3RSEG

Structural and biochemical characterization of two binding sites for nucleation promoting factor wasp-vca on arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
136
Chain Sequence
RFRKVDVGEYDENKFVDEEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 41
structure length 136
sequence length 142
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3rseG00
2P9SG 1K8KG 2P9UG 2P9IG 3DXMG 2P9LG 4XEIG 3DWLG 3DXKG 2P9KG 2P9NG 4JD2G 1U2VG 3RSEG 3ULEG 1TYQG 3UKUG 3UKRG 2P9PG
chains in the Genus database with same CATH superfamily
3UXGA 4U0SA 1N9AA 3LVQE 2XPZA 2WVIA 4GTOA 1S0PA 4HI9A 4WAFA 3UT7A 3ML9A 2V5QC 5A6CA 2RG8A 1BI7B 2JLBA 3AG3E 2L0TB 3APCA 5JJ6A 4X8QA 4U8YD 4BX9A 2OCCE 5D66A 4HLEA 5KBAA 3KS2A 4AP2A 4XE0A 4JVSA 2Y0BG 3TG4A 3ZRHA 2ZGGA 3CKCA 2UY1B 3AS4A 1OWNA 4ANUA 3W9GA 2Q7FA 3B95A 4JPSA 3PREA 5KWDA 3CVQA 1YA0A 3PS6A 3KEZA 3LVRE 3QJZA 3URZA 1FT1A 3CSTA 3C3RA 3G2TA 3UMVA 2WMNA 3JXJA 4I1OB 2XCCA 3LY9A 3L82A 3TWUA 4EZLA 2VTBB 3GZ1A 2NC9A 1JCRA 4EHMA 3TAXA 5KJMA 4L2YA 1DCQA 4G25A 4L1BA 1INZA 3ASFA 3UX4A 3QOUA 4FC8A 2XPIA 3Q4AB 3D9MA 2XRZA 4URKA 2FBNA 3T5XA 3SO8A 4YDEA 4GTVA 4IRUA 4XEIG 4J8FA 4AY6A 3UINC 3C3QA 3AS5A 1NFIE 2Y4UA 3CIAA 4B89A 5CEAA 2L6JA 4CCAA 3B7TA 3AJIA 2KATA 2VGYA 2FO1E 1YCSB 1OWMA 3TWVA 1N0QA 1IHBA 3CKBA 2KZTA 1TN6A 1FPPA 1SQMA 5ENQD 3NZSA 3ASNE 1DC2A 3E4BA 1ELKA 3FY4A 1JPLA 2IEJA 1E90A 4O60A 3DSVA 1JUQA 3O48A 1EF1C 1KZOA 3CVXA 2YHCA 2F37A 3DXMG 1OCRE 1JCQA 1NZNA 4A3TA 2KZTB 4CT0A 4GYOA 4BWRA 5LFAA 4BY6A 5ENTD 2AW6A 3B7UX 5HS0A 5ARFA 2VQ2A 5E76A 4GCNA 4NURA 3QWPA 5JMND 5ENOD 4F1SA 5BT1A 3J5QB 1N54A 4ILIA 3SFYA 2YINA 3OXGA 3FTXA 2XRYA 4NQ0A 2XGSA 5T4YA 3QWVA 4U8VD 3K9IA 5AYWD 5AJLA 5T3RA 3RK6A 3I5PA 2WXIA 5EX0A 5G55A 2E0IA 1OXJA 3FDHA 1PY1A 3FUEA 1H19A 3B7SA 3RSEG 5BV0A 1N4PA 4HOSA 1HE8A 3ZU7B 4ILHB 2HYZA 4UWHA 3S7JA 2V4LA 3Q75A 4I43A 4TRQA 1WY6A 4HI8A 5EYLA 2WQ6A 5CECB 2HR2A 3ULEG 4CRWA 2P9KG 3TJPA 3X2QE 4ANWA 3NOCD 2F8XK 1OWPA 3LY7A 4LERA 4K03A 1PAQA 3HXCA 4HFGA 5DBKA 1HG5A 3FH7A 1S64A 3CQGB 4G1TA 2AJAA 5G2NA 4LUNU 1OUVA 4UQXA 5EX3A 4F7AA 4F3VA 3CHPA 4JXTA 3RIBA 2HO1A 3QKYA 1UOHA 2VJ8A 3TXNA 4GZCA 4ZHBA 3S7FA 4JZYA 4KZ0A 3UM1A 1QQEA 3V30A 4CGVA 2F0YA 3ZVVA 4Z68A 4AV7A 4MS6A 1KT0A 2MOWA 2JEKA 2MRIA 3SD5A 3CQCB 3OXLA 3FTWA 1WAO1 2P58C 1TN7A 4J7WA 4E85A 4MRUA 2X6FA 4UUCA 3HVEB 3IXEA 1MQSA 5FQ8A 5JHBA 3D9HA 5BXOA 3Q15A 3ZYMA 3FEYA 3TWXA 3EDTB 2IOSA 3MKRA 5CBNA 4RLYA 3GZSA 3RAUA 3NF1A 1K1BA 4C9BB 2NYJA 3CHSA 4G8LA 3SY2A 3JUIA 2C0MA 1FCHA 4TUUA 5AQ7A 3VTYA 4FJZA 3SBTB 3CK7A 1SZ9A 3Q5MA 4A63B 1TNYA 4LCTA 2WXQA 5IY5E 5D0QD 1H2TC 2J49A 5G04C 2J07A 5G04J 1IHGA 3ABME 3DSTA 1HF8A 3CHMA 3HDXA 1BPOA 5FQ6A 5EDSA 3ESLA 4KXKB 1TYQG 4CEMA 4A1SA 4OAUC 1SA5A 3RRMB 3QAQA 3ONLA 3S7DA 4BX8A 1RZ4A 2LSUA 2EIKE 4GMLA 3MV3B 4ZFHA 3PNLB 3DXKG 3BEEA 4DI4A 3UI2A 2A5EA 1QNFA 1TJFA 3RRNB 1N4SA 3KD7A 2DZOA 5FT9A 3ML8A 3FUDA 5EIBE 4GPMA 4WNFA 1ZU2A 4L7TA 2IO2C 2XZDG 4D10C 3TG5A 2DIWA 2XS1A 1OWOA 3EHMA 3FU0A 3PRZA 5ENNA 1OWLA 4AJWA 3T9KA 5C1DA 3ZHEB 4J8EA 3VLEA 3CVWA 3RKVA 4GTTA 1DNPA 4KVMA 3MZLB 5FZQA 4HRMB 2EINE 5AIJA 1D8EA 4G11A 3PZ2A 3CK9A 4DLQA 3SZ7A 2OEVA 3HRAA 3PUJA 1TN8A 5CHEE 1YMPA 2DYSE 4N39A 3CEQA 2DVWA 5CCLA 4RSYA 2WXFA 2AXVA 4EBAA 4CGWA 2CHZA 3FU6A 5LCWJ 1UW4B 4NRHB 1HX8A 3ZXSA 3AU4A 2VSYA 4L2LA 1H6KA 3MGBA 1D9SA 4JEUA 2PQRA 2LNIA 4FLHA 4UI9C 2VGXB 2PM7A 4UQYA 4N5QA 4U96D 2BEDA 2XGMA 2C0LA 4WNEA 4UWKA 2GRPB 3I3NA 4XIFA 5JA4D 3S2AA 2L9BA 5H7PA 4DX5D 1HZ4A 2WXRA 4J8SA 3SNXA 2J4DA 3NBNB 1PC2A 3I4RB 4IYPA 2WXKA 4OVVA 1BI8B 2X6JA 2EIJE 1H2UA 4TUMA 2J09A 1N4RA 1E8YA 3L22A 3TWWA 3TWTA 4U0UA 2DBAA 2Y3AA 4ABNA 3AU5A 4I6EA 3F6QA 3HG0D 3FUHA 3L9TA 4O6FA 4B8CB 2I6HA 3CV0A 2FEZA 5G05J 4M7CA 3T8KA 4DUIA 3WG7E 3UPVA 2BKGA 3APDA 4JL0A 3Q7FA 1DCEA 5FQ4A 3EJNA 5EN5D 3ZEFA 2NXPA 3JYSA 1NP7A 2XEVA 4I9EA 1WM5A 3E37A 4FU3A 3UT8A 4DX1A 2PQNA 3DRAA 3GZ2A 2V5FA 1WDYA 3D9IA 3ULYA 4DX7D 4GMJA 4TXQA 2WM9A 2IF4A 1U3DA 4N2QA 2QYJA 1FT2A 3SHFA 4RG9A 2B0OE 3L08A 3LS8A 4GYYA 4CDMA 3TXMA 1U3CA 5FZSA 2BTDA 2ZISA 3AG1E 5FTPA 3TL5A 1V55E 1KLXA 2PNNA 4ILGA 3IBEA 3UM0A 5ARGA 2NSZA 3RRUA 4FADA 3DSSA 4G23A 3FUKA 2VGXA 2VYIA 4HRNA 5AENA 3C5RA 2GRMA 1S70B 1E8XA 2WXMA 1OCOE 3FTZA 5HQ8A 5LX8A 1OCCE 2XPYA 5ENPD 2VSXE 5AJDA 2WPVA 4APFA 3QWWA 3RO2A 2WXGA 3Q47B 3IEGA 1KZPA 1X5BA 4G2VA 1K3ZD 2XQ0A 1TNUA 3U9WA 3ABKE 3TWSA 3U66A 4KVOA 5E75A 5CMWA 4XKCA 3ZHEA 3ZGQA 4FP7A 4TV3A 2QYUA 2WQHA 4XZ4A 2X38A 3D9NA 3EIQC 4HVBA 2OOEA 3FU5A 3LKUA 2KCVA 2XHEA 4F6RD 3CVLA 2WXLA 3OTNA 3C3OA 4OAVB 3E34A 4A1GA 2DCPA 2H6FA 3T5VA 5CBOA 1Z6TA 3ASDA 3PE3A 3PVLA 3SBSA 4GB9A 3FP3A 1H6OA 2BF0X 4QFVA 4TXRA 2R02A 1KPSB 4LEUA 1HG2A 3SF4A 4MLPA 5CRVA 2LO6A 5CCMA 3FU3A 4AIFA 3ZUVB 1OT8A 4BETA 3MV2B 3FUNA 4CDNA 3SFZA 1BU9A 3AG2E 4FLBA 1K8KG 2WXPA 3Q78A 4KZCA 3AS8A 3CLJA 2P9LG 3DSWA 1UN8A 5KJNA 2ONDA 3V2OA 5LP0A 3NOGD 2UY1A 4GTQA 3ISMC 5KNGA 4I9CA 1BD8A 4FULA 5BV1A 3Q49B 4BTBA 2QFCA 2XCBA 1G3NB 1Z3YA 3NAWA 2M63A 4AVXA 3RU0A 3RJVA 3ENEA 5M72A 4G8KA 1UG3A 5KNHD 4GZ5A 2Y4TA 2FO7A 1Q2ZA 4RQIA 1K1AA 4DK5A 4BESA 3LJNA 2DZNA 3LEWA 3C98A 1HH8A 3G2VA 3FULA 1O1SA 4MKTA 5JJ7A 3ASOE 3R9MA 3CGHA 2OV8A 3QK0A 2YHEA 3ONKA 5HKPA 4N3AA 4NIKA 4I6JA 3CHQA 5JHAA 2ILRA 3GYZA 4GCOA 4UQZA 4ACKA 1HXIA 4KT6B 3UTMA 3AAAC 4NACA 5CMYA 5D0OD 3NB2A 4I17A 3DSUA 4MBGA 1D8DA 3QARA 3FHEA 3FUIA 4Q96A 2VSOE 3UKRG 3ASHA 2LXLA 4L23A 4XX5A 4B8AA 2EQXA 3MCXA 4U07A 5C2YA 2GRLA 2I1KA 3ZW3A 3Q9UC 2HE0A 1S63A 1TNBA 3IHVA 4GA2A 2WXOA 2IY0C 2KM4A 1O5MA 1KT1A 2WXNA 4I1AA 4O1OA 3EHQA 4AOFA 4PDXA 5EIDA 3MA5A 4A55A 4BSXA 3UIPC 2V0PA 5ITZF 5BW8C 2VGEA 3KEAA 3ZNGA 3E32A 1MX4A 3PUKA 1IQRA 3PZ1A 4R7LA 4LNBA 3NQPA 4FHJA 1N0RA 4DX2A 3LDZA 1AP7A 3TGOA 4JEHA 2R2LA 4ACLA 1N95A 1LD8A 3TWQA 1V54E 1YYHA 2QZAA 4AXHA 3R9AB 4U8HA 3LY8A 4WWPA 3HXEA 1IKND 2R05A 4PS3A 3MKQA 1EYHA 2I1JA 4KMOA 2VTBA 1MX6A 2VSNA 3D9PA 4J8DA 4YVOA 2LUHA 4XI0A 4YDYA 4I6GA 3PZ4A 4JA9A 2GRNB 3EHRA 4HBDA 2ETAA 4K5AB 5G05C 3DEOA 4BFRA 2RFMA 2RFAA 3JUEA 4GAAA 3PZDA 4WWOA 5ENRD 2V4HC 4I2WA 5J08A 4BT9A 3V31A 3CVPA 4Y6CA 5B1AE 3C72A 3P2BA 4CZ2D 4U04A 2CFUA 5A23A 4N3CA 3LCAA 5BPPA 1N11A 3IV0A 2IOLA 4EZJA 3Q79A 4N5CA 1Y8MA 3LPZA 3PH0C 3Q73A 1A17A 2AXUA 3EU9A 3UUXA 2IO3C 2R03A 4M3OA 1ELWA 4P29A 1RW2A 3EU5A 3CR3A 2ETCA 4ANVA 4BERA 4EECA 3P1UA 3V2XA 3PZ3A 5FQ7A 2AVPA 3UKUG 5ANRA 2IJGX 3ZN3A 4ATGA 1FVHA 3CK8A 4EZKA 1NI1A 1E7VA 4JB8P 4HORA 3B7BA 4PUCA 2X6IA 3VLFA 3JCKC 3D3MA 5LOZA 4YDWA 4XI9A 3PE4A 2MHKA 4DLOA 3FTSA 2AWIA 4HOQA 4JA7A 4RVBA 5AQBA 3ZYKA 4PS8A 2P9NG 2EILE 4CYMD 2KCKA 3D9KA 3U4TA 2ETBA 3FEXA 3VTXA 4G26A 2XEHA 3SGHA 4PH4B 1VDYA 4Y6WA 5FINA 1EPUA 5ANLA 3ZYLA 3UIOC 4HNAD 3ZIMA 3PNTB 3OXFA 4HXIA 1DVPA 3FTUA 4N3BA 1IYGA 4HOUA 5HI7A 3UQ3A 4EPZA 1H6PA 2P9PG 4GMRA 5D2MC 3DPDA 2I2OA 2CHWA 2FI7A 3NZUA 1OY3D 4FJYA 3UT4A 1JWFA 3ULQA 2UWJG 2Y69E 2GGFA 4E6HA 2X6KA 4GZDA 4H7YA 2OVBA 4I2ZA 2GRRB 2L6BA 3JQ0A 2ZIRA 1UN9A 3MYVA 5AAOA 4F53A 3D9JA 3U3WA 4O1PA 4K0RA 1MJ0A 3FUMA 4CDRA 3V79K 3ABLE 1UJJA 5KJKA 2H6IA 3ESKA 3BG0B 2IQCA 2WB2A 2KC7A 4HQDA 5AQAA 3ZXPA 4PS7A 3QB2A 3CHRA 4Q94A 2FULA 4LG6A 2J08A 3FTVA 3L17A 4YDOA 4V3IA 4F1PA 1QBQA 1B89A 2LAHA 2J8SD 4GA0A 4UWFA 3L6AA 5BXUA 4WNGA 3JXIA 1TEZA 4AY5A 2KXPC 2MYOA 3LXUX 4LRZA 4WNDA 1TNZA 4JHKA 1H2VC 4UI9K 5BNWA 4HB5A 4ME2A 3PDNA 3CSFA 3Q7AA 5KCMA 3QC1A 4B93B 5FIOA 3ASGA 4C0EA 2R59A 1EDUA 4UWGA 1ZBPA 1O1TA 3BUAA 1A5EA 1U2VG 4L9PA 2P2CP 4AM9A 4WWNA 3ZFWA 3ZKJA 3HXDA 4G24A 5DIZA 3WXXA 4OYSA 3HIZA 4U0ZA 2IU1A 2YNQA 1E8ZA 4EBAG 4GTSA 3UM3A 4BSZB 4DI3A 4B94A 5A7DB 2PM6A 2FF4A 1NA3A 1TNOA 4GA1A 1L5JA 3ZPJA 5J90A 4EQFA 3PEVB 3DBSA 3FWVA 1Z5SC 3D9LA 3ZYQA 2P9UG 4C0MA 5B3SE 2RKKA 4BTAA 2XGOA 3HYMB 3OAWA 2QY7A 3MEKA 5AN8A 3FFLA 3G2UA 3B13A 4U7EB 2BUGA 4XKBA 3N71A 4B0ZA 1X81A 2CFZA 1MHQA 2Y1LE 3AG4E 2A4ZA 1N4QA 1ELRA 1LD7A 1IQUA 2CG2A 4DX6D 3DPYA 3HXFA 3O4ZA 5FWQA 3IHYA 4N2SA 4I1MA 4BEPA 3UM2A 5EILA 4GZ3A 5CRUA 2B6CA 4RG6A 2DWZA 3W9FA 3DSXA 4C48B 2P9IG 4HRLA 1NA0A 2OVFA 3EHNA 3S7BA 3SI5A 3FUJA 3HVEA 4HOTA 1GW6A 1ZB1A 1SA4A 3MJWA 2PL2A 1SW6A 2J4BA 3L54A 3G2SA 2EIME 1JCSA 2WXJA 1BLXB 2XEEA 2R17C 2E2EA 1AWCB 3CHOA 2H6GA 4YNDA 4Q69A 4FHKA 1N94A 1Y6IA 3DWLG 4OVUA 4A3VA 2LXMA 4QQIA 3SFXA 5KJLA 4GU5A 4ANXA 3TWRA 1UJKA 2C2LA 3JQ1A 4YVQC 1JWGA 3E30A 3MX3A 4U63A 2H6HA 1E7UA 2DYRE 1TR4A 4GTMA 3SQVA 1IXVA 4GTPA 4JHJA 5CEDB 1LF8A 2GW1A 2CHXA 1H0AA 2AXZA 2ZU6B 1W3BA 1TJCA 2GROB 4APOA 3L16A 3LJ3A 3Q9NC 1P5QA 2LSVA 4DPRA 2WQ7A 3APFA 3MKQB 1HU3A 3BQOA 4AEZC 3IKOB 3I4GA 3VLDA 2YQ8A 2KBXA 1QZ2A 1MZCA 2L0IA 3QNKA 5ENSD 4W9RA 2WMOA 3CVVA 3BU8A 3L13A 3CVYA 4H7XA 3PEUB 1HS6A 4LNUD 3J5PA 1Z3XA 3CVNA 1O1RA 4FA6A 1MX2A 5LCWC 3E33A 4WUYA 3CVUA 2PZIA 2BKKB 4JW1A 2HM8A 3R7QA 2OEWA 3BG1B 3QDNA 2XZTG 1MYOA 4GZ6A 4J8YA 3KSQA 4DRXE 2CG3A 4IN3B 4LSZE 4HS2A 3R7RA 4IULA 5B1BE 5EYPF 2IONA 1HFAA 4K5BA 4DJAA 1QYMA 4J0UA 3FTYA 2RD0A 2ZGDA 2IFUA 4K5CA 3FH8A 5AQ9A 1LTXA 2A5UA 4UWLA 2I9CA 2V8SE 3U64A 3B7RL 3G2WA 3DEPA 3HXBA 5AARA 1NL4A 1WG0A 4CT4A 2JABA 1FVFA 2KCLA 1XNFA 2GRQB 4JHRA 4J6IA 3LYAA 5FJYA 1SVXA 2XENA 4KBQA 5BUZA 4GYWA 2XS8A 5HRYA 4LNGA 2X3MA 2P9SG 2R5SA 4JC8A 3T8MA 1OCZE 5EKQD 5CERB 5FZRA 2ZXWE 4KYOB 3FH5A 5T8IA 2J9QA 3HHMA 2X6HA 1E96B 1HO8A 4HLLA 3GW4A 2LAIA 4U95D 4JD2G 3FUFA 3RO3A 2F8YA 4UI9J 3KSLA 4GPKA 3EIJA 1N52A 2QC9A 4BT8A 1E8WA 5JJTA 1XGWA 4TXPA 4GTRA 3KAEA 4ATZD 3EUVA 2WXHA 1SZAA 3D9OA
chains in the Genus database with same CATH topology
2P9SG 1K8KG 2P9UG 2P9IG 3DXMG 2P9LG 4XEIG 3DWLG 3DXKG 2P9KG 2P9NG 4JD2G 1U2VG 3RSEG 3ULEG 1TYQG 3UKUG 3UKRG 2P9PG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9S G;  1K8K G;  2P9U G;  2P9I G;  3DXM G;  2P9L G;  4XEI G;  3DWL G;  3DXK G;  2P9K G;  2P9N G;  4JD2 G;  1U2V G;  3RSE G;  3ULE G;  1TYQ G;  3UKU G;  3UKR G;  2P9P G; 
#chains in the Genus database with same CATH topology
 3UXG A;  4U0S A;  1N9A A;  3LVQ E;  2XPZ A;  2WVI A;  4GTO A;  1S0P A;  4HI9 A;  4WAF A;  3UT7 A;  3ML9 A;  2V5Q C;  5A6C A;  2RG8 A;  1BI7 B;  2JLB A;  3AG3 E;  2L0T B;  3APC A;  5JJ6 A;  4X8Q A;  4U8Y D;  4BX9 A;  2OCC E;  5D66 A;  4HLE A;  5KBA A;  3KS2 A;  4AP2 A;  4XE0 A;  4JVS A;  2Y0B G;  3TG4 A;  3ZRH A;  2ZGG A;  3CKC A;  2UY1 B;  3AS4 A;  1OWN A;  4ANU A;  3W9G A;  2Q7F A;  3B95 A;  4JPS A;  3PRE A;  5KWD A;  3CVQ A;  1YA0 A;  3PS6 A;  3KEZ A;  3LVR E;  3QJZ A;  3URZ A;  1FT1 A;  3CST A;  3C3R A;  3G2T A;  3UMV A;  2WMN A;  3JXJ A;  4I1O B;  2XCC A;  3LY9 A;  3L82 A;  3TWU A;  4EZL A;  2VTB B;  3GZ1 A;  2NC9 A;  1JCR A;  4EHM A;  3TAX A;  5KJM A;  4L2Y A;  1DCQ A;  4G25 A;  4L1B A;  1INZ A;  3ASF A;  3UX4 A;  3QOU A;  4FC8 A;  2XPI A;  3Q4A B;  3D9M A;  2XRZ A;  4URK A;  2FBN A;  3T5X A;  3SO8 A;  4YDE A;  4GTV A;  4IRU A;  4XEI G;  4J8F A;  4AY6 A;  3UIN C;  3C3Q A;  3AS5 A;  1NFI E;  2Y4U A;  3CIA A;  4B89 A;  5CEA A;  2L6J A;  4CCA A;  3B7T A;  3AJI A;  2KAT A;  2VGY A;  2FO1 E;  1YCS B;  1OWM A;  3TWV A;  1N0Q A;  1IHB A;  3CKB A;  2KZT A;  1TN6 A;  1FPP A;  1SQM A;  5ENQ D;  3NZS A;  3ASN E;  1DC2 A;  3E4B A;  1ELK A;  3FY4 A;  1JPL A;  2IEJ A;  1E90 A;  4O60 A;  3DSV A;  1JUQ A;  3O48 A;  1EF1 C;  1KZO A;  3CVX A;  2YHC A;  2F37 A;  3DXM G;  1OCR E;  1JCQ A;  1NZN A;  4A3T A;  2KZT B;  4CT0 A;  4GYO A;  4BWR A;  5LFA A;  4BY6 A;  5ENT D;  2AW6 A;  3B7U X;  5HS0 A;  5ARF A;  2VQ2 A;  5E76 A;  4GCN A;  4NUR A;  3QWP A;  5JMN D;  5ENO D;  4F1S A;  5BT1 A;  3J5Q B;  1N54 A;  4ILI A;  3SFY A;  2YIN A;  3OXG A;  3FTX A;  2XRY A;  4NQ0 A;  2XGS A;  5T4Y A;  3QWV A;  4U8V D;  3K9I A;  5AYW D;  5AJL A;  5T3R A;  3RK6 A;  3I5P A;  2WXI A;  5EX0 A;  5G55 A;  2E0I A;  1OXJ A;  3FDH A;  1PY1 A;  3FUE A;  1H19 A;  3B7S A;  3RSE G;  5BV0 A;  1N4P A;  4HOS A;  1HE8 A;  3ZU7 B;  4ILH B;  2HYZ A;  4UWH A;  3S7J A;  2V4L A;  3Q75 A;  4I43 A;  4TRQ A;  1WY6 A;  4HI8 A;  5EYL A;  2WQ6 A;  5CEC B;  2HR2 A;  3ULE G;  4CRW A;  2P9K G;  3TJP A;  3X2Q E;  4ANW A;  3NOC D;  2F8X K;  1OWP A;  3LY7 A;  4LER A;  4K03 A;  1PAQ A;  3HXC A;  4HFG A;  5DBK A;  1HG5 A;  3FH7 A;  1S64 A;  3CQG B;  4G1T A;  2AJA A;  5G2N A;  4LUN U;  1OUV A;  4UQX A;  5EX3 A;  4F7A A;  4F3V A;  3CHP A;  4JXT A;  3RIB A;  2HO1 A;  3QKY A;  1UOH A;  2VJ8 A;  3TXN A;  4GZC A;  4ZHB A;  3S7F A;  4JZY A;  4KZ0 A;  3UM1 A;  1QQE A;  3V30 A;  4CGV A;  2F0Y A;  3ZVV A;  4Z68 A;  4AV7 A;  4MS6 A;  1KT0 A;  2MOW A;  2JEK A;  2MRI A;  3SD5 A;  3CQC B;  3OXL A;  3FTW A;  1WAO 1;  2P58 C;  1TN7 A;  4J7W A;  4E85 A;  4MRU A;  2X6F A;  4UUC A;  3HVE B;  3IXE A;  1MQS A;  5FQ8 A;  5JHB A;  3D9H A;  5BXO A;  3Q15 A;  3ZYM A;  3FEY A;  3TWX A;  3EDT B;  2IOS A;  3MKR A;  5CBN A;  4RLY A;  3GZS A;  3RAU A;  3NF1 A;  1K1B A;  4C9B B;  2NYJ A;  3CHS A;  4G8L A;  3SY2 A;  3JUI A;  2C0M A;  1FCH A;  4TUU A;  5AQ7 A;  3VTY A;  4FJZ A;  3SBT B;  3CK7 A;  1SZ9 A;  3Q5M A;  4A63 B;  1TNY A;  4LCT A;  2WXQ A;  5IY5 E;  5D0Q D;  1H2T C;  2J49 A;  5G04 C;  2J07 A;  5G04 J;  1IHG A;  3ABM E;  3DST A;  1HF8 A;  3CHM A;  3HDX A;  1BPO A;  5FQ6 A;  5EDS A;  3ESL A;  4KXK B;  1TYQ G;  4CEM A;  4A1S A;  4OAU C;  1SA5 A;  3RRM B;  3QAQ A;  3ONL A;  3S7D A;  4BX8 A;  1RZ4 A;  2LSU A;  2EIK E;  4GML A;  3MV3 B;  4ZFH A;  3PNL B;  3DXK G;  3BEE A;  4DI4 A;  3UI2 A;  2A5E A;  1QNF A;  1TJF A;  3RRN B;  1N4S A;  3KD7 A;  2DZO A;  5FT9 A;  3ML8 A;  3FUD A;  5EIB E;  4GPM A;  4WNF A;  1ZU2 A;  4L7T A;  2IO2 C;  2XZD G;  4D10 C;  3TG5 A;  2DIW A;  2XS1 A;  1OWO A;  3EHM A;  3FU0 A;  3PRZ A;  5ENN A;  1OWL A;  4AJW A;  3T9K A;  5C1D A;  3ZHE B;  4J8E A;  3VLE A;  3CVW A;  3RKV A;  4GTT A;  1DNP A;  4KVM A;  3MZL B;  5FZQ A;  4HRM B;  2EIN E;  5AIJ A;  1D8E A;  4G11 A;  3PZ2 A;  3CK9 A;  4DLQ A;  3SZ7 A;  2OEV A;  3HRA A;  3PUJ A;  1TN8 A;  5CHE E;  1YMP A;  2DYS E;  4N39 A;  3CEQ A;  2DVW A;  5CCL A;  4RSY A;  2WXF A;  2AXV A;  4EBA A;  4CGW A;  2CHZ A;  3FU6 A;  5LCW J;  1UW4 B;  4NRH B;  1HX8 A;  3ZXS A;  3AU4 A;  2VSY A;  4L2L A;  1H6K A;  3MGB A;  1D9S A;  4JEU A;  2PQR A;  2LNI A;  4FLH A;  4UI9 C;  2VGX B;  2PM7 A;  4UQY A;  4N5Q A;  4U96 D;  2BED A;  2XGM A;  2C0L A;  4WNE A;  4UWK A;  2GRP B;  3I3N A;  4XIF A;  5JA4 D;  3S2A A;  2L9B A;  5H7P A;  4DX5 D;  1HZ4 A;  2WXR A;  4J8S A;  3SNX A;  2J4D A;  3NBN B;  1PC2 A;  3I4R B;  4IYP A;  2WXK A;  4OVV A;  1BI8 B;  2X6J A;  2EIJ E;  1H2U A;  4TUM A;  2J09 A;  1N4R A;  1E8Y A;  3L22 A;  3TWW A;  3TWT A;  4U0U A;  2DBA A;  2Y3A A;  4ABN A;  3AU5 A;  4I6E A;  3F6Q A;  3HG0 D;  3FUH A;  3L9T A;  4O6F A;  4B8C B;  2I6H A;  3CV0 A;  2FEZ A;  5G05 J;  4M7C A;  3T8K A;  4DUI A;  3WG7 E;  3UPV A;  2BKG A;  3APD A;  4JL0 A;  3Q7F A;  1DCE A;  5FQ4 A;  3EJN A;  5EN5 D;  3ZEF A;  2NXP A;  3JYS A;  1NP7 A;  2XEV A;  4I9E A;  1WM5 A;  3E37 A;  4FU3 A;  3UT8 A;  4DX1 A;  2PQN A;  3DRA A;  3GZ2 A;  2V5F A;  1WDY A;  3D9I A;  3ULY A;  4DX7 D;  4GMJ A;  4TXQ A;  2WM9 A;  2IF4 A;  1U3D A;  4N2Q A;  2QYJ A;  1FT2 A;  3SHF A;  4RG9 A;  2B0O E;  3L08 A;  3LS8 A;  4GYY A;  4CDM A;  3TXM A;  1U3C A;  5FZS A;  2BTD A;  2ZIS A;  3AG1 E;  5FTP A;  3TL5 A;  1V55 E;  1KLX A;  2PNN A;  4ILG A;  3IBE A;  3UM0 A;  5ARG A;  2NSZ A;  3RRU A;  4FAD A;  3DSS A;  4G23 A;  3FUK A;  2VGX A;  2VYI A;  4HRN A;  5AEN A;  3C5R A;  2GRM A;  1S70 B;  1E8X A;  2WXM A;  1OCO E;  3FTZ A;  5HQ8 A;  5LX8 A;  1OCC E;  2XPY A;  5ENP D;  2VSX E;  5AJD A;  2WPV A;  4APF A;  3QWW A;  3RO2 A;  2WXG A;  3Q47 B;  3IEG A;  1KZP A;  1X5B A;  4G2V A;  1K3Z D;  2XQ0 A;  1TNU A;  3U9W A;  3ABK E;  3TWS A;  3U66 A;  4KVO A;  5E75 A;  5CMW A;  4XKC A;  3ZHE A;  3ZGQ A;  4FP7 A;  4TV3 A;  2QYU A;  2WQH A;  4XZ4 A;  2X38 A;  3D9N A;  3EIQ C;  4HVB A;  2OOE A;  3FU5 A;  3LKU A;  2KCV A;  2XHE A;  4F6R D;  3CVL A;  2WXL A;  3OTN A;  3C3O A;  4OAV B;  3E34 A;  4A1G A;  2DCP A;  2H6F A;  3T5V A;  5CBO A;  1Z6T A;  3ASD A;  3PE3 A;  3PVL A;  3SBS A;  4GB9 A;  3FP3 A;  1H6O A;  2BF0 X;  4QFV A;  4TXR A;  2R02 A;  1KPS B;  4LEU A;  1HG2 A;  3SF4 A;  4MLP A;  5CRV A;  2LO6 A;  5CCM A;  3FU3 A;  4AIF A;  3ZUV B;  1OT8 A;  4BET A;  3MV2 B;  3FUN A;  4CDN A;  3SFZ A;  1BU9 A;  3AG2 E;  4FLB A;  1K8K G;  2WXP A;  3Q78 A;  4KZC A;  3AS8 A;  3CLJ A;  2P9L G;  3DSW A;  1UN8 A;  5KJN A;  2OND A;  3V2O A;  5LP0 A;  3NOG D;  2UY1 A;  4GTQ A;  3ISM C;  5KNG A;  4I9C A;  1BD8 A;  4FUL A;  5BV1 A;  3Q49 B;  4BTB A;  2QFC A;  2XCB A;  1G3N B;  1Z3Y A;  3NAW A;  2M63 A;  4AVX A;  3RU0 A;  3RJV A;  3ENE A;  5M72 A;  4G8K A;  1UG3 A;  5KNH D;  4GZ5 A;  2Y4T A;  2FO7 A;  1Q2Z A;  4RQI A;  1K1A A;  4DK5 A;  4BES A;  3LJN A;  2DZN A;  3LEW A;  3C98 A;  1HH8 A;  3G2V A;  3FUL A;  1O1S A;  4MKT A;  5JJ7 A;  3ASO E;  3R9M A;  3CGH A;  2OV8 A;  3QK0 A;  2YHE A;  3ONK A;  5HKP A;  4N3A A;  4NIK A;  4I6J A;  3CHQ A;  5JHA A;  2ILR A;  3GYZ A;  4GCO A;  4UQZ A;  4ACK A;  1HXI A;  4KT6 B;  3UTM A;  3AAA C;  4NAC A;  5CMY A;  5D0O D;  3NB2 A;  4I17 A;  3DSU A;  4MBG A;  1D8D A;  3QAR A;  3FHE A;  3FUI A;  4Q96 A;  2VSO E;  3UKR G;  3ASH A;  2LXL A;  4L23 A;  4XX5 A;  4B8A A;  2EQX A;  3MCX A;  4U07 A;  5C2Y A;  2GRL A;  2I1K A;  3ZW3 A;  3Q9U C;  2HE0 A;  1S63 A;  1TNB A;  3IHV A;  4GA2 A;  2WXO A;  2IY0 C;  2KM4 A;  1O5M A;  1KT1 A;  2WXN A;  4I1A A;  4O1O A;  3EHQ A;  4AOF A;  4PDX A;  5EID A;  3MA5 A;  4A55 A;  4BSX A;  3UIP C;  2V0P A;  5ITZ F;  5BW8 C;  2VGE A;  3KEA A;  3ZNG A;  3E32 A;  1MX4 A;  3PUK A;  1IQR A;  3PZ1 A;  4R7L A;  4LNB A;  3NQP A;  4FHJ A;  1N0R A;  4DX2 A;  3LDZ A;  1AP7 A;  3TGO A;  4JEH A;  2R2L A;  4ACL A;  1N95 A;  1LD8 A;  3TWQ A;  1V54 E;  1YYH A;  2QZA A;  4AXH A;  3R9A B;  4U8H A;  3LY8 A;  4WWP A;  3HXE A;  1IKN D;  2R05 A;  4PS3 A;  3MKQ A;  1EYH A;  2I1J A;  4KMO A;  2VTB A;  1MX6 A;  2VSN A;  3D9P A;  4J8D A;  4YVO A;  2LUH A;  4XI0 A;  4YDY A;  4I6G A;  3PZ4 A;  4JA9 A;  2GRN B;  3EHR A;  4HBD A;  2ETA A;  4K5A B;  5G05 C;  3DEO A;  4BFR A;  2RFM A;  2RFA A;  3JUE A;  4GAA A;  3PZD A;  4WWO A;  5ENR D;  2V4H C;  4I2W A;  5J08 A;  4BT9 A;  3V31 A;  3CVP A;  4Y6C A;  5B1A E;  3C72 A;  3P2B A;  4CZ2 D;  4U04 A;  2CFU A;  5A23 A;  4N3C A;  3LCA A;  5BPP A;  1N11 A;  3IV0 A;  2IOL A;  4EZJ A;  3Q79 A;  4N5C A;  1Y8M A;  3LPZ A;  3PH0 C;  3Q73 A;  1A17 A;  2AXU A;  3EU9 A;  3UUX A;  2IO3 C;  2R03 A;  4M3O A;  1ELW A;  4P29 A;  1RW2 A;  3EU5 A;  3CR3 A;  2ETC A;  4ANV A;  4BER A;  4EEC A;  3P1U A;  3V2X A;  3PZ3 A;  5FQ7 A;  2AVP A;  3UKU G;  5ANR A;  2IJG X;  3ZN3 A;  4ATG A;  1FVH A;  3CK8 A;  4EZK A;  1NI1 A;  1E7V A;  4JB8 P;  4HOR A;  3B7B A;  4PUC A;  2X6I A;  3VLF A;  3JCK C;  3D3M A;  5LOZ A;  4YDW A;  4XI9 A;  3PE4 A;  2MHK A;  4DLO A;  3FTS A;  2AWI A;  4HOQ A;  4JA7 A;  4RVB A;  5AQB A;  3ZYK A;  4PS8 A;  2P9N G;  2EIL E;  4CYM D;  2KCK A;  3D9K A;  3U4T A;  2ETB A;  3FEX A;  3VTX A;  4G26 A;  2XEH A;  3SGH A;  4PH4 B;  1VDY A;  4Y6W A;  5FIN A;  1EPU A;  5ANL A;  3ZYL A;  3UIO C;  4HNA D;  3ZIM A;  3PNT B;  3OXF A;  4HXI A;  1DVP A;  3FTU A;  4N3B A;  1IYG A;  4HOU A;  5HI7 A;  3UQ3 A;  4EPZ A;  1H6P A;  2P9P G;  4GMR A;  5D2M C;  3DPD A;  2I2O A;  2CHW A;  2FI7 A;  3NZU A;  1OY3 D;  4FJY A;  3UT4 A;  1JWF A;  3ULQ A;  2UWJ G;  2Y69 E;  2GGF A;  4E6H A;  2X6K A;  4GZD A;  4H7Y A;  2OVB A;  4I2Z A;  2GRR B;  2L6B A;  3JQ0 A;  2ZIR A;  1UN9 A;  3MYV A;  5AAO A;  4F53 A;  3D9J A;  3U3W A;  4O1P A;  4K0R A;  1MJ0 A;  3FUM A;  4CDR A;  3V79 K;  3ABL E;  1UJJ A;  5KJK A;  2H6I A;  3ESK A;  3BG0 B;  2IQC A;  2WB2 A;  2KC7 A;  4HQD A;  5AQA A;  3ZXP A;  4PS7 A;  3QB2 A;  3CHR A;  4Q94 A;  2FUL A;  4LG6 A;  2J08 A;  3FTV A;  3L17 A;  4YDO A;  4V3I A;  4F1P A;  1QBQ A;  1B89 A;  2LAH A;  2J8S D;  4GA0 A;  4UWF A;  3L6A A;  5BXU A;  4WNG A;  3JXI A;  1TEZ A;  4AY5 A;  2KXP C;  2MYO A;  3LXU X;  4LRZ A;  4WND A;  1TNZ A;  4JHK A;  1H2V C;  4UI9 K;  5BNW A;  4HB5 A;  4ME2 A;  3PDN A;  3CSF A;  3Q7A A;  5KCM A;  3QC1 A;  4B93 B;  5FIO A;  3ASG A;  4C0E A;  2R59 A;  1EDU A;  4UWG A;  1ZBP A;  1O1T A;  3BUA A;  1A5E A;  1U2V G;  4L9P A;  2P2C P;  4AM9 A;  4WWN A;  3ZFW A;  3ZKJ A;  3HXD A;  4G24 A;  5DIZ A;  3WXX A;  4OYS A;  3HIZ A;  4U0Z A;  2IU1 A;  2YNQ A;  1E8Z A;  4EBA G;  4GTS A;  3UM3 A;  4BSZ B;  4DI3 A;  4B94 A;  5A7D B;  2PM6 A;  2FF4 A;  1NA3 A;  1TNO A;  4GA1 A;  1L5J A;  3ZPJ A;  5J90 A;  4EQF A;  3PEV B;  3DBS A;  3FWV A;  1Z5S C;  3D9L A;  3ZYQ A;  2P9U G;  4C0M A;  5B3S E;  2RKK A;  4BTA A;  2XGO A;  3HYM B;  3OAW A;  2QY7 A;  3MEK A;  5AN8 A;  3FFL A;  3G2U A;  3B13 A;  4U7E B;  2BUG A;  4XKB A;  3N71 A;  4B0Z A;  1X81 A;  2CFZ A;  1MHQ A;  2Y1L E;  3AG4 E;  2A4Z A;  1N4Q A;  1ELR A;  1LD7 A;  1IQU A;  2CG2 A;  4DX6 D;  3DPY A;  3HXF A;  3O4Z A;  5FWQ A;  3IHY A;  4N2S A;  4I1M A;  4BEP A;  3UM2 A;  5EIL A;  4GZ3 A;  5CRU A;  2B6C A;  4RG6 A;  2DWZ A;  3W9F A;  3DSX A;  4C48 B;  2P9I G;  4HRL A;  1NA0 A;  2OVF A;  3EHN A;  3S7B A;  3SI5 A;  3FUJ A;  3HVE A;  4HOT A;  1GW6 A;  1ZB1 A;  1SA4 A;  3MJW A;  2PL2 A;  1SW6 A;  2J4B A;  3L54 A;  3G2S A;  2EIM E;  1JCS A;  2WXJ A;  1BLX B;  2XEE A;  2R17 C;  2E2E A;  1AWC B;  3CHO A;  2H6G A;  4YND A;  4Q69 A;  4FHK A;  1N94 A;  1Y6I A;  3DWL G;  4OVU A;  4A3V A;  2LXM A;  4QQI A;  3SFX A;  5KJL A;  4GU5 A;  4ANX A;  3TWR A;  1UJK A;  2C2L A;  3JQ1 A;  4YVQ C;  1JWG A;  3E30 A;  3MX3 A;  4U63 A;  2H6H A;  1E7U A;  2DYR E;  1TR4 A;  4GTM A;  3SQV A;  1IXV A;  4GTP A;  4JHJ A;  5CED B;  1LF8 A;  2GW1 A;  2CHX A;  1H0A A;  2AXZ A;  2ZU6 B;  1W3B A;  1TJC A;  2GRO B;  4APO A;  3L16 A;  3LJ3 A;  3Q9N C;  1P5Q A;  2LSV A;  4DPR A;  2WQ7 A;  3APF A;  3MKQ B;  1HU3 A;  3BQO A;  4AEZ C;  3IKO B;  3I4G A;  3VLD A;  2YQ8 A;  2KBX A;  1QZ2 A;  1MZC A;  2L0I A;  3QNK A;  5ENS D;  4W9R A;  2WMO A;  3CVV A;  3BU8 A;  3L13 A;  3CVY A;  4H7X A;  3PEU B;  1HS6 A;  4LNU D;  3J5P A;  1Z3X A;  3CVN A;  1O1R A;  4FA6 A;  1MX2 A;  5LCW C;  3E33 A;  4WUY A;  3CVU A;  2PZI A;  2BKK B;  4JW1 A;  2HM8 A;  3R7Q A;  2OEW A;  3BG1 B;  3QDN A;  2XZT G;  1MYO A;  4GZ6 A;  4J8Y A;  3KSQ A;  4DRX E;  2CG3 A;  4IN3 B;  4LSZ E;  4HS2 A;  3R7R A;  4IUL A;  5B1B E;  5EYP F;  2ION A;  1HFA A;  4K5B A;  4DJA A;  1QYM A;  4J0U A;  3FTY A;  2RD0 A;  2ZGD A;  2IFU A;  4K5C A;  3FH8 A;  5AQ9 A;  1LTX A;  2A5U A;  4UWL A;  2I9C A;  2V8S E;  3U64 A;  3B7R L;  3G2W A;  3DEP A;  3HXB A;  5AAR A;  1NL4 A;  1WG0 A;  4CT4 A;  2JAB A;  1FVF A;  2KCL A;  1XNF A;  2GRQ B;  4JHR A;  4J6I A;  3LYA A;  5FJY A;  1SVX A;  2XEN A;  4KBQ A;  5BUZ A;  4GYW A;  2XS8 A;  5HRY A;  4LNG A;  2X3M A;  2P9S G;  2R5S A;  4JC8 A;  3T8M A;  1OCZ E;  5EKQ D;  5CER B;  5FZR A;  2ZXW E;  4KYO B;  3FH5 A;  5T8I A;  2J9Q A;  3HHM A;  2X6H A;  1E96 B;  1HO8 A;  4HLL A;  3GW4 A;  2LAI A;  4U95 D;  4JD2 G;  3FUF A;  3RO3 A;  2F8Y A;  4UI9 J;  3KSL A;  4GPK A;  3EIJ A;  1N52 A;  2QC9 A;  4BT8 A;  1E8W A;  5JJT A;  1XGW A;  4TXP A;  4GTR A;  3KAE A;  4ATZ D;  3EUV A;  2WXH A;  1SZA A;  3D9O A; 
#chains in the Genus database with same CATH homology
 2P9S G;  1K8K G;  2P9U G;  2P9I G;  3DXM G;  2P9L G;  4XEI G;  3DWL G;  3DXK G;  2P9K G;  2P9N G;  4JD2 G;  1U2V G;  3RSE G;  3ULE G;  1TYQ G;  3UKU G;  3UKR G;  2P9P G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...