3RSGA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nad.
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 179
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rsgA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rsgA02
4EOHA 3KTNA 3N1CA 3NM3A 4JJPA 3K5WA 3D3KA 1KYHA 1LHRA 2JG5A 3H74A 4YL5A 2AX3A 1C3QA 5C41A 1EKKA 5TRWA 3ZS7A 4KADA 4U7XA 5BYDA 2AWDA 2PKNA 3B1RA 3RQXA 5CGAA 3UQ6A 3FHYA 3KZHA 4YWRA 2JGVA 3QAIA 3ROZA 3RTDA 1LIIA 2AFBA 2AJRA 2C4EA 3B1OA 3H49A 4K8CA 4S1HA 3ROEA 3UBOA 4JKUA 4XF6A 3GO6A 3LJSA 1UB0A 3BGKA 3DRWA 3LOOA 3NCAA 3RTCA 1GC5A 2DDMA 2DCNA 3B1NA 4LBGA 1V1AA 3NM1A 1TZ3A 4C5JA 3UQDA 5C3YA 2ABSA 1JZTA 5TQIA 3PZSA 1GQTA 3NL3A 4XDAA 5CM5A 5F11A 4S1IA 3RTEA 3LHXA 3LKIA 4O1GA 1EKQA 5EYNA 3IBQA 3NL5A 3RQHA 3EWMA 4X8FA 4KAHA 4C5NA 3RQ5A 1RKAA 1ESJA 3NL2A 1YGJA 2A9YA 4E8ZA 5B6AA 3HPDA 4S1IB 3RSQA 3IKHA 4XF7A 3JULA 3FHXA 2HW1A 3KD6A 2I5BA 4E8WA 1V1SA 3RRJA 3RS8A 1RKSA 1L2LA 4C5MA 4E84A 1LIOA 1RFTA 3NC2A 4LC4A 4UBEA 3W4SA 2PKMA 3RSSA 1YGKA 3UMPA 1DGMA 4B8RA 3RY7A 1ESQA 3K9EA 4GM6A 3RREA 5COJA 4C5LA 2I6BA 2JG1A 1LIJA 3KEUA 1TYYA 4N09A 3RO7A 3Q92A 4O1LA 3B3LA 1BX4A 1VI9A 4K8TA 3ROGA 1UA4A 3HICA 3NL6A 2A9ZA 3RTGA 3CQDA 3BF5A 3VAQA 2PKFA 4KANA 3RT9A 1JXHA 1TZ6A 4WJMA 4DU5A 1V1BA 2AJPA 3D3JA 4K8KA 3RO4A 4XCKA 3RPZA 1RK2A 2RBCA 4K93A 3UMOA 5EY7A 4E3AA 5BYFA 1RFUA 3IH0A 4DC3A 3RSGA 2DDWA 4KALA 4EUMA 4LBXA 3RQ8A 2R3EA 3NBWA 2AB8A 2O8NA 2XTBA 2C49A 4EN4A 2AA0A 3MBHA 2YXUA 3QA2A 3RT7A 4N08A 4S1MA 1RKDA 3OTXA 3RQ2A 5BYEA 3DZVA 3B1QA 5F0ZA 3RPHA 2DDOA 2FV7A 2F7KA 2DG2A 3RU2A 3MBJA 3NC9A 4C5KA 5BYCA 3I3YA 3B1PA 3ROXA 1WYEA 3RU3A 1JXIA 1V19A 2R3BA 2ABQA 1YHJA 2QCVA 3RM5A 3HYOA 3RQQA 3IN1A 4LCAA 4JKSA 3RSFA 4EBUA 5CGEA 1TD2A 3PL2A 2VARA 3RQ6A 3UQEA 1LIKA 1LHPA 2HLZA 4K9IA 3RTAA 2PKKA 2YXTA 4K8PA 5C40A 1U2XA 3GO7A 3NBVA 4PVVA 4E69A 3RS9A 1VK4A 3RRFA 3GBUA 2Q5RA 3Q1YA 3RNOA 2NWHA 3IQ0A 4K9CA 2QHPA 3IE7A 3UQ9A 4B8SA 1VM7A 3VASA 2V78A 5C3ZA 3RTBA 1RFVA 2F02A 4KBEA 3RRBA 4E8YA 2HQQA 2I6AA
chains in the Genus database with same CATH superfamily
1TEZA 4I4TF 1F2TB 2GN2A 1J7KA 2P6UA 4INOA 3R6LA 4GI5A 4MZDA 1OVMA 4BDSA 3WLMA 2AE2A 2VKTA 3EODA 4QJ5A 4MWGA 2RSLA 1V7ZA 2GCEA 3FOAA 2Z04A 4H6WA 5F5XA 3ECSA 4XPZA 1GUFA 3V3TA 1QVZA 2Q9AA 1P1KA 3AY0A 4MRSA 3GPCA 2X5JO 1WHSA 1CUXA 2R6JA 2FEWB 4LA4A 1OD6A 2G88A 3KBOA 1CRZA 5DOVA 3DE5X 2BKVA 4QQNA 3SLRA 1KI6A 3CLUD 5LLTA 3K70B 2A78A 4MV9A 2VDWB 4O4LB 4C9BA 2AZTA 1NOKA 5L51A 4GH5A 4JVNA 4S1IA 1HE1C 3BE4A 4X63A 4QPDA 4LV5B 2O3QA 3GT7A 1HTTA 3ZGVA 2JFZA 2PGLA 5LU9A 4P34A 1W0JA 1I9CA 2D1RA 4WBNF 5LB2A 4LJ6A 2BW0A 5JTTA 4EEKA 3JTMA 1TD9A 1Y5LA 4ZMRA 5B1YA 1G7SA 2QVYX 4Q7LA 4XWTA 3TNFA 1N77A 1LLDA 4BB9A 1HYQA 1HYBA 1LSOA 2AW5A 2I6GA 2QGFA 3DMTA 3T3MB 4URHA 3SBDA 4NOKA 4X6YA 1XNQB 4BNLA 1KAQA 4BO9A 3LYLA 5IM4A 2VR1A 4KPFC 3U4IA 2X2EA 3D3WB 4PZAA 4MP8A 2X0EA 4CL0A 2OYRA 1P62B 4E5VA 1DAIA 4ZGGA 4LIPD 3STTA 3ZCQA 5CM9C 4ND8B 1W0KD 2C7BA 4ERXA 3P9NA 1TO6A 1W47A 4YIKA 4AF6A 2NV6A 3A58B 4D9JA 2YJZA 4B82A 3CZ5A 2YR0A 3CQDA 1EVYA 3LYAA 1JPNA 4HNRA 2IOFK 4MV3A 3BWXA 3WG9A 1P73A 2WMYA 4DCTA 2PMFA 1BXRA 4PZYA 1DWPA 4HAOA 3VH1A 5K9ZA 4U7GA 1E3MA 1JN0A 1WW3A 3T1OA 3CUWA 5CFZA 4OYRA 1XZEA 3D6AA 4R2XA 3ZDRA 3RKUA 2PUDA 4XD7D 2PLNA 1A04A 1U2QA 3OJEA 2JW5A 2XNDA 4KN9S 3N2NA 2Y1DA 3IELA 4D98A 3CLRC 4KQIA 4DWJA 4DY4A 1Y82A 2VJCA 4NC9A 3CRRA 5GGYA 5CFLA 3MWDB 1AQLA 2G1PA 4Z53A 5E6UA 3KPJA 4Q3EA 2H6EA 1DBIA 2OUKA 1M6VA 4C78A 5IK2D 1R2QA 4AZ3B 2GFIA 1Y7LA 2IHVA 2G3YA 1O95D 4RZQA 3HCFA 3Q7QA 1Q7GA 1AH2A 5BYCA 1Z82A 2I7CA 3E4DA 4QBGB 3ZWDA 3WGQA 4AO8A 4KL8S 1UFRA 1RXSA 4X7PA 1PHRA 3O7WA 1EX9A 2ISSD 2JGIA 3L46A 1BE1A 1RQLA 1YJQA 4FYHA 2GHIA 1AXGA 4GPTA 3NS7A 4GLLA 4BZWA 1M5UA 4YMSA 3OZ7A 4ALJA 4E4RA 4W8GA 3GDGA 4MI9A 4W5TA 2O0JA 1HDOA 1Q21A 3G2IA 5HR5A 2AFIE 3ILVA 4KLZA 1QF9A 4Z1MA 2Z8ZA 2ZI5A 4MRNA 5AM1A 3AY3A 5IFKA 4CUZA 1UK6A 1SJ9A 2RG1A 2GXQA 2IJGX 3O74A 3QUQA 3R5XA 4GR4A 1UDRA 2PM8A 3B7WA 1XQXA 2P9BA 4KVZA 1IULA 1QLJA 1V95A 2AZDA 2XAUA 2V96A 3X1YA 1GA6A 4J2OA 1E7QA 4QA9A 1AQIA 2OFWA 3SICE 2BFCB 4MUGA 1F48A 2IDJA 3P5SA 2MMCA 4TVBA 5EHIA 1BYUA 1PFGA 1L7OA 2QN1A 3I0MA 3FR8A 1J1ZA 3GA7A 4UDXX 1IIRA 3GNTA 2Q8NA 3O3MB 1AC5A 3QBTA 2D5IA 2YZ2A 3MUFA 4O8CA 4JJ4A 4O4HA 4CTKA 2RK3A 3GPDG 1RR6A 3A6GA 1YDMA 3B1NA 2WYUA 1QIHA 5BWLA 3LRPA 4W5QA 4GKAA 4QNNA 1NF8A 4QULA 3MYYA 4OXYA 1Q2XA 4ZYLA 1UBRS 4M0KA 4NJMB 4AMGA 1UZLA 4BBAA 1M2KA 1NUHA 1Q1BA 1ES9A 3RFFA 3TPZA 5CCXA 4AKIA 1A27A 3C24A 5L8VA 2JFPA 3NJ4A 4KHZA 2GCOA 5CB4F 1DVRA 1OV6A 2H2WA 1JHVA 5A3JA 1QHNA 3T5TA 1RJDA 1RJGA 3EQ2A 2WMNB 5K0JA 5KNCA 2P3LA 1O5ZA 4Y8VA 2O4UX 2OHFA 2OHVA 1JR3A 4YXWA 3DOCA 5JPDA 1ZN9A 2JAWA 3QLVC 4LEIA 2RGNA 1O8BA 4BMVA 4C6TA 2NXWA 2XB8A 3DOEA 4AI6A 1CFJA 1P60A 3ZTWA 2C92A 4QUBA 1G6OA 3HZRA 1L4MA 4IDFA 2MTBA 1FDRA 5J58A 5LFAA 2F8SA 1G0NA 4YMTA 2XECA 1BWQA 1ZQ1A 2FLVA 1IK6A 3FB1A 3LI2A 1J8VA 3L8CA 3P0JA 3PWZA 4MEJA 2WJWA 1RPTA 4JGIA 4D6YA 4J3NA 4N47A 2QAGB 3FPKA 1NMXA 2EBWA 3OZTA 4P4SB 1KOLA 3GDHA 4F71A 5JT1A 1V1BA 1N7HA 4ERNA 5KUTA 3F98A 3PKJA 4TTVA 1U8EA 3H4VA 1B6TA 1Z12A 3DBIA 2CNWA 5ALNA 2FSIA 1ORWA 1W4BA 2W2OA 2WUGA 3DTVD 1UK7A 2WHQA 2ZT7A 1VSBA 2BV3A 4B33A 1MENA 2DC1A 2YJGA 1J2YA 2NYRA 4X24A 1QM5A 3WNQA 2XQGA 4DL9A 2GAIA 2GLUA 2HF9A 5H7XA 2XITA 3OX4A 4QBIA 3TFWA 1FA9A 2QIPA 4ESHA 4Y9DA 3I9FA 3DM5A 3FWZA 2HMYB 2N1MA 3NTOA 1Z0IA 2JH3A 4BNNA 1CBUA 1NV8A 5FUXA 4PX3A 3EIXA 1E3DA 2P9TA 3RC3A 2Y6VA 3NHLA 3WICA 4ML3A 3U6BA 2V7QA 3MK31 4I4CA 2FPIA 1U28A 1N5JA 1V41E 1YZKA 3E84A 3MUEA 2A58A 3LFHA 3AXSA 3WOHA 4B45A 4DBZA 1QFZA 4DQDA 1BXKA 4ROSA 2YX1A 4QODA 4R9UC 4KYTA 4H4EA 1OA0A 3PEVA 2CXPA 4DLZA 1D6JA 1L8OA 3JD3A 1GKIA 2IXGA 4E12A 5C1OA 3PFCA 4E2ZA 1DL5A 3FN4A 4LISA 4WGFA 2HMAA 4Z4CA 1MIOB 5JYCA 3AC0A 3DYIA 2WVAA 4LOAA 4MWEA 4P83A 1GNPA 2OXRA 4IVPA 1PS8A 1VKNA 3C1OA 1U3UA 3U7RA 1JIQA 3JS5A 2AYXA 2XWSA 1OTHA 3EIHA 3RC7A 3JQ6A 2BFBA 2DPXA 3FKSD 4HGRA 4X94A 4XTRA 3KHTA 2HUPA 3SYRA 3VNAA 1ISHA 2Y1FA 5L3ZA 4C6HA 4YCSA 4UATA 4YAJA 2EXXA 4PWYA 1OYVA 4KQ6A 3RFUA 1RSZA 2QUBA 1ZJ5A 1H3FA 1KHHA 1OAOA 3PPWA 5E6RB 1KGDA 1DBRA 1FPMA 2PH5A 4MK4A 5ALHA 2VUSA 4DDUA 2QZJA 2VBCA 5E9AA 2IGBA 4KGZA 3TL6A 4U6QA 4ZIYA 5ETJA 1K7SN 1QH1A 4V0QA 2CHVA 4TVKA 5K0GA 1YZUA 2WAYA 3J7TA 5CH5A 3KFLA 4HNQA 1Z5ZA 3NFRA 2R84A 4URUR 2DOKA 1Y4UA 2ZRLA 3I1JA 4N1AA 3LJSA 3GUVA 5HF6A 3TCKA 3O21A 5FUQA 5AWFC 1O6ZA 1UPAA 4RK4A 2HNAA 2K2WA 1N6LA 1YQEA 2I7XA 3LPNA 1VHDA 1QV7A 4H27A 3WL5A 4IIBA 4QDTA 1BDJA 4DJJA 3CU5A 3AHDA 2V3VA 4JI5B 3E9NA 3RADC 3ADDA 4BV8A 5GJCA 3O8NA 2C29D 1M2WA 1KJIA 1U2DA 5DLPA 2NZVG 1LDYA 3OJXA 5IKEA 2GZRA 1L4GA 1CE8B 5FIUA 2ZR8A 5DYIA 2WP8J 1VMDA 4GXNA 1NVBA 3VJMA 1ZCZA 4UTOA 4BO3A 1TVKB 3WYEA 4B87A 4DSTA 1YA6A 3BXGA 1OFIA 2LW7A 5C0OE 2EF1A 1P2SA 1JUDA 2FK7A 4OIMA 2O7NA 5IF3A 3P9ZA 2YV1A 5BSFA 5JAUA 1LDMA 1E60A 4JB2A 3KTFA 5K3BA 4QD3A 2G1UA 1PJ2A 1PUIA 3FMVA 2JLXA 2I76A 4DC9A 5KTKA 4NZNA 1QO7A 3RR2A 4D3DA 1PKXA 2VXOA 3SZUA 3NOXA 4WCFA 3KUCA 3PNBA 5NULA 5JDIA 1A77A 4MH0R 2I5PO 4HRXA 3U7GA 3JATA 4XDZA 1ZMBA 3CLSC 4C4TA 1KOGA 2F3QA 4G1UC 1UJ4A 2IIBA 1JLRA 1V96A 5DHRA 1G0OA 2AI2A 3OQBA 5JDCC 2XGGA 1O58A 1OGJA 2JLQA 1TEVA 3BRQA 2RJNA 2XNCA 3CB4A 2DTEA 3EVZA 1RQNA 4GZMA 5TT0A 2ZAOA 1KRWA 3L4SO 1TCUA 1NVWQ 2Z83A 2BKUA 3DEHA 5ER9A 4O2AA 5GMOA 221PA 4OK5A 2GASA 3TINA 1HDYA 1IJBA 2QPAA 2FUEA 3CQ9A 3MMPA 4OFBA 3WC4A 4M53A 5CCEA 4B8WA 4EA6A 1N34B 1QP4A 2JGDB 2QLLA 1NBOA 1MQ8B 4BZPA 1A8QA 1NBAA 2P3OA 2P41A 2QF7A 3N1UA 3KT6A 4MUIA 5F9MA 5H1YA 5KDOA 1X80B 2REOA 4C0KA 1F3OA 1XRPA 2ZJFA 5M04A 1RQRA 1GPJA 1MOPA 5LLSA 3IQDB 2L69A 4I19A 1XZ8A 2RE8A 2GD2A 2GPAA 1WEKA 4D43A 2GK3A 3G13A 1MAAA 2OM2A 1P74A 4XQCA 1G3IA 5EWMB 1SU4A 3LHDA 3GO7A 1IWBB 1TMYA 2BF7A 3SFZA 5I4CA 2X76A 3UY4A 4UHCA 3BQNB 4LWZA 2NO4A 2RHHA 3B6JA 3GJ3A 4IIXA 3ZCPA 5DBIA 4EGCB 3QV2A 1WXQA 3FSGA 2DWPA 5M29A 4UQLA 1EP1B 2NTVA 4YAIA 1NMSA 1XCPA 5CVUA 4Z49A 1WF3A 2FWBA 1QG4A 3Q8KA 1RKUA 1CU1A 1ODSA 4CEIA 3TZLA 3SAJA 1QQAA 1F5NA 3N6RA 1A76A 4M37A 5IAKA 4Q01A 4PG8A 1E2LA 1P7CA 4DIMA 2MSNA 3VMMA 2SHKA 1EBUA 3FNGA 2AUTA 3CR3C 3GVXA 2OFFA 3UK7A 1PVOA 4HYTA 1C0IA 3AILA 1XTBA 3LRXA 2UAGA 3IB3A 1EM8A 1KJJA 5FV7A 3UMVA 4XWGA 2BHTA 4WLOA 1GEEA 3IUBA 4QHYA 3L8HA 1DBQA 2H92A 4ZU6X 1TMGE 5JVDB 3BQMB 4MR8B 1TU0A 3KV1A 1GQTA 1P2GA 4WCDA 1LTQA 3KQQA 4AB1A 3UJHA 1I1QB 4ZODA 2AF3C 2C4UA 2NXJA 5E7QA 1LPOA 3I01A 4NCXA 4RMIA 4CR6A 2I4OA 1G64A 2ZTSA 3GP5A 3NHBA 4RFSA 4WKGA 1FXWA 4YP9A 2IYWA 4HEA1 3ME5A 1YR9A 1FFDA 3ND9A 2X0FA 3VPBA 2GLXA 3QOXA 4H35A 1QQBA 5H59A 3DYBA 1DIRA 1ORIA 5J2TF 3UC9A 2XTJA 2HHCA 2WQZA 1LLQA 2NU7A 2WFMA 1AMOA 3QXSA 5E3JA 4UBEA 2QV0A 5DH9A 3QU5A 4B4WA 3EQ6A 3IUQA 2ZIUB 4CFYA 3M6XA 5DLYA 3S44A 2ZR7A 2D59A 1TJYA 5KJ6A 3O3CA 3WLQA 3KETA 3ITNA 1RHRA 3CONA 3R0IA 1Q5PA 1GQYA 3EVDA 4PYRA 1DDOA 4JJ7A 3HMKA 2OBMA 1HT1E 1TJ4A 2QD5A 3HO6A 1X0VA 2ZJ3A 2W6ZA 4ZDKA 5AKEA 1N32B 4GGOA 4FHFA 4XD2A 1ZD5A 4MMXB 1HRKA 3LECA 4C2TA 4XM1A 1MB3A 5G2OA 1XG5A 2NIPA 4M87A 3GLIE 2A5GA 1SXGA 3ZZNA 2Z2YA 4DVGA 2NV2B 4ZVNA 4P82A 2I7TA 1RMYA 3ST7A 4C0QC 4A7PA 3NOOA 4MVJG 3DBLA 3A3YA 2FW9A 3NYQA 4FYPA 4YCJA 3R5TA 3RS7A 5KI6A 3GAMA 2XHEA 5KIAA 3ZVKA 2OBBA 2Y68A 4FCTA 1R5JA 2Q4TA 4E2XA 3WZ2A 3ZLTA 3TPFA 2H9IA 3UJ6A 3W3AH 1TU3A 4MR9A 4FJ2A 2A9VA 4PS0A 4HH0A 1T2EA 1XRJA 5JW6A 3A9SA 1OHHA 3CX8A 3RASA 4OO3A 3F3KA 4KVFA 2WTUA 4MWTA 4LXUA 1V19A 4CQMB 1JAIA 4P58A 1QE5A 2R4TA 3KJGA 4A6PA 2FDRA 4XX1A 4B75A 5IMBA 4EBUA 2H65A 1IWPB 3AH8A 1IM2A 4UULA 3GJ5A 3R9WA 3JQQA 2OP1A 2CCGA 2WSYB 3E5HA 2AN5A 4E2WA 4BVBA 3JWEA 5CEEA 4J9UE 4N3NA 5J47A 1QP7A 3R76A 3DO5A 4RKQA 3RS9A 4C2UA 3BWMA 1J24A 3D4NA 1XLUA 5AW4A 4Y67A 1PJCA 1CF2O 4LRUA 3K1TA 2GJ9A 3B3JA 3P9XA 4H3VA 4HR7A 5CB6A 5EC8A 1GPNA 4BFXA 1U9IC 2I4MA 3P1JA 1JYEA 4D9FA 2W58A 3EXHA 4KR3A 5EP2A 3HCPA 2E21A 2IZOA 1KS2A 5EVCA 4ZD6A 2GZ3A 4JQZA 3ZNNA 3RFTA 2QTVB 2WABA 3OLWA 2QP9X 3L1IA 1FSGA 3A6PC 1QCYA 2AOUA 4LK2A 3RJMA 3PUWA 4JWKA 1C7JA 3IDQA 1UM8A 3RC1A 3HJTA 1YBHA 1WB4A 1QDEA 3U44B 2NU9B 3ICWA 3IP1A 1IBKB 1LPPA 3N87A 4J0FA 4BC0A 3UA4A 1JLLB 1PDVA 5ALUA 1ODIA 1QYWA 5LPNA 3KTAA 1OYWA 4GT1A 4R5HA 3GH1A 2HWWA 3WRYC 5IAGA 3O2SB 2LUOA 1PR0A 2OYSA 2B7LA 3FNEA 4FQ8A 1XRQA 3B3GA 3OLQA 2VF5X 3OQPA 4X00A 5CTAA 5FNVA 4DV5B 2G1AA 2CYBA 2GTHA 4NI5A 3I1YA 2WA2A 1VP9A 4CEIB 3QU4A 2CUTA 1GWNA 1K7XB 3C6BA 3LWZA 2WIDA 3MWKA 3A1TA 3QVVA 4TSFD 5HM6A 5HM8A 2A5YB 5LSAA 4GC5A 1YI0A 1YU9A 4JD5A 1U4SA 2H54A 2HGZA 3KG2A 1ESEA 5D2CA 1XKQA 4GI1A 4OATA 1ZZEA 2VQ6A 3D3QA 3IMFA 3STWA 3R0XA 4D02A 3LX4A 3NT2A 4G1FA 2CMGA 3QXCA 1OFUX 2GEDA 3AM5A 2XVYA 3RAGA 3IIIA 2WVJA 1G98A 2E4WA 2QEQA 3C4VA 5C18A 1FEZA 1OAKA 5LYJB 2AJLI 1BMFA 1H3NA 2NUPA 1S8NA 4MLZA 4M1OA 4QATA 3RC9A 3EUEA 4P2BA 4IQ8A 4IIVA 1UJNA 4GX0A 4PGGA 2KMLA 4TWRA 3V00A 3MMNA 4XVQA 5CJPA 2J5XA 4TL9A 1Z18A 2IELA 3RCBA 3ROQA 3T7KA 4C43A 1BHO1 1SUCA 1QVWA 1MX5A 2BSXA 4A1OA 1T13A 3IAS1 2JFUA 2VDNB 3CMCO 3H1GA 2WVGA 3L4BC 3L0ZA 3MTAA 3QELA 4YN3A 1P3DA 1IEWA 3VBEA 4RUKA 2XB2A 2CK3A 2PVCA 1YCGA 5UKDA 3TDKA 4GYYA 5DSZA 4N08A 1GU0A 1IEQA 5E95A 1RRKA 3ADKA 5CW1A 4DMGA 2NLOA 4EUEA 1OXUA 3C85A 3G7SA 2BT4A 1UOEA 3PU6A 4CVNA 1F2VA 2CXNA 4TQGA 1NSYA 3DFKA 4C0HA 3WLIA 1NRJB 1JT2A 2YN2A 3F4BA 3M0EA 3EUFA 4X54A 3ICEA 1CRQA 2CBXA 3NBZC 1AQYA 2DBQA 4YWJA 4CG1A 5L7TA 1NJFA 4QTXA 4DQLA 4N8EA 4INZA 5KOHA 1JHDA 3KB2A 3U3JA 2ENUA 3SXUB 4BNMA 4CM9D 4GGPA 4EQ6A 2I87A 3ECAA 4KMMA 3DT6A 1GPDG 1FXSA 1ZMRA 4JYPA 3TDMA 1TT7A 1BWPA 3ER6A 3C8UA 3P94A 2BDTA 721PA 2VT7A 3TXAA 3TUZC 3OPNA 3PSAA 4PC3A 4JHXA 4AN0A 1Z4MA 4MKHA 4OFWA 2GN9A 1OMOA 3HBMA 5EJ9A 3NBFA 1UQUA 1XD9A 2ZJ2A 1RZVA 4Y2RA 2C0QA 1CJVC 1SWWA 2AVNA 5CU7A 2WZQA 3QQPA 4DHEA 5IKPA 4RKRA 2I29A 4B3RB 5BSHA 3PE6A 3AEUB 4WESA 5CX1B 3T61A 1RQXA 1YS9A 1BC5A 1W59A 4QSMA 1ODFA 4WVLA 3W78A 3FMFA 4OMCA 4XX0A 2FAXA 4WEOA 1C9YA 1P6UA 1RFLA 2I8CA 3DXZA 2FPGA 3KQSA 1P6QA 2P0EA 1T36B 1B6GA 1BGXT 1SU8A 1Y1QA 1G8AA 3NBAA 3QG5A 4J76A 3VHXB 4NCAA 3EXEB 5AK4A 3KWJA 3VH4A 1REQB 1M76A 1KOFA 2QY6A 2NSHA 2VSOA 4HATA 3VOSA 1T5IA 1J2RA 2YWEA 2DHRA 3PWSA 1WWKA 1GXSA 4HZIA 5K4HA 4JBIA 1M73E 1XDZA 3CPSA 1NQXA 5IC5A 2QE7A 1DC7A 3EGIA 3VR6H 2UXCB 2ZWMA 1AKNA 4PC2A 3L93A 4XOIA 3U4AA 3JZDA 5LZ4A 5KVQA 1EVIA 3EXG1 4RESA 4MX8A 3H8WA 4QJIA 4NCBA 2QUIA 1UWVA 3GMTA 1CUZA 3I6MA 4R1UA 3UJ8A 1RFTA 3LT4A 5D6NA 2A92A 2R8RA 2CF6A 3CLHA 4OJYA 3TIXB 3UICA 3U6KA 4R1MA 1CETA 5EXEA 3D6UA 1ZJJA 2HF8A 2BOVA 3F96A 4QLAA 1WDMA 1T34A 2IXBA 4UTXA 1JNYA 1AK9A 1FVOA 1GGJA 3TBFA 1L3IA 1YZYA 4R40A 3PC8A 3Q0IA 4EEZA 3UPTA 1UFOA 2ADFA 4KO3S 4MUBA 4BCDA 1VI9A 1SIUA 4EO9A 1T10A 3GG2A 1CS0B 2PSSA 3LL4A 2YIDA 3CPHA 4YR7A 1U04A 5C5CA 3KQNA 1Q7BA 3ILYA 2R1VA 2W22A 3KOWA 4KANA 1OLXA 3SXUA 1TZ6A 1ISFA 2OEPA 2A7QA 2PD4A 4B74A 3PEFA 1FP6A 2VDVE 1XLWA 3D3JA 3OJOA 4RS3A 4H7EA 2YWFA 3EMBA 4RHTA 2WK1A 1CJUC 1YMQA 5JNWA 5LWQA 1FU4A 1OWLA 4NBKA 1BQEA 3A14A 2YMLA 5JQGF 1EQAA 1WABA 3OOJA 1A9XB 3ZW9A 2BFNA 3ONDA 4MTCA 2VT2A 3UXHA 4PBRA 1E3WA 4FQ5A 3HJHA 1XCOA 3FSJX 1FP2A 2R96A 1QHFA 1XNJA 2Y1KA 4UHHA 1L9KA 1L3BA 2G7ZA 5K09A 1EUCB 3Q7RA 5JH7A 2QB5A 4DEYA 1CB0A 4WIAA 1CWUA 1E2DA 1C9KA 4IUYA 5ALRA 3HFRA 3FAZA 1TB4A 4DC1A 3SE0A 3AESB 4HGYA 3SMQA 1WOMA 1DXQA 3ZW8A 3ZZTA 3A1WA 1E1DA 2GN4A 3NTVA 3T52A 1FE8A 1MRNA 1V5FA 1XAGA 3QPUA 4I5IA 3QNWA 3MS4A 3T3EA 5IANA 5ALZA 4WNAA 5BW8A 2QUAA 2QSZA 3UAXA 3IQFA 1W88A 2GM3A 5HF9A 3D0RA 3IP5A 4HAWA 4EVQA 4Z2AA 1NHGA 4L15A 3F74A 3M6IA 4JLUA 4LXYA 4C3OB 3SPXA 2AWOA 3E22B 4G0ZA 2ZXUA 1LY1A 1JFLA 1G42A 1KRHA 1R6AA 2JK1A 3ANMA 1GA1A 4NJOA 3K9NA 4RHFA 2C9DA 3VOTA 3GJRA 1WVGA 2I22A 3O3NB 3PT5A 1AS3A 3VNSA 2RHCA 2IXDA 2F8MA 2OHGA 2ODAA 1BE8A 2VF7A 2GEFA 5IDVA 1V47A 4CG2A 5K3DA 3UXYA 1KBZA 2CNKA 2WKWA 1QGDA 3NFYA 2HEGA 2GWHA 2PLWA 3D8TA 3R3ZA 3R6DA 4Y30A 2VH5R 4CGZA 1TZKA 4WNIA 3RRMA 3UQ6A 2GEBA 3LXMA 1EFHA 2OWEA 1G8GA 3PNLA 5FOWA 2W70A 3C3EA 1WU7A 3VR2D 4YLEA 5CHEA 3UMCA 5DNAA 4JSYA 4B0OA 4MQ5A 5EIAA 1Y9DA 4W1SA 3DMDA 5BQFA 5HXAA 4PYIA 1P1JA 1NQ5A 2JLZA 2P27A 3U4CA 3TLAA 2AMFA 2DBRA 5CVTA 3A6JA 3AW8A 3OJFA 4OGWA 4DYDA 4NYJR 3FLAA 1Z7WA 2JASA 1VL6A 4WY2A 4G1MB 4Y9UA 2J48A 2ZUVA 3MWLA 3K0CA 3SHFA 1Z88A 2HQSA 2WWWA 1SPXA 5ICMA 2UZ4A 2MINA 4NARA 3QW2A 4R0VA 4EP1A 1Q0ZA 3RRJA 2HD4A 3RS8A 3KLPX 3OIUA 2VXCA 5BSEA 4OHCA 2GPNA 1RI1A 2VYQA 1ACMA 1Z38A 1EDEA 3DMHA 1FTWA 3DUFA 5BN5B 4PF1A 5FADA 1D9XA 2OC9A 4GOXA 4JUDX 4YJ3F 1R8QA 3TLEA 1Y1KE 4A8JA 1FSFA 1GKUB 1IY0A 2Y67A 2YJ5A 2YYZA 3PWKA 4OSEA 3K5PA 1HM5A 2NUAB 5ALMA 2DWOA 3EN0A 4HAIA 4R1LA 1U9IA 4JEUA 2VPIA 4L8GA 3HYRA 1G6KA 1Z16A 3LDHA 4Q93A 4XWAA 4KDEA 3R8XA 2XEDA 1LI4A 3O4FA 4RCZA 4RDXA 3OFKA 3GXOA 4ZTZB 4IXTA 4LQLA 4BU0A 3TVYA 1ZH4A 1TZBA 3PD0A 5KMGB 5CRIA 1P9RA 2HXSA 1D4FA 3KUDA 1IC6A 3A37A 2IIVA 3I4LA 3MD9A 3JU3A 3KEQA 3OO0A 3QXHA 4Q0MA 4JYAB 4KITB 4LRQA 4DYVA 1XAJA 3HRKA 1SHJA 4JN6B 3H16A 4OP2A 2V4UA 1CF9A 5KC9A 3JQFA 5JAZA 3TR6A 1QC5B 3LUKA 1VE5A 2XMCA 1MX3A 5FEUA 2ZYSA 4O5OA 1YULA 2C00A 2V55B 4MLCA 5CPBA 1A50B 2XUGA 4PFJA 5F1OA 1WETA 4GC9A 2GZDA 2W4IA 1U9CA 2MSLA 2AOXA 2E2WA 2R7LA 4MYRA 3GEPA 2A0YA 1Z7BA 2PPLA 4J0HA 4UD6A 3TEJA 1QQTA 3W3ZB 4D9CA 2FFQA 3NIWA 3RHZA 4KBYA 3TQFA 1BA2A 1F9AA 1T6BY 2R3BA 3URMA 4CKEA 2C4HA 1PBNA 4FFBA 4JXXA 3S2UA 5CT4A 1EUYA 1E0AA 3V8QA 1CR1A 4HKTA 3UWPA 9ATCA 4QO8A 5LR6A 4JX9A 2A5LA 2RMKA 1J00A 2ZBQA 3KSRA 2XI4A 1XGKA 3D2CA 3VTKA 4QDKA 2LCQA 4IG9A 2O07A 3I2JA 1OCEA 3A7EA 4QQRA 4ZZ1A 4ETMA 2UUBB 5AI5A 2JZOA 2Q7XA 4PSAA 4GECA 4B3TB 3UQ9A 1LK7A 1E18A 1PNQA 2CXQA 3DFUA 4FDVA 4QLOA 3BWDD 4FS8A 1W7KA 3G0CA 2RHJA 4YBRA 4OTZA 4A16A 3LPLA 2O2ZA 1UPCA 2EV9A 1QYXA 4EGAA 4EOHA 4Q39A 3D5EA 5A1JA 2RBKA 5BPFA 5CVEA 2G76A 4UARA 1TVKA 1OR8A 3P0HA 4P8RA 4RACA 2KYRA 4RX1A 5CHYA 1GRCA 4DSZA 2BAGA 4PC7A 3QSYA 1JR4A 2FJ0A 5BW4A 2YFHA 4TTPA 1GZ7A 1QZUA 1R00A 5FNVF 4ZEXA 4AN1A 1MC5A 3PXDA 3OT1A 4IJWA 1K5PA 4FINA 3FFXA 3QEKA 4XF6A 1KH1A 1Z56C 2IZZA 4JODA 2HHJA 4OHRA 3H99A 5IBRA 1I7DA 1EX6A 1WBBA 2D54A 1EBFA 1UMBA 2J4CA 4JJIA 4KMOA 5HEKA 3GRVA 3EARA 3WGOA 3ZIAA 4AVYA 1ZGJA 5JXGA 3LWDA 4IDCA 2VPTA 3ONVA 4QRDA 2HRZA 1JXOA 4MYUA 3GCWA 5F73A 3L7JA 1FYEA 2R0QC 1DT5A 2AW3A 2WG2A 1UBUS 4I36A 5LQCA 4LWQA 3ZX5A 2O48X 2EW2A 5BSGA 1A1VA 2D6FA 1R9GA 1VE6A 2K4MA 3ELYA 3IP8A 3LC0A 4ZGWA 2AN1A 2QUKA 4K6HA 2I5BA 2OP0A 1XVIA 2G5TA 2N47A 1OLOA 5FORA 3W4KA 1LJUA 1JZQA 4Z51A 2Z3ZA 1QC5A 3BB3A 5AHRA 4AO7A 2VEDA 4WKOA 6PFKA 2PQ0A 4BGUA 4AKEA 2J7PA 1Z28A 2YRWA 4DMFA 4DV6B 2CE7A 4ZO7A 5B1HA 3RREA 4N49A 3WIDA 4CG3A 1GPAA 2SNIE 5EWLB 4H77A 3M6AA 5FLYA 3BK2A 4MA0A 5FO1A 2O0KA 4N09A 2DR0A 5IJ9B 1J8DA 1U0EA 2HI0A 2J32A 1ULZA 2YASA 1OT5A 4YFVA 4MAMA 3HICA 1EH5A 1I3OA 2HKIA 2C20A 4FKMA 3W2IA 3BTOA 2YMQA 4P33A 4ZAGA 4GRIA 5KWJA 1MB9A 4L7VA 3N3AC 3ZWAA 4EX7A 4L9AA 2VHXA 2P2GA 2AFRA 2RGCA 2J7PD 1JQ5A 1UDCA 1TUGA 2XQIA 5DM0A 4XSHA 3K20A 2CMHA 5KYNA 4X92A 5JNVA 1AIPA 4KKXB 3II6X 5LB4A 1I2CA 4IQ4A 3M9LA 3QVKA 1H6BA 1LS6A 3M5CA 2OCYC 6REQA 3PC6A 3L2OB 3GYBA 3FLEA 4HRAA 1TKAA 1ZLXA 2B1QA 3K9WA 5KTOA 1NSTA 1DKPA 1U7WA 1YHYA 1E8CA 3CVOA 3PQEA 1YNSA 4KI7A 5LP6C 1XCLA 3P9PA 5DBEX 3TBKA 2W8ZA 2RB4A 3F8TA 2YZNA 1T5TA 2BZ1A 2AGVA 1KJ8A 2XMQA 5J5VA 2JS7A 2NU9A 3GEBA 1Z45A 3PYMA 2ONJA 1G5HA 2FV8A 5DF1A 1OU4A 1CQZA 1E5DA 2F4VB 5B4TA 5FPHA 1VE3A 3KLMX 5C7IO 4US1R 2X77A 2P91A 1E5XA 1ECFA 2ZS7A 3MGCA 5CK5A 1WS6A 2IUEA 5AH0A 3TIIA 2WI8A 3KQTA 4XB1A 1AGPA 1F6WA 3ZLJA 3VZCA 1T9KA 1X8KA 3GJ4A 1B3RA 1H8HA 2AYYA 3JY6A 3ZHOA 2R1TB 3TEMA 3ZNOA 1G2IA 2J9YB 4V2UA 4OJKA 4ZCPA 1C1DA 1QUEA 2JJ1D 2HMSA 3LDUA 4FCCA 4QIHA 5FP0A 1TZ2A 3R8CA 3WDLA 5JAIA 2GM5A 2Y9MB 3AB8A 3T9FA 2Z9CA 1S3SA 3E5NA 2PUVA 4OHXA 4BV3A 1EXDA 1IPEA 5CT9A 2PD6A 1XQVA 4TRJA 1U7PA 2QP4A 1FRQA 3HXLA 2CD9A 3H1PA 2PS3A 5EKXA 3VR6A 1U8TA 1MVOA 4MROA 3WK6A 3ZGLA 1EXWA 4DLKA 1H94A 1EDDA 1HSOA 3LZDA 1ULTA 3MWEB 4Y2XA 3VU0A 4CNQA 3NL3A 4KOEC 4H0CA 1W6UA 1V1RB 2H4HA 2O1XA 3NRBA 3Q2OA 4J6FA 4XCXA 1RPNA 4J90A 1DUVG 1XF9A 5CMLA 4MIEA 1W581 3WK9A 4L74A 1GPMA 4XCQA 3WYDA 3NDBB 2R8PA 1YGPA 3AERA 1JIKA 1HQYE 2CLDX 4A8PA 1YI1A 4OLBA 4ARZA 1TZCA 2PBLA 4RQTA 3UCEA 3HU3A 1MUUA 3O2NA 5KTPA 3THWB 2RIRA 4H16A 3CXRA 4KXXA 3L43A 3BK1A 1JHAA 3PQ2A 4PLGA 4O0LA 4WXMA 2J30A 1TC2A 2ZE7A 3ESQA 4X90A 1T3ZA 3ZOKA 4PLTA 2GAAA 1X1QA 5AO9A 2FPOA 1QDUA 1JHZA 1UBHS 3HUDA 1BXGA 3ESXA 3P27A 4QBKA 5HUHA 1YE8A 3TQOA 3WGJA 1WZIA 3IXMA 3UUFA 1N0IA 3RUFA 4YUXA 5JO0A 1U6JA 3WRVA 2CL6X 1FNNA 4UZSA 3OTGA 2QX4A 2ZWIA 2AN9A 4HH3C 4QASA 4B81A 1LV8A 5M2QA 3I28A 4I1PA 2QRUA 3INRA 1QIGA 3IBCA 1WUIS 3L04A 1LBQA 1Q1GA 3PL1A 3MJEA 5JSZA 2HYIC 2OK7A 3M6FA 4D46A 1ZVKA 5C8YF 1GAWA 1Q50A 2J0UB 4NWIA 3E4CA 1IXYA 1K2VN 1UXIA 1O7JA 1USUA 3QJ5A 3IPRA 4IDOA 1XJWA 2G70A 4Q48A 2B20A 4LRYA 5JH7B 2GM4A 1RHMA 2VQEB 2VJMA 2XQFA 4NX2A 3KJIA 2IEYA 4AJHA 1SVSA 1TVCA 2BJVA 4CHTA 1JSZA 2HIMA 5KX5A 3J81k 2O54A 3RYTC 1IFXA 1M72A 2IL1A 2YCLA 5AICA 1W1UA 2XAAA 5EHNA 3RG8A 3GFRA 3EK2A 4CLOB 2J07A 1RIFA 2PX3A 3MNFA 1ZNZA 3ESBA 3N74A 4U9UA 1JF8A 4GOKA 3UTDA 1I33A 2YHAA 4UPDA 1QP0A 2OQ2A 4CU2A 3U61B 4LFCB 3NHJA 4DGQA 4N0DA 2IYFA 5EYPA 4P3KA 3I6IA 4KKVA 1Y8QA 1AQNA 1N9GA 2YOGA 1K75A 4OKSA 5ECWA 3WY9A 1IOLA 3O31A 3R5FA 1YRWA 3D0QA 1ID8A 1LJ8A 4H7DA 3HZZA 3H13A 1PAUA 4OHUA 1A71A 1GQFA 2HX1A 4WTOA 4Z0PA 2BGWA 3ZX4A 1D3AA 1XDDA 5C3UA 3AFOA 2I54A 5HDBB 3EDYA 5CBPB 3IEKA 4QGFA 1BFUA 1IVYA 4NCKA 4RF3A 3VYRB 4B5KA 4F11A 3RIEA 4B8SA 4FFRA 4ON9A 4QARA 4ENQA 4YQYA 3W2GA 1HYEA 2AC2A 4MUFA 4GVLA 1MW8X 2TS1A 1T9ZA 1UAGA 2OCXA 1BEEA 4DWWA 4GAEA 1WA5A 4OY3A 4XW2A 5CB4A 5IJ0B 1VLQA 2IK8A 1Z8FA 3GRRA 3LTEA 1N6PA 1Z6YA 3IUJA 4IY1A 5TARA 1UK8A 2CDNA 4O63O 3BTSA 4O08A 4U0JA 1YF3A 1ESDA 2ETVA 1REQA 2Q5HA 4TLLB 2ZG6A 1YQGA 2BTOA 3EDMA 4E1AA 1P29A 1DJNA 3DAOA 1LVUA 3RS2A 1PGPA 2FZVA 3PNMA 4ZO4A 1IQ0A 3QKWA 2ZIEA 1GAJA 4WCFC 4YJ3A 3M4JA 3TNDA 3IBQA 2VOEA 2NPFA 3HI4A 5J4HA 1CQWA 5CLLA 4JITA 5FLEX 5TGDA 2GN6A 2BD0A 2OV4A 3ND6A 3G5AA 1WKBA 2ZBFA 4WT7A 3QG1A 4M7OA 2RCYA 2JFWA 3M6LA 3FWHA 2FEXA 2X4LA 1JEQA 1KYQA 3D3NA 3SYNA 1ABFA 3MLEA 1NN0A 4LE2A 3IEUA 4V0SA 1JH8A 1HORA 3BFXA 3WRWA 1VA5A 4CXMA 4FYWA 1BWSA 1TCVA 4LX8A 4MOWA 4WK6A 4BRUA 5JZOA 4B8RA 3QTBA 3Q2KA 3EQZA 4CKXA 1O97D 2I2CA 1I1NA 3GFBA 3DVRX 2VSNA 2X2OA 3ONWA 4N0PA 3AI1A 1XQ6A 2A9JA 2UZAA 4WPGA 3UAVA 1T2UA 1D5WA 5D87A 4NU5A 4PO1A 2V0GA 1P1CA 1FSSA 3QKSA 3KHSA 3DZKA 5CX4A 3C3WA 1W96A 4RLQA 1Y89A 2FU5C 4IIJF 4BQPA 4CETA 2EHJA 3H5OA 3ABZA 1W5AA 4Q82A 1GNLA 2F3RA 2OENG 2SBTA 2VL7A 1JIJA 1UKZA 3K4HA 3R5HA 1TO2E 2CFSA 4FZRA 4J8PA 2BFWA 5HJEA 1C8KA 3FNRA 3HNPA 1DNPA 1YB5A 4L3WA 1DRWA 2QM0A 1E2PA 1FSPA 1V45E 1NN5A 4Z2YA 1KC3A 2RKWA 2OG2A 3CH7A 1QS0B 4YRJA 5K8IA 3K8ZA 1XE3A 2BR4A 5A4FS 1TM1E 1WY7A 4FBLA 1JSXA 3PLRA 3CCFA 2DAPA 3BWCA 4B8ZA 1T6YA 2IOFA 2QN3A 2XTBA 2OSVA 1RTKA 1ECLA 5E38A 5TQVA 4L4ZA 1UXKA 4CIXA 4E5PA 5B58C 1PG5A 2RB5A 4HGOA 3SQWA 4UASA 2UZ1A 2HCRA 4JBYA 3E9EA 5CK4A 4QNRA 4HJXA 2PL3A 4FE3A 1FTQA 4QHTA 5FR1A 1DAPA 1DAOA 4IO0A 2QE6A 4I1SA 1E61A 4LTMA 2D0IA 3MFQA 4NJMA 3AR8A 2GEJA 1PJZA 2A4KA 1WVIA 2HRRA 3JQAB 3ZU6A 4S1PA 3L8DA 3ZY2A 1YS7A 2JFBA 2TMGA 4NMWA 4OQXA 4DIUA 1DBVO 1T9GS 2AI3A 4EY8A 4Y9SA 4I8DA 3SBEA 3SVTA 5BT9A 4OKIA 2V4ZA 4G84A 3NAQA 5HFJA 2Q3FA 5BV1A 2I9KA 3K4QA 4YAFA 3WB9A 1Q44A 3KD3A 4RWEA 4EKNB 3GQBB 3OFNA 3JCZA 3PQFA 3A04A 1TCAA 1TLFA 1QU3A 4ZAYA 4KU4A 4BLSA 2GZ1A 3F46A 3FFAA 1GSOA 5EE5B 3TTWA 3VASA 1KI4A 3ZHBA 1T8WA 2XYGA 3QH4A 1NP6A 1NE2A 3OCJA 3OZXA 1ITZA 5BSTA 4WXRA 2JCBA 4URVR 2CXXA 1AKRA 4UUNA 3WGGA 1DC4A 1QANA 1RKBA 3A36A 3T7EA 4AF7A 1ZITA 4DJ5X 5L3QA 1V6AA 3BEOA 1H93A 2YVQA 1GL3A 3CN7A 1W0JD 4MIYA 3PA6A 4NEQA 2OBFA 3KPWA 4A0GA 2GPYA 3BCSA 3B1RA 4DNPA 1J5PA 1QIMA 1FF9A 4KWCA 4LW8A 2O5CA 5TMPA 4G0UA 3B1OA 1Z0JA 3SHTA 3SYLA 4D0SA 2H2DA 2YW2A 2CDBA 3NBKA 4LZOA 5GZ1A 3UMJA 2FJPA 3G59A 5GY7A 1KF0A 4EMBA 1YACA 1HDCA 1QZXA 1V11B 3RTCA 4MUAA 4AIRA 4MCAA 1GO2A 1V1AA 2DCNA 3UQDA 2R85A 3UMYA 1QJ4A 3D59A 1AUPA 4M89A 2QW8A 1N78A 1QG0A 1H4SA 1OC2A 4DCJA 2NZUG 3PEEA 1FU7A 1HWYA 2Q62A 6YASA 3KYJB 3TFOA 3RQHA 2O8DB 3AM4A 2XVAA 5H3LA 1E9AA 3V7WA 5HJ5A 3Q85A 2C97A 2AXQA 2I4LA 3F7MA 4ZVQA 1C1YA 3ZM5A 1G66A 3MCUA 2H7YA 3BXOA 3LC2O 4DLRA 1PG2A 2O0HA 2UYGA 3SHOA 4HNTA 4GLBA 3QLVA 4AJIA 2XIJA 2EBHX 3U9TA 3MWDA 1UPFA 2OORC 3GCDA 2YHUA 3NDIA 4TTRA 4F85A 4N48A 4BV2A 4YBZA 8AT1A 1E4EB 1KH3A 3F4KA 3IIJA 5I8WA 1DG1G 3ZGYA 1CY6A 4C30A 2JAPA 1G4UR 4FMBB 1L4NA 4QGAA 2C7VA 2EKQA 2D5AA 4J43A 1KDTA 5C1IA 1TADA 1WDKA 3F6BX 5G0SA 4IFIA 1NJ8A 3K4PA 1X2EA 2B3DA 1B26A 3PXGA 4JLAA 2AJBA 3IE0A 2O8BA 1FFCA 4G0XA 1AUOA 2LV8A 4BXOA 2PSJA 1F0YA 2YRFA 3FCSB 4RL6A 3MXTA 1JBKA 1GOTA 1UKEA 4K6FA 4DDHA 4AFNA 2AJPA 5BNFA 1L1EA 3KBBA 2Y3IA 2HPVA 3N7TA 4GM0A 3NBQA 1WSBA 1Z73A 3LLMA 5KSWB 4MR9B 5DYTA 1J90A 3NGMA 3JQ9A 2QTRA 3HUUA 4LVOA 4X1KA 2HBQA 4V24A 1R12A 3ZGOA 1UIRA 2GBLC 2WU0A 4NU6A 4RTSA 1K6MA 3L82B 1RVV1 1FQKA 2NXEA 3KVYA 3EEQA 1OFTA 3VZQA 3VU9A 1ICEA 2O5RA 2P7IA 5LMUB 1T5BA 4DBLC 2VWHA 4Y2SA 3VPAA 1A4IA 4TVSA 4YJ3B 2VP2A 1S8OA 4DMLA 4Z1MD 4PX9A 2CFCA 2RI6A 3BD9A 4BQQA 4DT1B 1FCJA 1R3DA 2BUCA 2FN9A 3ZH9B 3HCRA 2EDCA 4YQFA 1NXPA 5AOAA 2IS1A 4DSUA 2G80A 1RWXA 2C99A 3JYOA 4ZALA 1E2GA 1RCUA 3BG5A 5E9WA 1AZTA 1UODA 4JZYA 4REMA 3D2LA 2QTLA 1WUHS 1WZCA 2YZGA 5FKJA 1JIUA 2JVIA 3NWPA 4HDAA 3VYWA 1HBJA 3MWFA 4Y2TA 5BR8B 1J4AA 3EHEA 3H6GA 3I8SA 4WESB 3FGOA 1Y5RA 4DIOA 3G89A 4K6OA 4ZKDA 1B41A 4ZJUA 1Z6XA 1N7GA 1T4MA 2XZOA 3QLJA 3LK6A 3TOZA 3WGUA 2QD3A 1X7GA 2ZJ0A 2QXUA 3WYCA 1YRAA 4H3KB 1LQUA 2W2LA 4Q9JA 10MHA 2I1QA 5C2JB 1E89A 3RF7A 3H1TA 3UJDA 2XYQA 1JHQA 3P52A 2NQTA 1EKKA 5EMNA 4G1EB 1X39A 5BW6B 2V5AA 3T9DA 8LDHA 3ZE8A 4FOOA 1Z0ZA 2FG6C 9LDBA 5HG0A 4Z7OB 1QG6A 4LDQA 2HJHA 3U13A 1P5HA 5CG1A 1MZVA 2CWDA 3SM3A 1QMGA 4NZMA 3CRZA 3DXYA 3PGXA 5IVIA 5TQ0B 3E3NA 3HR7A 1XPJA 1THTA 2NVOA 3SHWA 4H18A 3ZGNA 4HOYA 5BPHA 3QA3E 4MW7A 4BMSA 5C51B 2P9HA 4M36A 5DSTA 4XQ0A 3RTEA 3M4XA 3F7NA 1MTOA 3CH6A 3JQEA 4WOPA 5EXXA 1UBKS 4YV0A 1YJBA 4ZQHA 1EVEA 3K0FA 1DC6A 2CLMB 3PT9A 4QT0A 3LKZA 5GJVC 4D4LA 4QVIA 4K2AA 2ZRFA 4CMBA 4YMGA 2PZFA 5DNCA 4ZOAA 4DCMA 3I1FA 4MR7B 5C5EA 1UBCA 4KO2S 4QEZA 2PKMA 1ZCFA 3ET4A 1EAYA 4RZUA 4S0XA 4B6FA 4GXRA 1SCBA 5HIMA 1O3YA 2F3PA 4RANA 5DT2A 3GLFA 4DTCA 5TT1A 1TECE 3NO4A 4IRMA 1FDWA 4O4JB 4DQ0A 3K70C 1SUIA 2FCAA 3PFIA 4IYRA 5LA6B 1IXKA 4RVOA 4IF6A 5IT9A 1TTPB 2QBYA 1E9VA 1KXZA 2FKAA 1FBTA 1G20A 3QHAA 1CHNA 4BBZA 4DJFC 3DGFC 5ULLA 4E22A 1RAHA 2QZZA 5ALIA 1VLZA 2Y27A 3PFGA 2AI1A 3EVEA 1R74A 5JI3E 1QWOA 3DEJA 1WUJS 2GD1O 2ZIWB 3DDUA 3N6VA 3EPJA 3HXOA 2D2XA 1ZK1A 4CR7A 3WBBA 2A88A 4CMKA 3IJRA 1ZRHA 1W4AA 2N46A 3NKVA 1F17A 4HLCA 1Y7HA 3N3BC 3L41A 4REOA 4WZAE 3S2FA 1DADA 3O4RA 4XPIA 3MBHA 1GG2A 1NZJA 2HY7A 2H2AA 3IT3A 2FFHA 1NUSA 4UNQA 1F1BA 4BIIA 1A7KA 2X9QA 4PZPA 3BSFA 4PYLA 4HVLA 2F7KA 1N5MA 2BR3A 1IHYA 2PMCA 4RL4A 2GTPA 1J56A 1JLHA 1URPA 2NUBA 2NTYC 1K8RA 2QP3A 4NULA 2XUPA 1BDIA 2X3UA 1MO6A 4JC8A 1U94A 2G71A 3OIFA 4U7PB 4DR2B 4OI0A 4ETIA 3ZWCA 1FFXB 4ZV4A 1A2QA 2Q2QA 3M6UA 1BXZA 1K5GA 3KT8A 4RH3A 2IHJA 2QTMA 3GROA 4PZZA 2BWJA 3W5SA 2O8EA 5CA1F 3HDGA 3NL2A 1H05A 2A4MA 4FX2A 1RACA 3CB2A 3OD1A 1ZKMA 2ZI4A 1PF7E 2A3NA 1J22A 3BX1A 3N0TA 1LLUA 5FFFA 1WULS 4MRRA 4ZRDA 4P4UA 2FSUA 1WW8A 4UMVA 3NH9A 3PNVA 3T1QA 5GONA 3LYHA 3DL4A 3UYKA 2O1WA 2QENA 1Y4DE 3HUFA 3PQDA 3QIVA 4L5CA 4PG5A 1C8BA 1PL8A 3L9XA 4Q9IA 4CTJA 1IBRA 4ZHQF 5LZ9A 1IEXA 3A1FA 3TX2A 2BFEB 4IV5A 4B2PA 1Q0PA 1DTWA 3GLKA 5AVRA 1UOPA 5ICEA 1U5BA 1WCXA 1E66A 2MWMA 2QAIA 4UMEA 4ZVTA 4BMYA 5BUQA 2GPTA 4ZXFA 3OUZA 1OSNA 3V34A 2JIDA 3SVLA 1TOAA 4ZP1A 3QFSA 2FQYA 3AQIA 4R1QA 2V45A 4RETA 5EWJB 4AD8A 4EW1A 1XL1A 2GDZA 4L4SA 1ZA1A 1GPWB 1A5TA 1PR4A 1Q92A 2RFLA 3EDQA 3JTEA 3KEOA 2C5LA 3N8IA 1W4RA 4O5AA 1QPBA 2XDAA 1FDUA 1KEUA 3DBRB 1NLFA 1JIIA 3MRVA 3MVEA 1B74A 3S2ZA 5A9SA 1A69A 3SS8A 3LY5A 2CFOA 4QDUA 4QUKA 3ICOA 3ZQKA 5HKBA 2C61A 2X15A 4QQ8A 2QRJA 1NM5C 3R7FA 3CTPA 3HJAA 1YVDA 1RAIA 2BELA 2V9ZA 2JKZA 5CLGA 2OAQ1 2YV4A 1K63A 3I9OA 3O8QA 3F5DA 3Q0TA 4I55A 5JCJA 2CCKA 1VSTA 3V1KA 2F1KA 4ARIA 2RAVA 2BONA 5SY6A 5AVSA 3PKZA 2EW8A 2PT9A 1BGVA 2N42A 1NQTA 2GA8A 4HLQB 1LSUA 1EWKA 4OV6B 1HEYA 1NFFA 2H29A 1XZDA 2I6BA 4LNHA 4M1EA 5KNDH 3I53A 5M5BA 3KJEA 4YUYA 2XIQA 2RAFA 4XLZA 4ER3A 1N2CE 1D6NA 1PEDA 1F12A 3OQIB 5D00A 1DAEA 1CQJB 1QAOA 1U8YA 2IDKA 2JAOA 3T1YB 2WG0A 3JX9A 3VHLB 5JSKA 4L8VA 5KQGA 3BT7A 4ZOEA 1JB1A 3C6QA 1CNEA 4PHFA 2YYAA 4X3CA 1U3VA 4H0NA 3SX4A 1RKXA 4PINA 4BE9A 4KO4S 3GHYA 2GAOA 1CEEA 4BUZA 4O4IB 1HTWA 2MSEB 4GZ3A 4P7GA 4U7JA 4KAFA 3NBWA 3DZJA 1ZOLA 3NBUA 4PLVA 2ONYA 5JBIA 1Y81A 3UVEA 4KUEA 1LI7A 3IR7A 4XOUA 4F2HA 3GG9A 3QU2A 2DDOA 1WTCA 2Z43A 5EZYB 1FFXA 2D5CA 1TJ5A 3WLKX 4DADA 9GPBA 2IYQA 3CC8A 3QEMB 5IXYA 3DQPA 3L77A 3ANYB 3DH0A 1ZD8A 5B3JA 2PKCA 2QN7A 2G9RA 3H5VA 1D1PA 2FEAA 1JJBA 1U3FA 5H4GA 5HJ2A 2OWDA 3RT1A 3VSBA 3EGXB 4RZSA 2IPNA 4C04A 3HB7A 4TKZA 4G4JA 4R6XA 2BYTA 4INAA 3BUSA 1DG9A 1EQUA 1HLFA 1TE2A 2GN8A 3L1UA 4OSOA 4QXAA 1MAWA 1RXEA 5CVVA 4ALKA 3L1JA 1Z62A 4YJKA 1C14A 3O2QB 3BERA 3KPUA 5E2AA 2CMKA 2C9MA 2WFAA 2WBLC 1XTTA 1ZXBA 2FR1A 3JVEA 3GNQA 1JEEA 3T6KA 3QEAZ 1NDUA 3LV8A 2WA1A 3AHGA 2PH7A 3QBVA 4Q6BA 4XLLA 3ZS8A 5J1TB 5C80A 1PCXA 2VPZA 3RRBA 5FA8A 2J0EA 2EHDA 3UQYS 2I2BA 3EPHA 1F51E 3NETA 1PL7A 1TYCA 4Z7JA 2ZM6B 2QPOA 3H17A 1P3Y1 1PEAA 1Z06A 4LHYA 4YGYA 3O3OB 3FPLA 3FYUB 2Z08A 3IR5A 5K0BA 4WNAB 1H5NA 2C4MA 4L7QA 1FS6A 4PLYA 4RHUA 5BURA 2XD9A 3O1JC 1VRVA 4LDPA 2QRVB 1MJNA 4J4BA 3I5YA 3TKLA 2EKDA 1P5FA 1JSRA 2R00C 2XY4A 3GFTA 4XQ9A 4OLFA 1KY3A 4YREA 3BMCB 3JQ7A 1QHEA 3K1JA 1AKUA 3MPOA 4O1GA 4Y6SA 2VRBA 5ILQA 2X0DA 3V1TC 3QPCA 4H7FA 4OP1A 2Z1MA 1K08A 4JLMA 1IBSA 3KOOA 1LTKA 3Q3VA 4WERA 4EWLA 1CUGA 1F0NA 1MJGA 3QMMA 1NRXA 1Q7EA 4Z86A 5DW3A 3ZJ5A 2AC4A 1PV4A 2B1JA 2FWNA 1R9NA 2OB2A 3O9MA 4NDAA 3TN7A 1MC4A 2P67A 5DNWA 3CRW1 3TTSA 2G9NA 1JPVA 4F91B 1Y6GA 1YA8A 3FMIA 4HGNA 1TRHA 2OYCA 2IZ6A 4L27A 3COJA 1BD3A 4EKDA 4URFA 1IONA 1K8YB 2H5LA 1HFEL 2VP3A 3KR2A 2P1RA 2YN0A 3R2JA 1FS5A 3WGLA 5JTUA 3KVNA 3AUSA 3A9WA 1WV0A 3QBJA 4DCGA 1H3EA 4L5YA 4MVXA 1J8MF 1ORVA 1KZYC 2AR0A 1E5VA 2B2CA 1ZD1A 2BZSA 1UDXA 1YWGO 1WIWA 1ZM9A 2W4MA 2WWFA 3AB3A 1CSEE 3IAS6 4KDFA 4NNOA 5JCZA 4MHTA 2WOOA 3VAQA 1E1RA 3IEMA 4I2NA 1R9JA 4R8RA 1CUBA 5C8VA 2NU6A 1JKIA 3MWJA 1UOOA 4RV5A 4P53A 4UNSA 1XQ9A 3VR1A 1YZGA 5HKLA 1I0ZA 4RTNA 2FEMA 4CCYA 1AUVA 3HKDB 1X7ZB 1X6VA 3AI2A 4AZ3A 4RFLA 4Q16A 1TDJA 3DV2A 2MJLA 4IDBA 3UFXB 3PGVA 1GT6A 1A2KC 1ACLA 3NRJA 3F49S 4UQOA 4DREA 3I61A 5IVDA 1ANKA 2HW8A 1BDMA 1PX0A 3F7OA 3NUGA 4FMDB 4HWSA 3CEPB 4BECA 1HR0B 3LP8A 3A6EA 5LZ2A 2LP4Y 1O1YA 2PNFA 4JT9A 2NZYA 3DC7A 1PQYA 1N92A 1FYWA 1NLZA 3D4IA 4KXUA 5BR7A 5LOVF 3CO0S 1QORA 3OTOB 3P9KA 2IUSA 3REQB 2XSZA 3VSAA 4IS2A 4K1LA 4BEBA 1NJ2A 2GFQA 3ZDDA 2Q8PA 1UDBA 1WSAA 1VZ3A 2CHEA 4P4NA 2CFTA 4F4IA 5KCMA 4YVFA 1UMKA 3FWPA 4TSKA 4B3IA 2PJZA 2GRUA 4BQIA 2ZIXA 5AW8A 2V6BA 4G0PA 4IPTA 3ADBA 1QX3A 4KI0A 4EYGA 1SK8A 5HZKA 1A9OA 3GC6A 3WWZA 1LV7A 1V48A 3CRQA 5ENVA 1KC1A 4PSUA 1CVLA 4IEIA 4UFOA 4AQYB 2HSGA 2YOHA 4JL8A 2O8EB 5BMOA 1E1LA 1N9ZA 4HP8A 3GJYA 4RMJA 3INNA 1DFGA 2JH9A 2B94A 4FP9A 1AHNA 2X6RA 3G6WA 3MCWA 3V3KA 3FNFA 4PZUA 2B78A 1OKKD 2HU5A 4PY2A 2A86A 3PX3A 1DEKA 2GLTA 5K20A 3O8CA 4GSYA 5I9NA 2DYKA 1OBFO 5IASA 2AMLA 5A7FA 1KWGA 3D2AA 4KIFA 1QFMA 4IVRA 3BSSA 2FMXA 2IFTA 1I6KA 4G4SP 1UBFA 1VL0A 3DOOA 3L5KA 1JFFB 4RD2A 1IN8A 1G16A 2PQ2A 1IRIA 1JEYA 2PLAA 3QK7A 3U2QA 4DR3B 5L9AA 4RD3A 2BTQA 5A05A 5C34B 5KZMB 1MW9X 3QOFA 1TZ3A 4MNTA 2DUNA 5A03A 2IITA 1DUSA 2QVZX 2ZSDA 3P32A 3S7TA 5CM5A 1X3SA 4E5NA 1G8YA 4FFPA 2CLFB 2B1RA 1D03A 2PUTA 4IVNA 2G0AA 1VGQA 3LLVA 4ZN6A 2OQRA 1US8B 2PZJA 4B3CA 5JRDS 2CJWB 2LR0A 4EPWA 3UJNA 1SZDA 4PCLA 3CJQA 4EB8A 4M6WB 5D1NA 8ABPA 1RW4A 2B5VA 3NATA 1SA0A 1XRNA 3A6FA 4L78A 4P3XA 2Y1LA 1KDVA 4M49A 3HBJA 5KPDA 5GOTA 2WKSA 2ZRPA 4X1IB 3UOAB 3Q3EA 1CUDA 1B2LA 1DRUA 4B2YA 4HMQA 2DTXA 1MG0A 3TBHA 1MT0A 4Z7QB 4XGRA 2WF6A 3IVCA 2VNHA 4KWEA 3MT9A 4X0EA 2B4RO 1KJWA 3PUIA 1OX6A 1SA0B 2GYWA 1TEXA 2JD2A 2V9PA 3EWSA 3NVDA 4DEVA 4DLYA 3ZWOA 4QUHA 2IA5A 2I3ZA 4Q4CA 2AK2A 3GT0A 3IEVA 1PZHA 3HUTA 3HYLA 4HX9A 3VR4A 5GJWC 4CIWA 4HMOA 3BRWA 2WWRA 4X6LA 2UXDB 3HBLA 3RPZA 3O1HB 2ORYA 1J8FA 1JR3D 2WF8A 3I0NA 2ZBEA 3Q6IA 3R6WA 4IGIA 3BXHA 1YQWA 4MKZA 4AJ1A 3AUKA 4P93A 2GCOB 1MOQA 4RJJA 4RVDA 4OQPA 2R68A 4Q1AA 2XGOA 3IJEB 4CUJA 4ARZB 1KEKA 5TQ0A 3CW9A 4HX2A 1R6UA 4I3GA 4NAUA 4U6SA 2X0RA 3SP1A 1I7QB 4JJGA 1X70A 2IQIA 4GLOA 2C8JA 1KK0A 4RY0A 4WCVA 4Y7DA 1V11A 3CW2A 3OTXA 1DU4A 4Q66C 1L4EA 2C0CA 3L0YA 4OJNA 2B7BA 1JTEA 4JCOA 4XUDA 4RZIA 1DXOA 2HTFA 2NO7A 2RC5A 3OZVA 4JU9A 1C8LA 2W7TA 3GRAA 4LDAA 2ZRIA 4Z9YA 3T0FA 5DSXA 4UEKA 3FHOA 3GLHA 3QUSA 4ZOQI 1JXIA 2JI4A 4MHOA 4TLAA 1I2ZA 3FI9A 3HYOA 3WDMA 4HDRA 4IHJF 1XCGB 3PQ7A 1MO5A 4G8CA 3ZXIA 2XMGA 2BKAA 5J4VA 3CF6R 3KRTA 3L7IA 2D2VA 2OUIA 2QRLA 4P84A 1I36A 4PQEA 2XBMA 1QKIA 3RRNA 2QA5A 3U37A 2R5FA 1VGRA 5CFPA 1OTYA 1M34E 4MVYA 4E21A 4EY3A 2D8AA 4YRZA 4E69A 3ZXXA 1FDVA 4JT8A 2HH9A 2KX7A 4NATA 1JGTA 5HS6A 3C15C 4TL6A 1AO0A 5DCUA 1T0BA 4J7UA 5KQMA 1XMJA 3TZCA 3I4CA 3VUFA 5IMSA 4MPJA 3TTXA 1I8TA 4YK7A 4JUBA 1PN3A 4EA7A 1IZ9A 1HT0A 2A33A 5I4KA 2J41A 2YJ3A 4E3ZA 1CQJA 4ZZ3A 1LEHA 1G9XA 2IV7A 3JQDA 3TXYA 1BCSA 3VM6A 3CLKA 1Z15A 3RUDA 3EH1A 3ZG6A 4DIDA 1AKTA 2DBVO 2VCEA 3QAIA 2C2YA 3AFMA 2C4TA 1N9GB 4GPEA 4F5DA 3FYUC 3NB0A 2WM3A 3TVTA 1ZJWA 4Z3DA 5K03A 1RQ2A 1ZSYA 4EJ2A 5KKNB 2V3CC 1DIGA 3AUYA 1OBOA 3R44A 3RSCA 2IYSA 1EE1A 1CUWA 3WSWA 4BKOA 2CJWA 4ZCRA 1XALA 2BGJA 4L76A 4U8HA 3ETNA 5TQIA 3L02A 5FI3A 3NIBA 4K3VA 3X0DA 3HBNA 1CXZA 5M3BA 3L84A 4MVJI 1H9AA 1CY4A 1MAUA 4NU0A 2HIHA 2HN9A 4MW1A 1JKJA 3EBLA 2D2EA 3GOQA 3I09A 4U9IS 4QTUB 1VG0B 2ZUSA 4LMBA 4EHNA 4L0QA 4I50F 3TJRA 1H6DA 5TPWB 1VLHA 4M60A 3EBOA 1ZCAA 3JQ8A 2VHJA 3NGXA 4FIDA 4D4GA 3LYUA 4MDYA 3ZCUA 5HKKA 3GUZA 1E1MA 2A1UB 2EF0A 2EQAA 1NUTA 3N8GA 4CLXA 4QYIB 4FEAA 1ZNQO 3NBYC 4AY4A 2HNKA 3ELWA 1PG0A 1HFJA 2NO6A 3M81A 3O95A 2H3HA 4KNVA 4C0JA 4US2R 1N6HA 2Q0XA 4QUEA 3OECA 4XDYA 3WMXA 5DRYA 3LIIA 4AROA 5AVYA 5L3VA 4POOA 3VTFA 3B6MA 4F4UA 3SYTA 4DA9A 5D5HA 2HPHA 1OJLA 4FDUA 4R54A 4FMCF 4RJKA 5FWXB 3GDOA 1GTG1 1TLLA 2AFIA 1SVNA 1Z5NA 2P5UA 4FB4A 3GEHA 3LQKA 1W9HA 1C50A 4WKPA 4FUQA 4RVUA 4DV7B 2VAMA 1KK1A 4KH0A 1UF9A 3QU9A 4IHJB 3IO5A 4UXJA 2ASVA 2AA3A 1C4OA 2O20A 4K8OA 1RFUA 5ARBA 1P0FA 3BHIA 4EH1A 2V1UA 3PHJA 1RRGA 1JX6A 1E59A 3MERA 1SD1A 1QWSA 2WFLA 4I1IA 4LXIA 5I4BA 3KPVA 2OZEA 3ITEA 3HB4X 4FFWA 4IH9A 5JCOA 1J21A 3A25A 3R0ZA 1NNI1 5FOTA 4L28A 1F60A 2RH5A 2PT5A 3DP9A 1JHPA 2XUQA 1U63A 3UWDA 1NVAA 4JUIA 4EA9A 4MWOA 4HQ0A 1R6XA 4CIDA 4M0LA 1P2TA 2MYPA 4KFUA 4NNJA 4CPDA 5B64A 3UAOA 2BRUC 3NDPA 1L5HB 4J3JA 4WZAA 4DMKA 2ACVA 4MQEB 5AUPB 4QU9A 1WHSB 3NHMA 5FULA 5AVUA 1JWLA 2WJVA 1X0XA 4HNHA 1W85A 5K99A 5A4JA 4QZVA 5ERXA 4RZ3A 1ZD3A 2CK3D 1PW7A 4IP0A 5A2GA 2B82A 1ZM4A 3JR7A 4NBVA 3H9EO 2P9ZA 4Y2GA 3QLTA 3RFXA 1B14A 4RENA 3TLKA 1K0FA 1K7EB 1HFWA 4DLBA 3S81A 1YOVB 2QTAA 2DH5A 2WIFA 2Z3VA 3OG9A 4PHHA 4EG8A 2XQKA 4MI6A 5T67A 5HMMA 3W6OA 4QFCA 5CYPA 2FRVA 5KJ1A 1UADA 1WKVA 1UCFA 5FBQB 4YV7A 2BGMA 1UH5A 3ASZA 1YK0A 5D7BA 3GWGA 1MX9A 5HDQA 2JGMA 1YTUA 2PLFA 5AW9A 2KPOA 4P5DA 1N6KA 2J33A 1P1RA 4NKRA 4RY2A 3WMWA 4ZPJA 1WSDA 3P2MA 4BFYA 3CUUA 4J0CA 4JEMA 2HCTA 2EWVA 2ZI7A 1XVVA 4KPUA 3N0WA 3UGQA 2P2DA 4RK0A 2WKQA 3FETA 3PPYA 1IHDA 3X2SA 4OMFG 5C37A 5CGQB 2GO1A 3KHUA 4OOEA 1DZIA 4MQBA 3WYFA 1ZHOA 3M33A 1B16A 4ZEOA 1GKLA 5EPEA 3W5BA 3DLPX 2Z4RA 1AN9A 2WJGA 2JI8A 4RKFA 4R8KA 4UBMA 3S8EA 4ZI7A 5F12A 6REQB 1YH3A 2RJOA 3M9WA 4W7IA 3WWYA 4TZKA 2C2HA 3OEHA 1WQ1R 5LA6F 1AMUA 3BIOA 1JILA 3H1EA 4RSHA 4U7WA 5TEVA 1HA3A 4BGVA 5IM5A 4ALMA 4E33A 1BSVA 1DC8A 3CNOA 3BMCA 1CZNA 3HVIA 3KD2A 3IDZA 4HAUA 2HLNA 1DCKA 1FK8A 1SHTX 4IIUA 1YC5A 4FHCA 3BEDA 3IDFA 4HPWA 2QLBA 4TRMA 4TWBA 4WOJA 5CT5A 1I6LA 2VJDA 2W6ID 4X64B 3D54D 1C7IA 5ALQA 4D26A 4AJEA 2LGJA 2WTXA 3I3OA 1M8KA 2Y05A 3UJ9A 4DMCA 4BCBA 4XD7A 4MQFA 1P5JA 4N8SA 4H17A 4BBJA 3SN6A 4HXEB 3P19A 4MKIA 3HFGA 1E69A 3PPXA 3W8DA 4BVJA 5HQTA 4JXZA 2BI8A 2HU8A 4TRNA 4D3SA 1U5CA 1POWA 4MVJP 2LIVA 2W2VA 3FPHA 2CBGA 3BXFA 3C3PA 3B3LA 4KIWA 3IXQA 4UUAA 4ASUA 3ZZ0A 1UA4A 2X4DA 1UUFA 3ZJ4A 5GONB 5JJBA 2ACKA 3AP2A 3M8KA 1H85A 4FW8A 1KVSA 3RO4A 3KFXA 1SPBS 4NCIA 1Y3FE 3GRCA 1UKAA 4H7HA 3QX9A 5B4VA 1UT5A 2NYAA 3PDIA 4QRIA 2B6HA 1WZEA 1TMOA 3IMCA 3OE7A 2JBAB 3ZZMA 2ZI6A 3E3LA 2OCLA 1SQ0A 4HUJA 1M83A 4OM8A 1U90A 1AOXA 1G3RA 1L4UA 1UXOA 1YRQA 2OHXA 3C98A 5T3YA 2HMVA 4D41A 3ASVA 4EJSA 1XIVA 5JD3A 3GBPA 1E92A 3QFTA 1J39A 3FSRA 3EEOA 3WHPA 3DW1X 1NJ6A 5LZ5A 4PBTA 1VHWA 1PFUA 2OZLA 1KEEA 1P4SA 3MCVA 1YHJA 5SYNA 4Z7NB 5F7OA 2BBTA 3N59A 3OQOA 4L5JA 3PX7A 2EERA 1E6LA 4CMEA 1FNMA 3PHCA 1NWHA 3FVWA 4F2PA 3ZWKA 3OEED 4E5SA 2B2XA 2I2XB 3AT1A 3HJFA 1MB4A 2OA0A 3KL4A 1P33A 4G5FA 5F76A 1DQZA 2NVBA 5KHOC 2ETXA 2RD2A 4N7RA 1CTQA 2VJAA 4NG4A 3S2YA 4NE7A 2ORVA 3I6BA 1Y7IA 2YWHA 1FMFA 2JARA 4EGFA 4BQOA 1TYZA 5FOVA 2OGTA 4RMNA 4NNPA 5AVVA 3PS9A 1HDXA 3OU2A 3QWFA 2DQSA 3M1LA 4ENSA 3C8ZA 3SXJA 3FNQA 2DBZA 3HCDA 2QHXA 1TK9A 1SO8A 4IEEA 5L6LB 4YL5A 3NEYA 2PIAA 1FP1D 5IAOA 3OZFA 3H6HA 4KAAA 4F1JA 4CLEA 1H2RS 4RC9A 5IJAA 1K7FB 3OLCX 1JHOA 4YCDA 2FYTA 1S9HA 2GB4A 1JAXA 4RJLA 3OCYA 1VHLA 5LN1A 1UM9A 1IVSA 1DGQA 3VAYA 3HJBA 2ZS9A 4CM1A 1ISPA 1ZL2A 1K9VF 3UHAA 3LCCA 1JYFA 5JY1A 2QLTA 5CT8A 5CNJA 1BROA 1K66A 2V7EA 3H0CA 4IIJA 3U7QB 1KDPA 3PUVA 1KAHA 4QPPA 4S12A 2O8VA 1SOMA 4Q4JA 2CDCA 5HRCA 3IUNA 3DAPA 3Q7IA 2ZDGA 4WNYA 1FVXA 4KC0A 2OD7A 3H75A 1V1RA 3EY9A 2RGYA 4V3CA 2Y6UA 5DGDA 3JULA 5EHZA 1EZ4A 1S4QA 2IIPA 1ECJA 3EHDA 2D1YA 3H5IA 4IQGA 2EQBA 4OAQA 5DXAA 3DM9B 3L7DA 2W2NA 5BYJA 4ND5A 4BUJA 3GFQA 3IJPA 1T26A 2O8BB 1U5BB 3B20A 3D4LA 2BHLA 4ISCA 5I6DA 1ZD2P 1S2OA 1BCSB 1QTRA 3M70A 2W8BA 3K6SB 1QU2A 2K7FA 1ZRMA 3SF0A 4AZWA 4JJZA 3GBSA 5G4LA 4N01A 3I64A 3GWZA 1L6IA 3I8XA 2IY8A 4ZIRA 3CE6A 3G8YA 5TXGA 3T4EA 5BMVF 4JVMA 1O8CA 1R37A 3BCHA 2WU1A 3RTGA 4ZANA 4BZXA 4QREA 1Z2CA 3NONA 3RGGA 1CP3A 4CQJA 3L1VA 4PW0A 4YRDA 1YDEA 1TK3A 3AR9A 4AM8A 3ZIUA 5JANA 4Q7QA 4HZGA 1N5OX 1D7AA 1W8IA 2FWJA 4TGLA 2GM9A 4RKYA 3RVLA 1T9HA 4IZHA 4KRFA 3WGHA 3RI3A 4PYNA 2OBLA 3V5NA 3OJCA 2ZSUA 3E7XA 3VKFA 1DCMA 4I1OA 4EEXA 4WFIA 5TPZD 2ODPA 1NT4A 2VYND 3N70A 3TD6A 3VTZA 4AJLA 1QAQA 3J80A 3MMXA 2INGX 1USVA 5G0UA 1YQDA 5CJJA 1XYVA 1XZBA 3QYFA 3TE7A 2XGJA 1QSGA 2AR9A 2DH6A 1LFAA 1ZU5A 3LKVA 1C3JA 1K88A 3QWAA 1GUZA 1ATZA 1SUEA 3GZTB 1SK9A 2GBFA 3PP8A 4E11A 5G40A 3TRIA 4G86A 2IBTA 1PJ4A 1UC8A 1UWLA 3IILA 5ALPA 1QOZA 3RSFA 1QR6A 1Q1EA 2Q1WA 3ESDA 3L8YA 3LH5A 4NICA 2GYUA 3NEJA 5CLQA 1V8PA 3PL2A 4RM3A 5F7ZA 4EQZA 1ADCA 1FFYA 1WCIA 2EZ9A 3JYLA 3OC0A 3OMLA 3MJHA 3GJ7A 1S96A 4CKZA 1POXA 5MFPA 2H9YA 3EPLA 2ZAMA 3PE3A 1A9TA 2A2ZA 3LUGA 4PLPA 2G4LA 1T3LA 4EATA 3GBUA 2Q5RA 1Y37A 3H2ZA 1ISIA 1EBBA 2GC6A 3K92A 2QRQA 3K0AB 4QPJC 4G5RA 5FA5A 3UB2A 1D07A 1BX0A 2UZIR 2Z57A 5CLIA 4YC7A 1HYGA 3WIBA 3GFSA 1G2QA 4QUIA 1IM5A 1V4NA 3KJHA 2YHIB 1CY2A 3K09A 4FFBB 4XARA 4KSBA 1OAAA 1C9EA 1P61B 4CKEB 4CT0A 5B12A 1UIMA 1IB6A 3C97A 2QMHA 3SSNA 4DXHA 4UU8A 1NQVA 1PNRA 2I33A 1A3CA 3ONFA 4LSWA 2QLJA 2IT1A 5BN3B 2AXNA 1FMLA 4YT4A 1RAFA 3THYB 5JARA 3ADOA 1GKKA 2VF2A 3RPEA 4ABYA 2YS6A 1O0BA 2P9QA 1JHYA 1E4YA 1O6GA 2JEYA 4EPVA 2E48A 2QVBA 1RZRA 5I9TA 3VX3A 5CVJA 4DM3A 2WUEA 1QH8A 4P81A 5JQGA 1R8XA 4PR3A 1W0KA 1ESJA 3KU4A 1M6NA 4MPRA 3NP9A 4N82A 3N28A 3L0BA 5DBFA 2EFCB 3OQHA 1E1RD 1ST3A 1EFDN 2IS4A 3NW9A 3C8HA 2GCNA 4HYEA 5E4TA 4R9SA 1NF3A 2ALJA 2H0QA 2VFAA 5MF6A 2JZNA 1ZC3A 2OV6A 2GMWA 3W6PA 3DLCA 2RGUA 1BHJA 3SK0A 4PU0A 3AOEC 2Q7DA 4YV1A 1PFYA 4FFMA 4C01A 4WAUA 3CZ9A 4H7IA 3VZRA 2ZJOA 2GDJA 4MPDA 4D8TA 1N6NA 1YB7A 5HOEA 4F12A 2YWGA 2JLYA 2QLFA 3G0DA 5EP4A 1IBLB 4HVCA 3U19A 2UV8A 3PXUA 2ZUEA 2JFFA 2GF0A 3AU8A 2ZB7A 4JYBA 5A4KA 1T5OA 3M9XA 4QOEA 4GKJB 4B34A 5AW5A 1NW3A 2QG6A 3C41J 3CNHA 1K92A 1RYDA 1TFUA 2PWYA 3C8MA 3FYHA 2I8LA 4HWPA 4X45A 3RAEC 3WLRA 2Y71A 4M4SA 1UJ5A 3UV7A 4UVIA 1AURA 1MJHA 1Q12A 1Q91A 1UKCA 1KEZA 2ZXFA 3DTNA 4TMZA 2EL7A 3SFTA 4AN4A 3U4MA 2VT6A 1B0UA 3PUJA 2P5YA 1P19A 3WL6A 1JJAA 5KPJA 4OOFA 1M6YA 3FNHA 1OX4B 3O8RA 2R6HA 4S1MA 3C6MA 4RPKA 1GXSB 1P7YA 3QVJA 1XLTC 1WO8A 4V0KA 4E88A 5A3RA 5LU8A 1DX4A 3PDHA 2F43B 3DO8A 3R7NA 2B35A 4PRYA 4J07A 3ZR4B 2WM8A 3IKLA 3R7WA 4FYYA 1Z0FA 4K8RB 4M1KA 4QTTB 2EG5A 3IYLW 2X9VA 2CUNA 4FWBA 4PVCA 5BSUA 2W2PA 1EFVB 2OO7A 5CXQA 4HK4A 1WEHA 1CQXA 2G72A 2J3IA 2QD2A 1AA6A 2Y0DA 1ZISA 4EJMA 3MAAC 1NY6A 5KYXA 1ZH6A 2DPHA 3KQYA 3OQVA 4CCYB 3F6EX 5TF4A 4BWYA 1QZTA 4PLZA 1PYDA 1F2TA 3L06A 1NX9A 4V0NA 4BLUA 1DXHA 3DAYA 2NXCA 3H7IA 4C0LA 5EJ6A 1NXOA 4JEIA 4PAMA 3VFDA 4D8WA 1YFJA 5HHTA 2HBRA 4LDZA 1AF7A 3RHFA 2VG8A 3OURA 2QIOA 4WECA 2BY4A 3W1EA 1RJWA 3WGVA 1MIOA 3I9LA 4L5IA 4KSCA 3AETA 1M1NA 3O4IA 5DE3A 1GCUA 4CMIB 1R4ZA 3QHQA 3VOAA 1P8JA 3UYLA 3VO8A 4IICA 3AI7A 3ZUPA 1MAVA 1NFQA 1G8PA 2O3JA 3N75A 2KBFA 2D5BA 1QK4A 1YO6A 4E4YA 4RYLA 2JLRA 1F2UA 1QO0A 2ZKLA 2C42A 2JVJA 1E1QA 3D02A 4O59O 1L8LA 5CA0F 4NMLA 5ITSA 2G06A 3CVXA 1V43A 3CE9A 1TW2A 3IDOA 5IC4A 5KNCD 2QV7A 3RE1A 3MJFA 2IU4A 2Q0QA 1MABB 1ABEA 1EEXB 1R15A 1W0CA 4GXQA 4LJ8A 4RM2A 3VR4H 3ZLBA 2GWRA 1LZLA 2JGEA 4CT4B 3F8WA 1VL1A 4BS9A 1PR1A 1EVJA 4S0ZA 3LT0A 2VK2A 4F2GA 3AR5A 5DCLA 4I1RA 1VPTA 3KKOA 4F2DA 2RH4A 4RE6A 1O6CA 1T0PA 4IHQA 1W4LA 4LYFA 1GDDA 2EOAA 2FX2A 2IXTA 4K81B 4Z9FA 3IIKA 3T3NA 3V8NA 3PRHA 5CG2A 3VISA 2C83A 4D5GA 4QJ3A 3SEFA 2XCQA 5EE0A 3VXKA 2QMEA 3ZWPA 4HDCA 4P4SA 2A5DA 4L73A 5DTJA 4ZDJA 1S5PA 3MMZA 2Z2JA 1D4AA 4PTLA 5BRJA 5BV2P 1GQQA 4CIAA 2W9XA 4MS1B 3GRPA 2ONKA 2VHZA 2PGXA 3QUTA 3L7CA 4HRYA 3H9CA 2H16A 2JFVA 4TKUA 1C3VA 3U4DA 1YJ8A 3X2FA 4BTEA 4CDNA 3GIDA 3EVNA 4KQWA 2VS1A 2H1SA 3I04A 1VLJA 2PBFA 1M1XB 2Q6OA 4UC0A 3DKRA 4S2UA 5HW0A 1X1TA 1W78A 5CFMA 2FUG6 2IOQA 3EG9A 1EKXA 5EJ7A 2VT3A 1A1SA 1ZY2A 2GKOA 2QDXA 4XCKA 2Y2UA 3V97A 3BBPA 1P4RA 1Q57A 3X3HA 1IL0A 4YUZA 3PVSA 1AMNA 1VKJA 2RBEA 2BR5A 1PD0A 2CNBA 1RJFA 4UPVA 2J0QA 3KCQA 4B84A 4S1TA 2Q5QA 3CR7A 5ESRA 5GP1A 5J2TB 1INLA 3RYIA 5HX7A 1GNSA 2H2FA 1RCFA 3GLRA 4K0KB 4N6GA 4KE6A 3EYWA 4NZPA 3IQZA 3IRVA 4UXHA 3Q3CA 3UQZA 3W8RA 3ZLUA 4DIBA 2IPLA 1T24A 2BEJA 1NZDA 2W0MA 2XRFA 5E6SB 1V26A 1XVTA 5DLEA 1Z0UA 1C7QA 1P80A 2DP4E 4MWCA 5ITZB 3QI2A 3ZWXA 3S1AA 3TX6A 3I6ZA 5CB4B 5IJ0A 5IAJA 1GGMA 2NZJA 3W5JA 4QM6A 4EJSC 1FYFA 3D6VA 2CLHB 1N2SA 2G9VA 2PUJA 1H1DA 1VJ1A 2LPMA 3EMVA 3GHHA 5A6SB 4E30A 3CVVA 1U1EA 5GPBA 3K2IA 1KR2A 3IB6A 1KMQA 1CRPA 1SXPA 2R1TA 2ZSHA 2CLOB 2GK6A 1NLUA 1YL7A 3LQ1A 1E9BA 1H0RA 1IATA 1ILWA 2ODWA 3M1YA 1BU8A 4ZWNA 4U5QA 5LNK6 5BVGB 2VJMB 5ICCA 1HYHA 2OVFA 3BH6A 3KWLA