4CZEA 3WQTA 4BRAA 1GLFO 4PKIA 3ZX3A 5AQTA 1KAZA 2YJEA 4WQ5C 4I6MB 4BC3A 3AY9A 3WXIA 3WXLA 4BRIA 2GWJA 5F0XA 2FF6A 2W40A 3H45C 4IJAA 4IJNA 1QQOA 1YVNA 4BR7A 4M63C 4H0YB 3L6QA 5FPDA 3O8MA 2CGJA 4PL8A 2QWMA 4CBWA 1NGEA 4BC5A 1WOQA 4CI6A 3QICA 5AZIB 3CJ1A 1D4XA 2YHYA 2BTFA 2V7ZA 3H6EA 5KPRA 3EKUA 4FWPA 5BPNA 4M7XA 1SAZA 1JCGA 3BEXA 2NLXA 2ZF5O 2ITMA 1T6DA 1E4FT 1SQKA 4H0PA 5TKYA 1HLUA 2W41A 1HX1A 3C7NB 4EFHA 1NGCA 4WQ4C 4BR4A 1BOTO 3BP8A 2ZWHA 3C0BA 5E26A 3IFRA 3O6WA 3D2EB 2Q1NA 5KPTA 1ATNA 3VERA 1NGAA 1DKGD 5AQXA 5AQJA 3O4WA 2CH6A 4ISGA 4PL7A 2ASPA 1X3MA 1Y64A 3VGMA 4JD2B 3DXMA 4PKHA 4EAHD 3VEXA 4WQ4A 3MN9A 2VWBA 3CI5A 2GEMA 1P8ZA 3M6GA 3CQXA 1ATSA 1T6CA 3ZEUB 3ID8A 3HBTA 2FSKA 3EO3A 4CZKA 4FWLA 1NGDA 2H3GX 4BR0A 1GLCG 3P4IA 3SK3A 4QS7A 4FWSA 4BRCA 1BG3A 2IIRA 3G25A 3I8BA 3QBXA 2QWNA 1Z05A 3SJHA 2D0OA 2HF4A 4Y0WA 1BO5O 4H5WA 3B8AX 4GY2B 2E1ZA 3U9ZA 4H0VB 4CZGA 2P9IB 4CBUA 1G99A 4MLEA 5FPNA 1S3XA 4NO7A 4BRDA 4BQLA 4A62A 1H1VA 1MWKA 3FZLA 4MO4A 3SMPA 4BRGA 1GLDG 4DHYA 3QB0A 5AQWA 1NGFA 2HOEA 5AZIA 3VOVA 1CZAN 5BPMA 3O80A 2A5XA 4K43A 3R8EA 5LJWA 3H1QA 4LC9B 2ASMA 2IVOA 4O5FA 4MLHA 5AQVA 4CZJA 2CH5A 4K42A 4O8KA 4FPAA 1Q18A 3EL2A 4AM6A 3QMLA 1EQYA 4H5NA 4FWNA 4B1WB 1ATRA 3CJAA 5AQUA 3F9MA 3LDQA 4XH5A 2QWLA 2QM1A 4EIAA 3LDPA 3A5NC 3VEWA 1WUAA 1MA9B 4JHDB 3CJ9A 3MN7A 3D2EA 3WQUA 4A2BA 3R9PA 3BUZB 1HKCA 3LM2A 1GLJO 5FPEA 3A0IX 2J4RA 4B1UB 3O1WA 4PKGA 4JD2A 3VETA 1HJOA 1NGBA 3ULEB 2P9NA 4HTLA 1HPMA 2PBDA 4ISFA 3LDLA 3ZEUA 2EWSA 4BG9A 1NM1A 3D2FA 4WQ5A 1E4GT 1K8KB 3HI0A 3MCPA 5AR0A 5BN9A 4J8FA 1GLLO 3ENHA 2F9WA 1BWFO 2ZGYA 4BG8A 2AP1A 3MK6A 4DCHA 1QZ5A 1LOTB 4FWOA 4ISEA 1R59O 3SLCA 3KVGA 4YDUC 4DQ8A 4CJ7A 1Z6RA 5JLHA 4IO8A 3CIPA
chains in the Genus database with same CATH superfamily
1TK8A 1U49A 3DAWA 3U9DA 3THWA 3NF6A 3IUCA 4H8KA 3N4PA 1A5VA 1JCFA 4K41A 3OS2A 1B9DA 2FXUA 3AGRA 2P9UB 3UKUB 1RT6A 1YAGA 2NRHA 3GG4A 4CIEA 3FE1A 1OH8A 5AQOA 1WN7A 3CCEN 1J5EK 3CQYA 3NF7A 4BQZA 2HHHK 3D2FB 4H0XB 1L3TA 4I9LA 4PA1A 2G8FA 4OX9K 2FBYA 3M3ZA 4MFBA 3O1BA 1BL3A 2A1RA 3LZIA 3K9JA 2KFZA 3MECA 4A5AA 1C0FA 1HJRA 4H0TB 3K2PA 4J2DA 4JHDA 1KVCA 4YNQA 3ZSVA 4KI4A 3C6TA 1KFDA 1MWMA 4FW2A 3T19A 3L2WA 1TYQB 3EZ5A 3CXCM 4RTFD 3QETA 1N34K 1WNSA 3VF4A 4FJ7A 4KKOA 1TVRA 3FZHA 3M1FA 2IVNA 3ULEA 1NK8A 1LWEA 2X6SA 4RWTA 3T1YK 3V4IA 1IV0A 2ZD1A 4FW1A 3BF3A 4E7LA 4FVMA 1LWFA 4FZZA 3CYGA 1QQNA 4G9ZA 3RMDA 4XJXA 3SAHA 4CJ3A 1YF5L 4JK8A 3ULDA 4M7YA 4CEZA 4CJ5A 4DUYK 4CEBA 3AVHA 1TKZA 4FJ5A 2Q2RA 3O4NA 3J8AA 2F8SA 1ZC6A 4W5TA 3LP2A 1RDWX 2E20A 3FR0A 4YOXA 2YHWA 3O08A 5EXWA 4ZTFA 4WYBA 3ISNC 4AHRA 1C1CA 3O9QA 2YV0X 1HUXA 4CJWA 1QQCA 3V1OA 1J5OA 3VF6A 3QIPA 3AVIA 4N76A 1ESVA 4GKJK 1IBLK 3AGKA 4JRPA 2VWJA 3O3HA 1XI1A 3KIOA 3MX5A 1RBSA 3QESA 2P9LB 3QDKA 4BE1A 4BREA 3TAQA 4DFKA 3ZLJA 5AQGA 5AFUA 3O9RA 3O5BA 5EOYA 4NB4A 4JI2K 4CFCA 3HSTB 4PUOA 5TKWA 1D9FA 4JYAK 4ELVA 1SL1A 1L3VA 5SZTA 3EZWA 4UQGA 1NGJA 2E88A 3D45A 1IBKK 3CCSN 3BZKA 2XHBA 4CZIA 1U2VA 4JKCA 4CIGA 2GTDA 5CZ1A 2ZGZA 4LH5A 4DTMA 4DB3A 4CZFA 3OYDA 4WFBL 3H3NO 3QEPA 4M42A 4JI0K 2HF3A 4LF8K 3ZETB 1FXXA 3WXMB 5HRSA 4I7FA 2E2OA 2FC0A 1VQNN 1T03A 1V4SA 1RBRA 2VG7A 2E2NA 1FKPA 4FWRA 2FLOA 3EEQA 2XY5A 4BC4A 3EKSA 2D4WA 4CK1A 2BUPA 4E72A 1QHAA 4EZ6A 1T7PA 1F21A 4F3TA 5BRDA 3ZSRA 4H5RA 1B9FA 3THYA 2I5JA 4L3QA 4FO0A 5ADXH 4NXMK 3ENOA 3U3GA 1L5UA 1V4TA 4BWMA 3K57A 3Q7CA 4O0IA 1RGIA 2IGIA 4IXCA 3CMEN 4OKJA 1ZBHA 2P9KB 2DFHA 1YVUA 3ENBA 3JXUA 3VENA 4JI3K 5AQIA 3PO4A 5FRMA 1TAUA 2OPPA 2Z1JA 3K5NA 5J2MA 5AQQA 3M8QA 5IT9O 4KREA 4IOXA 4Z4FA 3JYTA 1K8AO 1QVGM 1GLEG 2OPQA 3WUHA 4B08A 5LMNK 2XY6A 3KK7A 1RT3A 2CGLA 1S1VA 4OPKA 4I6MA 4CEDA 1IKYA 3DMJA 3VEZA 4DTRA 3SQ1A 3CJCA 1HYSA 3AAPA 4I2QA 4CESA 5ELZA 1VQ5N 1VQ8N 1QE1A 4OLAA 3DXMB 4IOAL 4JAXA 3NVMA 3VTIA 4U7BA 1MU2A 3QEVA 1U48A 1TKDA 1SKRA 4IKFA 2GX9A 3VF2A 5C10A 1FW6A 4JK7A 4KV8A 4BECA 4FLUA 3MCAB 4BGBA 2JLEA 2I7PA 3MEGA 5JICA 3KKRA 4DKWA 3NGZA 1VSMA 3HRGA 3SUQA 3AO1A 2Q31A 3E9OA 3HJFA 3WQTA 3MWPA 1GLFO 4DV4K 4DV0K 1J53A 4WQ5C 4WCEL 3DM2A 3ZSZA 4FJIA 3H45C 4IJAA 2R7YA 4FVUA 3AO3A 1RT7A 4WE1A 1YVNA 4DR3K 4BR7A 4H0YB 1IO2A 2Q3SA 4FM2A 1I39A 4ELUA 1YIJN 1OH6A 1NGEA 1BI4A 4OPJA 4NLBA 4CERA 5C25A 1VAZA 4B9TA 4OLBA 1RTHA 1DTQA 1WB9A 1SAZA 3BEXA 3J81O 1HYZA 4LH4A 2ZF5O 4CGHA 3NVKA 4DF8A 3AVMA 3V1QA 1N6QA 1T6DA 1E4FT 1JXEA 2PZSA 2W41A 3SV4A 3C7NB 4EFHA 4JKGB 1NGCA 1REVA 3C95A 4BR4A 5GAEP 2ZWHA 3O6WA 1C0MA 1SUQA 4RW9A 2Q1NA 2O4IA 3O4WA 1C6VA 1HNIA 4JKFA 1YITN 1Y64A 4JD2B 1Z25A 4BE7B 2E6LA 3TAMA 3VMFB 1Q81O 3HK2A 1S1XA 3M6GA 2O8CB 4Z4CA 4AHCA 3RR8A 1KVAA 2RHKA 4G1QA 2H3GX 4BR0A 1X9WA 1GLCG 2E6MA 4ZHRA 2OTLN 4WFNL 5KRSA 3AVCA 1BG3A 5BR8K 2HMIA 5HOOA 1DT9A 4CVNE 5HLFA 4B3TK 3SJHA 3NCIA 4NCGA 4H5WA 3VA3A 1IKXA 4JK9A 3NDKA 3P39A 4DQRA 4H0VB 4OPHA 4MLEA 3P83D 5FPNA 4CHQA 3WNEA 4YHHK 4BRDA 4IDKA 4CJKA 3VQQA 3SMPA 1MWKA 3LANA 1GLDG 1CXUA 1FKOA 3CMAN 1ILYA 2HHWA 1IG9A 3VOVA 1CZAN 3OYMA 3IG1A 2A5XA 4AQYK 5LJWA 1D8YA 3H1QA 4DSJA 3E66A 3PX4A 2BDPA 4W5OA 1RT1A 1WAJA 4O5FA 1VSLA 1I3AA 3QEWA 1Q18A 4R79A 4H5NA 1LAWA 5AQUA 2AJQA 2QWLA 3T69A 2G8HA 4JHDB 4A2BA 3MN7A 3D2EA 4YOYA 4I9QA 3R9PA 1YTUA 1HKCA 4KHWA 1GLJO 1NKEA 4TSXA 3K9KA 3NF8A 4M3YA 1U45A 3HXMA 3ULEB 1HPMA 2PBDA 4ISFA 5HROA 3TTCA 3THXA 3LDLA 2EWSA 1NM1A 4B3RK 4KAZA 2UUAK 1JLAA 2BGGA 3MCPA 5AR0A 3VA0A 3P38A 3ENHA 4KH6A 2YNIA 1BWFO 4IDHA 3ZT0A 1QZ5A 4FWOA 3VQ7A 4CFBA 1M90O 3OA9A 3SAFA 3ZSOA 1E3MA 2Q36A 4FWQA 3OYEA 1ZBIA 4FLVA 3A2FA 1IJJA 3DWLA 1C1BA 3H3OB 3DRRA 2YKNA 4KHUA 1DLOA 1IBMK 3L2UA 5EVZA 2PFUA 2ZJQL 4DU1A 2P9NB 4EHUA 1K9MO 2VYPA 3DOLA 4DV5K 3L3VA 1RTJA 2DFEA 4H4OA 4DTPA 4N47A 3SYZA 3GOIA 2VQEK 4O55A 4IFYA 2ATQA 1ZYQA 5C2DA 2VGMA 2XY7A 4IWVA 3VN5A 2A42A 5BR9A 3HOSA 3B6PA 4BVPA 4QS8A 2QXFA 2D1KA 1UAXA 2V52B 4ICLA 1CZ9A 1U2VB 3W0LA 2HNZA 2QWQA 3QFPA 1L3UA 1VSIA 3FZFA 3HTVA 3KHYA 1I94K 3CETA 2QTDA 1YTAA 3AO4A 3O9UA 3LAKA 4FJ8A 5F2RA 4B1YB 3OS1A 3SQ4A 1Q8IA 3I0RA 4Q5VA 5BRHA 5CY4A 4CJSA 1K8KA 2D0AA 1TAQA 4HCCA 4FJGA 1OVYA 3RSEB 1VHXA 3OTOK 2HHVA 3ZT3A 4CCHA 2QK9A 1ZXOA 2NRWA 3OYAA 3JS6A 3THYB 1JL2A 1U04A 4DWIA 4NLCA 3WXKA 3OYBA 4DTNA 4LF7K 4QAGA 3DLRA 1OKJA 3PV8A 2P9SA 3IRXA 3VQCA 5LL6Z 2O8DA 4MDAA 3V81A 3EY1A 3V6DA 5KPZA 1U6ZA 4Z4IA 2E2QA 2HVHA 3IKMA 3M5RA 2Q97A 2VG5A 4B9UA 5LJVA 5AFUH 4M3WA 4OVLA 4DFPA 5JMVA 4B1XB 3FGUA 4IZ9A 1WBDA 4DF4A 1GLAG 4DMNA 3KZBA 4FCYA 1XUPO 4AF1A 2HHSA 1RCHA 4FYDA 4GNIA 4B9VA 3IMXA 1DGKN 1X9MA 1S22A 2AA4A 1TK0A 3VEVA 2HBLA 4PWDA 1J6ZA 2E1YA 1BA1A 3MXJA 5LY3A 4R5PA 4DTXA 1NJIO 3ZX2A 3VQBA 1BDGA 4AHUA 2QWPA 4DR5K 3SV3A 4DSEA 3QNNA 1RDAA 3GBTA 1U47A 3AVBA 3E9LA 4HCBA 3WXJA 2EX3A 4HWIA 4AM7A 3TARA 3VPZA 1UA1A 2YNFA 1XHZA 3QIOA 3ZT4A 3H1VX 3U4LA 1HMVA 3I56N 5AQSA 1HRHA 3HM8A 4O8UA 3NE6A 4E19A 2D0CA 2FSNA 4NXNK 2RKIA 4DR7K 3A8YA 4ILGB 4OKEA 2ASOA 2OPRA 2W6KA 2LSNA 4AILC 3AA4A 5KRTA 4FLXA 5BREA 1GOBA 4CZHA 3TAFA 4OGCA 4GVMA 3S41A 3HVTA 4M41A 4FLYA 2KTQA 1HNWK 3QNOA 1NK6A 4K0KK 5MLCQ 4PY5A 4EZ9A 3PUFA 4FK4A 4MDBA 3ZSWA 3GDQA 4BRNA 2Z1GA 3C65A 2O8FA 4KH5A 1GOCA 3H08A 2O8EA 3CERA 3CD6N 3DLEA 1ASUA 2OYQA 4JNEA 3S9HA 1EWRA 1UWBA 4EP5A 1SKSA 4JS4A 2UU9K 4DQIA 4DQQA 2GWKA 4JN4A 3G71N 2IOCA 1WBBA 3SBGA 3NMUA 5B8HA 3KLIA 3VQDA 4CHOA 4CE9A 4X62K 4FJ9A 3NBPA 1HKGA 2QI2A 1G15A 2E8AA 1P90A 1VQ4N 3D0PA 3SPZA 4DFMA 5EX5A 3KLGA 3UE5A 3MDQA 3CM6A 4YY3K 3RMCA 3EE8A 3SCXA 1Q9YA 2PY5A 3G10A 3LDOA 4C8OA 5CYMA 3MMVA 4PQUA 1LCUA 1S9GA 4MQ3A 4JKHA 1M1KO 4A61A 5C42A 3NGIA 4HUEA 1TK5A 4K25A 1QSLA 1NK5A 3QFUA 5I9EB 2B6AA 5GIPA 4BRPA 3T1AA 3WEEA 4CZEA 3M8RA 3AA5X 3OYJA 5DM6L 1C0TA 3NGYA 3SQ2A 4BRAA 3ZX3A 1KAZA 4CEAA 3LP1A 4BRIA 3AO5A 2FF6A 2W40A 4BE2A 2RF2A 3TSPA 5FPDA 1N32K 4PHTX 2CGJA 4B3OA 1S5JA 3VQ5A 3ID6A 1WOQA 3QICA 4CECA 3TAGA 1QSSA 4DR4K 2V7ZA 1T3VA 3U3YA 2Z1IA 4LFBK 2O4GA 3DLGA 4JKBA 4E89A 5BPNA 2ZJPL 1JCGA 2HBJA 2NLXA 4CF0A 4KHYA 1D5AA 1CLQA 4CJ4A 1SQKA 4H0PA 3V9UA 1VQMN 4NCBA 5E41A 4BDPA 4CFAA 3BP8A 4O4GA 3C0BA 1ZBFA 3VQ8A 4IBNA 3D2EB 3QEIA 5KPTA 1NGAA 3DOKA 3O9SA 4OGEA 1UOCA 2OZSA 4J2EA 3MN9A 3CI5A 2GEMA 3CCUN 3THXB 2G8WA 1T6CA 5M1KA 4U67L 3ID8A 3HBTA 4LSNA 4GMJB 2JWKA 5C0YA 4KTWA 4DR6K 2FSKA 4DFJA 1EXQA 5JS2A 3P4IA 3DLKA 4QS7A 3PX6A 3CQ8A 4DQPA 3CC7N 3KK1A 4E7IA 3G25A 3QBXA 4CF9A 3VQ6A 3RTVA 2BANA 4Y0WA 4DR2K 4W5QA 1RTIA 3U9ZA 3HPGA 1G99A 3J7YP 4C8MA 2W42A 2WBNA 1A5XA 4KHQA 3FZLA 5C2FA 2YX6A 2X78A 4O5BA 1RT4A 3ALYA 4DHYA 3QB0A 1S72N 5AQWA 1VSHA 1DTTA 1VQ7N 5AZIA 3O80A 4O44A 4K43A 4B8AB 3FFIA 5AQVA 1EX4A 1KTQA 1HNVA 1VSEA 3KLEA 3LP3A 1C1AA 4KB0A 3EL2A 4AM6A 1EQYA 1NJWA 1OVQA 3CJAA 1JL1A 1NKBA 4C1NK 4FJKA 4NYFA 4EIAA 3SPYA 4W5RA 1X9SA 5A2QO 3THVA 3WQUA 3CJ9A 4X64K 3RRHA 1WSJA 3Q7BA 3A0IX 2J4RA 2EHGA 4JI4K 3CC4N 2G8KA 4DV2K 1JLQA 3DLLL 2A1SA 1OH5A 3R3LA 2KFNA 3OYCA 2B5JA 3D2FA 4WQ5A 4C1NI 1K8KB 5I3UA 4B9NA 1NJYA 3TWHA 3CCMN 1O13A 1GLLO 2ZGYA 3OYGA 3UIQA 1IH7A 4XIUA 4DCHA 1NK7A 3AVNA 1LOTB 1R59O 4B9MA 3KVGA 3E01A 1S1WA 4DQ8A 2KZMA 1NU0A 4JKAA 1Z6RA 4KB1A 4BVOA 4CF1A 4CJFA 1TUUA 1T44A 2P9IA 2NZTA 3HSCA 2F96A 4DS4A 2G8IA 2P9SB 2BE2A 1T8EA 4FOEA 2A40A 2YNHA 1UA0A 2HMPA 3K0SA 1QTMA 4YFUA 5AQLA 4YOUA 3KJVA 4H0OA 3AARA 1TKXA 3IDHA 3CPWM 2FF3B 2YHAA 4DLEA 3HZ6A 1BA0A 4Z4HA 4KH4A 3VESA 1EWQA 3DRSA 1S6QA 1RT2A 3DJCA 3CF5L 3CFPA 2A6AA 1HR0K 4JV5K 1NGHA 3BF1A 5KQDA 4F8RA 3TTFA 2BH1A 4Z4GA 2FSJA 5KGXA 1NG9A 4CF8A 4K8XA 3BGRA 4FXDA 3OBYA 4GV3A 1X1PA 1U4BA 5ADXA 3HL8A 5JVHL 3THWB 2IC3A 4X65K 3NF9A 5GINA 1KQSM 4Z4EA 3RMBA 4OJRA 4BR2A 2XO7A 3VEYA 4A2AA 1TL3A 4CHPA 4KHNA 3H46O 2QWRA 2P9LA 2YHXA 4CJRA 5AQYA 2PAVA 4FJXA 5EY4A 4BGAA 3OYNA 4HUGA 3O9TA 3F5TA 5J2PA 3OS0A 2W6LA 4FJJA 2E2PA 2KKZA 3T7ZA 4W5NA 2YJFA 4BDYA 2NRZA 3CFRA 3FZKA 4BROA 5HRPA 5DK5A 3QBWA 3AA2A 1Q82O 1WAFA 2QA4N 4B9SA 1W2BM 3VGLA 2YCHA 4WF9L 3PIOL 3U6FA 3LDNA 4FOIA 1SKWA 2O8FB 4LF5K 2O8EB 3HM9A 3SNNA 2GUIA 5FDLA 3RMAA 4E7KA 4A5BA 2PYJA 1XQSC 2O8BA 4CZMA 1BQNA 4FLWA 2DTUA 2YKMA 1YUWA 2XY8A 4JKEA 5HRRA 3CFOA 4FM1A 3ATUA 2P1JA 1TUYA 3CM5A 5C12A 4B1ZA 3I0SA 1WSHA 3CCQN 3CG7A 3S3NA 2G8VA 3L0QA 3MEDA 2D5RA 2GELA 4DSLA 3K59A 4QOZB 3I8DA 5GAGP 4HUFA 3TAEA 4IOCL 1QVFM 2P9KA 4DUZK 1XMQK 3PSIA 5BPLA 4BRKA 3MN5A 2OPSA 1NJZA 1NKCA 3D6RA 4H4MA 4M3UA 3DYAA 4CFDA 3L2QA 4GV9A 3MEEA 3IAYA 1D9DA 3TU5A 2KW4A 4X66K 3NH2A 3WEEB 2CGKA 1LWCA 1NOZA 4BR9A 3FZMA 2UUBK 4B8CA 1KLMA 1KAYA 4FPBA 4IEIA 1BIUA 4Z94A 2W00A 3UKRA 3LZJA 3U8XA 1WSFA 3CJBA 4HHTA 4DV1K 3BDPA 5AQZA 3LPUA 4OPAA 4CIFA 5CE3A 5FRNA 1NMDA 1W97L 1VQLN 2QWOA 1KD1O 3S3OA 4BRFA 4J2BA 3GE1A 3MN6A 1TL1A 1QHTA 3A5LC 2HB5A 2JWLA 5KGWA 3DXKA 3OYLA 1J9AA 3V9XA 1VQ6N 5AQPA 4JI1K 4CGIA 4LY7A 1KVBA 4FWMA 3DLHA 2P9PA 4IFEA 4KBOA 1KAXA 1RBVA 4DV3K 4FK0A 5H1SQ 4L8RB 2IVPA 1W9HA 5AZJA 3TANA 3CCRN 4M3XA 3O3GA 3TABA 4JI5K 4CHZA 1YJNN 3SI6A 1Q7YO 2F4VK 1SS6A 4IG3A 4XEIA 3MAQA 3WT0A 5K14A 2HVIA 4CJLA 1VQPN 3TPQA 1BISA 4FZXC 3C7NA 3WNGA 1JLCA 3EN9A 3PLAA 4PKIA 4N56A 2YJEA 1XNQK 5CYQA 4I6MB 4BC3A 2GBZA 3AY9A 3RR7A 4BY9C 2RE2A 3C94A 5F0XA 4GV6A 5GAHP 4CK3A 4IJNA 4JKDA 3V9WA 4M63C 4FLTA 3O8MA 1VQ9N 4FZYA 4PL8A 4CBWA 1YHQN 4BC5A 2X6NA 4CGJA 3CPEA 5AZIB 4AHSA 1KC8O 2YHYA 1JJ2M 2BTFA 1ZBLA 4F2SA 3H6EA 3EKUA 3SAGA 5HBMA 2FBXA 3VQEA 5T7BA 5C24A 3TSUA 2XRIA 3CC2N 1S1UA 5TKYA 4DSKA 4GW6A 3PO5A 2E4LA 3OBWA 1LAVA 1NMNA 3AVAA 3G4SN 3M8PA 5E26A 1ATNA 4IO9L 2GV9A 1DKGD 5AQXA 2C1GA 5AQJA 3RVCA 5FLXO 4ISGA 3L4QA 3HOTA 2ASPA 2ITGA 3VGMA 5M1NA 3VQAA 4PKHA 1J54A 3VEXA 1ZBUA 3J7ZO 3AA3A 2FBTA 4K8ZA 5KI6A 2VWBA 1P8ZA 1BI4B 3CQXA 4DTJA 4HVJA 4B3SK 1LV5A 1JLGA 3NFAA 1KFSA 4CZKA 4A57A 1NGDA 2F7TA 3TTDA 3KLFA 1R0AA 1VRTA 2ETJA 2RPIA 4FWSA 2WONA 3CYMA 2IIRA 1KRPA 4Z0UA 4OO1J 2KZZA 1ASWA 3I8BA 4LF6K 1BGXT 3DI6A 2QWNA 1Z05A 2D0OA 4BEBA 1RBUA 3B8AX 2OCEA 2E1ZA 3AVGA 3AVKA 1S6PA 4C8LA 4CZGA 4LD0A 2P9IB 3F73A 1BCMA 4DTUA 4FJMA 4CJEA 3CCJN 4CJQA 4NO7A 4DR1K 1HNZK 4KHPK 1BCOA 1H1VA 4MO4A 1Y97A 4BRGA 2C1IA 3P31A 3NHGA 4O0JA 1NGFA 1VK0A 2HOEA 4BDZA 3ZSXA 1W0HA 5BPMA 3VQ4A 4LC9B 2ASMA 4I2PA 1N8RO 4MLHA 4CZJA 3SUNA 2RN2A 2VGNA 4K42A 4O8KA 2HW3A 3OYHA 4FWNA 1ATRA 4KTQA 4F2RA 3SBTA 3F9MA 2OTJN 4AHVA 3NH1A 2HBMA 5M1FA 3TAPA 1GOAA 3LALA 4QCLA 4KTZA 4C8NA 3P5JA 5KTQA 3LP0A 2VQFK 3LM2A 4B1UB 3M8SA 3KWIA 5DM7L 5D3GA 4PKGA 3VETA 1NNEA 5JS1A 4Q0BA 2P9NA 4HTLA 1YJ9N 3DLBA 1NK0A 3ZEUA 3OVNA 4BG9A 4B9LA 4N5SA 4CGGA 3HI0A 1KSPA 1XC9A 1N36K 5BN9A 1EP4A 1B92A 2IAJA 3KWGA 4E1MA 4BG8A 4YOTA 4KRFA 3SLCA 3PSFA 4CJPA 4YDUC 3KD5E 3IS9A 1Z26A 1EO1A 4CJTA 4IO8A 1VSDA 2DPNA 5JLHA 4J2AA 3HP9A 1MDUB 1WSIA 4FSVA 3DRPA 4H5TA 4QS9A 1HQEA 4F4KA 4ID5A 4BRQA 2D0BA 3CCLN 1JXBA 2DY4A 3QLHA 4E1JA 4BRMA 4CEEA 3KK2A 1NBWA 1KLNA 4CD1A 4YDUA 3RWUA 2VCPA 3K5MA 5F1XA 3E1YA 5KQ8A 1JLEA 1RNHA 2HNYA 5FPMA 1NJXA 3ITHA 3AVJA 3HPHA 2KLAA 4CBXA 2O8BB 4CD3A 1JLBA 5AQHA 3RSEA 5AQKA 4B9QA 4DS5A 1Q86O 3HVRA 4BRLA 1YXQA 4BRHA 1HPZA 2Q0UA 2G8UA 1VRUA 3AAQA 3R6MA 4RW4A 1NGIA 5J2QA 4FL9A 1X3NA 2D0PA 5LMUK 1ZBSA 4M3RA 4E3SA 4F9OA 2V51B 3B6OA 1XHXA 4N41A 5M1OA 2QXLA 1KXPA 2Z1HA 1BHLA 2HSTA 3LAMA 2UXCK 3SJJA 5BN8A 2A41A 3KLHA 1BU6O 4RCHA 1ITGA 2GUPA 2YI1A 1HKBA 4WFAL 4FWKA 3UB5A 4IEEA 4BR5A 1QZ6A 2OA8A 3E9PA 3ZT2A 3R1XA 4E0DA 2WFBA 4ID1A 3PX0A 5BRFA 3CHWA 3S5TA 3UKRB 4ELTA 1GLBG 3SUPA 3SMSA 1ASVA 4YOWA 3AVLA 2ZJRL 5AQMA 4HTUA 2DFFA 4H03B 3C6HA 3LDSA 3LM9A 2YNGA 4CW7B 1DEJA 4FJNA 5JLFA 4UY8O 4H5VA 3ZT1A 4IG0A 2P9UA 3UKUA 2B4JA 3DXKB 3ZSQA 1S9EA 1S1TA 3HYFA 5AQRA 3T1HK 3FLCO 1NWKA 2P9PB 4JS5A 2Y1JA 4CZLA 2FBVA 4NYNA 5JVGL 3GL1A 2WTUA 2QKBA 3C6AA 3ZCMA 1NLVA 1BQMA 3LL3A 5AQNA 3L4IA 5AZJB 4FK2A 2QW9A 2HHTA 1C0GA 2E5LK 3ZX0A 1FK9A 2NRVA 1JCEA 1IKWA 1SL2A 1IG8A 1TYQA 5DMRA 3P1GA 1XWLA 2ZE2A 2O8DB 1X9JA 3BZCA 3NAEA 4LSLA 5IWAK 2KHOA 4E1NA 4EP4A 4BE0A 3VEOA 1RDBA 1TGOA 3K5OA 4B1VA 1XC3A 4BC2A 1VSKA 3K5LA 1JKHA 2Y1IA 3J7AP 1WSGA 3L8BA 4EHTA 4LF9K 3CCVN 3QEXA 1WSEA 1VSFA 4B3MK 4FJLA 3CJ7A 4KPYA 4KHSA 1SZ2A 2I7NA 1WLJA 2V7YA 5CHIA 3F9KA 1TV6A 1BUPA 1EKEA 3LPTA 4IFVA 4FM0A 1EETA 4CHYA 5E84A 2Q0RA 1YT3A 4FLZA 3AO2A 3I33A 2UXBK 4XH1A 4BWJA 1QSYA 1QQMA 4E7HA 2VG6A 3O3FA 5J2NA 2F9TA 2HHXA 4E7JA 2UXDK 1O1WA 3KKSA 4CGDA 5AQFA 1RFQA 4ILHA 3A5OC 1VQON 1BIZA 3RRGA 1N33K 1NK4A 2P5GA 3MXMA 5FROA 1CZBA 1JLFA 2NNWA 3G6EN 3OY9A 2IDOA 3HO1A 2A3ZA 3J80O 3D7EO 3VGKA 1RDCA 4MO5A 4RG8A 4XH4A 5M1QA 2HHIA 1RTDA 2OANA 1RILA 3TR8A 1NGGA 3ATVA 3W3DA 4BACA 4AH9A 3KD1E 2X74A 4C23A 3OHRA 3OYFA 3FFKB 3EYZA 3MXIA 2UUCK 2HNDA 3AV9A 3A5MC 4JI6K 2WUSA 1FJGK 3HP6A 3ZETA 4DLGA 3SZ2A 2UYTA 3MWTA 4JEPA 3F2KA 4YORA 3VQPA 3JAMO 3KK3A 4C8KA 1RBTA 4DV6K 5AQTA 2NRTA 4DTOA 5AJ3K 4LFCK 3G0ZA 3WXIA 3WXLA 2GWJA 4DQSA 4JI8K 1QQOA 2VWKA 3O4QA 5HL7L 2YHBA 3OW2M 2NRRA 2ZM6K 3L6QA 1A5WA 4GKKK 2QWMA 3NH0A 4CI6A 1NOYA 5HRNA 1XNRK 3BY5A 3CJ1A 3VQ9A 1D4XA 2QEXN 2PYLA 5CZ2A 3OJUA 5KPRA 4FWPA 3ZYYX 3OJSA 4M7XA 3HPOA 3PIPL 3VTHA 1SL0A 2KQ2A 4M45A 2ITMA 4CEQA 5C15A 1CXQA 1HYVA 1K6YA 1HLUA 1HX1A 4DSIA 1C0UA 5GADP 4CF2A 4WQ4C 3N4QA 1BOTO 4NCAA 2HHQA 3IFRA 4DSFA 2QKKA 2NRXA 3VERA 3LWMA 3K58A 2CH6A 2P5OA 4JRQA 3MX2A 3QINA 4PL7A 5SWMA 1VSJA 1X3MA 3DXMA 4EAHD 3TSQA 1RT5A 4WQ4A 1ATSA 2ZQBA 5M1PA 3ZEUB 3JSMA 4CGFA 4A59A 2IS3A 5J1EA 3PY8A 4LF4K 3V1RA 3EO3A 4FWLA 3C6UA 4RW6A 3L2RA 3SK3A 1OH7A 3T3FA 4BRCA 3L2VA 3LWLA 4LFAK 2P51A 4RW7A 4M3ZA 2HF4A 1BO5O 5CR4A 4GY2B 3WNHA 4DU3A 4CHNA 4CBUA 1S3XA 4KFBA 4M3TA 2HBKA 3ZSYA 1YJWN 4BQLA 4CEFA 4A62A 1LW2A 4CK2A 3QERA 4RW8A 2NUBA 1HNXK 1K73O 1TKTA 4ILJA 4KI6A 4CJVA 4Y1DA 4DV7K 1N5YA 3WNFA 5GIOA 3R8EA 1QS4A 3I55N 3OYIA 2IVOA 4DU4A 5HP1A 2OZMA 2CH5A 3OYKA 4FPAA 4FJHA 1RDUA 2HHUA 3QMLA 3KTQA 3ASMA 4B1WB 1T05A 3LDQA 4XH5A 3V9SA 2QM1A 4Y1CA 4JKGA 1Q9XA 1LW0A 4F3OA 4JI7K 3V9ZA 3SUOA 3LDPA 1W7AA 3A5NC 3VEWA 4DTSA 1WUAA 1MA9B 3BUZB 2JGUA 3AVFA 1XMOK 5FPEA 3S3MA 1NK9A 3O1WA 1HQUA 4JLHA 4JD2A 1HJOA 4ZTJA 4DG1A 1NGBA 3TI0A 4V19S 3SQ0A 1L3SA 4YOVA 1RDDA 3EE9A 2O8CA 1YI2N 5I42A 4KO0A 4GVEA 3QO9A 1E4GT 5EU7A 2WC9A 4AHTA 2F8TA 4CEOA 4J8FA 1SV5A 2F9WA 3L3UA 1KCFA 5JENA 2AP1A 1IKVA 3MK6A 4OKKA 4ISEA 2WOMA 4CJUA 4CJ7A 1VQKN 3CIPA 3HT3A
chains in the Genus database with same CATH topology
4BVOA 1M90O 1MDUB 3OA9A 4FSVA 4H5TA 4QS9A 3SAFA 1TUUA 1T44A 2Q36A 3DAWA 2P9IA 4FWQA 3U9DA 2NZTA 3HSCA 4BRQA 3CCLN 2P9SB 3IUCA 1IJJA 3DWLA 1JCFA 3N4PA 3H3OB 4FOEA 2A40A 4K41A 4E1JA 4BRMA 2FXUA 1NBWA 3AGRA 2P9UB 3UKUB 2HMPA 4CD1A 4YDUA 1YAGA 2NRHA 2VCPA 3GG4A 4YOUA 2PFUA 3E1YA 5AQLA 2P9NB 5EVZA 4H0OA 4EHUA 3FE1A 5F1XA 5KQ8A 5AQOA 3AARA 5FPMA 1K9MO 2VYPA 3CCEN 3CQYA 2KLAA 3IDHA 4CBXA 4BQZA 3D2FB 4CD3A 4H0XB 5AQHA 3RSEA 5AQKA 4B9QA 3CPWM 2FF3B 1Q86O 4BRLA 1YXQA 3HZ6A 1BA0A 4BRHA 3GOIA 2Q0UA 3M3ZA 4KH4A 3VESA 3AAQA 3O1BA 3R6MA 1NGIA 3DJCA 3CF5L 4FL9A 1X3NA 3K9JA 2A6AA 1NGHA 2D0PA 3BF1A 4A5AA 3TTFA 2BH1A 5C2DA 2VGMA 5KQDA 1ZBSA 1C0FA 2FSJA 2V51B 4H0TB 4IWVA 4F9OA 2A42A 4JHDA 5BR9A 3HOSA 5M1OA 4QS8A 4BVPA 2D1KA 3OBYA 4GV3A 1MWMA 2V52B 2QXLA 1TYQB 5ADXA 5JVHL 1U2VB 1KXPA 3W0LA 3CXCM 2QWQA 3QFPA 4RTFD 2HSTA 3FZFA 3HTVA 3KHYA 3VF4A 5BN8A 5GINA 2A41A 1KQSM 3FZHA 3M1FA 2IVNA 3CETA 3ULEA 2QTDA 4BR2A 4RWTA 1BU6O 4RCHA 3VEYA 4A2AA 2GUPA 3BF3A 3O9UA 2YI1A 1HKBA 5F2RA 4WFAL 4FWKA 4B1YB 3H46O 5BRHA 2QWRA 1K8KA 1QQNA 3UB5A 4IEEA 4BR5A 4G9ZA 4XJXA 3SAHA 2P9LA 2YHXA 1QZ6A 1YF5L 4JK8A 5AQYA 1OVYA 3RSEB 2PAVA 3E9PA 4M7YA 3R1XA 5EY4A 4BGAA 2WFBA 3O9TA 3F5TA 5BRFA 3CHWA 3UKRB 1ZXOA 1GLBG 2NRWA 2E2PA 2KKZA 2Q2RA 3J8AA 3T7ZA 3JS6A 1ZC6A 2YJFA 3SMSA 2NRZA 4NLCA 3WXKA 3FZKA 4YOWA 4BROA 2ZJRL 5AQMA 1RDWX 2E20A 4H03B 3C6HA 3FR0A 3QBWA 2YHWA 4YOXA 1OKJA 3O08A 5EXWA 4WYBA 3LM9A 2P9SA 3O9QA 1Q82O 1DEJA 4UY8O 5JLFA 1HUXA 2QA4N 4H5VA 1W2BM 4MDAA 3VGLA 2YCHA 4WF9L 3PIOL 3LDNA 1U6ZA 5KPZA 2P9UA 4FOIA 3UKUA 2E2QA 3DXKB 3IKMA 3M5RA 5AQRA 2Q97A 3VF6A 3FLCO 5LJVA 5AFUH 1ESVA 1NWKA 2P9PB 4A5BA 5JMVA 1XQSC 4CZLA 4B1XB 3AGKA 4CZMA 3FGUA 4IZ9A 3MX5A 5JVGL 1GLAG 3KZBA 2P9LB 3QDKA 1XUPO 1YUWA 3GL1A 4AF1A 4BREA 4JKEA 4GNIA 5AQGA 5AFUA 3O9RA 3C6AA 1NLVA 3ATUA 3O5BA 1TUYA 3LL3A 3IMXA 1DGKN 4NB4A 5EOYA 5TKWA 5AQNA 1S22A 2AA4A 4B1ZA 3L4IA 5AZJB 2QW9A 3VEVA 1C0GA 3CCQN 2HBLA 3EZWA 3L0QA 1NGJA 1J6ZA 2E1YA 1BA1A 2E88A 2GELA 5LY3A 3ZX0A 1NJIO 2NRVA 1JCEA 3ZX2A 5GAGP 3CCSN 4IOCL 1BDGA 1QVFM 2QWPA 2P9KA 4CZIA 1IG8A 1TYQA 1U2VA 4JKCA 3GBTA 5BPLA 4BRKA 2GTDA 3MN5A 2ZGZA 1X9JA 3E9LA 4DB3A 4CZFA 3D6RA 3H3NO 4WFBL 2KHOA 2HF3A 3VEOA 3WXJA 4GV9A 4B1VA 3ZETB 1XC3A 4HWIA 4BC2A 3WXMB 4AM7A 3TU5A 3VPZA 2E2OA 3WEEB 1VQNN 1V4SA 2CGKA 4EHTA 2E2NA 4FWRA 2FLOA 3FZMA 4BR9A 3CCVN 4BC4A 3H1VX 3EKSA 2D4WA 3U4LA 2BUPA 3I56N 1KAYA 3CJ7A 4FPBA 5AQSA 4IEIA 3HM8A 1QHAA 4O8UA 4Z94A 2W00A 1SZ2A 3UKRA 2FSNA 2I7NA 5BRDA 3A8YA 4H5RA 4ILGB 2V7YA 3U8XA 5CHIA 2ASOA 4L3QA 1BUPA 4FO0A 3CJBA 5ADXH 3ENOA 5AQZA 4OPAA 1V4TA 5E84A 2Q0RA 5BREA 4CZHA 5CE3A 3Q7CA 1NMDA 1RGIA 3S41A 1W97L 3I33A 4IXCA 1VQLN 2QWOA 4XH1A 1KD1O 3CMEN 2P9KB 1QQMA 3ENBA 3JXUA 4BRFA 3VENA 5AQIA 5MLCQ 3GE1A 2F9TA 3MN6A 3A5LC 2JWLA 5AQQA 4MDBA 5AQFA 4BRNA 3GDQA 1RFQA 3C65A 3DXKA 4KH5A 4IOXA 4ILHA 3A5OC 1K8AO 1VQ6N 3CERA 5AQPA 1QVGM 1VQON 4FWMA 1GLEG 3WUHA 3CD6N 2P9PA 4IFEA 3KK7A 4KBOA 1KAXA 4JNEA 2CGLA 2NNWA 4I6MA 3G6EN 3VEZA 2GWKA 4JN4A 5H1SQ 3CJCA 3G71N 2A3ZA 2IVPA 3D7EO 3SBGA 3NMUA 5B8HA 3VGKA 3AAPA 5AZJA 4MO5A 4XH4A 3CCRN 5M1QA 1HKGA 2QI2A 5ELZA 1VQ5N 1VQ8N 2E8AA 1P90A 3DXMB 5C12A 1YJNN 1VQ4N 2OANA 3NVMA 4JAXA 1Q7YO 4IOAL 1SS6A 3VTIA 4U7BA 1NGGA 5EX5A 3ATVA 4XEIA 2GX9A 3VF2A 3W3DA 3UE5A 3MDQA 5C10A 3WT0A 3EE8A 4JK7A 4BECA 4C23A 3OHRA 1VQPN 3LDOA 3MCAB 4BGBA 3FFKB 3TPQA 3MMVA 2I7PA 1LCUA 5JICA 3A5MC 1M1KO 4JKHA 4DKWA 2WUSA 4A61A 3ZETA 3HRGA 4K25A 3QFUA 5I9EB 5GIPA 3C7NA 4BRPA 2UYTA 3MWTA 4JEPA 3WEEA 3F2KA 3EN9A 4YORA 2Q31A 3E9OA 4CZEA 3WQTA 3PLAA 3MWPA 5DM6L 4BRAA 1GLFO 4PKIA 3ZX3A 5AQTA 1KAZA 2YJEA 2NRTA 4WQ5C 4I6MB 4BC3A 4WCEL 3AY9A 3WXIA 3WXLA 4BRIA 2GWJA 4BY9C 2RE2A 2FF6A 2W40A 5F0XA 3H45C 4IJAA 4GV6A 5GAHP 4FVUA 4IJNA 1QQOA 1YVNA 4JKDA 4BR7A 5HL7L 4M63C 2NRRA 3TSPA 4H0YB 3OW2M 3L6QA 5FPDA 3O8MA 4PHTX 2CGJA 1VQ9N 4PL8A 2QWMA 4CBWA 1YHQN 1YIJN 3ID6A 1NGEA 4BC5A 4NLBA 1WOQA 4CI6A 3CPEA 3QICA 5AZIB 3CJ1A 1KC8O 1D4XA 2QEXN 1VAZA 2YHYA 2BTFA 1JJ2M 2V7ZA 1T3VA 3H6EA 5KPRA 4JKBA 3EKUA 4FWPA 3ZYYX 5BPNA 4M7XA 3SAGA 2ZJPL 1SAZA 1JCGA 3BEXA 3PIPL 2HBJA 2NLXA 3TSUA 3VTHA 3NVKA 2ZF5O 2ITMA 3CC2N 1T6DA 1E4FT 1SQKA 4H0PA 5TKYA 5C15A 1HLUA 2W41A 1VQMN 1HX1A 3C7NB 4EFHA 4JKGB 3OBWA 1NGCA 5GADP 4WQ4C 4BR4A 3N4QA 1BOTO 5GAEP 3BP8A 2ZWHA 3G4SN 3C0BA 5E26A 3IFRA 3O6WA 3D2EB 2Q1NA 5KPTA 1ATNA 2NRXA 3VERA 1NGAA 4IO9L 1DKGD 5AQXA 2C1GA 5AQJA 3O4WA 3RVCA 2CH6A 3O9SA 4ISGA 3L4QA 3MX2A 4PL7A 3HOTA 2ASPA 4JKFA 1X3MA 1YITN 1Y64A 3VGMA 4JD2B 5M1NA 3DXMA 4PKHA 4EAHD 4BE7B 3VEXA 3VMFB 1Q81O 3TSQA 3J7ZO 4WQ4A 3MN9A 2VWBA 3CI5A 2GEMA 1P8ZA 3M6GA 3CQXA 3CCUN 1ATSA 5M1PA 1T6CA 3ZEUB 3CIPA 5M1KA 4U67L 3ID8A 3HBTA 4A59A 2RHKA 2JWKA 5C0YA 2FSKA 3EO3A 4CZKA 4FWLA 4A57A 1NGDA 2F7TA 2H3GX 4BR0A 3TTDA 1GLCG 3P4IA 2OTLN 3SK3A 4WFNL 4QS7A 4FWSA 4BRCA 1BG3A 2IIRA 3CC7N 3G25A 4OO1J 3I8BA 3QBXA 5HOOA 1DT9A 2QWNA 1Z05A 3SJHA 2D0OA 2HF4A 4BEBA 4Y0WA 1BO5O 4H5WA 3B8AX 5CR4A 4GY2B 2E1ZA 4JK9A 3P39A 3U9ZA 4H0VB 4CZGA 2P9IB 4CBUA 1G99A 4OPHA 4MLEA 5FPNA 3CCJN 1S3XA 4NO7A 2HBKA 2WBNA 1YJWN 4BRDA 4BQLA 4A62A 1H1VA 1MWKA 3FZLA 4MO4A 3SMPA 2YX6A 4BRGA 5C2FA 1GLDG 2C1IA 3P31A 1K73O 4DHYA 3QB0A 1S72N 4ILJA 5AQWA 1NGFA 3CMAN 1ILYA 1VQ7N 2HOEA 5AZIA 3VOVA 1CZAN 5BPMA 3O80A 5GIOA 2A5XA 4K43A 3R8EA 5LJWA 3H1QA 3E66A 4LC9B 3I55N 2ASMA 2IVOA 1N8RO 4O5FA 4MLHA 5AQVA 4CZJA 2CH5A 4K42A 2VGNA 4O8KA 4FPAA 1Q18A 3EL2A 1RDUA 4R79A 4AM6A 2ZJQL 3QMLA 1EQYA 4H5NA 4FWNA 4B1WB 1ATRA 3CJAA 5AQUA 3SBTA 3F9MA 3LDQA 4C1NK 4XH5A 2QWLA 2QM1A 2OTJN 3T69A 4JKGA 4EIAA 2HBMA 5M1FA 3LDPA 3A5NC 3VEWA 1WUAA 1MA9B 4JHDB 3CJ9A 3MN7A 3D2EA 3WQUA 4A2BA 4YOYA 3R9PA 3BUZB 1HKCA 3LM2A 1GLJO 3Q7BA 5FPEA 3A0IX 2J4RA 4B1UB 3KWIA 3K9KA 5DM7L 3O1WA 4PKGA 3CC4N 4JD2A 3VETA 1HJOA 1NGBA 3ULEB 3DLLL 2P9NA 4HTLA 1YJ9N 1HPMA 4YOVA 2PBDA 4ISFA 3EE9A 3R3LA 3TTCA 1YI2N 3LDLA 3ZEUA 2EWSA 4BG9A 1NM1A 3D2FA 4GVEA 4WQ5A 1E4GT 1K8KB 4C1NI 2WC9A 3HI0A 3MCPA 5AR0A 3CCMN 5BN9A 3P38A 1O13A 1GLLO 3ENHA 4J8FA 2F9WA 4KH6A 1BWFO 2ZGYA 3KWGA 4IDHA 4BG8A 4YOTA 2AP1A 3MK6A 4DCHA 1QZ5A 1LOTB 4FWOA 4ISEA 1R59O 3SLCA 3KVGA 4YDUC 4DQ8A 4CJ7A 4JKAA 1VQKN 1Z6RA 1EO1A 5JLHA 4IO8A 2DPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVO A;  1MDU B;  4FSV A;  4H5T A;  4QS9 A;  1TUU A;  1T44 A;  2Q36 A;  3DAW A;  2P9I A;  4FWQ A;  3U9D A;  2NZT A;  3HSC A;  4BRQ A;  2P9S B;  3IUC A;  1IJJ A;  3DWL A;  1JCF A;  3H3O B;  4FOE A;  2A40 A;  4K41 A;  4E1J A;  4BRM A;  2FXU A;  1NBW A;  2P9U B;  3UKU B;  2HMP A;  4CD1 A;  4YDU A;  1YAG A;  2NRH A;  2VCP A;  3GG4 A;  5AQL A;  5EVZ A;  5F1X A;  2P9N B;  4EHU A;  4H0O A;  5KQ8 A;  3FE1 A;  5AQO A;  3AAR A;  5FPM A;  2VYP A;  3CQY A;  3IDH A;  4CBX A;  4BQZ A;  3D2F B;  4CD3 A;  4H0X B;  5AQH A;  3RSE A;  5AQK A;  4B9Q A;  2FF3 B;  4BRL A;  1YXQ A;  3HZ6 A;  1BA0 A;  4BRH A;  3GOI A;  2Q0U A;  3M3Z A;  3VES A;  3AAQ A;  3O1B A;  3R6M A;  1NGI A;  3DJC A;  4FL9 A;  1X3N A;  2A6A A;  1NGH A;  2D0P A;  3BF1 A;  5KQD A;  1ZBS A;  1C0F A;  2FSJ A;  2V51 B;  4H0T B;  4IWV A;  4F9O A;  2A42 A;  4JHD A;  5BR9 A;  4BVP A;  4QS8 A;  2D1K A;  1MWM A;  2V52 B;  2QXL A;  1TYQ B;  5ADX A;  1U2V B;  1KXP A;  3W0L A;  2QWQ A;  3QFP A;  4RTF D;  3FZF A;  3HTV A;  3KHY A;  3VF4 A;  5BN8 A;  2A41 A;  3FZH A;  3M1F A;  2IVN A;  3CET A;  3ULE A;  4BR2 A;  4RWT A;  1BU6 O;  4RCH A;  3VEY A;  4A2A A;  2GUP A;  3BF3 A;  2YI1 A;  1HKB A;  5F2R A;  4FWK A;  4B1Y B;  3H46 O;  5BRH A;  2QWR A;  1K8K A;  1QQN A;  3UB5 A;  4BR5 A;  2P9L A;  2YHX A;  1QZ6 A;  5AQY A;  3RSE B;  2PAV A;  4M7Y A;  5EY4 A;  4BGA A;  5BRF A;  3CHW A;  3UKR B;  1ZXO A;  1GLB G;  2E2P A;  2Q2R A;  3J8A A;  3JS6 A;  1ZC6 A;  2YJF A;  3SMS A;  3WXK A;  3FZK A;  4BRO A;  5AQM A;  1RDW X;  2E20 A;  4H03 B;  3FR0 A;  3QBW A;  2YHW A;  1OKJ A;  3O08 A;  5EXW A;  4WYB A;  3LM9 A;  2P9S A;  1DEJ A;  5JLF A;  1HUX A;  4H5V A;  3VGL A;  2YCH A;  3LDN A;  1U6Z A;  5KPZ A;  2P9U A;  4FOI A;  3UKU A;  2E2Q A;  3DXK B;  5AQR A;  2Q97 A;  3VF6 A;  3FLC O;  5LJV A;  5AFU H;  1ESV A;  1NWK A;  2P9P B;  5JMV A;  1XQS C;  4CZL A;  4B1X B;  4CZM A;  3FGU A;  4IZ9 A;  1GLA G;  3KZB A;  2P9L B;  3QDK A;  1XUP O;  1YUW A;  3GL1 A;  4BRE A;  4GNI A;  5AQG A;  5AFU A;  1NLV A;  3ATU A;  3O5B A;  1TUY A;  3LL3 A;  3IMX A;  1DGK N;  4NB4 A;  5EOY A;  4B1Z A;  5AQN A;  1S22 A;  2AA4 A;  3L4I A;  5AZJ B;  2QW9 A;  3VEV A;  1C0G A;  3EZW A;  3L0Q A;  1NGJ A;  1J6Z A;  2E1Y A;  1BA1 A;  2E88 A;  2GEL A;  5LY3 A;  3ZX0 A;  1JCE A;  3ZX2 A;  1BDG A;  2QWP A;  2P9K A;  4CZI A;  1IG8 A;  1TYQ A;  1U2V A;  3GBT A;  5BPL A;  4BRK A;  2GTD A;  3MN5 A;  2DPN A;  2ZGZ A;  1X9J A;  4DB3 A;  4CZF A;  3H3N O;  2KHO A;  2HF3 A;  3VEO A;  3WXJ A;  4B1V A;  3ZET B;  1XC3 A;  4HWI A;  4BC2 A;  4AM7 A;  3TU5 A;  3VPZ A;  2E2O A;  3WEE B;  1V4S A;  2CGK A;  4EHT A;  2E2N A;  4FWR A;  2FLO A;  3FZM A;  4BR9 A;  4BC4 A;  3H1V X;  3EKS A;  2D4W A;  3U4L A;  2BUP A;  1KAY A;  3CJ7 A;  4FPB A;  5AQS A;  3HM8 A;  1QHA A;  4Z94 A;  1SZ2 A;  3UKR A;  2FSN A;  2I7N A;  5BRD A;  3A8Y A;  4H5R A;  3U8X A;  2V7Y A;  2ASO A;  4L3Q A;  1BUP A;  4FO0 A;  3CJB A;  5ADX H;  3ENO A;  5AQZ A;  1V4T A;  5E84 A;  2Q0R A;  5BRE A;  4CZH A;  5CE3 A;  1NMD A;  1RGI A;  3S41 A;  3I33 A;  4IXC A;  2QWO A;  4XH1 A;  2P9K B;  1QQM A;  3JXU A;  4BRF A;  3VEN A;  5AQI A;  3GE1 A;  2F9T A;  3MN6 A;  3A5L C;  5AQQ A;  5AQF A;  4BRN A;  3GDQ A;  1RFQ A;  3DXK A;  3A5O C;  3CER A;  5AQP A;  4FWM A;  1GLE G;  3WUH A;  2P9P A;  4KBO A;  1KAX A;  4JNE A;  2CGL A;  4I6M A;  3VEZ A;  2GWK A;  4JN4 A;  3CJC A;  2A3Z A;  2IVP A;  3D7E O;  5B8H A;  3VGK A;  3AAP A;  5AZJ A;  4MO5 A;  4XH4 A;  1HKG A;  5ELZ A;  2E8A A;  3DXM B;  2OAN A;  4JAX A;  1NGG A;  5EX5 A;  3ATV A;  4XEI A;  3VF2 A;  3W3D A;  3UE5 A;  3MDQ A;  3WT0 A;  4C23 A;  3OHR A;  3LDO A;  4BGB A;  3FFK B;  3TPQ A;  3MMV A;  2I7P A;  1LCU A;  5JIC A;  3A5M C;  2WUS A;  4A61 A;  3ZET A;  4K25 A;  3QFU A;  5I9E B;  3C7N A;  4BRP A;  2UYT A;  3WEE A;  3EN9 A;  2Q31 A;  4CZE A;  3WQT A;  4BRA A;  1GLF O;  4PKI A;  3ZX3 A;  5AQT A;  1KAZ A;  2YJE A;  4WQ5 C;  4I6M B;  4BC3 A;  3AY9 A;  3WXI A;  3WXL A;  4BRI A;  2GWJ A;  5F0X A;  2FF6 A;  2W40 A;  3H45 C;  4IJA A;  4IJN A;  1QQO A;  1YVN A;  4BR7 A;  4M63 C;  4H0Y B;  3L6Q A;  5FPD A;  3O8M A;  2CGJ A;  4PL8 A;  2QWM A;  4CBW A;  1NGE A;  4BC5 A;  1WOQ A;  4CI6 A;  3QIC A;  5AZI B;  3CJ1 A;  1D4X A;  2YHY A;  2BTF A;  2V7Z A;  3H6E A;  5KPR A;  3EKU A;  4FWP A;  5BPN A;  4M7X A;  1SAZ A;  1JCG A;  3BEX A;  2NLX A;  2ZF5 O;  2ITM A;  1T6D A;  1E4F T;  1SQK A;  4H0P A;  5TKY A;  1HLU A;  2W41 A;  1HX1 A;  3C7N B;  4EFH A;  1NGC A;  4WQ4 C;  4BR4 A;  1BOT O;  3BP8 A;  2ZWH A;  3C0B A;  5E26 A;  3IFR A;  3O6W A;  3D2E B;  2Q1N A;  5KPT A;  1ATN A;  3VER A;  1NGA A;  1DKG D;  5AQX A;  5AQJ A;  3O4W A;  2CH6 A;  4ISG A;  4PL7 A;  2ASP A;  1X3M A;  1Y64 A;  3VGM A;  4JD2 B;  3DXM A;  4PKH A;  4EAH D;  3VEX A;  4WQ4 A;  3MN9 A;  2VWB A;  3CI5 A;  2GEM A;  1P8Z A;  3M6G A;  3CQX A;  1ATS A;  1T6C A;  3ZEU B;  3ID8 A;  3HBT A;  2FSK A;  3EO3 A;  4CZK A;  4FWL A;  1NGD A;  2H3G X;  4BR0 A;  1GLC G;  3P4I A;  3SK3 A;  4QS7 A;  4FWS A;  4BRC A;  1BG3 A;  2IIR A;  3G25 A;  3I8B A;  3QBX A;  2QWN A;  1Z05 A;  3SJH A;  2D0O A;  2HF4 A;  4Y0W A;  1BO5 O;  4H5W A;  3B8A X;  4GY2 B;  2E1Z A;  3U9Z A;  4H0V B;  4CZG A;  2P9I B;  4CBU A;  1G99 A;  4MLE A;  5FPN A;  1S3X A;  4NO7 A;  4BRD A;  4BQL A;  4A62 A;  1H1V A;  1MWK A;  3FZL A;  4MO4 A;  3SMP A;  4BRG A;  1GLD G;  4DHY A;  3QB0 A;  5AQW A;  1NGF A;  2HOE A;  5AZI A;  3VOV A;  1CZA N;  5BPM A;  3O80 A;  2A5X A;  4K43 A;  3R8E A;  5LJW A;  3H1Q A;  4LC9 B;  2ASM A;  2IVO A;  4O5F A;  4MLH A;  5AQV A;  4CZJ A;  2CH5 A;  4K42 A;  4O8K A;  4FPA A;  1Q18 A;  3EL2 A;  4AM6 A;  3QML A;  1EQY A;  4H5N A;  4FWN A;  4B1W B;  1ATR A;  3CJA A;  5AQU A;  3F9M A;  3LDQ A;  4XH5 A;  2QWL A;  2QM1 A;  4EIA A;  3LDP A;  3A5N C;  3VEW A;  1WUA A;  1MA9 B;  4JHD B;  3CJ9 A;  3MN7 A;  3D2E A;  3WQU A;  4A2B A;  3R9P A;  3BUZ B;  1HKC A;  3LM2 A;  1GLJ O;  5FPE A;  3A0I X;  2J4R A;  4B1U B;  3O1W A;  4PKG A;  4JD2 A;  3VET A;  1HJO A;  1NGB A;  3ULE B;  2P9N A;  4HTL A;  1HPM A;  2PBD A;  4ISF A;  3LDL A;  3ZEU A;  2EWS A;  4BG9 A;  1NM1 A;  3D2F A;  4WQ5 A;  1E4G T;  1K8K B;  3HI0 A;  3MCP A;  5AR0 A;  5BN9 A;  4J8F A;  1GLL O;  3ENH A;  2F9W A;  1BWF O;  2ZGY A;  4BG8 A;  2AP1 A;  3MK6 A;  4DCH A;  1QZ5 A;  1LOT B;  4FWO A;  4ISE A;  1R59 O;  3SLC A;  3KVG A;  4YDU C;  4DQ8 A;  4CJ7 A;  1Z6R A;  5JLH A;  4IO8 A;  3CIP A; 
#chains in the Genus database with same CATH topology
 1TK8 A;  1U49 A;  3DAW A;  3U9D A;  3THW A;  3NF6 A;  3IUC A;  4H8K A;  3N4P A;  1A5V A;  1JCF A;  4K41 A;  3OS2 A;  1B9D A;  2FXU A;  3AGR A;  2P9U B;  3UKU B;  1RT6 A;  1YAG A;  2NRH A;  3GG4 A;  4CIE A;  3FE1 A;  1OH8 A;  5AQO A;  1WN7 A;  3CCE N;  1J5E K;  3CQY A;  3NF7 A;  4BQZ A;  2HHH K;  3D2F B;  4H0X B;  1L3T A;  4I9L A;  4PA1 A;  2G8F A;  4OX9 K;  2FBY A;  3M3Z A;  4MFB A;  3O1B A;  1BL3 A;  2A1R A;  3LZI A;  3K9J A;  2KFZ A;  3MEC A;  4A5A A;  1C0F A;  1HJR A;  4H0T B;  3K2P A;  4J2D A;  4JHD A;  1KVC A;  4YNQ A;  3ZSV A;  4KI4 A;  3C6T A;  1KFD A;  1MWM A;  4FW2 A;  3T19 A;  3L2W A;  1TYQ B;  3EZ5 A;  3CXC M;  4RTF D;  3QET A;  1N34 K;  1WNS A;  3VF4 A;  4FJ7 A;  4KKO A;  1TVR A;  3FZH A;  3M1F A;  2IVN A;  3ULE A;  1NK8 A;  1LWE A;  2X6S A;  4RWT A;  3T1Y K;  3V4I A;  1IV0 A;  2ZD1 A;  4FW1 A;  3BF3 A;  4E7L A;  4FVM A;  1LWF A;  4FZZ A;  3CYG A;  1QQN A;  4G9Z A;  3RMD A;  4XJX A;  3SAH A;  4CJ3 A;  1YF5 L;  4JK8 A;  3ULD A;  4M7Y A;  4CEZ A;  4CJ5 A;  4DUY K;  4CEB A;  3AVH A;  1TKZ A;  4FJ5 A;  2Q2R A;  3O4N A;  3J8A A;  2F8S A;  1ZC6 A;  4W5T A;  3LP2 A;  1RDW X;  2E20 A;  3FR0 A;  4YOX A;  2YHW A;  3O08 A;  5EXW A;  4ZTF A;  4WYB A;  3ISN C;  4AHR A;  1C1C A;  3O9Q A;  2YV0 X;  1HUX A;  4CJW A;  1QQC A;  3V1O A;  1J5O A;  3VF6 A;  3QIP A;  3AVI A;  4N76 A;  1ESV A;  4GKJ K;  1IBL K;  3AGK A;  4JRP A;  2VWJ A;  3O3H A;  1XI1 A;  3KIO A;  3MX5 A;  1RBS A;  3QES A;  2P9L B;  3QDK A;  4BE1 A;  4BRE A;  3TAQ A;  4DFK A;  3ZLJ A;  5AQG A;  5AFU A;  3O9R A;  3O5B A;  5EOY A;  4NB4 A;  4JI2 K;  4CFC A;  3HST B;  4PUO A;  5TKW A;  1D9F A;  4JYA K;  4ELV A;  1SL1 A;  1L3V A;  5SZT A;  3EZW A;  4UQG A;  1NGJ A;  2E88 A;  3D45 A;  1IBK K;  3CCS N;  3BZK A;  2XHB A;  4CZI A;  1U2V A;  4JKC A;  4CIG A;  2GTD A;  5CZ1 A;  2ZGZ A;  4LH5 A;  4DTM A;  4DB3 A;  4CZF A;  3OYD A;  4WFB L;  3H3N O;  3QEP A;  4M42 A;  4JI0 K;  2HF3 A;  4LF8 K;  3ZET B;  1FXX A;  3WXM B;  5HRS A;  4I7F A;  2E2O A;  2FC0 A;  1VQN N;  1T03 A;  1V4S A;  1RBR A;  2VG7 A;  2E2N A;  1FKP A;  4FWR A;  2FLO A;  3EEQ A;  2XY5 A;  4BC4 A;  3EKS A;  2D4W A;  4CK1 A;  2BUP A;  4E72 A;  1QHA A;  4EZ6 A;  1T7P A;  1F21 A;  4F3T A;  5BRD A;  3ZSR A;  4H5R A;  1B9F A;  3THY A;  2I5J A;  4L3Q A;  4FO0 A;  5ADX H;  4NXM K;  3ENO A;  3U3G A;  1L5U A;  1V4T A;  4BWM A;  3K57 A;  3Q7C A;  4O0I A;  1RGI A;  2IGI A;  4IXC A;  3CME N;  4OKJ A;  1ZBH A;  2P9K B;  2DFH A;  1YVU A;  3ENB A;  3JXU A;  3VEN A;  4JI3 K;  5AQI A;  3PO4 A;  5FRM A;  1TAU A;  2OPP A;  2Z1J A;  3K5N A;  5J2M A;  5AQQ A;  3M8Q A;  5IT9 O;  4KRE A;  4IOX A;  4Z4F A;  3JYT A;  1K8A O;  1QVG M;  1GLE G;  2OPQ A;  3WUH A;  4B08 A;  5LMN K;  2XY6 A;  3KK7 A;  1RT3 A;  2CGL A;  1S1V A;  4OPK A;  4I6M A;  4CED A;  1IKY A;  3DMJ A;  3VEZ A;  4DTR A;  3SQ1 A;  3CJC A;  1HYS A;  3AAP A;  4I2Q A;  4CES A;  5ELZ A;  1VQ5 N;  1VQ8 N;  1QE1 A;  4OLA A;  3DXM B;  4IOA L;  4JAX A;  3NVM A;  3VTI A;  4U7B A;  1MU2 A;  3QEV A;  1U48 A;  1TKD A;  1SKR A;  4IKF A;  2GX9 A;  3VF2 A;  5C10 A;  1FW6 A;  4JK7 A;  4KV8 A;  4BEC A;  4FLU A;  3MCA B;  4BGB A;  2JLE A;  2I7P A;  3MEG A;  5JIC A;  3KKR A;  4DKW A;  3NGZ A;  1VSM A;  3HRG A;  3SUQ A;  3AO1 A;  2Q31 A;  3E9O A;  3HJF A;  3WQT A;  3MWP A;  1GLF O;  4DV4 K;  4DV0 K;  1J53 A;  4WQ5 C;  4WCE L;  3DM2 A;  3ZSZ A;  4FJI A;  3H45 C;  4IJA A;  2R7Y A;  4FVU A;  3AO3 A;  1RT7 A;  4WE1 A;  1YVN A;  4DR3 K;  4BR7 A;  4H0Y B;  1IO2 A;  2Q3S A;  4FM2 A;  1I39 A;  4ELU A;  1YIJ N;  1OH6 A;  1NGE A;  1BI4 A;  4OPJ A;  4NLB A;  4CER A;  5C25 A;  1VAZ A;  4B9T A;  4OLB A;  1RTH A;  1DTQ A;  1WB9 A;  1SAZ A;  3BEX A;  3J81 O;  1HYZ A;  4LH4 A;  2ZF5 O;  4CGH A;  3NVK A;  4DF8 A;  3AVM A;  3V1Q A;  1N6Q A;  1T6D A;  1E4F T;  1JXE A;  2PZS A;  2W41 A;  3SV4 A;  3C7N B;  4EFH A;  4JKG B;  1NGC A;  1REV A;  3C95 A;  4BR4 A;  5GAE P;  2ZWH A;  3O6W A;  1C0M A;  1SUQ A;  4RW9 A;  2Q1N A;  2O4I A;  3O4W A;  1C6V A;  1HNI A;  4JKF A;  1YIT N;  1Y64 A;  4JD2 B;  1Z25 A;  4BE7 B;  2E6L A;  3TAM A;  3VMF B;  1Q81 O;  3HK2 A;  1S1X A;  3M6G A;  2O8C B;  4Z4C A;  4AHC A;  3RR8 A;  1KVA A;  2RHK A;  4G1Q A;  2H3G X;  4BR0 A;  1X9W A;  1GLC G;  2E6M A;  4ZHR A;  2OTL N;  4WFN L;  5KRS A;  3AVC A;  1BG3 A;  5BR8 K;  2HMI A;  5HOO A;  1DT9 A;  4CVN E;  5HLF A;  4B3T K;  3SJH A;  3NCI A;  4NCG A;  4H5W A;  3VA3 A;  1IKX A;  4JK9 A;  3NDK A;  3P39 A;  4DQR A;  4H0V B;  4OPH A;  4MLE A;  3P83 D;  5FPN A;  4CHQ A;  3WNE A;  4YHH K;  4BRD A;  4IDK A;  4CJK A;  3VQQ A;  3SMP A;  1MWK A;  3LAN A;  1GLD G;  1CXU A;  1FKO A;  3CMA N;  1ILY A;  2HHW A;  1IG9 A;  3VOV A;  1CZA N;  3OYM A;  3IG1 A;  2A5X A;  4AQY K;  5LJW A;  1D8Y A;  3H1Q A;  4DSJ A;  3E66 A;  3PX4 A;  2BDP A;  4W5O A;  1RT1 A;  1WAJ A;  4O5F A;  1VSL A;  1I3A A;  3QEW A;  1Q18 A;  4R79 A;  4H5N A;  1LAW A;  5AQU A;  2AJQ A;  2QWL A;  3T69 A;  2G8H A;  4JHD B;  4A2B A;  3MN7 A;  3D2E A;  4YOY A;  4I9Q A;  3R9P A;  1YTU A;  1HKC A;  4KHW A;  1GLJ O;  1NKE A;  4TSX A;  3K9K A;  3NF8 A;  4M3Y A;  1U45 A;  3HXM A;  3ULE B;  1HPM A;  2PBD A;  4ISF A;  5HRO A;  3TTC A;  3THX A;  3LDL A;  2EWS A;  1NM1 A;  4B3R K;  4KAZ A;  2UUA K;  1JLA A;  2BGG A;  3MCP A;  5AR0 A;  3VA0 A;  3P38 A;  3ENH A;  4KH6 A;  2YNI A;  1BWF O;  4IDH A;  3ZT0 A;  1QZ5 A;  4FWO A;  3VQ7 A;  4CFB A;  1M90 O;  3OA9 A;  3SAF A;  3ZSO A;  1E3M A;  2Q36 A;  4FWQ A;  3OYE A;  1ZBI A;  4FLV A;  3A2F A;  1IJJ A;  3DWL A;  1C1B A;  3H3O B;  3DRR A;  2YKN A;  4KHU A;  1DLO A;  1IBM K;  3L2U A;  5EVZ A;  2PFU A;  2ZJQ L;  4DU1 A;  2P9N B;  4EHU A;  1K9M O;  2VYP A;  3DOL A;  4DV5 K;  3L3V A;  1RTJ A;  2DFE A;  4H4O A;  4DTP A;  4N47 A;  3SYZ A;  3GOI A;  2VQE K;  4O55 A;  4IFY A;  2ATQ A;  1ZYQ A;  5C2D A;  2VGM A;  2XY7 A;  4IWV A;  3VN5 A;  2A42 A;  5BR9 A;  3HOS A;  3B6P A;  4BVP A;  4QS8 A;  2QXF A;  2D1K A;  1UAX A;  2V52 B;  4ICL A;  1CZ9 A;  1U2V B;  3W0L A;  2HNZ A;  2QWQ A;  3QFP A;  1L3U A;  1VSI A;  3FZF A;  3HTV A;  3KHY A;  1I94 K;  3CET A;  2QTD A;  1YTA A;  3AO4 A;  3O9U A;  3LAK A;  4FJ8 A;  5F2R A;  4B1Y B;  3OS1 A;  3SQ4 A;  1Q8I A;  3I0R A;  4Q5V A;  5BRH A;  5CY4 A;  4CJS A;  1K8K A;  2D0A A;  1TAQ A;  4HCC A;  4FJG A;  1OVY A;  3RSE B;  1VHX A;  3OTO K;  2HHV A;  3ZT3 A;  4CCH A;  2QK9 A;  1ZXO A;  2NRW A;  3OYA A;  3JS6 A;  3THY B;  1JL2 A;  1U04 A;  4DWI A;  4NLC A;  3WXK A;  3OYB A;  4DTN A;  4LF7 K;  4QAG A;  3DLR A;  1OKJ A;  3PV8 A;  2P9S A;  3IRX A;  3VQC A;  5LL6 Z;  2O8D A;  4MDA A;  3V81 A;  3EY1 A;  3V6D A;  5KPZ A;  1U6Z A;  4Z4I A;  2E2Q A;  2HVH A;  3IKM A;  3M5R A;  2Q97 A;  2VG5 A;  4B9U A;  5LJV A;  5AFU H;  4M3W A;  4OVL A;  4DFP A;  5JMV A;  4B1X B;  3FGU A;  4IZ9 A;  1WBD A;  4DF4 A;  1GLA G;  4DMN A;  3KZB A;  4FCY A;  1XUP O;  4AF1 A;  2HHS A;  1RCH A;  4FYD A;  4GNI A;  4B9V A;  3IMX A;  1DGK N;  1X9M A;  1S22 A;  2AA4 A;  1TK0 A;  3VEV A;  2HBL A;  4PWD A;  1J6Z A;  2E1Y A;  1BA1 A;  3MXJ A;  5LY3 A;  4R5P A;  4DTX A;  1NJI O;  3ZX2 A;  3VQB A;  1BDG A;  4AHU A;  2QWP A;  4DR5 K;  3SV3 A;  4DSE A;  3QNN A;  1RDA A;  3GBT A;  1U47 A;  3AVB A;  3E9L A;  4HCB A;  3WXJ A;  2EX3 A;  4HWI A;  4AM7 A;  3TAR A;  3VPZ A;  1UA1 A;  2YNF A;  1XHZ A;  3QIO A;  3ZT4 A;  3H1V X;  3U4L A;  1HMV A;  3I56 N;  5AQS A;  1HRH A;  3HM8 A;  4O8U A;  3NE6 A;  4E19 A;  2D0C A;  2FSN A;  4NXN K;  2RKI A;  4DR7 K;  3A8Y A;  4ILG B;  4OKE A;  2ASO A;  2OPR A;  2W6K A;  2LSN A;  4AIL C;  3AA4 A;  5KRT A;  4FLX A;  5BRE A;  1GOB A;  4CZH A;  3TAF A;  4OGC A;  4GVM A;  3S41 A;  3HVT A;  4M41 A;  4FLY A;  2KTQ A;  1HNW K;  3QNO A;  1NK6 A;  4K0K K;  5MLC Q;  4PY5 A;  4EZ9 A;  3PUF A;  4FK4 A;  4MDB A;  3ZSW A;  3GDQ A;  4BRN A;  2Z1G A;  3C65 A;  2O8F A;  4KH5 A;  1GOC A;  3H08 A;  2O8E A;  3CER A;  3CD6 N;  3DLE A;  1ASU A;  2OYQ A;  4JNE A;  3S9H A;  1EWR A;  1UWB A;  4EP5 A;  1SKS A;  4JS4 A;  2UU9 K;  4DQI A;  4DQQ A;  2GWK A;  4JN4 A;  3G71 N;  2IOC A;  1WBB A;  3SBG A;  3NMU A;  5B8H A;  3KLI A;  3VQD A;  4CHO A;  4CE9 A;  4X62 K;  4FJ9 A;  3NBP A;  1HKG A;  2QI2 A;  1G15 A;  2E8A A;  1P90 A;  1VQ4 N;  3D0P A;  3SPZ A;  4DFM A;  5EX5 A;  3KLG A;  3UE5 A;  3MDQ A;  3CM6 A;  4YY3 K;  3RMC A;  3EE8 A;  3SCX A;  1Q9Y A;  2PY5 A;  3G10 A;  3LDO A;  4C8O A;  5CYM A;  3MMV A;  4PQU A;  1LCU A;  1S9G A;  4MQ3 A;  4JKH A;  1M1K O;  4A61 A;  5C42 A;  3NGI A;  4HUE A;  1TK5 A;  4K25 A;  1QSL A;  1NK5 A;  3QFU A;  5I9E B;  2B6A A;  5GIP A;  4BRP A;  3T1A A;  3WEE A;  4CZE A;  3M8R A;  3AA5 X;  3OYJ A;  5DM6 L;  1C0T A;  3NGY A;  3SQ2 A;  4BRA A;  3ZX3 A;  1KAZ A;  4CEA A;  3LP1 A;  4BRI A;  3AO5 A;  2FF6 A;  2W40 A;  4BE2 A;  2RF2 A;  3TSP A;  5FPD A;  1N32 K;  4PHT X;  2CGJ A;  4B3O A;  1S5J A;  3VQ5 A;  3ID6 A;  1WOQ A;  3QIC A;  4CEC A;  3TAG A;  1QSS A;  4DR4 K;  2V7Z A;  1T3V A;  3U3Y A;  2Z1I A;  4LFB K;  2O4G A;  3DLG A;  4JKB A;  4E89 A;  5BPN A;  2ZJP L;  1JCG A;  2HBJ A;  2NLX A;  4CF0 A;  4KHY A;  1D5A A;  1CLQ A;  4CJ4 A;  1SQK A;  4H0P A;  3V9U A;  1VQM N;  4NCB A;  5E41 A;  4BDP A;  4CFA A;  3BP8 A;  4O4G A;  3C0B A;  1ZBF A;  3VQ8 A;  4IBN A;  3D2E B;  3QEI A;  5KPT A;  1NGA A;  3DOK A;  3O9S A;  4OGE A;  1UOC A;  2OZS A;  4J2E A;  3MN9 A;  3CI5 A;  2GEM A;  3CCU N;  3THX B;  2G8W A;  1T6C A;  5M1K A;  4U67 L;  3ID8 A;  3HBT A;  4LSN A;  4GMJ B;  2JWK A;  5C0Y A;  4KTW A;  4DR6 K;  2FSK A;  4DFJ A;  1EXQ A;  5JS2 A;  3P4I A;  3DLK A;  4QS7 A;  3PX6 A;  3CQ8 A;  4DQP A;  3CC7 N;  3KK1 A;  4E7I A;  3G25 A;  3QBX A;  4CF9 A;  3VQ6 A;  3RTV A;  2BAN A;  4Y0W A;  4DR2 K;  4W5Q A;  1RTI A;  3U9Z A;  3HPG A;  1G99 A;  3J7Y P;  4C8M A;  2W42 A;  2WBN A;  1A5X A;  4KHQ A;  3FZL A;  5C2F A;  2YX6 A;  2X78 A;  4O5B A;  1RT4 A;  3ALY A;  4DHY A;  3QB0 A;  1S72 N;  5AQW A;  1VSH A;  1DTT A;  1VQ7 N;  5AZI A;  3O80 A;  4O44 A;  4K43 A;  4B8A B;  3FFI A;  5AQV A;  1EX4 A;  1KTQ A;  1HNV A;  1VSE A;  3KLE A;  3LP3 A;  1C1A A;  4KB0 A;  3EL2 A;  4AM6 A;  1EQY A;  1NJW A;  1OVQ A;  3CJA A;  1JL1 A;  1NKB A;  4C1N K;  4FJK A;  4NYF A;  4EIA A;  3SPY A;  4W5R A;  1X9S A;  5A2Q O;  3THV A;  3WQU A;  3CJ9 A;  4X64 K;  3RRH A;  1WSJ A;  3Q7B A;  3A0I X;  2J4R A;  2EHG A;  4JI4 K;  3CC4 N;  2G8K A;  4DV2 K;  1JLQ A;  3DLL L;  2A1S A;  1OH5 A;  3R3L A;  2KFN A;  3OYC A;  2B5J A;  3D2F A;  4WQ5 A;  4C1N I;  1K8K B;  5I3U A;  4B9N A;  1NJY A;  3TWH A;  3CCM N;  1O13 A;  1GLL O;  2ZGY A;  3OYG A;  3UIQ A;  1IH7 A;  4XIU A;  4DCH A;  1NK7 A;  3AVN A;  1LOT B;  1R59 O;  4B9M A;  3KVG A;  3E01 A;  1S1W A;  4DQ8 A;  2KZM A;  1NU0 A;  4JKA A;  1Z6R A;  4KB1 A;  4BVO A;  4CF1 A;  4CJF A;  1TUU A;  1T44 A;  2P9I A;  2NZT A;  3HSC A;  2F96 A;  4DS4 A;  2G8I A;  2P9S B;  2BE2 A;  1T8E A;  4FOE A;  2A40 A;  2YNH A;  1UA0 A;  2HMP A;  3K0S A;  1QTM A;  4YFU A;  5AQL A;  4YOU A;  3KJV A;  4H0O A;  3AAR A;  1TKX A;  3IDH A;  3CPW M;  2FF3 B;  2YHA A;  4DLE A;  3HZ6 A;  1BA0 A;  4Z4H A;  4KH4 A;  3VES A;  1EWQ A;  3DRS A;  1S6Q A;  1RT2 A;  3DJC A;  3CF5 L;  3CFP A;  2A6A A;  1HR0 K;  4JV5 K;  1NGH A;  3BF1 A;  5KQD A;  4F8R A;  3TTF A;  2BH1 A;  4Z4G A;  2FSJ A;  5KGX A;  1NG9 A;  4CF8 A;  4K8X A;  3BGR A;  4FXD A;  3OBY A;  4GV3 A;  1X1P A;  1U4B A;  5ADX A;  3HL8 A;  5JVH L;  3THW B;  2IC3 A;  4X65 K;  3NF9 A;  5GIN A;  1KQS M;  4Z4E A;  3RMB A;  4OJR A;  4BR2 A;  2XO7 A;  3VEY A;  4A2A A;  1TL3 A;  4CHP A;  4KHN A;  3H46 O;  2QWR A;  2P9L A;  2YHX A;  4CJR A;  5AQY A;  2PAV A;  4FJX A;  5EY4 A;  4BGA A;  3OYN A;  4HUG A;  3O9T A;  3F5T A;  5J2P A;  3OS0 A;  2W6L A;  4FJJ A;  2E2P A;  2KKZ A;  3T7Z A;  4W5N A;  2YJF A;  4BDY A;  2NRZ A;  3CFR A;  3FZK A;  4BRO A;  5HRP A;  5DK5 A;  3QBW A;  3AA2 A;  1Q82 O;  1WAF A;  2QA4 N;  4B9S A;  1W2B M;  3VGL A;  2YCH A;  4WF9 L;  3PIO L;  3U6F A;  3LDN A;  4FOI A;  1SKW A;  2O8F B;  4LF5 K;  2O8E B;  3HM9 A;  3SNN A;  2GUI A;  5FDL A;  3RMA A;  4E7K A;  4A5B A;  2PYJ A;  1XQS C;  2O8B A;  4CZM A;  1BQN A;  4FLW A;  2DTU A;  2YKM A;  1YUW A;  2XY8 A;  4JKE A;  5HRR A;  3CFO A;  4FM1 A;  3ATU A;  2P1J A;  1TUY A;  3CM5 A;  5C12 A;  4B1Z A;  3I0S A;  1WSH A;  3CCQ N;  3CG7 A;  3S3N A;  2G8V A;  3L0Q A;  3MED A;  2D5R A;  2GEL A;  4DSL A;  3K59 A;  4QOZ B;  3I8D A;  5GAG P;  4HUF A;  3TAE A;  4IOC L;  1QVF M;  2P9K A;  4DUZ K;  1XMQ K;  3PSI A;  5BPL A;  4BRK A;  3MN5 A;  2OPS A;  1NJZ A;  1NKC A;  3D6R A;  4H4M A;  4M3U A;  3DYA A;  4CFD A;  3L2Q A;  4GV9 A;  3MEE A;  3IAY A;  1D9D A;  3TU5 A;  2KW4 A;  4X66 K;  3NH2 A;  3WEE B;  2CGK A;  1LWC A;  1NOZ A;  4BR9 A;  3FZM A;  2UUB K;  4B8C A;  1KLM A;  1KAY A;  4FPB A;  4IEI A;  1BIU A;  4Z94 A;  2W00 A;  3UKR A;  3LZJ A;  3U8X A;  1WSF A;  3CJB A;  4HHT A;  4DV1 K;  3BDP A;  5AQZ A;  3LPU A;  4OPA A;  4CIF A;  5CE3 A;  5FRN A;  1NMD A;  1W97 L;  1VQL N;  2QWO A;  1KD1 O;  3S3O A;  4BRF A;  4J2B A;  3GE1 A;  3MN6 A;  1TL1 A;  1QHT A;  3A5L C;  2HB5 A;  2JWL A;  5KGW A;  3DXK A;  3OYL A;  1J9A A;  3V9X A;  1VQ6 N;  5AQP A;  4JI1 K;  4CGI A;  4LY7 A;  1KVB A;  4FWM A;  3DLH A;  2P9P A;  4IFE A;  4KBO A;  1KAX A;  1RBV A;  4DV3 K;  4FK0 A;  5H1S Q;  4L8R B;  2IVP A;  1W9H A;  5AZJ A;  3TAN A;  3CCR N;  4M3X A;  3O3G A;  3TAB A;  4JI5 K;  4CHZ A;  1YJN N;  3SI6 A;  1Q7Y O;  2F4V K;  1SS6 A;  4IG3 A;  4XEI A;  3MAQ A;  3WT0 A;  5K14 A;  2HVI A;  4CJL A;  1VQP N;  3TPQ A;  1BIS A;  4FZX C;  3C7N A;  3WNG A;  1JLC A;  3EN9 A;  3PLA A;  4PKI A;  4N56 A;  2YJE A;  1XNQ K;  5CYQ A;  4I6M B;  4BC3 A;  2GBZ A;  3AY9 A;  3RR7 A;  4BY9 C;  2RE2 A;  3C94 A;  5F0X A;  4GV6 A;  5GAH P;  4CK3 A;  4IJN A;  4JKD A;  3V9W A;  4M63 C;  4FLT A;  3O8M A;  1VQ9 N;  4FZY A;  4PL8 A;  4CBW A;  1YHQ N;  4BC5 A;  2X6N A;  4CGJ A;  3CPE A;  5AZI B;  4AHS A;  1KC8 O;  2YHY A;  1JJ2 M;  2BTF A;  1ZBL A;  4F2S A;  3H6E A;  3EKU A;  3SAG A;  5HBM A;  2FBX A;  3VQE A;  5T7B A;  5C24 A;  3TSU A;  2XRI A;  3CC2 N;  1S1U A;  5TKY A;  4DSK A;  4GW6 A;  3PO5 A;  2E4L A;  3OBW A;  1LAV A;  1NMN A;  3AVA A;  3G4S N;  3M8P A;  5E26 A;  1ATN A;  4IO9 L;  2GV9 A;  1DKG D;  5AQX A;  2C1G A;  5AQJ A;  3RVC A;  5FLX O;  4ISG A;  3L4Q A;  3HOT A;  2ASP A;  2ITG A;  3VGM A;  5M1N A;  3VQA A;  4PKH A;  1J54 A;  3VEX A;  1ZBU A;  3J7Z O;  3AA3 A;  2FBT A;  4K8Z A;  5KI6 A;  2VWB A;  1P8Z A;  1BI4 B;  3CQX A;  4DTJ A;  4HVJ A;  4B3S K;  1LV5 A;  1JLG A;  3NFA A;  1KFS A;  4CZK A;  4A57 A;  1NGD A;  2F7T A;  3TTD A;  3KLF A;  1R0A A;  1VRT A;  2ETJ A;  2RPI A;  4FWS A;  2WON A;  3CYM A;  2IIR A;  1KRP A;  4Z0U A;  4OO1 J;  2KZZ A;  1ASW A;  3I8B A;  4LF6 K;  1BGX T;  3DI6 A;  2QWN A;  1Z05 A;  2D0O A;  4BEB A;  1RBU A;  3B8A X;  2OCE A;  2E1Z A;  3AVG A;  3AVK A;  1S6P A;  4C8L A;  4CZG A;  4LD0 A;  2P9I B;  3F73 A;  1BCM A;  4DTU A;  4FJM A;  4CJE A;  3CCJ N;  4CJQ A;  4NO7 A;  4DR1 K;  1HNZ K;  4KHP K;  1BCO A;  1H1V A;  4MO4 A;  1Y97 A;  4BRG A;  2C1I A;  3P31 A;  3NHG A;  4O0J A;  1NGF A;  1VK0 A;  2HOE A;  4BDZ A;  3ZSX A;  1W0H A;  5BPM A;  3VQ4 A;  4LC9 B;  2ASM A;  4I2P A;  1N8R O;  4MLH A;  4CZJ A;  3SUN A;  2RN2 A;  2VGN A;  4K42 A;  4O8K A;  2HW3 A;  3OYH A;  4FWN A;  1ATR A;  4KTQ A;  4F2R A;  3SBT A;  3F9M A;  2OTJ N;  4AHV A;  3NH1 A;  2HBM A;  5M1F A;  3TAP A;  1GOA A;  3LAL A;  4QCL A;  4KTZ A;  4C8N A;  3P5J A;  5KTQ A;  3LP0 A;  2VQF K;  3LM2 A;  4B1U B;  3M8S A;  3KWI A;  5DM7 L;  5D3G A;  4PKG A;  3VET A;  1NNE A;  5JS1 A;  4Q0B A;  2P9N A;  4HTL A;  1YJ9 N;  3DLB A;  1NK0 A;  3ZEU A;  3OVN A;  4BG9 A;  4B9L A;  4N5S A;  4CGG A;  3HI0 A;  1KSP A;  1XC9 A;  1N36 K;  5BN9 A;  1EP4 A;  1B92 A;  2IAJ A;  3KWG A;  4E1M A;  4BG8 A;  4YOT A;  4KRF A;  3SLC A;  3PSF A;  4CJP A;  4YDU C;  3KD5 E;  3IS9 A;  1Z26 A;  1EO1 A;  4CJT A;  4IO8 A;  1VSD A;  2DPN A;  5JLH A;  4J2A A;  3HP9 A;  1MDU B;  1WSI A;  4FSV A;  3DRP A;  4H5T A;  4QS9 A;  1HQE A;  4F4K A;  4ID5 A;  4BRQ A;  2D0B A;  3CCL N;  1JXB A;  2DY4 A;  3QLH A;  4E1J A;  4BRM A;  4CEE A;  3KK2 A;  1NBW A;  1KLN A;  4CD1 A;  4YDU A;  3RWU A;  2VCP A;  3K5M A;  5F1X A;  3E1Y A;  5KQ8 A;  1JLE A;  1RNH A;  2HNY A;  5FPM A;  1NJX A;  3ITH A;  3AVJ A;  3HPH A;  2KLA A;  4CBX A;  2O8B B;  4CD3 A;  1JLB A;  5AQH A;  3RSE A;  5AQK A;  4B9Q A;  4DS5 A;  1Q86 O;  3HVR A;  4BRL A;  1YXQ A;  4BRH A;  1HPZ A;  2Q0U A;  2G8U A;  1VRU A;  3AAQ A;  3R6M A;  4RW4 A;  1NGI A;  5J2Q A;  4FL9 A;  1X3N A;  2D0P A;  5LMU K;  1ZBS A;  4M3R A;  4E3S A;  4F9O A;  2V51 B;  3B6O A;  1XHX A;  4N41 A;  5M1O A;  2QXL A;  1KXP A;  2Z1H A;  1BHL A;  2HST A;  3LAM A;  2UXC K;  3SJJ A;  5BN8 A;  2A41 A;  3KLH A;  1BU6 O;  4RCH A;  1ITG A;  2GUP A;  2YI1 A;  1HKB A;  4WFA L;  4FWK A;  3UB5 A;  4IEE A;  4BR5 A;  1QZ6 A;  2OA8 A;  3E9P A;  3ZT2 A;  3R1X A;  4E0D A;  2WFB A;  4ID1 A;  3PX0 A;  5BRF A;  3CHW A;  3S5T A;  3UKR B;  4ELT A;  1GLB G;  3SUP A;  3SMS A;  1ASV A;  4YOW A;  3AVL A;  2ZJR L;  5AQM A;  4HTU A;  2DFF A;  4H03 B;  3C6H A;  3LDS A;  3LM9 A;  2YNG A;  4CW7 B;  1DEJ A;  4FJN A;  5JLF A;  4UY8 O;  4H5V A;  3ZT1 A;  4IG0 A;  2P9U A;  3UKU A;  2B4J A;  3DXK B;  3ZSQ A;  1S9E A;  1S1T A;  3HYF A;  5AQR A;  3T1H K;  3FLC O;  1NWK A;  2P9P B;  4JS5 A;  2Y1J A;  4CZL A;  2FBV A;  4NYN A;  5JVG L;  3GL1 A;  2WTU A;  2QKB A;  3C6A A;  3ZCM A;  1NLV A;  1BQM A;  3LL3 A;  5AQN A;  3L4I A;  5AZJ B;  4FK2 A;  2QW9 A;  2HHT A;  1C0G A;  2E5L K;  3ZX0 A;  1FK9 A;  2NRV A;  1JCE A;  1IKW A;  1SL2 A;  1IG8 A;  1TYQ A;  5DMR A;  3P1G A;  1XWL A;  2ZE2 A;  2O8D B;  1X9J A;  3BZC A;  3NAE A;  4LSL A;  5IWA K;  2KHO A;  4E1N A;  4EP4 A;  4BE0 A;  3VEO A;  1RDB A;  1TGO A;  3K5O A;  4B1V A;  1XC3 A;  4BC2 A;  1VSK A;  3K5L A;  1JKH A;  2Y1I A;  3J7A P;  1WSG A;  3L8B A;  4EHT A;  4LF9 K;  3CCV N;  3QEX A;  1WSE A;  1VSF A;  4B3M K;  4FJL A;  3CJ7 A;  4KPY A;  4KHS A;  1SZ2 A;  2I7N A;  1WLJ A;  2V7Y A;  5CHI A;  3F9K A;  1TV6 A;  1BUP A;  1EKE A;  3LPT A;  4IFV A;  4FM0 A;  1EET A;  4CHY A;  5E84 A;  2Q0R A;  1YT3 A;  4FLZ A;  3AO2 A;  3I33 A;  2UXB K;  4XH1 A;  4BWJ A;  1QSY A;  1QQM A;  4E7H A;  2VG6 A;  3O3F A;  5J2N A;  2F9T A;  2HHX A;  4E7J A;  2UXD K;  1O1W A;  3KKS A;  4CGD A;  5AQF A;  1RFQ A;  4ILH A;  3A5O C;  1VQO N;  1BIZ A;  3RRG A;  1N33 K;  1NK4 A;  2P5G A;  3MXM A;  5FRO A;  1CZB A;  1JLF A;  2NNW A;  3G6E N;  3OY9 A;  2IDO A;  3HO1 A;  2A3Z A;  3J80 O;  3D7E O;  3VGK A;  1RDC A;  4MO5 A;  4RG8 A;  4XH4 A;  5M1Q A;  2HHI A;  1RTD A;  2OAN A;  1RIL A;  3TR8 A;  1NGG A;  3ATV A;  3W3D A;  4BAC A;  4AH9 A;  3KD1 E;  2X74 A;  4C23 A;  3OHR A;  3OYF A;  3FFK B;  3EYZ A;  3MXI A;  2UUC K;  2HND A;  3AV9 A;  3A5M C;  4JI6 K;  2WUS A;  1FJG K;  3HP6 A;  3ZET A;  4DLG A;  3SZ2 A;  2UYT A;  3MWT A;  4JEP A;  3F2K A;  4YOR A;  3VQP A;  3JAM O;  3KK3 A;  4C8K A;  1RBT A;  4DV6 K;  5AQT A;  2NRT A;  4DTO A;  5AJ3 K;  4LFC K;  3G0Z A;  3WXI A;  3WXL A;  2GWJ A;  4DQS A;  4JI8 K;  1QQO A;  2VWK A;  3O4Q A;  5HL7 L;  2YHB A;  3OW2 M;  2NRR A;  2ZM6 K;  3L6Q A;  1A5W A;  4GKK K;  2QWM A;  3NH0 A;  4CI6 A;  1NOY A;  5HRN A;  1XNR K;  3BY5 A;  3CJ1 A;  3VQ9 A;  1D4X A;  2QEX N;  2PYL A;  5CZ2 A;  3OJU A;  5KPR A;  4FWP A;  3ZYY X;  3OJS A;  4M7X A;  3HPO A;  3PIP L;  3VTH A;  1SL0 A;  2KQ2 A;  4M45 A;  2ITM A;  4CEQ A;  5C15 A;  1CXQ A;  1HYV A;  1K6Y A;  1HLU A;  1HX1 A;  4DSI A;  1C0U A;  5GAD P;  4CF2 A;  4WQ4 C;  3N4Q A;  1BOT O;  4NCA A;  2HHQ A;  3IFR A;  4DSF A;  2QKK A;  2NRX A;  3VER A;  3LWM A;  3K58 A;  2CH6 A;  2P5O A;  4JRQ A;  3MX2 A;  3QIN A;  4PL7 A;  5SWM A;  1VSJ A;  1X3M A;  3DXM A;  4EAH D;  3TSQ A;  1RT5 A;  4WQ4 A;  1ATS A;  2ZQB A;  5M1P A;  3ZEU B;  3JSM A;  4CGF A;  4A59 A;  2IS3 A;  5J1E A;  3PY8 A;  4LF4 K;  3V1R A;  3EO3 A;  4FWL A;  3C6U A;  4RW6 A;  3L2R A;  3SK3 A;  1OH7 A;  3T3F A;  4BRC A;  3L2V A;  3LWL A;  4LFA K;  2P51 A;  4RW7 A;  4M3Z A;  2HF4 A;  1BO5 O;  5CR4 A;  4GY2 B;  3WNH A;  4DU3 A;  4CHN A;  4CBU A;  1S3X A;  4KFB A;  4M3T A;  2HBK A;  3ZSY A;  1YJW N;  4BQL A;  4CEF A;  4A62 A;  1LW2 A;  4CK2 A;  3QER A;  4RW8 A;  2NUB A;  1HNX K;  1K73 O;  1TKT A;  4ILJ A;  4KI6 A;  4CJV A;  4Y1D A;  4DV7 K;  1N5Y A;  3WNF A;  5GIO A;  3R8E A;  1QS4 A;  3I55 N;  3OYI A;  2IVO A;  4DU4 A;  5HP1 A;  2OZM A;  2CH5 A;  3OYK A;  4FPA A;  4FJH A;  1RDU A;  2HHU A;  3QML A;  3KTQ A;  3ASM A;  4B1W B;  1T05 A;  3LDQ A;  4XH5 A;  3V9S A;  2QM1 A;  4Y1C A;  4JKG A;  1Q9X A;  1LW0 A;  4F3O A;  4JI7 K;  3V9Z A;  3SUO A;  3LDP A;  1W7A A;  3A5N C;  3VEW A;  4DTS A;  1WUA A;  1MA9 B;  3BUZ B;  2JGU A;  3AVF A;  1XMO K;  5FPE A;  3S3M A;  1NK9 A;  3O1W A;  1HQU A;  4JLH A;  4JD2 A;  1HJO A;  4ZTJ A;  4DG1 A;  1NGB A;  3TI0 A;  4V19 S;  3SQ0 A;  1L3S A;  4YOV A;  1RDD A;  3EE9 A;  2O8C A;  1YI2 N;  5I42 A;  4KO0 A;  4GVE A;  3QO9 A;  1E4G T;  5EU7 A;  2WC9 A;  4AHT A;  2F8T A;  4CEO A;  4J8F A;  1SV5 A;  2F9W A;  3L3U A;  1KCF A;  5JEN A;  2AP1 A;  1IKV A;  3MK6 A;  4OKK A;  4ISE A;  2WOM A;  4CJU A;  4CJ7 A;  1VQK N;  3CIP A;  3HT3 A; 
#chains in the Genus database with same CATH homology
 4BVO A;  1M90 O;  1MDU B;  3OA9 A;  4FSV A;  4H5T A;  4QS9 A;  3SAF A;  1TUU A;  1T44 A;  2Q36 A;  3DAW A;  2P9I A;  4FWQ A;  3U9D A;  2NZT A;  3HSC A;  4BRQ A;  3CCL N;  2P9S B;  3IUC A;  1IJJ A;  3DWL A;  1JCF A;  3N4P A;  3H3O B;  4FOE A;  2A40 A;  4K41 A;  4E1J A;  4BRM A;  2FXU A;  1NBW A;  3AGR A;  2P9U B;  3UKU B;  2HMP A;  4CD1 A;  4YDU A;  1YAG A;  2NRH A;  2VCP A;  3GG4 A;  4YOU A;  2PFU A;  3E1Y A;  5AQL A;  2P9N B;  5EVZ A;  4H0O A;  4EHU A;  3FE1 A;  5F1X A;  5KQ8 A;  5AQO A;  3AAR A;  5FPM A;  1K9M O;  2VYP A;  3CCE N;  3CQY A;  2KLA A;  3IDH A;  4CBX A;  4BQZ A;  3D2F B;  4CD3 A;  4H0X B;  5AQH A;  3RSE A;  5AQK A;  4B9Q A;  3CPW M;  2FF3 B;  1Q86 O;  4BRL A;  1YXQ A;  3HZ6 A;  1BA0 A;  4BRH A;  3GOI A;  2Q0U A;  3M3Z A;  4KH4 A;  3VES A;  3AAQ A;  3O1B A;  3R6M A;  1NGI A;  3DJC A;  3CF5 L;  4FL9 A;  1X3N A;  3K9J A;  2A6A A;  1NGH A;  2D0P A;  3BF1 A;  4A5A A;  3TTF A;  2BH1 A;  5C2D A;  2VGM A;  5KQD A;  1ZBS A;  1C0F A;  2FSJ A;  2V51 B;  4H0T B;  4IWV A;  4F9O A;  2A42 A;  4JHD A;  5BR9 A;  3HOS A;  5M1O A;  4QS8 A;  4BVP A;  2D1K A;  3OBY A;  4GV3 A;  1MWM A;  2V52 B;  2QXL A;  1TYQ B;  5ADX A;  5JVH L;  1U2V B;  1KXP A;  3W0L A;  3CXC M;  2QWQ A;  3QFP A;  4RTF D;  2HST A;  3FZF A;  3HTV A;  3KHY A;  3VF4 A;  5BN8 A;  5GIN A;  2A41 A;  1KQS M;  3FZH A;  3M1F A;  2IVN A;  3CET A;  3ULE A;  2QTD A;  4BR2 A;  4RWT A;  1BU6 O;  4RCH A;  3VEY A;  4A2A A;  2GUP A;  3BF3 A;  3O9U A;  2YI1 A;  1HKB A;  5F2R A;  4WFA L;  4FWK A;  4B1Y B;  3H46 O;  5BRH A;  2QWR A;  1K8K A;  1QQN A;  3UB5 A;  4IEE A;  4BR5 A;  4G9Z A;  4XJX A;  3SAH A;  2P9L A;  2YHX A;  1QZ6 A;  1YF5 L;  4JK8 A;  5AQY A;  1OVY A;  3RSE B;  2PAV A;  3E9P A;  4M7Y A;  3R1X A;  5EY4 A;  4BGA A;  2WFB A;  3O9T A;  3F5T A;  5BRF A;  3CHW A;  3UKR B;  1ZXO A;  1GLB G;  2NRW A;  2E2P A;  2KKZ A;  2Q2R A;  3J8A A;  3T7Z A;  3JS6 A;  1ZC6 A;  2YJF A;  3SMS A;  2NRZ A;  4NLC A;  3WXK A;  3FZK A;  4YOW A;  4BRO A;  2ZJR L;  5AQM A;  1RDW X;  2E20 A;  4H03 B;  3C6H A;  3FR0 A;  3QBW A;  2YHW A;  4YOX A;  1OKJ A;  3O08 A;  5EXW A;  4WYB A;  3LM9 A;  2P9S A;  3O9Q A;  1Q82 O;  1DEJ A;  4UY8 O;  5JLF A;  1HUX A;  2QA4 N;  4H5V A;  1W2B M;  4MDA A;  3VGL A;  2YCH A;  4WF9 L;  3PIO L;  3LDN A;  1U6Z A;  5KPZ A;  2P9U A;  4FOI A;  3UKU A;  2E2Q A;  3DXK B;  3IKM A;  3M5R A;  5AQR A;  2Q97 A;  3VF6 A;  3FLC O;  5LJV A;  5AFU H;  1ESV A;  1NWK A;  2P9P B;  4A5B A;  5JMV A;  1XQS C;  4CZL A;  4B1X B;  3AGK A;  4CZM A;  3FGU A;  4IZ9 A;  3MX5 A;  5JVG L;  1GLA G;  3KZB A;  2P9L B;  3QDK A;  1XUP O;  1YUW A;  3GL1 A;  4AF1 A;  4BRE A;  4JKE A;  4GNI A;  5AQG A;  5AFU A;  3O9R A;  3C6A A;  1NLV A;  3ATU A;  3O5B A;  1TUY A;  3LL3 A;  3IMX A;  1DGK N;  4NB4 A;  5EOY A;  5TKW A;  5AQN A;  1S22 A;  2AA4 A;  4B1Z A;  3L4I A;  5AZJ B;  2QW9 A;  3VEV A;  1C0G A;  3CCQ N;  2HBL A;  3EZW A;  3L0Q A;  1NGJ A;  1J6Z A;  2E1Y A;  1BA1 A;  2E88 A;  2GEL A;  5LY3 A;  3ZX0 A;  1NJI O;  2NRV A;  1JCE A;  3ZX2 A;  5GAG P;  3CCS N;  4IOC L;  1BDG A;  1QVF M;  2QWP A;  2P9K A;  4CZI A;  1IG8 A;  1TYQ A;  1U2V A;  4JKC A;  3GBT A;  5BPL A;  4BRK A;  2GTD A;  3MN5 A;  2ZGZ A;  1X9J A;  3E9L A;  4DB3 A;  4CZF A;  3D6R A;  3H3N O;  4WFB L;  2KHO A;  2HF3 A;  3VEO A;  3WXJ A;  4GV9 A;  4B1V A;  3ZET B;  1XC3 A;  4HWI A;  4BC2 A;  3WXM B;  4AM7 A;  3TU5 A;  3VPZ A;  2E2O A;  3WEE B;  1VQN N;  1V4S A;  2CGK A;  4EHT A;  2E2N A;  4FWR A;  2FLO A;  3FZM A;  4BR9 A;  3CCV N;  4BC4 A;  3H1V X;  3EKS A;  2D4W A;  3U4L A;  2BUP A;  3I56 N;  1KAY A;  3CJ7 A;  4FPB A;  5AQS A;  4IEI A;  3HM8 A;  1QHA A;  4O8U A;  4Z94 A;  2W00 A;  1SZ2 A;  3UKR A;  2FSN A;  2I7N A;  5BRD A;  3A8Y A;  4H5R A;  4ILG B;  2V7Y A;  3U8X A;  5CHI A;  2ASO A;  4L3Q A;  1BUP A;  4FO0 A;  3CJB A;  5ADX H;  3ENO A;  5AQZ A;  4OPA A;  1V4T A;  5E84 A;  2Q0R A;  5BRE A;  4CZH A;  5CE3 A;  3Q7C A;  1NMD A;  1RGI A;  3S41 A;  1W97 L;  3I33 A;  4IXC A;  1VQL N;  2QWO A;  4XH1 A;  1KD1 O;  3CME N;  2P9K B;  1QQM A;  3ENB A;  3JXU A;  4BRF A;  3VEN A;  5AQI A;  5MLC Q;  3GE1 A;  2F9T A;  3MN6 A;  3A5L C;  2JWL A;  5AQQ A;  4MDB A;  5AQF A;  4BRN A;  3GDQ A;  1RFQ A;  3C65 A;  3DXK A;  4KH5 A;  4IOX A;  4ILH A;  3A5O C;  1K8A O;  1VQ6 N;  3CER A;  5AQP A;  1QVG M;  1VQO N;  4FWM A;  1GLE G;  3WUH A;  3CD6 N;  2P9P A;  4IFE A;  3KK7 A;  4KBO A;  1KAX A;  4JNE A;  2CGL A;  2NNW A;  4I6M A;  3G6E N;  3VEZ A;  2GWK A;  4JN4 A;  5H1S Q;  3CJC A;  3G71 N;  2A3Z A;  2IVP A;  3D7E O;  3SBG A;  3NMU A;  5B8H A;  3VGK A;  3AAP A;  5AZJ A;  4MO5 A;  4XH4 A;  3CCR N;  5M1Q A;  1HKG A;  2QI2 A;  5ELZ A;  1VQ5 N;  1VQ8 N;  2E8A A;  1P90 A;  3DXM B;  5C12 A;  1YJN N;  1VQ4 N;  2OAN A;  3NVM A;  4JAX A;  1Q7Y O;  4IOA L;  1SS6 A;  3VTI A;  4U7B A;  1NGG A;  5EX5 A;  3ATV A;  4XEI A;  2GX9 A;  3VF2 A;  3W3D A;  3UE5 A;  3MDQ A;  5C10 A;  3WT0 A;  3EE8 A;  4JK7 A;  4BEC A;  4C23 A;  3OHR A;  1VQP N;  3LDO A;  3MCA B;  4BGB A;  3FFK B;  3TPQ A;  3MMV A;  2I7P A;  1LCU A;  5JIC A;  3A5M C;  1M1K O;  4JKH A;  4DKW A;  2WUS A;  4A61 A;  3ZET A;  3HRG A;  4K25 A;  3QFU A;  5I9E B;  5GIP A;  3C7N A;  4BRP A;  2UYT A;  3MWT A;  4JEP A;  3WEE A;  3F2K A;  3EN9 A;  4YOR A;  2Q31 A;  3E9O A;  4CZE A;  3WQT A;  3PLA A;  3MWP A;  5DM6 L;  4BRA A;  1GLF O;  4PKI A;  3ZX3 A;  5AQT A;  1KAZ A;  2YJE A;  2NRT A;  4WQ5 C;  4I6M B;  4BC3 A;  4WCE L;  3AY9 A;  3WXI A;  3WXL A;  4BRI A;  2GWJ A;  4BY9 C;  2RE2 A;  2FF6 A;  2W40 A;  5F0X A;  3H45 C;  4IJA A;  4GV6 A;  5GAH P;  4FVU A;  4IJN A;  1QQO A;  1YVN A;  4JKD A;  4BR7 A;  5HL7 L;  4M63 C;  2NRR A;  3TSP A;  4H0Y B;  3OW2 M;  3L6Q A;  5FPD A;  3O8M A;  4PHT X;  2CGJ A;  1VQ9 N;  4PL8 A;  2QWM A;  4CBW A;  1YHQ N;  1YIJ N;  3ID6 A;  1NGE A;  4BC5 A;  4NLB A;  1WOQ A;  4CI6 A;  3CPE A;  3QIC A;  5AZI B;  3CJ1 A;  1KC8 O;  1D4X A;  2QEX N;  1VAZ A;  2YHY A;  2BTF A;  1JJ2 M;  2V7Z A;  1T3V A;  3H6E A;  5KPR A;  4JKB A;  3EKU A;  4FWP A;  3ZYY X;  5BPN A;  4M7X A;  3SAG A;  2ZJP L;  1SAZ A;  1JCG A;  3BEX A;  3PIP L;  2HBJ A;  2NLX A;  3TSU A;  3VTH A;  3NVK A;  2ZF5 O;  2ITM A;  3CC2 N;  1T6D A;  1E4F T;  1SQK A;  4H0P A;  5TKY A;  5C15 A;  1HLU A;  2W41 A;  1VQM N;  1HX1 A;  3C7N B;  4EFH A;  4JKG B;  3OBW A;  1NGC A;  5GAD P;  4WQ4 C;  4BR4 A;  3N4Q A;  1BOT O;  5GAE P;  3BP8 A;  2ZWH A;  3G4S N;  3C0B A;  5E26 A;  3IFR A;  3O6W A;  3D2E B;  2Q1N A;  5KPT A;  1ATN A;  2NRX A;  3VER A;  1NGA A;  4IO9 L;  1DKG D;  5AQX A;  2C1G A;  5AQJ A;  3O4W A;  3RVC A;  2CH6 A;  3O9S A;  4ISG A;  3L4Q A;  3MX2 A;  4PL7 A;  3HOT A;  2ASP A;  4JKF A;  1X3M A;  1YIT N;  1Y64 A;  3VGM A;  4JD2 B;  5M1N A;  3DXM A;  4PKH A;  4EAH D;  4BE7 B;  3VEX A;  3VMF B;  1Q81 O;  3TSQ A;  3J7Z O;  4WQ4 A;  3MN9 A;  2VWB A;  3CI5 A;  2GEM A;  1P8Z A;  3M6G A;  3CQX A;  3CCU N;  1ATS A;  5M1P A;  1T6C A;  3ZEU B;  3CIP A;  5M1K A;  4U67 L;  3ID8 A;  3HBT A;  4A59 A;  2RHK A;  2JWK A;  5C0Y A;  2FSK A;  3EO3 A;  4CZK A;  4FWL A;  4A57 A;  1NGD A;  2F7T A;  2H3G X;  4BR0 A;  3TTD A;  1GLC G;  3P4I A;  2OTL N;  3SK3 A;  4WFN L;  4QS7 A;  4FWS A;  4BRC A;  1BG3 A;  2IIR A;  3CC7 N;  3G25 A;  4OO1 J;  3I8B A;  3QBX A;  5HOO A;  1DT9 A;  2QWN A;  1Z05 A;  3SJH A;  2D0O A;  2HF4 A;  4BEB A;  4Y0W A;  1BO5 O;  4H5W A;  3B8A X;  5CR4 A;  4GY2 B;  2E1Z A;  4JK9 A;  3P39 A;  3U9Z A;  4H0V B;  4CZG A;  2P9I B;  4CBU A;  1G99 A;  4OPH A;  4MLE A;  5FPN A;  3CCJ N;  1S3X A;  4NO7 A;  2HBK A;  2WBN A;  1YJW N;  4BRD A;  4BQL A;  4A62 A;  1H1V A;  1MWK A;  3FZL A;  4MO4 A;  3SMP A;  2YX6 A;  4BRG A;  5C2F A;  1GLD G;  2C1I A;  3P31 A;  1K73 O;  4DHY A;  3QB0 A;  1S72 N;  4ILJ A;  5AQW A;  1NGF A;  3CMA N;  1ILY A;  1VQ7 N;  2HOE A;  5AZI A;  3VOV A;  1CZA N;  5BPM A;  3O80 A;  5GIO A;  2A5X A;  4K43 A;  3R8E A;  5LJW A;  3H1Q A;  3E66 A;  4LC9 B;  3I55 N;  2ASM A;  2IVO A;  1N8R O;  4O5F A;  4MLH A;  5AQV A;  4CZJ A;  2CH5 A;  4K42 A;  2VGN A;  4O8K A;  4FPA A;  1Q18 A;  3EL2 A;  1RDU A;  4R79 A;  4AM6 A;  2ZJQ L;  3QML A;  1EQY A;  4H5N A;  4FWN A;  4B1W B;  1ATR A;  3CJA A;  5AQU A;  3SBT A;  3F9M A;  3LDQ A;  4C1N K;  4XH5 A;  2QWL A;  2QM1 A;  2OTJ N;  3T69 A;  4JKG A;  4EIA A;  2HBM A;  5M1F A;  3LDP A;  3A5N C;  3VEW A;  1WUA A;  1MA9 B;  4JHD B;  3CJ9 A;  3MN7 A;  3D2E A;  3WQU A;  4A2B A;  4YOY A;  3R9P A;  3BUZ B;  1HKC A;  3LM2 A;  1GLJ O;  3Q7B A;  5FPE A;  3A0I X;  2J4R A;  4B1U B;  3KWI A;  3K9K A;  5DM7 L;  3O1W A;  4PKG A;  3CC4 N;  4JD2 A;  3VET A;  1HJO A;  1NGB A;  3ULE B;  3DLL L;  2P9N A;  4HTL A;  1YJ9 N;  1HPM A;  4YOV A;  2PBD A;  4ISF A;  3EE9 A;  3R3L A;  3TTC A;  1YI2 N;  3LDL A;  3ZEU A;  2EWS A;  4BG9 A;  1NM1 A;  3D2F A;  4GVE A;  4WQ5 A;  1E4G T;  1K8K B;  4C1N I;  2WC9 A;  3HI0 A;  3MCP A;  5AR0 A;  3CCM N;  5BN9 A;  3P38 A;  1O13 A;  1GLL O;  3ENH A;  4J8F A;  2F9W A;  4KH6 A;  1BWF O;  2ZGY A;  3KWG A;  4IDH A;  4BG8 A;  4YOT A;  2AP1 A;  3MK6 A;  4DCH A;  1QZ5 A;  1LOT B;  4FWO A;  4ISE A;  1R59 O;  3SLC A;  3KVG A;  4YDU C;  4DQ8 A;  4CJ7 A;  4JKA A;  1VQK N;  1Z6R A;  1EO1 A;  5JLH A;  4IO8 A;  2DPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...