3RSEG

Structural and biochemical characterization of two binding sites for nucleation promoting factor wasp-vca on arp2/3 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
136
Chain Sequence
RFRKVDVGEYDENKFVDEEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of two binding sites for nucleation-promoting factor WASp-VCA on Arp2/3 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 41
structure length 136
sequence length 142
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3rseG00
4JD2G 3DXKG 3UKRG 2P9UG 2P9SG 3DWLG 3DXMG 3RSEG 2P9IG 3ULEG 1U2VG 2P9NG 3UKUG 1TYQG 2P9KG 1K8KG 2P9PG 4XEIG 2P9LG
chains in the Genus database with same CATH superfamily
4RG6A 1H2UA 2GW1A 5ENNA 3IBEA 2WMOA 4GTVA 5CCMA 1UN9A 3W9GA 3Q5MA 3FH5A 2QYJA 1JCRA 4U8YD 1N4PA 2PZIA 2IO2C 1BI8B 2X3MA 2X6HA 3ONKA 1IKND 1HZ4A 2Y4TA 2PNNA 5C2YA 1TNZA 3NB2A 4GA0A 3FTVA 3W9FA 3VLDA 1KT1A 4EECA 3BG0B 3RU0A 4J6IA 1FT1A 1HS6A 1PAQA 4PH4B 5ENSD 3AS5A 3WXXA 5KJMA 1SA4A 4EBAA 1FT2A 4HLEA 3OXGA 2CFZA 5FTPA 4BESA 5ENPD 1E8XA 2Y1LE 1X81A 4MKTA 4I6GA 3L82A 4XX5A 2PQRA 2R02A 1N4RA 3S2AA 3MYVA 2H6GA 4KXKB 3TGOA 3UTMA 2IONA 3IV0A 3OTNA 4JW1A 3EHQA 4C0MA 4UWFA 5LCWC 4NURA 3U9WA 5HKPA 5CCLA 2QZAA 4I1MA 3FFLA 4CGWA 3UXGA 3LDZA 4JHJA 2PM6A 2WB2A 3GZ2A 4F3VA 3ABKE 1S63A 2LSVA 1AP7A 3HXCA 4DI4A 3Q7FA 2KC7A 4XKCA 2XEHA 4FA6A 4Y6WA 4UI9J 4BETA 2RFAA 3PEUB 4YVOA 1ZB1A 4HRMB 2RKKA 1X5BA 1JCSA 1IQUA 4CYMD 3TL5A 4DI3A 4G8KA 3S7BA 1O5MA 5KBAA 4O1PA 4JEHA 3FDHA 1TR4A 1MYOA 3PZ4A 3ABME 3OXLA 4I2ZA 5T3RA 2F8XK 2WXLA 1B89A 2DCPA 4U7EB 1TN7A 1YMPA 3MGBA 4I9EA 4IN3B 2XCCA 4M7CA 4Z68A 4FP7A 5EILA 5DIZA 1W3BA 2OVFA 3KSQA 3AG3E 2CHXA 5D0OD 4O1OA 3ZW3A 3JYSA 5AQ9A 2P9UG 3EIQC 3NZSA 4UUCA 1AWCB 2R03A 4WWNA 4TV3A 4PDXA 4KBQA 3HIZA 2GRRB 5G2NA 3KS2A 2ZGDA 2IY0C 4N2QA 2WXGA 1EYHA 4N3AA 4FHKA 4A63B 2ZGGA 3QB2A 3CK7A 3E34A 3L17A 1IXVA 3CKCA 4XZ4A 1N4QA 3MKQB 2IOSA 3BEEA 5HS0A 4UQXA 5J08A 3FUJA 3BUAA 4XI0A 1YCSB 3TWSA 4N5QA 2PM7A 3ZYMA 1HG5A 2EINE 1ELRA 3CHRA 2HE0A 3RRMB 3AJIA 5BW8C 3CHOA 4X8QA 3V79K 4UWHA 3APFA 4UWLA 4BFRA 1E90A 3CLJA 3SFXA 3S7FA 2YHCA 3EHNA 4U8HA 3ZNGA 1E7VA 4DK5A 2HYZA 5AJDA 4NRHB 4RVBA 5KNGA 2ONDA 3CVNA 3MV2B 1ZBPA 4WAFA 1SQMA 1TJCA 3Q9NC 1HX8A 2KBXA 3PE4A 2AXZA 4GCNA 1N94A 2VGXB 2LAHA 4H7YA 1FVFA 5FWQA 2VQ2A 1QQEA 4XIFA 2LXMA 2WXOA 4HQDA 4LNUD 3UKRG 4K5CA 4C9BB 2QC9A 1LTXA 3IXEA 2VTBA 4XEIG 2KM4A 2H6IA 2AVPA 4YDYA 5BNWA 1NP7A 2I2OA 2X6IA 1NI1A 4A1GA 2LUHA 2ETCA 2XS1A 1NFIE 3CVPA 2FEZA 1RZ4A 2VGEA 4MS6A 1MX6A 3AG4E 3DSSA 3QJZA 4TUUA 2A5EA 3JXJA 3PREA 2GRNB 2EIME 2LAIA 4GMRA 4K03A 4LCTA 3NOCD 2WXIA 4TUMA 3FUEA 3UT4A 2EIJE 2QYUA 2P9KG 3ZGQA 1N9AA 5BPPA 1H6OA 2YINA 4ZFHA 4FHJA 3IHVA 4LUNU 1N4SA 4XE0A 3TWXA 5T4YA 4I1OB 4JXTA 1KPSB 4B8AA 1WAO1 3ESLA 1D8EA 2F37A 3KD7A 1QZ2A 3AS8A 5CECB 5A7DB 3MCXA 2DYSE 4AXHA 4ILGA 5EYPF 1E96B 3T8MA 4GZ3A 5JJ7A 2ETAA 2OCCE 2KZTA 1JWGA 3FU3A 5IY5E 2CFUA 4TXQA 3RIBA 1S0PA 5KWDA 5AENA 3JQ0A 2WXMA 2XQ0A 3E33A 4GTOA 3B7BA 4CDNA 4K0RA 5FT9A 1A5EA 3G2SA 2DYRE 2I9CA 3DSUA 3LY9A 4FJYA 3TWVA 4UWGA 3L9TA 1LF8A 4BWRA 2Y0BG 5G04J 4AV7A 2KCVA 4ACLA 5FIOA 1DC2A 5EKQD 4U95D 1OUVA 3DEPA 2EQXA 3TWQA 3D9NA 3KEAA 2WQ6A 2CG2A 2C0LA 3DSXA 4GA2A 4GTPA 1UJKA 3DXKG 3DBSA 4JA7A 4CZ2D 1K1AA 4JD2G 4BTBA 3FEYA 3AS4A 5G04C 3OXFA 2MHKA 3JUIA 5B1BE 4B8CB 2J4DA 4I43A 4F1PA 2VSYA 1BPOA 4WNDA 4TXPA 5AAOA 1P5QA 4C0EA 4HS2A 4HVBA 1YYHA 3DWLG 3LS8A 4HOQA 2BKGA 2X6KA 4DX2A 4U0ZA 4JHRA 3R7QA 2LXLA 1INZA 3B7SA 2AJAA 3C72A 3TG4A 4GYYA 2I1KA 4G8LA 4GZ6A 4NQ0A 3PZDA 1E7UA 3MX3A 4G24A 3S7DA 3PZ1A 2X6JA 3RKVA 2CHWA 4FC8A 4J8SA 5HQ8A 4I9CA 3P2BA 1QBQA 4K5BA 1SVXA 4FLBA 3TAXA 3AU5A 5ANRA 2H6FA 3SY2A 1Z3XA 1HXIA 3MKQA 3V2OA 5EDSA 4EZLA 4F7AA 2C0MA 5BT1A 1HE8A 3Q9UC 3G2UA 3DSVA 3UT8A 1OCZE 1DCQA 3NQPA 1L5JA 2XHEA 3I4RB 3FUHA 2CHZA 3URZA 4V3IA 3VLFA 3FTWA 2X6FA 4J8EA 3DSTA 2HM8A 3ISMC 2IU1A 3HYMB 5CEDB 1OWLA 2Y3AA 4YVQC 3MV3B 2V4HC 5KJLA 3CVWA 2FI7A 3SZ7A 3ZPJA 2LSUA 3FHEA 4BY6A 1RW2A 1JUQA 2ZIRA 3EJNA 2ETBA 4PS8A 2JLBA 4CRWA 2Y69E 3GZSA 3PH0C 3TWUA 4GTSA 2EIKE 2P2CP 4GZ5A 4AP2A 3R9AB 5FQ4A 2RFMA 1S64A 3LVQE 2UWJG 1OXJA 3QOUA 3ASGA 1OY3D 4JZYA 2J07A 4GTMA 4TRQA 1UG3A 1KZOA 4EZJA 2ILRA 3RO3A 3CVYA 4W9RA 4KT6B 3CVXA 3CHQA 2V4LA 3FWVA 1ZU2A 2X38A 3ZIMA 2M63A 1YA0A 1DCEA 4B94A 4HORA 3UIOC 1Y8MA 3AG1E 3V31A 3VLEA 2I1JA 4AEZC 3G2VA 2AW6A 1HO8A 4F53A 4RQIA 2F8YA 3ZXSA 4JVSA 4L9PA 3MJWA 4DX5D 4OYSA 4ANUA 3LKUA 4LNBA 3CVVA 5AN8A 5EIBE 1HG2A 3FUDA 1MQSA 2OEWA 4Y6CA 1TJFA 2MOWA 3E30A 2L9BA 3LYAA 3RK6A 5AARA 2XS8A 3BU8A 2J4BA 4G11A 1OT8A 1WY6A 4H7XA 1KZPA 2I6HA 1H0AA 5FQ6A 4G2VA 1A17A 1TNOA 4AY6A 4KMOA 4UQYA 3RO2A 3PNTB 3UPVA 3CK9A 3PUJA 1TN8A 2NC9A 4HBDA 5H7PA 2KATA 3SBTB 3ASHA 2KZTB 4RG9A 3NAWA 4GZCA 4CCAA 2B6CA 4ACKA 2DWZA 3ABLE 3QWVA 3QWWA 4U96D 2WXQA 3PEVB 1H6KA 1E8WA 3NOGD 3T5VA 5D66A 1H19A 2XGSA 3Q78A 1BLXB 5FZRA 3BQOA 3QAQA 4PS7A 3J5QB 4BERA 4HLLA 5CBOA 3L16A 4U0UA 2GRMA 2AXVA 4B93B 1OWOA 4WUYA 3D9IA 3SD5A 4AJWA 2J8SD 3DXMG 4ABNA 3LXUX 4CT0A 4CEMA 1PY1A 1N95A 2IFUA 2HO1A 2FO7A 3IHYA 3LY7A 3RSEG 4GYWA 4GMLA 4MBGA 2WXPA 4N39A 3K9IA 3TWRA 3F6QA 1TNUA 1MHQA 2WXFA 3AU4A 5EX3A 3QNKA 3ZKJA 4MRUA 1K8KG 3HRAA 4U07A 1FCHA 1Q2ZA 1MZCA 4FU3A 2PQNA 1OCOE 3AAAC 4G23A 4DUIA 3FP3A 1WDYA 2DIWA 3ZVVA 5AQAA 4EQFA 3LJ3A 5T8IA 3Q79A 1HFAA 3B95A 4L2YA 2XGMA 3CSTA 5FZQA 3VTXA 2P9LG 3UIPC 4J8FA 1N0RA 4QFVA 1FVHA 5EX0A 4IULA 3LY8A 4ILIA 1K1BA 2ZXWE 4I1AA 3CEQA 4LSZE 1PC2A 1SW6A 2H6HA 5ARFA 4ILHB 5JMND 4AVXA 4EZKA 3ML8A 5ITZF 4L1BA 4HFGA 3TXMA 1V55E 5EN5D 3QC1A 4IYPA 5D0QD 4EHMA 5KCMA 2YHEA 3B7UX 3QWPA 4ANWA 3OAWA 1DVPA 2XZTG 4R7LA 1N0QA 4U63A 3D9HA 4Q94A 1QNFA 3CQCB 3FUIA 3GW4A 2C2LA 4UI9K 3SHFA 2JEKA 3L13A 3HXDA 5FQ7A 4OAUC 2WMNA 3B7RL 3HXEA 3RRUA 2L0TB 4G26A 1XNFA 4BSZB 4P29A 1KT0A 5B1AE 2NSZA 4J7WA 4LNGA 3FH7A 2LNIA 3LEWA 2EILE 3DPYA 3JQ1A 2KCKA 4HOTA 4KZCA 4KVOA 3T8KA 2R59A 1H2TC 2WXNA 5E76A 3C3OA 4I6JA 3LPZA 1WM5A 5ENRD 4DJAA 1EDUA 4Q69A 3UM1A 4PS3A 1SZ9A 3G2TA 1VDYA 3UM0A 1XGWA 2BTDA 3D9MA 3KSLA 1LD8A 1TNBA 3HDXA 3Q75A 4HOSA 1HH8A 5EIDA 4HRLA 3HXBA 2XGOA 3VTYA 3FUKA 2OOEA 3ZUVB 2BF0X 2B0OE 2GRQB 3CSFA 4L7TA 5G05J 4I2WA 3D9JA 2L0IA 2KXPC 2WXJA 5FZSA 4JHKA 3ULQA 2LO6A 4WNGA 2GRPB 3N71A 4BT9A 2VYIA 4JEUA 4N5CA 4GPKA 5LFAA 3APCA 3HVEB 1IHBA 1TN6A 4RLYA 1K3ZD 3APDA 4E85A 2CG3A 3ZYLA 4KZ0A 3QARA 3V30A 1O1SA 4M3OA 3RJVA 4N3BA 3ZYKA 2R5SA 3UUXA 4N3CA 1BU9A 2UY1B 3NZUA 3PVLA 3SFZA 2V0PA 2V5FA 3Q47B 4JA9A 4CGVA 2E0IA 3CVUA 5HRYA 1JPLA 1FPPA 5A23A 5EYLA 3ENEA 3UMVA 4ZHBA 4UQZA 3O4ZA 3ESKA 2P9SG 4L23A 3UINC 3HHMA 4XKBA 3NF1A 5AQ7A 2FO1E 4YDWA 1ELWA 4AY5A 3HXFA 4DRXE 3Q49B 3JXIA 4GZDA 4GCOA 3D9KA 2ZU6B 3QDNA 2PL2A 3C5RA 2AWIA 3CHMA 2XPIA 2XEVA 4KVMA 3UKUG 2P9PG 2BKKB 5AYWD 4F1SA 4B89A 3SO8A 1NA0A 3FTUA 4DPRA 3E37A 2IO3C 3L54A 2XEEA 2DZOA 3UQ3A 4BX9A 4HB5A 5FQ8A 2Y4UA 3SGHA 2P9NG 2YQ8A 4GMJA 3GZ1A 5D2MC 2JABA 4WWOA 4CT4A 4LERA 2J9QA 1OWMA 4ATGA 3PRZA 4AM9A 3JUEA 4LEUA 3GYZA 3SI5A 5J90A 1G3NB 4GTQA 1Z3YA 4J0UA 4ANVA 3C3RA 4J8YA 3ZXPA 3ULEG 4GB9A 2WQHA 4FULA 4G25A 4HRNA 1V54E 3ASDA 4PUCA 2GGFA 2NYJA 3FULA 1TYQG 1HF8A 2DBAA 3PZ3A 3T9KA 3D9LA 2FULA 4O6FA 5LCWJ 4MLPA 3TG5A 3X2QE 1E8YA 3MKRA 4AIFA 5A6CA 2XCBA 4ME2A 3FU5A 2L6BA 1KLXA 1D8DA 2QFCA 3EU5A 4U8VD 4ANXA 3O48A 1JCQA 3EDTB 5ENTD 4D10C 3SBSA 3CV0A 3NBNB 4OAVB 5JA4D 2DZNA 2R05A 2V8SE 2Q7FA 3SQVA 5BV0A 2A4ZA 2WQ7A 2GRLA 2VGXA 3ZHEB 2VSNA 3R7RA 5CBNA 4LRZA 3SFYA 2J08A 3FTXA 2OV8A 5KNHD 1MX2A 4EBAG 2RD0A 4G1TA 2VSOE 3FUNA 5C1DA 3UM3A 3LCAA 3EHMA 1HU3A 2XZDG 4WNEA 3DSWA 1EPUA 1Z6TA 4HI9A 2L6JA 4BX8A 4Q96A 2VSXE 3QKYA 3Q73A 4OVUA 3B7TA 3WG7E 1JWFA 1MJ0A 2OEVA 2YNQA 1OWPA 5ANLA 2R2LA 2NXPA 3SF4A 1O1TA 3PE3A 4I17A 3FU6A 4A3TA 1TNYA 1S70B 2RG8A 3IEGA 3PS6A 3CKBA 2AXUA 3U3WA 3Q4AB 2DVWA 5ENQD 4I6EA 2J49A 3PZ2A 3D3MA 1Z5SC 3AG2E 4URKA 1UJJA 1TEZA 1O1RA 3TJPA 3U64A 2IOLA 2A5UA 4JC8A 3J5PA 2IF4A 3T5XA 4GA1A 4DX6D 3ZFWA 4BT8A 3RAUA 3ASNE 5AIJA 3ZYQA 3PDNA 3ML9A 5BXOA 4OVVA 3FUFA 3EIJA 3L22A 1SZAA 1N52A 3ZHEA 2XPZA 3ULYA 5CMYA 5LP0A 3HG0D 3KAEA 4F6RD 3ZEFA 2UY1A 3CGHA 5AQBA 3PUKA 1WG0A 3EHRA 3FEXA 4U04A 1UW4B 4WWPA 2GROB 1N54A 2VTBB 2P58C 2IQCA 4E6HA 2WPVA 3CR3A 4UWKA 2XPYA 1DNPA 2MRIA 4GYOA 4FJZA 3TWTA 2WXHA 2XENA 4NACA 1E8ZA 4A3VA 4DX7D 2FF4A 1OCRE 3V2XA 2KCLA 3Q15A 4QQIA 4YNDA 3DRAA 2F0YA 2WVIA 2ZISA 1SA5A 5CHEE 3BG1B 1U2VG 3TXNA 5ENOD 2QY7A 3PNLB 4RSYA 5BUZA 3CVQA 3UI2A 4NIKA 1D9SA 3FY4A 1Y6IA 3FTSA 3U66A 4J8DA 4APOA 3UT7A 5HI7A 3UX4A 4HNAD 3C98A 3L6AA 1LD7A 1UOHA 1IYGA 1GW6A 3I5PA 2WXRA 3RRNB 4AOFA 4TXRA 1OCCE 2J09A 3DEOA 5LOZA 3ZU7B 1OWNA 3CIAA 5JHBA 5CRVA 1BI7B 4FADA 4CDRA 4YDOA 4GTTA 3DPDA 3I4GA 3IKOB 1IHGA 5CEAA 1ELKA 2WM9A 2BEDA 3G2WA 4APFA 5KJNA 3EUVA 5CRUA 3LJNA 3Q7AA 3CK8A 3R9MA 1NA3A 1N11A 5JHAA 3CVLA 4YDEA 4IRUA 3JCKC 3B13A 3I3NA 5G55A 5DBKA 3CQGB 4LG6A 4JB8P 2E2EA 2P9IG 3QK0A 4O60A 4ATZD 3MEKA 2VGYA 5KJKA 3LVRE 1U3CA 4BTAA 5AJLA 3E32A 4FLHA 3ZN3A 3EU9A 4CDMA 3L08A 4HOUA 5CMWA 3FU0A 5M72A 4XI9A 4BSXA 1UN8A 1NL4A 4GAAA 2V5QC 2HR2A 3MZLB 3D9OA 4KYOB 2FBNA 3ZRHA 5LX8A 4WNFA 2R17C 2OVBA 4GTRA 4U0SA 3KEZA 3HVEA 5BV1A 4N2SA 3CHSA 4EPZA 4JPSA 3ASOE 4A1SA 4L2LA 1MX4A 4DLQA 1BD8A 2MYOA 5FINA 3U4TA 3ONLA 2WXKA 4GPMA 1H6PA 5JJ6A 3ASFA 1IQRA 3FUMA 2IEJA 5G05C 5FJYA 3SNXA 3UM2A 2XRYA 4A55A 3S7JA 4BEPA 1H2VC 1EF1C 3C3QA 2XRZA 4GU5A 4HXIA 4DX1A 4UI9C 1U3DA 2BUGA 3P1UA 1QYMA 4DLOA 5JJTA 5ARGA 1NZNA 4B0ZA 3FTYA 5BXUA 5E75A 3D9PA 3TWWA 3MA5A 2IJGX 4JL0A 3FTZA 4C48B 2VJ8A 3FH8A 4K5AB 5CERB 4HI8A 3E4BA 5B3SE 3CHPA
chains in the Genus database with same CATH topology
4JD2G 3DXKG 3UKRG 2P9UG 2P9SG 3DWLG 3DXMG 3RSEG 2P9IG 3ULEG 1U2VG 2P9NG 3UKUG 1TYQG 2P9KG 1K8KG 2P9PG 4XEIG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 G;  3DXK G;  3UKR G;  2P9U G;  2P9S G;  3DWL G;  3DXM G;  3RSE G;  2P9I G;  3ULE G;  1U2V G;  2P9N G;  3UKU G;  1TYQ G;  2P9K G;  1K8K G;  2P9P G;  4XEI G;  2P9L G; 
#chains in the Genus database with same CATH topology
 4RG6 A;  1H2U A;  2GW1 A;  5ENN A;  3IBE A;  2WMO A;  4GTV A;  5CCM A;  1UN9 A;  3W9G A;  3Q5M A;  3FH5 A;  2QYJ A;  1JCR A;  4U8Y D;  1N4P A;  2PZI A;  2IO2 C;  1BI8 B;  2X3M A;  2X6H A;  3ONK A;  1IKN D;  1HZ4 A;  2Y4T A;  2PNN A;  5C2Y A;  1TNZ A;  3NB2 A;  4GA0 A;  3FTV A;  3W9F A;  3VLD A;  1KT1 A;  4EEC A;  3BG0 B;  3RU0 A;  4J6I A;  1FT1 A;  1HS6 A;  1PAQ A;  4PH4 B;  5ENS D;  3AS5 A;  3WXX A;  5KJM A;  1SA4 A;  4EBA A;  1FT2 A;  4HLE A;  3OXG A;  2CFZ A;  5FTP A;  4BES A;  5ENP D;  1E8X A;  2Y1L E;  1X81 A;  4MKT A;  4I6G A;  3L82 A;  4XX5 A;  2PQR A;  2R02 A;  1N4R A;  3S2A A;  3MYV A;  2H6G A;  4KXK B;  3TGO A;  3UTM A;  2ION A;  3IV0 A;  3OTN A;  4JW1 A;  3EHQ A;  4C0M A;  4UWF A;  5LCW C;  4NUR A;  3U9W A;  5HKP A;  5CCL A;  2QZA A;  4I1M A;  3FFL A;  4CGW A;  3UXG A;  3LDZ A;  4JHJ A;  2PM6 A;  2WB2 A;  3GZ2 A;  4F3V A;  3ABK E;  1S63 A;  2LSV A;  1AP7 A;  3HXC A;  4DI4 A;  3Q7F A;  2KC7 A;  4XKC A;  2XEH A;  4FA6 A;  4Y6W A;  4UI9 J;  4BET A;  2RFA A;  3PEU B;  4YVO A;  1ZB1 A;  4HRM B;  2RKK A;  1X5B A;  1JCS A;  1IQU A;  4CYM D;  3TL5 A;  4DI3 A;  4G8K A;  3S7B A;  1O5M A;  5KBA A;  4O1P A;  4JEH A;  3FDH A;  1TR4 A;  1MYO A;  3PZ4 A;  3ABM E;  3OXL A;  4I2Z A;  5T3R A;  2F8X K;  2WXL A;  1B89 A;  2DCP A;  4U7E B;  1TN7 A;  1YMP A;  3MGB A;  4I9E A;  4IN3 B;  2XCC A;  4M7C A;  4Z68 A;  4FP7 A;  5EIL A;  5DIZ A;  1W3B A;  2OVF A;  3KSQ A;  3AG3 E;  2CHX A;  5D0O D;  4O1O A;  3ZW3 A;  3JYS A;  5AQ9 A;  2P9U G;  3EIQ C;  3NZS A;  4UUC A;  1AWC B;  2R03 A;  4WWN A;  4TV3 A;  4PDX A;  4KBQ A;  3HIZ A;  2GRR B;  5G2N A;  3KS2 A;  2ZGD A;  2IY0 C;  4N2Q A;  2WXG A;  1EYH A;  4N3A A;  4FHK A;  4A63 B;  2ZGG A;  3QB2 A;  3CK7 A;  3E34 A;  3L17 A;  1IXV A;  3CKC A;  4XZ4 A;  1N4Q A;  3MKQ B;  2IOS A;  3BEE A;  5HS0 A;  4UQX A;  5J08 A;  3FUJ A;  3BUA A;  4XI0 A;  1YCS B;  3TWS A;  4N5Q A;  2PM7 A;  3ZYM A;  1HG5 A;  2EIN E;  1ELR A;  3CHR A;  2HE0 A;  3RRM B;  3AJI A;  5BW8 C;  3CHO A;  4X8Q A;  3V79 K;  4UWH A;  3APF A;  4UWL A;  4BFR A;  1E90 A;  3CLJ A;  3SFX A;  3S7F A;  2YHC A;  3EHN A;  4U8H A;  3ZNG A;  1E7V A;  4DK5 A;  2HYZ A;  5AJD A;  4NRH B;  4RVB A;  5KNG A;  2OND A;  3CVN A;  3MV2 B;  1ZBP A;  4WAF A;  1SQM A;  1TJC A;  3Q9N C;  1HX8 A;  2KBX A;  3PE4 A;  2AXZ A;  4GCN A;  1N94 A;  2VGX B;  2LAH A;  4H7Y A;  1FVF A;  5FWQ A;  2VQ2 A;  1QQE A;  4XIF A;  2LXM A;  2WXO A;  4HQD A;  4LNU D;  3UKR G;  4K5C A;  4C9B B;  2QC9 A;  1LTX A;  3IXE A;  2VTB A;  4XEI G;  2KM4 A;  2H6I A;  2AVP A;  4YDY A;  5BNW A;  1NP7 A;  2I2O A;  2X6I A;  1NI1 A;  4A1G A;  2LUH A;  2ETC A;  2XS1 A;  1NFI E;  3CVP A;  2FEZ A;  1RZ4 A;  2VGE A;  4MS6 A;  1MX6 A;  3AG4 E;  3DSS A;  3QJZ A;  4TUU A;  2A5E A;  3JXJ A;  3PRE A;  2GRN B;  2EIM E;  2LAI A;  4GMR A;  4K03 A;  4LCT A;  3NOC D;  2WXI A;  4TUM A;  3FUE A;  3UT4 A;  2EIJ E;  2QYU A;  2P9K G;  3ZGQ A;  1N9A A;  5BPP A;  1H6O A;  2YIN A;  4ZFH A;  4FHJ A;  3IHV A;  4LUN U;  1N4S A;  4XE0 A;  3TWX A;  5T4Y A;  4I1O B;  4JXT A;  1KPS B;  4B8A A;  1WAO 1;  3ESL A;  1D8E A;  2F37 A;  3KD7 A;  1QZ2 A;  3AS8 A;  5CEC B;  5A7D B;  3MCX A;  2DYS E;  4AXH A;  4ILG A;  5EYP F;  1E96 B;  3T8M A;  4GZ3 A;  5JJ7 A;  2ETA A;  2OCC E;  2KZT A;  1JWG A;  3FU3 A;  5IY5 E;  2CFU A;  4TXQ A;  3RIB A;  1S0P A;  5KWD A;  5AEN A;  3JQ0 A;  2WXM A;  2XQ0 A;  3E33 A;  4GTO A;  3B7B A;  4CDN A;  4K0R A;  5FT9 A;  1A5E A;  3G2S A;  2DYR E;  2I9C A;  3DSU A;  3LY9 A;  4FJY A;  3TWV A;  4UWG A;  3L9T A;  1LF8 A;  4BWR A;  2Y0B G;  5G04 J;  4AV7 A;  2KCV A;  4ACL A;  5FIO A;  1DC2 A;  5EKQ D;  4U95 D;  1OUV A;  3DEP A;  2EQX A;  3TWQ A;  3D9N A;  3KEA A;  2WQ6 A;  2CG2 A;  2C0L A;  3DSX A;  4GA2 A;  4GTP A;  1UJK A;  3DXK G;  3DBS A;  4JA7 A;  4CZ2 D;  1K1A A;  4JD2 G;  4BTB A;  3FEY A;  3AS4 A;  5G04 C;  3OXF A;  2MHK A;  3JUI A;  5B1B E;  4B8C B;  2J4D A;  4I43 A;  4F1P A;  2VSY A;  1BPO A;  4WND A;  4TXP A;  5AAO A;  1P5Q A;  4C0E A;  4HS2 A;  4HVB A;  1YYH A;  3DWL G;  3LS8 A;  4HOQ A;  2BKG A;  2X6K A;  4DX2 A;  4U0Z A;  4JHR A;  3R7Q A;  2LXL A;  1INZ A;  3B7S A;  2AJA A;  3C72 A;  3TG4 A;  4GYY A;  2I1K A;  4G8L A;  4GZ6 A;  4NQ0 A;  3PZD A;  1E7U A;  3MX3 A;  4G24 A;  3S7D A;  3PZ1 A;  2X6J A;  3RKV A;  2CHW A;  4FC8 A;  4J8S A;  5HQ8 A;  4I9C A;  3P2B A;  1QBQ A;  4K5B A;  1SVX A;  4FLB A;  3TAX A;  3AU5 A;  5ANR A;  2H6F A;  3SY2 A;  1Z3X A;  1HXI A;  3MKQ A;  3V2O A;  5EDS A;  4EZL A;  4F7A A;  2C0M A;  5BT1 A;  1HE8 A;  3Q9U C;  3G2U A;  3DSV A;  3UT8 A;  1OCZ E;  1DCQ A;  3NQP A;  1L5J A;  2XHE A;  3I4R B;  3FUH A;  2CHZ A;  3URZ A;  4V3I A;  3VLF A;  3FTW A;  2X6F A;  4J8E A;  3DST A;  2HM8 A;  3ISM C;  2IU1 A;  3HYM B;  5CED B;  1OWL A;  2Y3A A;  4YVQ C;  3MV3 B;  2V4H C;  5KJL A;  3CVW A;  2FI7 A;  3SZ7 A;  3ZPJ A;  2LSU A;  3FHE A;  4BY6 A;  1RW2 A;  1JUQ A;  2ZIR A;  3EJN A;  2ETB A;  4PS8 A;  2JLB A;  4CRW A;  2Y69 E;  3GZS A;  3PH0 C;  3TWU A;  4GTS A;  2EIK E;  2P2C P;  4GZ5 A;  4AP2 A;  3R9A B;  5FQ4 A;  2RFM A;  1S64 A;  3LVQ E;  2UWJ G;  1OXJ A;  3QOU A;  3ASG A;  1OY3 D;  4JZY A;  2J07 A;  4GTM A;  4TRQ A;  1UG3 A;  1KZO A;  4EZJ A;  2ILR A;  3RO3 A;  3CVY A;  4W9R A;  4KT6 B;  3CVX A;  3CHQ A;  2V4L A;  3FWV A;  1ZU2 A;  2X38 A;  3ZIM A;  2M63 A;  1YA0 A;  1DCE A;  4B94 A;  4HOR A;  3UIO C;  1Y8M A;  3AG1 E;  3V31 A;  3VLE A;  2I1J A;  4AEZ C;  3G2V A;  2AW6 A;  1HO8 A;  4F53 A;  4RQI A;  2F8Y A;  3ZXS A;  4JVS A;  4L9P A;  3MJW A;  4DX5 D;  4OYS A;  4ANU A;  3LKU A;  4LNB A;  3CVV A;  5AN8 A;  5EIB E;  1HG2 A;  3FUD A;  1MQS A;  2OEW A;  4Y6C A;  1TJF A;  2MOW A;  3E30 A;  2L9B A;  3LYA A;  3RK6 A;  5AAR A;  2XS8 A;  3BU8 A;  2J4B A;  4G11 A;  1OT8 A;  1WY6 A;  4H7X A;  1KZP A;  2I6H A;  1H0A A;  5FQ6 A;  4G2V A;  1A17 A;  1TNO A;  4AY6 A;  4KMO A;  4UQY A;  3RO2 A;  3PNT B;  3UPV A;  3CK9 A;  3PUJ A;  1TN8 A;  2NC9 A;  4HBD A;  5H7P A;  2KAT A;  3SBT B;  3ASH A;  2KZT B;  4RG9 A;  3NAW A;  4GZC A;  4CCA A;  2B6C A;  4ACK A;  2DWZ A;  3ABL E;  3QWV A;  3QWW A;  4U96 D;  2WXQ A;  3PEV B;  1H6K A;  1E8W A;  3NOG D;  3T5V A;  5D66 A;  1H19 A;  2XGS A;  3Q78 A;  1BLX B;  5FZR A;  3BQO A;  3QAQ A;  4PS7 A;  3J5Q B;  4BER A;  4HLL A;  5CBO A;  3L16 A;  4U0U A;  2GRM A;  2AXV A;  4B93 B;  1OWO A;  4WUY A;  3D9I A;  3SD5 A;  4AJW A;  2J8S D;  3DXM G;  4ABN A;  3LXU X;  4CT0 A;  4CEM A;  1PY1 A;  1N95 A;  2IFU A;  2HO1 A;  2FO7 A;  3IHY A;  3LY7 A;  3RSE G;  4GYW A;  4GML A;  4MBG A;  2WXP A;  4N39 A;  3K9I A;  3TWR A;  3F6Q A;  1TNU A;  1MHQ A;  2WXF A;  3AU4 A;  5EX3 A;  3QNK A;  3ZKJ A;  4MRU A;  1K8K G;  3HRA A;  4U07 A;  1FCH A;  1Q2Z A;  1MZC A;  4FU3 A;  2PQN A;  1OCO E;  3AAA C;  4G23 A;  4DUI A;  3FP3 A;  1WDY A;  2DIW A;  3ZVV A;  5AQA A;  4EQF A;  3LJ3 A;  5T8I A;  3Q79 A;  1HFA A;  3B95 A;  4L2Y A;  2XGM A;  3CST A;  5FZQ A;  3VTX A;  2P9L G;  3UIP C;  4J8F A;  1N0R A;  4QFV A;  1FVH A;  5EX0 A;  4IUL A;  3LY8 A;  4ILI A;  1K1B A;  2ZXW E;  4I1A A;  3CEQ A;  4LSZ E;  1PC2 A;  1SW6 A;  2H6H A;  5ARF A;  4ILH B;  5JMN D;  4AVX A;  4EZK A;  3ML8 A;  5ITZ F;  4L1B A;  4HFG A;  3TXM A;  1V55 E;  5EN5 D;  3QC1 A;  4IYP A;  5D0Q D;  4EHM A;  5KCM A;  2YHE A;  3B7U X;  3QWP A;  4ANW A;  3OAW A;  1DVP A;  2XZT G;  4R7L A;  1N0Q A;  4U63 A;  3D9H A;  4Q94 A;  1QNF A;  3CQC B;  3FUI A;  3GW4 A;  2C2L A;  4UI9 K;  3SHF A;  2JEK A;  3L13 A;  3HXD A;  5FQ7 A;  4OAU C;  2WMN A;  3B7R L;  3HXE A;  3RRU A;  2L0T B;  4G26 A;  1XNF A;  4BSZ B;  4P29 A;  1KT0 A;  5B1A E;  2NSZ A;  4J7W A;  4LNG A;  3FH7 A;  2LNI A;  3LEW A;  2EIL E;  3DPY A;  3JQ1 A;  2KCK A;  4HOT A;  4KZC A;  4KVO A;  3T8K A;  2R59 A;  1H2T C;  2WXN A;  5E76 A;  3C3O A;  4I6J A;  3LPZ A;  1WM5 A;  5ENR D;  4DJA A;  1EDU A;  4Q69 A;  3UM1 A;  4PS3 A;  1SZ9 A;  3G2T A;  1VDY A;  3UM0 A;  1XGW A;  2BTD A;  3D9M A;  3KSL A;  1LD8 A;  1TNB A;  3HDX A;  3Q75 A;  4HOS A;  1HH8 A;  5EID A;  4HRL A;  3HXB A;  2XGO A;  3VTY A;  3FUK A;  2OOE A;  3ZUV B;  2BF0 X;  2B0O E;  2GRQ B;  3CSF A;  4L7T A;  5G05 J;  4I2W A;  3D9J A;  2L0I A;  2KXP C;  2WXJ A;  5FZS A;  4JHK A;  3ULQ A;  2LO6 A;  4WNG A;  2GRP B;  3N71 A;  4BT9 A;  2VYI A;  4JEU A;  4N5C A;  4GPK A;  5LFA A;  3APC A;  3HVE B;  1IHB A;  1TN6 A;  4RLY A;  1K3Z D;  3APD A;  4E85 A;  2CG3 A;  3ZYL A;  4KZ0 A;  3QAR A;  3V30 A;  1O1S A;  4M3O A;  3RJV A;  4N3B A;  3ZYK A;  2R5S A;  3UUX A;  4N3C A;  1BU9 A;  2UY1 B;  3NZU A;  3PVL A;  3SFZ A;  2V0P A;  2V5F A;  3Q47 B;  4JA9 A;  4CGV A;  2E0I A;  3CVU A;  5HRY A;  1JPL A;  1FPP A;  5A23 A;  5EYL A;  3ENE A;  3UMV A;  4ZHB A;  4UQZ A;  3O4Z A;  3ESK A;  2P9S G;  4L23 A;  3UIN C;  3HHM A;  4XKB A;  3NF1 A;  5AQ7 A;  2FO1 E;  4YDW A;  1ELW A;  4AY5 A;  3HXF A;  4DRX E;  3Q49 B;  3JXI A;  4GZD A;  4GCO A;  3D9K A;  2ZU6 B;  3QDN A;  2PL2 A;  3C5R A;  2AWI A;  3CHM A;  2XPI A;  2XEV A;  4KVM A;  3UKU G;  2P9P G;  2BKK B;  5AYW D;  4F1S A;  4B89 A;  3SO8 A;  1NA0 A;  3FTU A;  4DPR A;  3E37 A;  2IO3 C;  3L54 A;  2XEE A;  2DZO A;  3UQ3 A;  4BX9 A;  4HB5 A;  5FQ8 A;  2Y4U A;  3SGH A;  2P9N G;  2YQ8 A;  4GMJ A;  3GZ1 A;  5D2M C;  2JAB A;  4WWO A;  4CT4 A;  4LER A;  2J9Q A;  1OWM A;  4ATG A;  3PRZ A;  4AM9 A;  3JUE A;  4LEU A;  3GYZ A;  3SI5 A;  5J90 A;  1G3N B;  4GTQ A;  1Z3Y A;  4J0U A;  4ANV A;  3C3R A;  4J8Y A;  3ZXP A;  3ULE G;  4GB9 A;  2WQH A;  4FUL A;  4G25 A;  4HRN A;  1V54 E;  3ASD A;  4PUC A;  2GGF A;  2NYJ A;  3FUL A;  1TYQ G;  1HF8 A;  2DBA A;  3PZ3 A;  3T9K A;  3D9L A;  2FUL A;  4O6F A;  5LCW J;  4MLP A;  3TG5 A;  3X2Q E;  1E8Y A;  3MKR A;  4AIF A;  5A6C A;  2XCB A;  4ME2 A;  3FU5 A;  2L6B A;  1KLX A;  1D8D A;  2QFC A;  3EU5 A;  4U8V D;  4ANX A;  3O48 A;  1JCQ A;  3EDT B;  5ENT D;  4D10 C;  3SBS A;  3CV0 A;  3NBN B;  4OAV B;  5JA4 D;  2DZN A;  2R05 A;  2V8S E;  2Q7F A;  3SQV A;  5BV0 A;  2A4Z A;  2WQ7 A;  2GRL A;  2VGX A;  3ZHE B;  2VSN A;  3R7R A;  5CBN A;  4LRZ A;  3SFY A;  2J08 A;  3FTX A;  2OV8 A;  5KNH D;  1MX2 A;  4EBA G;  2RD0 A;  4G1T A;  2VSO E;  3FUN A;  5C1D A;  3UM3 A;  3LCA A;  3EHM A;  1HU3 A;  2XZD G;  4WNE A;  3DSW A;  1EPU A;  1Z6T A;  4HI9 A;  2L6J A;  4BX8 A;  4Q96 A;  2VSX E;  3QKY A;  3Q73 A;  4OVU A;  3B7T A;  3WG7 E;  1JWF A;  1MJ0 A;  2OEV A;  2YNQ A;  1OWP A;  5ANL A;  2R2L A;  2NXP A;  3SF4 A;  1O1T A;  3PE3 A;  4I17 A;  3FU6 A;  4A3T A;  1TNY A;  1S70 B;  2RG8 A;  3IEG A;  3PS6 A;  3CKB A;  2AXU A;  3U3W A;  3Q4A B;  2DVW A;  5ENQ D;  4I6E A;  2J49 A;  3PZ2 A;  3D3M A;  1Z5S C;  3AG2 E;  4URK A;  1UJJ A;  1TEZ A;  1O1R A;  3TJP A;  3U64 A;  2IOL A;  2A5U A;  4JC8 A;  3J5P A;  2IF4 A;  3T5X A;  4GA1 A;  4DX6 D;  3ZFW A;  4BT8 A;  3RAU A;  3ASN E;  5AIJ A;  3ZYQ A;  3PDN A;  3ML9 A;  5BXO A;  4OVV A;  3FUF A;  3EIJ A;  3L22 A;  1SZA A;  1N52 A;  3ZHE A;  2XPZ A;  3ULY A;  5CMY A;  5LP0 A;  3HG0 D;  3KAE A;  4F6R D;  3ZEF A;  2UY1 A;  3CGH A;  5AQB A;  3PUK A;  1WG0 A;  3EHR A;  3FEX A;  4U04 A;  1UW4 B;  4WWP A;  2GRO B;  1N54 A;  2VTB B;  2P58 C;  2IQC A;  4E6H A;  2WPV A;  3CR3 A;  4UWK A;  2XPY A;  1DNP A;  2MRI A;  4GYO A;  4FJZ A;  3TWT A;  2WXH A;  2XEN A;  4NAC A;  1E8Z A;  4A3V A;  4DX7 D;  2FF4 A;  1OCR E;  3V2X A;  2KCL A;  3Q15 A;  4QQI A;  4YND A;  3DRA A;  2F0Y A;  2WVI A;  2ZIS A;  1SA5 A;  5CHE E;  3BG1 B;  1U2V G;  3TXN A;  5ENO D;  2QY7 A;  3PNL B;  4RSY A;  5BUZ A;  3CVQ A;  3UI2 A;  4NIK A;  1D9S A;  3FY4 A;  1Y6I A;  3FTS A;  3U66 A;  4J8D A;  4APO A;  3UT7 A;  5HI7 A;  3UX4 A;  4HNA D;  3C98 A;  3L6A A;  1LD7 A;  1UOH A;  1IYG A;  1GW6 A;  3I5P A;  2WXR A;  3RRN B;  4AOF A;  4TXR A;  1OCC E;  2J09 A;  3DEO A;  5LOZ A;  3ZU7 B;  1OWN A;  3CIA A;  5JHB A;  5CRV A;  1BI7 B;  4FAD A;  4CDR A;  4YDO A;  4GTT A;  3DPD A;  3I4G A;  3IKO B;  1IHG A;  5CEA A;  1ELK A;  2WM9 A;  2BED A;  3G2W A;  4APF A;  5KJN A;  3EUV A;  5CRU A;  3LJN A;  3Q7A A;  3CK8 A;  3R9M A;  1NA3 A;  1N11 A;  5JHA A;  3CVL A;  4YDE A;  4IRU A;  3JCK C;  3B13 A;  3I3N A;  5G55 A;  5DBK A;  3CQG B;  4LG6 A;  4JB8 P;  2E2E A;  2P9I G;  3QK0 A;  4O60 A;  4ATZ D;  3MEK A;  2VGY A;  5KJK A;  3LVR E;  1U3C A;  4BTA A;  5AJL A;  3E32 A;  4FLH A;  3ZN3 A;  3EU9 A;  4CDM A;  3L08 A;  4HOU A;  5CMW A;  3FU0 A;  5M72 A;  4XI9 A;  4BSX A;  1UN8 A;  1NL4 A;  4GAA A;  2V5Q C;  2HR2 A;  3MZL B;  3D9O A;  4KYO B;  2FBN A;  3ZRH A;  5LX8 A;  4WNF A;  2R17 C;  2OVB A;  4GTR A;  4U0S A;  3KEZ A;  3HVE A;  5BV1 A;  4N2S A;  3CHS A;  4EPZ A;  4JPS A;  3ASO E;  4A1S A;  4L2L A;  1MX4 A;  4DLQ A;  1BD8 A;  2MYO A;  5FIN A;  3U4T A;  3ONL A;  2WXK A;  4GPM A;  1H6P A;  5JJ6 A;  3ASF A;  1IQR A;  3FUM A;  2IEJ A;  5G05 C;  5FJY A;  3SNX A;  3UM2 A;  2XRY A;  4A55 A;  3S7J A;  4BEP A;  1H2V C;  1EF1 C;  3C3Q A;  2XRZ A;  4GU5 A;  4HXI A;  4DX1 A;  4UI9 C;  1U3D A;  2BUG A;  3P1U A;  1QYM A;  4DLO A;  5JJT A;  5ARG A;  1NZN A;  4B0Z A;  3FTY A;  5BXU A;  5E75 A;  3D9P A;  3TWW A;  3MA5 A;  2IJG X;  4JL0 A;  3FTZ A;  4C48 B;  2VJ8 A;  3FH8 A;  4K5A B;  5CER B;  4HI8 A;  3E4B A;  5B3S E;  3CHP A; 
#chains in the Genus database with same CATH homology
 4JD2 G;  3DXK G;  3UKR G;  2P9U G;  2P9S G;  3DWL G;  3DXM G;  3RSE G;  2P9I G;  3ULE G;  1U2V G;  2P9N G;  3UKU G;  1TYQ G;  2P9K G;  1K8K G;  2P9P G;  4XEI G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...