3RSHA

Structure of 3-ketoacyl-(acyl-carrier-protein)reductase (fabg) from vibrio cholerae o1 complexed with nadp+ (space group p62)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
244
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 88
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rshA00
4J1QA 4UVEA 4OGWA 1LDEA 1XIVA 1YDWA 1I8TA 1MC4A 2J3KA 3GZNA 3VAZA 3DXFA 4ALNA 4CL3A 1JWAB 2YDXA 3IP3A 2ZB4A 1XCBA 4NHEA 2DTXA 1YBMA 4NFHA 3BMCB 1ZK1A 3OA0A 4PVCA 2NU9A 5IF3A 2Y68A 3DBRB 1I36A 4RVFA 4JNKA 4BO7A 4PN3A 4K26A 2BH9A 1P33A 1YGYA 2O2SA 4J4BA 4RF3A 3PYLA 3KLMX 1PZEA 5IDYA 2GUGA 2ZIZA 5C7OO 3GN1A 2VRCA 3WFJA 2PKRA 2PZMA 4L0QA 4LSMA 4MP3A 5IXSA 2Q2WA 3PQDA 2C0CA 2NACA 3VZQA 3ZWAA 3KYDB 4J7XA 3QSGA 3H3JA 2B35A 3ZHBA 4YJHB 5JFOA 4ND1A 1R4MA 3RVDA 4U5QA 1EVYA 1GPDG 3WMXA 2JCVA 3HSKA 4FIZA 1SEVA 4IDCA 1E7WA 4N5NA 2H63A 5BQFA 3GMSA 4BKQA 2GZ3A 4UVDA 1YQGA 4TRJA 3GPDG 1JVSA 2FPIA 5I9LA 3LC7O 1NNUA 1MG5A 3PGJA 2Y99A 4A7PA 5CG1A 2GD1O 1ZKMA 1PGPA 5IFLA 3OFSA 3H5RA 2X8LA 2O4UX 4IINA 2P2SA 5AXDA 4FR5A 3WICA 3KZVA 4CQMD 1JVBA 4CR8A 1E1LA 1YB4A 1TVEA 3GN2A 1LQUA 2PGDA 3F1KA 4OO3A 4YJGB 3RASA 2QRJA 1T1SA 4WCFB 4PRKA 3VH3A 4OJNA 1K5HA 4BNTA 2QZ9A 4DA9A 5A06A 1MLDA 3Q11A 2OP1A 3ONEA 1LTHR 2DU8A 2NQ8A 4GX1A 4YR9A 3WYBA 3H9GA 1QRRA 3B1KA 1A72A 1HDZA 3UVEA 4IS2A 3R0IA 4FOSA 3DZIA 2IXAA 1YH3A 4OOEA 3GEMA 4AICA 2FSVA 3AUSA 3F1LA 2EIHA 3I1JA 3ZHZA 1HT0A 1DLJA 4JN6B 5BNIA 3WOHA 4Q3BA 5JAMA 5TC4A 1C0PA 1ID1A 5C5IA 1XYGA 2I67A 2EP5A 3QP9A 1LJ8A 3WR5A 2FR0A 3JYOA 1HE2A 3WTBA 1CIVA 3MJ4A 4CPDA 1T2CA 3FI9A 1T1RA 4QO7A 5FI3A 1LRKA 5L40A 3L4BA 2BFPA 2NU7A 2YHIA 1TT5A 1YE3A 5A9TA 3NT5A 3RBZA 1GADO 4OH1A 2WDZA 3ZNPA 4NIMA 4A2CA 2Y1EA 3EVNA 2PGJA 2VHXA 2I3AA 3PWKA 1PJCA 1LDGA 4EZBA 4KUGA 3D1LA 2B69A 2WD7B 3DMTA 2I76A 3M1AA 1QSGA 4KWHA 4TZTA 3NRCA 1W4ZA 3ULKA 3I5MA 3QA9A 2G0TA 1P1KA 5EMHA 3OJFA 3H2SA 4E5KA 1IZ9A 1SBYA 2JHFA 5TJ9A 3JQAA 5JDIA 4YQYA 1C1DA 2AMFA 1GEEA 4BNJA 2VRCD 3EGOA 4O59O 5GZ1A 4HFMA 3PWSA 1NFFA 4R16A 4CLRA 2VWHA 1JDJA 4PCVA 4FCCA 1EVIA 1IHXA 2CUKA 2CNBA 3ST7A 2WYVA 1Y7TA 5CP8A 3I6IA 3IMFA 4CR7A 4B3HA 1M76A 4BL5A 3I9JA 1LI4A 1LBEA 5JSFA 3UCFA 4QUKA 4YTEA 2JD0A 5KJEA 4DC0A 2CVZA 2FN7A 4WLFA 5KVVA 3ZH2A 5JE8A 4D43A 3KYBA 1JKIA 1WDKA 3NDRA 3WBFA 4GH5A 5KVQA 3UH1A 3KXDA 4A03A 2ZB7A 1ZH8A 4OXNA 1R0SA 1X7HA 2GCGA 4CM8B 1X14A 1IHYA 2OHXA 3U49A 2WEKA 1I32A 3AWDA 5FWNA 4DXHA 1KY4A 4G81A 4EW6A 3VTFA 1H0KA 2HQ1A 4DLBA 3E9NA 3JQFA 4J4HA 3DZKA 4JQCA 4RPLA 4C7JA 4MVJE 1AHIA 3GVHA 5IZCA 4KQWA 3NX4A 3AY6A 3PFWO 4I9HA 3ANNA 1MGOA 1RM0A 1DIHA 4IGFA 1R6DA 2ZJ0A 2D0IA 4FD3A 4EUHA 3PHGA 1CEQA 2Q2VA 5AXCA 1V3VA 1WZIA 5ILOA 3U9LA 2AG8A 1QYVA 4MO2A 3F46A 3D64A 5IZ4A 5L7TA 4RZHA 3BMOA 2GZ2A 3LQFA 4BQPA 3TZKA 4RJTA 3BYZA 4TWRA 3PXXA 5GMOA 3L4SO 1HSOA 2E37A 1UDBA 4CM4A 3FR8A 2GLXA 2LDXA 1PL7A 3W1VA 4DPKA 4XIYA 3TL2A 1HDCA 2X86A 3RFXA 2WYUA 5CEFA 1SB9A 4FJ1A 4M8SA 3RKRA 4JBIA 1PGOA 3PQEA 4UEJA 5I7EA 2X58A 4DC1A 1GUFA 3FSRA 5KTKA 2D5AA 3QWFA 1BGVA 4W9NA 5TT1A 1B14A 3JYPA 4FFRA 5TQVA 3OSUA 1YL6A 1H94A 4MJLA 2JKVA 3DL2A 3KETA 1ADBA 3PQFA 3JSAA 1GYPA 3ICCA 1GYQA 3JQAD 3N58A 4FPXA 4PLWA 3WXBA 1M6HA 2RHRA 3QWAA 1D4FA 3H3FA 2E48A 1FDSA 4Q39A 2NADA 3F4BA 1BMDA 3QVOA 4LN1A 1YWGO 4RQUA 3L77A 2YDYA 4AJPA 4DRYA 3Q0EA 3GDFA 4GLLA 3SEFA 4G65A 1GD1O 4R3WA 9LDTA 2NQTA 4NG5A 4R4JA 5KCZA 2JFGA 1YRLA 1HYHA 3FWNA 4QTZA 4XD2A 5DCUA 3JQGB 3JD0A 1YB5A 1OC2A 3PZRA 3ZV6A 4ZQHA 2QZZA 3FCOA 1DXYA 1DIAA 3LLSA 4OKNA 4PLZA 5L45A 3CZRA 1UJMA 1K3TA 2HRZA 3BMNB 2Q4EA 3OIGA 1BVRA 2V6FA 4KOAA 4OOFA 4YXFA 4RVGA 3P19A 4RVHA 1ULSA 3TPCA 3BMQB 3S1LA 3LF2A 3GT0A 3L9XA 2X9GA 3IQDB 4IDGA 1LC0A 3PTZA 2YFHA 4OYRA 5EQDA 3AI3A 4I1IA 4UUMA 1ENOA 3HDJA 4YA6A 5GY7A 1VL8A 1HKUA 5F1PA 1Y8RA 2VHYA 1XEAA 1ADGA 5U1PA 4EGFA 3KB6A 1H5QA 3ZN2A 3GMDA 3I9OA 5A04A 4M49A 5JC8A 1UDCA 4E30A 3PIDA 2UDPA 4PLFA 4YJFA 2JFFA 5ER6A 3KYCB 5B12A 1MXHA 4DPMA 1Q7BA 4WCFC 4HWKA 4OM8A 4NR0A 1VJTA 3WGHA 3LLVA 3NT2A 4J16A 4J9UE 4ND5A 3JQBC 4R9SA 4Y9DA 4J9VA 4UVGA 1I2ZA 4WLUA 3WS7A 4IDDA 5CDUA 3RBXA 2AE1A 2J5QA 3HUDA 2AQHA 4R5MA 2YV2A 5TSDA 1XU9A 3GA0A 3LT4A 4XIJA 1P1RA 4O5OA 2J8ZA 2I6TA 1H9AA 4CUJA 1PGJA 3NEPX 2V6GA 4IY1A 3SBOA 1CWUA 1YOVB 3H65A 3KHUA 4L74A 4XYGA 5CHEA 4WOJA 3ZV4A 1UXKA 1FDVA 2C7GA 2NUAA 1E7SA 5IDXA 1ZSVA 5HM8A 1IPEA 1H6BA 3GFGA 3WBBA 3V8BA 4AJOA 3VZPA 4W99A 1PZGA 3F5QA 2VHWA 2B5WA 3TNLA 2VUUA 2WYWA 1P3DA 5EJ2A 1E1NA 5AXBA 3RD5A 3FTNA 2OMEA 2EGHA 3IKVA 2NVBA 2QIOA 3VH4A 1U4SA 3FWZA 4WLOA 2DLDA 3Q9NA 1I0ZA 4XRGA 2F00A 1U7HA 5C7LO 5JCXA 4DQVA 4BKPA 3B20A 3Q9UA 4ZICA 2B37A 1DHRA 1G6KA 1P1JA 1PR9A 3O8QA 2PZJA 2WMDA 3HG7A 1DJQA 2C2XA 3ZGYA 4L9RA 1E3SA 5A9SB 2NV6A 4CUKA 2Q4BA 4KDFA 3RKUA 4E6PA 3PK0A 4XEHA 3H4VA 1DAOA 1DDOA 3EZYA 4L76A 4LK3A 4R51A 3MOGA 4NJMB 2Y93A 1Y81A 1Q0HA 2Q1WA 2A35A 2GN9A 2WWRA 4G5HA 4R54A 2P4HX 4YAGA 1XU7A 2R00C 3C24A 4P4GA 1E6EA 3AUTA 4FFOA 4DQUA 4ALLA 3UCEA 1M6WA 3HJAA 1QR6A 1V35A 4TROA 4FFLA 2XOXA 1WDLA 4I9UA 4L75A 1ZEJA 2XPCA 4QFCA 3L9WA 3VVCA 3AW9A 4B4VA 3HDQA 1UH5A 5B1YA 4YB8A 3JTMA 5HRUA 5CDGA 4OMUA 5ENDA 1YS4A 2HSDA 1ONOA 2DVMA 2OUIA 4WK6A 3PHJA 4RL6A 2Y66A 2Z1NA 1NWCA 3DBLA 3MJEA 4RDHA 4II2A 1LDYA 5DN9A 3IOYA 4BKOA 3RROA 1H6AA 4B7XA 3KEQA 2OOSA 4S1VA 1TB4A 2P5UA 4EUEA 4ND3A 3RUEA 4E2WA 3C3XA 4XJTA 3JYLA 1PJBA 2VTEA 4S3MA 5F1KA 1I3NA 3D7LA 1U3WA 3QRWA 3TSCA 4IQ0A 1KVRA 5BSEA 4ITUA 2H9IA 1C0LA 3BIOA 1PL6A 1GPJA 4XX0A 1E3JA 3KVOA 3MJSA 4FN4A 1SCUA 4AJKA 6ADHA 2ILTA 3PYMA 3GG2A 3UW3A 2B4TO 1KETA 8LDHA 1DEHA 1PJSA 4EEXA 3WIDA 1EUZA 1NBOA 4L4SA 3K96A 2IEDA 5KIAA 1G1AA 3O4RA 4XR4A 1CYDA 4A73A 2PY6A 4URFA 4WOKA 5HBRA 3RUHA 2PZLA 1D1TA 3P2OA 1AGNA 5L4SA 4LVCA 5JO0A 2UUOA 1LSJA 1PWZA 3TN7A 2VTDA 2PFGA 4Z9XA 3OIDA 1WDMA 4WCDA 3ICPA 2I3GA 1T25A 3OQ1A 1XGKA 4A27A 3OP4A 4UUPA 5DBGA 1WP4A 2FMUA 3TZQA 4CLXA 2O7SA 5JAIA 2QYTA 3AU9A 4TVOA 5L53A 2ZKLA 1BDBA 3W8DA 3NV9A 1UP6A 1DLIA 4KWIA 4MVJP 3GC6A 2Y05A 3PZBA 2Q99A 4MVJG 5JYDA 2O50A 4BNWA 4ZQEA 5A02A 2P68A 1JWBB 2YYYA 5JAQA 5JNLA 5JC1A 2PKQO 1VJ1A 4BNYA 3GF4A 5TIIA 4D79A 3B1JA 4CM6A 3K73O 1ISHA 3KO8A 2EJWA 3K9QO 2GN8A 1ZJYA 4B7CA 1DRWA 2GYYA 3HDYA 1E7MA 2P9GA 5MDHA 4IIVA 1DHTA 2UVDA 3VKVA 4I5EA 3CE6A 3K8ZA 4NI5A 2HCTA 3ZHYA 2VYVA 2AHRA 3EHEA 4J43A 1NHGA 3OHSX 3OJOA 4Q9NA 2FZWA 4HADA 2OORA 3JQ8B 3ROMA 2W2LA 3L07A 5CFZA 7MDHA 4BB6A 1UAGA 2HK8A 1HE4A 1BXZA 5JY1A 2PD3A 4M54A 1ARZA 4ZGWA 2CD9A 2YV1A 1MG0A 1HRDA 2DT5A 1E6UA 3VZRA 2EF1A 3WGTA 1UZMA 5BNTA 4J90A 3Q6IA 4XB2A 3OECA 1K2WA 3DC2A 5BT9A 4YT8A 3EC7A 4PLTA 1NPYA 1ENPA 4Z6KA 3OM9A 3VDRA 2DTDA 1JAYA 3HN2A 2Q50A 4BO5A 2AQ8A 1LXCA 1EE2A 3BZUA 5AXAA 1R16A 4L4RA 3ZHXA 4CM3A 5C37A 4J3FA 5G2OA 2QQ5A 1SO8A 4QQRA 3RFTA 5B4VA 2D2IA 4NU5A 3ZU3A 4YBZA 4IBOA 1VSVA 4FC7A 3RJ5A 1DC6A 5DDIP 1QXSA 2VCYA 3F6YA 5JO9A 3AI2A 3W6UA 4J1TA 3INGA 3M1LA 1TLTA 3ZWYA 2QYSA 2JCYA 3BAZA 1I01A 2SCUA 2X7HA 3AM3A 5A5EA 2Q1UA 5JBIA 3QHAA 3TQHA 4J0EA 4TKMA 3SVTA 3AI1A 2AEMA 2FZEA 3AK4A 4EI2A 5EPOA 4BO6A 3GUCA 1X0XA 5JCJD 4ZQFA 5TGDA 5I9MA 1IULA 4HKTA 5H81A 3WIEA 5I7SA 2Y1GA 2O4CA 4A26A 4JBGA 3EUWA 3SJ7A 1NQ5A 4E5YA 4RVDA 3A06A 2VT2A 4Z9FA 3N74A 1E1MA 3ZWNA 1PJLA 5IN5A 3T4EA 3U4CA 5DT9A 1HE3A 4M86A 3CSDA 4RVUA 2Q1TA 3T4XA 1KVUA 1ZK0A 5T67A 5IG2A 3JQCA 1EK5A 2EW8A 4PG6A 4U6QA 5T8KC 3GZNB 1WLYA 3LSYA 3SJUA 5F3RA 4NK4A 1FXSA 4BMSA 1JKFA 4BIIA 1ZJZA 3KSDO 1V6AA 2AQKA 4JCOA 4EJ0A 3S2IA 2ZYDA 1ORRA 2GR9A 2HO5A 4ALKA 1Z6ZA 4AVYA 5GZ3A 3U3XA 1LLUA 1BW9B 1A27A 2P5YA 1HLPA 2O3JA 3FPCA 1RWBA 4YAJA 1NVTA 2XXJA 4EJ6A 1J6UA 2EWMA 2VQ3A 4GSKA 1NVGA 4TZKA 4LSWA 3TOZA 1NFRA 3BMCA 5TNXA 3MOIA 2GASA 3H7AA 3WNQA 3HZZA 3L6EA 2OZPA 1JW9B 5ICMA 1SNYA 1LDBA 5TT0A 1K0UA 3B70A 4FB5A 4CM9A 5JDCC 1WXDA 1HDGO 1P45A 4WNIA 2IDZA 1DIBA 1PJTA 2JFHA 3TWOA 1VPDA 4K1LA 4RGBA 1HYGA 2FOIA 1DJNA 5DBIA 4CMIB 1E7YA 2W4QA 2Z95A 4Q3CA 5TJHA 4DMLA 4UEKA 2W2KA 3KYDA 1NAHA 4KUEA 4LISA 2Y0EA 2IZZA 1VC2A 4IXWA 3K92A 1DC3A 3F9IA 3HQ4O 4Q3EA 3V2GA 1P44A 4QEDA 3VDQA 4XYBA 4YT5A 2ZQYA 1GEGA 3DHYA 4Y98A 1U8XX 3KSUA 4AL4A 2X5JO 4U0KA 1Y6JA 3F4LA 3NAQA 4ALMA 4AFNA 4FBGA 4PLPA 4UUOA 2VHVA 2FPGA 4MIEA 3I9NA 3DMYA 1P77A 4ZHSA 1HDXA 3P2YA 2BFAA 2PR2A 2X9VA 1Y9AA 2D3TA 4ZD6A 4F45A 4Y6RA 4D7AA 2ZYAA 3GGPA 3ETDA 3E9MA 5I9NA 3L0DA 1EUDA 4YJGA 4N7RA 4AJHA 1B3BA 4WCFA 3LK7A 3B1FA 3WFIA 1OBFO 1I2BA 2EKQA 1HETA 1XG5A 1O95A 4IJVA 4OQZA 4RQTA 3JQBA 4HFNA 3D4NA 4YAEA 3RCBA 2O3SA 2P91A 2C82A 3H9QA 3V2UA 5IN4A 1I30A 3LC1O 1N1GA 2PH5A 3QIVA 4PLHA 1PGNA 5C7IO 4FGSA 1ISFA 1HL3A 1ZBQA 3PIIA 3OMLA 1NP3A 4J2OA 4FFPA 4RLHA 4CM1A 3V1UA 3BHIA 5KJFA 1UP7A 4IM7A 4XKJA 5JMPA 3WGIA 1B0AA 4YRAA 4XJSA 1NAIA 3CIFA 4LMPA 2DPGA 2CDBA 2I5PO 3C7DB 4B4OA 3W4JA 2FY8A 4CV1A 3GHHA 1Y5RA 1EEHA 1HXHA 2EV9A 3R1IA 3ZU4A 3COSA 2RH8A 4CJXA 4YYZA 3BTOA 3C1TA 4XQEA 5EQFA 3W8EA 1TI7A 1LX6A 4ID9A 2AW5A 4PFJA 1E6WA 3JQAB 3K5PA 2WD7A 1CQJA 4L73A 1EFLA 4LMRA 1DC5A 1E3WA 2PZKA 3KV3O 2E6UX 2WSBA 1CETA 1FMCA 3PDJA 4K6FA 4BNKA 1CDOA 3RJ9A 4NBWA 4QSMA 1NYTA 3DFUA 3UICA 4CLRB 1EFKA 2GERA 5DCWA 4JX8A 2DC1A 4J4TA 1HLDA 1D7OA 1RPNA 1XLTA 4GX5A 4YPOA 5A05A 2WJPA 1YO6A 2B5VA 1KBZA 2BELA 5KOIA 3FNFA 4J0FA 3DTTA 3MJCA 1K6XA 2POQX 4L4XA 3D3WA 1YJ8A 4ESOA 1OZAA 1E7QA 2R00A 3CXRA 3KEOA 2Y1FA 4LGVA 4PZDA 4B3JA 3NT4A 3P7MA 1WNTA 1LDNA 1DIGA 4E5PA 3ZWXA 3RWBA 1R37A 2FR8A 4GX2A 3WDSA 3OEWA 4DGSA 2RBEA 1EDZA 2X0IA 4HNHA 2I9PA 2Y0DA 3DAFA 4J7UA 3W4IA 3PJFA 5DNAA 4NBTA 2IXBA 1EQUA 3AM5A 4BGIA 2VT3A 1VI2A 2BI8A 2YUTA 4BMNA 3JD3A 4CM8A 4ZJUA 3CMCO 3FTPA 4UUNA 4CLEA 1R4NA 5K9ZA 4MPDA 3G49A 4EDFA 3FNGA 3U4DA 3DHNA 2VWPA 3E18A 1PTJA 4LW8A 3JD1A 1M67A 3OJ0A 1YL5A 3GQVA 3RFVA 5JAZA 3BMOB 1X13A 2BF7A 4CV0A 4BO0A 1T2EA 1BTOA 1BDMA 1ZUD1 3MWEB 1Q0LA 1L7EA 2BKAA 1RYEA 2G82A 2GN6A 3DZHA 3OJEA 7ADHA 2VNSA 2YJZA 5COQA 3QWIA 3UFXA 3DBHA 4OIMA 4P4NA 1NX6A 3F3SA 4OL9A 4FW8A 1XKQA 1T4DA 1MP0A 1PJQA 1ZXLA 1X0VA 3RC9A 3WGYA 2BI7A 3LVFO 1U9JA 3VPXA 3K6JA 1B7GO 1OAAA 3NKLA 1E77A 2G17A 4E2YA 3HE3A 1B26A 2J5RA 4IUYA 1D8AA 1LLCA 2RH4A 3EW7A 2PKQP 4OSOA 3STHA 4GVLA 3RBVA 4ZRNA 3WGZA 1B8UA 3Q1LA 1X7DA 1KS9A 3E5RA 4H3VA 3JQ9A 2TMGA 3GK3A 4O63O 4BKUA 5F5LA 5KKCA 3TOXA 4XGIA 2AG5A 2ZB3A 4AJNA 3PVZA 4UREA 4EEZA 5DBFA 4ALJA 4WJZA 2B4RO 1PEDA 4R41A 3ROKA 5LDHA 4UAGA 3CMMA 3E1KA 3ORFA 4D41A 2DBRA 1VM6A 4FGWA 1P9LA 4ND2A 3HHPA 5B4UA 1U3UA 2PH3A 4ZVVA 4JBHA 4UVIA 1CF2O 3C8MA 2VWGA 4MP6A 3A14A 2AEJA 2V6MA 4O1MA 2YHUA 3LZ6A 3JV7A 1A5ZA 4B4UA 4R69A 1Y5MA 4D44A 3G3EA 4BV8A 5L7WA 4LCEA 3IUSA 3EDMA 3GGOA 4BB5A 1QYWA 2H1SA 2Z1MA 1PJ3A 2HMVA 3EK2A 3WWYA 2OP0A 2PV7A 4II3A 2C54A 2B83A 4P4LA 1XQ1A 2HK7A 3JQGA 3MTGA 3BTUA 4E0BA 2X1HA 1Z7EA 3MTJA 2W98A 4CM7A 3DZJA 4QECA 3H9JA 1Y8RB 1E3LA 1D1SA 4WECA 1ZMOA 4BOYA 2PD6A 2Z5LA 5BR7A 5TF4A 4CLHA 3BMQA 4YRDA 2Q49A 3PLNA 4RO0A 4BKRA 1VL6A 2PNFA 4P38A 3V1YA 1PGQA 2GN4A 5I8WA 2HMUA 2BHLA 4RV9A 4XZ3A 2VUTA 1EVZA 2PTGA 3TFOA 2Y1OA 4UVHA 3QVTA 1JTVA 3NUGA 3ZWOA 3UCXA 4BNMA 3ZW8A 4CR6A 1RM3A 2J3JA 3R6DA 2XF8A 4MKZA 4PRLA 4WUVA 2NTNA 2FHSA 3KYCA 4IMRA 3E48A 1GAEO 1SMKA 2EJVA 2D5CA 2UUPA 4LVUA 4W4TA 1BXGB 3K30A 2AXQA 3V1TC 4J2HA 3VH1A 1KIFA 3MEQA 3JQEA 2EW2A 1LQTA 3VC7A 3ETGA 5ER9A 1XWFA 4D46A 3B6ZA 5H83A 2HMWA 3QW2A 4KUHA 1VJ0A 4D3FA 2JAPA 4HX5A 2GSDA 1DIRA 1H6DA 2IZ0A 3GAZA 3BA1A 4MOWA 4CMEC 1NQOA 1P31A 3NJ8A 3RUDA 1H93A 1RJWA 3JQ7B 1LRJA 4NMHA 3AY3A 3MJTA 2XAAA 2QW8A 1NVMB 2DBZA 2X5KO 1H2BA 2ZQZA 4MIYA 4Y6SA 5FFFA 4YAKA 4D42A 5ILGA 4RCVA 1JAXA 4R1TA 1Q7GA 4X54A 4CMJA 1LU9A 1IY8A 2OGUA 1QP8A 2OL4A 2X5OA 3PWZA 1I33A 3G17A 2J6IA 4IDFA 1V0JA 4PVDA 3O8QB 5A03A 1HDOA 2QRKA 1N9GB 1PL8A 1WPQA 5LC1A 4DIFA 3ROQA 2HMSA 2VYNA 1NASA 3L6OO 3HFSA 2CVOA 4IJWA 3WGGA 3C7AA 4WLEA 3INRA 3PEFA 1DC4A 3UXYA 1B3RA 3VKUA 2DM6A 1CERA 1CJCA 1LDMA 1PX0A 5CDTA 1HZZA 3AFNA 4OAQA 1U7TA 4U7WA 4LCJA 1I10A 1LLDA 1JKJA 4RDIA 5A9SA 1L7DA 4M55A 5T8KA 4GBJA 5TRTA 2WE8A 1AUPA 1YQXA 2D59A 1ZIDA 3EY4A 2E82A 3V2HA 5I7VA 1GY8A 3WYEA 1VE9A 4H7PA 1FJHA 2W90A 3HNPA 1QV6A 4B4WA 2A92A 1ZZEA 5THKA 4GQAA 2IZ1A 2J3IA 4CLDA 3I9LA 4RPHA 3RI3A 4GWKA 1NQAO 2BGLA 5CPFA 3DOOA 4PLYA 1JQBA 3QVSA 1O5IA 3HWRA 1OOEA 5IDWA 3C7CB 2VUSA 5F21A 1I2CA 4FQ8A 2BLLA 3WJ7A 3OIFA 3IJRA 4IPTA 3DBLB 4FFNA 5T6BA 1LNQA 3H5AA 5BSHA 3ON5A 4NH4A 1GYRA 6LDHA 5U9CA 1P74A 4Y6PA 1FDWA 2C5AA 3WQSB 1F06A 1GV0A 5JDCA 4WLNA 3FBTA 4HV4A 3WQRA 2JCXA 2HJRA 4JK3A 4R01A 3I52A 2CDCA 2OFPA 5ES3A 5I8ZA 1ZW1A 1K6IA 3FBGA 4IQ8A 3SC4A 1UR5A 3RQSA 4XYEA 4PG5A 4E13A 3DWFA 3WJAA 3GNSA 2JAHA 4N5LA 3RUIA 1JU9A 4XDYA 2WTBA 2WE7A 1RYDA 2C5EA 4J1SA 1P1FA 2GRAA 3OBBA 3S2FA 1L1FA 3ZZNA 1XELA 3ENNA 3H6KA 1GFSA 3BXXA 3JQ9C 4TQGA 5GZ6A 4DYDA 4YCAA 2ZYGA 1FDUA 2CZCA 1ZK2A 3JYQA 4IJUA 4BGVA 4HP8A 3E9QA 3E8XA 2J5KA 4RZIA 1C14A 3K2EA 3R3JA 4G2NA 1LRLA 4LRSB 1YB1A 3PLRA 4CQLB 1YL7A 4CLOB 1WWKA 1QMGA 4XQCA 3GEGA 4XQ9A 4F6LA 5JPIA 4C4OA 3PYXA 2FP4A 3D5QA 4CMHA 4RPKA 2VYND 1EE9A 3GDGA 2JL1A 2D8AA 4I8XA 3OETA 2HU2A 5T5QA 1UP4A 3D5TA 4GI2A 2DFDA 3ZV5A 1VKOA 3NGLA 4YEDA 3MWDB 3NDIA 4HFJA 4TRMA 4CODB 1GU7A 3O9ZA 2I66A 5BNFA 3INTA 1HDYA 3WLFA 1B8VA 4TRNA 2EKPA 3PHLA 5C3MA 2P9EA 2VZ8A 3GRKA 2C20A 4MVJA 1GV1A 4CMAA 4E5MA 1V3UA 5CDYA 5G4KB 3Q2KA 3ADOA 4NJOA 5FF9A 3GFBA 4BNNA 1GDHA 1R0LA 4PIVA 3GH3A 1Y8QA 1M66A 2EGGA 4FC6A 4PG4A 1U1IA 1V8BA 9LDBA 4PGFA 1ISMA 3DZGA 3OF2A 1GCOA 5I7FA 1XSEA 3FHLA 3RUAA 1ZO8A 3NYWA 2G1UA 3IC5A 4WKGA 3VTZA 3I4CA 2ZTVA 4XYMA 1M75A 1S6YA 2NVUB 2BGMA 5ITWA 4Z3KA 1DBVO 4ONEA 2GPTA 4BO8A 3KRTA 3DBVO 4IJKA 3W6ZA 3JQ8A 1SZJG 4ND4A 1CRWG 5K6AA 1HF3A 5HA5A 2NNLD 1F8FA 1PU2A 3DFZA 3QVWA 3AUUA 5KNLA 3NTOA 5COBA 1E3IA 2NSDA 1WMBA 3I6QA 4KMSA 3D0OA 1P0FA 2YW9A 4CV2A 1RM4A 5G0TA 2VN8A 3JYNA 5BSFA 3U62A 2G76A 1I3LA 2VOJA 1Q2XA 3KUXA 3IJPA 3ZNNA 3H9EO 1KVQA 1W0CA 3GHYA 1YQDA 4CQMB 4EYEA 2C7VA 1EUCA 5COAA 3LT1A 1UUFA 1NHWA 1QYXA 1HEUA 3PFFA 4IZHA 1T2FA 3MJVA 1VKNA 5CG2A 3GEDA 1C1XB 2RIRA 4PG7A 1H2HA 4AJJA 1BRMA 3F5SA 1QORA 3ONFA 4W7IA 4KTTE 1A9YA 2PD4A 1N8KA 1T4BA 4BNLA 1EVJA 2X0RA 1SPXA 3HN7A 5IXYA 1T2DA 2AQIA 1RM5A 3G1TA 1DRVA 3WYCA 1E5LA 4M89A 3KLPX 3DZBA 4B79A 1VLLA 1A9ZA 3ABIA 3WWZA 1AE1A 4B7UA 5FEUA 4CMBA 2X23A 1O8CA 1SOWA 1KERA 4U6SA 3AUAA 4IIUA 4GPD1 4XWYA 5B4TA 4KP7A 5BSGA 3GVIA 4BNVA 4OXYA 4PZEA 4OSPA 3GDOA 3ZWVA 4PLGA 4XQGA 3TFQA 3WSVA 1EMDA 1X1TA 5B37A 4NBUA 2JD2A 5KJ1A 2GDZA 5A9RA 4AJ2A 1V3TA 1NR1A 4RORA 5AOVA 1PJ2A 3SLKA 4A5OA 4OKIA 3TL3A 1N5DA 2HUNA 3ZCXA 4F6CA 4IDAA 4MVJD 2Q1SA 3Q3CA 4RF5A 1ML3A 2YV3A 1FF9A 1Z7BA 4H15A 1Z74A 4ILKA 2AEFA 1MB4A 1ULUA 2E4AA 2XXBA 2Q2QA 2YFQA 4GGOA 2VYVD 1P0CA 4BO2A 5CDSA 2IYPA 4AJIA 1J49A 2R6JA 2V6BA 4R1NA 4BMVA 3UAGA 1BG6A 2VRBA 1CQIA 5DOZA 2W2LD 3PPIA 1FDTA 4CMGA 3F47A 1DFHA 1P1HA 3DONA 3DBRA 4AJLA 5DP1A 4U0JA 2W8ZA 3TDKA 1SB8A 4XGNA 4JGBA 3TF5A 4QT0A 4I5GA 1BW9A 2Y1DA 3PP8A 3SC6A 5DCYA 2EEZA 1PQWA 1A4IA 4IGEA 2GZ1A 4Q3AA 1LSSA 1R4MB 1OFGA 5G0VA 2DUUA 4FJ0A 4BNUA 4RPGA 4GL4A 5FI5A 5A4DA 2PWZA 4NK5A 1BSVA 4IDEA 5L7YA 1UXGA 3DOCA 1R0KA 1Z82A 3FR7A 2B4QA 4BS9A 4YJHA 2W2KB 1QV7A 3QE3A 1GQYA 1EBUA 3ONDA 2OXIA 1C0IA 3WNVA 1EZ4A 5ADHA 2CY0A 1SC6A 1WVGA 3CKYA 4TSKA 5IJZA 1U28A 4J1NA 2EKLA 4RVSA 1G0NA 2HJSA 4CMIA 4DUPA 3ZNQA 3QV1A 3LU1A 4GLOA 2DUWA 3TJRA 4E3ZA 3UHAA 3FF4A 2VZ9A 3TZ6A 2HAEA 4ZRMA 3H2ZA 2HK9A 3A9WA 1LA2A 1U5AA 3KM0A 3ADPA 4MDHA 1C3VA 3JQDA 2BGKA 1R66A 4BNXA 3BTVA 4GAEA 3H8VA 4YACA 5G4LA 4R3NA 4KZPA 1Q0QA 5HS6A 4MVJM 3SXPA 4WE3A 5F1OA 3ZWWA 1EDOA 3G79A 4BQRA 2GGSA 3VVBA 5F5NA 4Z0PA 3U4HA 4Z9YA 2JHGA 1KC3A 4C7KA 5AQ1A 4DQXA 2VHZA 2A94A 4XGKA 2V7PA 3S55A 1W8DA 1J4AA 4WLVA 1MA0A 1U3TA 1ZVMA 3N7UA 4ALIA 3G1UA 1WZEA 4J49A 4BNHA 1EQ2A 2B36A 1TT5B 2YHIB 3QVXA 4K6CA 3ROPA 1N7HA 4MVJI 1PS0A 2C59A 2VWQA 4KQXA 3O26A 1XDWA 2ZCUA 4I08A 2X4GA 1PS9A 3RC7A 8ADHA 2AA3A 2YQ4A 1F12A 3RC2A 4CMEA 4JJIA 3DQPA 1E92A 3KBOA 2EXXA 3AY7A 3LYLA 3AFMA 2EG9A 1M2WA 5EERA 1IZ0A 1U2DA 1C1DB 4MP8A 2C29D 3RAJA 1MFPA 3KOUA 3GVPA 1F17A 3IL2A 4BVAA 1AN9A 4PZCA 4YT2A 2IYOA 1E3WB 4YVFA 5TX7A 4CM9D 2Y67A 3Q2IA 4IDBA 5TS3A 2PLAA 5A1TA 5K6AC 1Z73A 1GZ3A 1MFZA 2O2YA 4BO1A 2YQ5A 3EAGA 2B0JA 3CTMA 3DAPA 1DRUA 3H9UA 3ASUA 3D3WB 4FDAA 3HADA 4JROA 1IUKA 1ONNA 5AYVA 4BNGA 3AOEA 2HDHA 3ENKA 3ZNOA 4DYVA 1NPDA 3ITKA 4JJFA 4E21A 3CINA 1G0OA 3PDUA 1HYEA 1MC5A 2V65A 4IMPA 1F8GA 5FYDA 4YT4A 2PA3A 4PLCA 4CV3A 1ZK3A 3M2TA 3CUKA 3OEYA 3HFGA 4RLSA 1ADCA 1BVUA 1K6JA 5G0UA 2P9CA 2LDBA 4ZQGA 3LC2O 4TRRA 3U5TA 2O3RA 2Q46A 3MZ0A 4FJ2A 2FSSA 4BHTA 1U2GA 4CMCA 1NWHA 5AVOA 1ADFA 2UAGA 2D4AA 1KEVA 1ZNQO 2DFVA 4H16A 1GTMA 4M87A 4P22A 2A4KA 1R4NB 3W8FA 2NWQA 4IZIA 2NM0A 1LSOA 1DPGA 2HMTA 5CEEA 2ZTMA 1O0SA 3M2PA 1NQTA 2C07A 3GUYA 1MX3A 4B8WA 4J6FA 1OMOA 1YJQA 3CEAA 4R1UA 5JYEA 3TZCA 1RKXA 1AXEA 1YVEI 4XRRA 3RUCA 4AG3A 4CM4B 3GRPA 3RUFA 5L95A 2CVQA 2NTVA 3SLGA 3EMKA 1YDEA 4O0LA 1Q7CA 5KVCA 4QXMA 4NDNE 1GUYA 1H6CA 3EZLA 5EINA 4WEQA 5ITVA 3NTQA 3W4KA 1N7GA 3TRIA 3DBHB 3VPFA 3QLJA 3BTSA 1NR7A 2EP7A 4I9NA 3ZWMA 4YRBA 4ZU3A 4AJ4A 4D3DA 5JMWA 4GSLA 3CZMA 2F1KA 4HXYA 5L9AA 1YBVA 3HDHA 1I5RA 1QLHA 2I99A 4F46A 1ZSNA 3G0OA 3GZ4A 4DPLA 1HDRA 3JD4A 4WPGA 3TZHA 3DO5A 1OC4A 3UOGA 1PS8A 1YONA 3WTCA 3LT2A 3I83A 3QJ5A 4BGEA 4EITA 3AU8A 2DBQA 3GNQA 2E49A 2CSUA 3UKOA 1ISJA 1O89A 4NNJA 1YKFA 4LRTB 1PWXA 1SEPA 1TXGA 1UAYA 4BGUA 1EBFA 4FS3A 4F3YA 1EK6A 1SAYA 5DF1A 2FPPA 3U09A 4CL8A 2NLOA 3DZFA 4W6ZA 3IAHA 4XCVA 1B15A 5EESA 1NFQA 3DR3A 3PGXA 3S2EA 3HB5X 3S8MA 4YDRA 2VNAA 1NXQA 5KWEA 3A1NA 5L4NA 3NDJA 4WEOA 3I4FA 1LC3A 1PQPA 4TMFA 5EN4A 1A7KA 1PSDA 1KC1A 4GKVA 1DSSG 5HS4A 1JA9A 3WMWA 4DWVA 3H5NA 3PHHA 2ZTUA 5JXWA 1IB6A 3DB2A 4Z0TA 2QHXA 2FRDA 4CM5A 1F0YA 5CPBA 4U8GA 1XQ6A 3FPLA 1Z75A 1E3EA 2OBYA 3ZU2A 3BMNA 2DQ4A 3QWBA 4P8RA 4YQZA 1ENZA 1ISGA 2JJYA 1GZ6A 1UXHA 1Y9EA 4JP3A 4GWGA 3PHIA 2ZCVA 4NQZA 2UV8A 3PI7A 2X0NA 4DIOA 1ZEMA 3EVTA 3UN1A 1AHHA 2CDAA 3CPSA 3FD8A 2J3HA 1KVTA 1UZNA 3NTRA 4HFRA 4JLWA 2Y1CA 3JQ6A 3GAFA 4YJFB 3ZWPA 2DAPA 4IQGA 3I9MA 2CF5A 2YZ7A 4D0RA 4XDZA 1ISIA 2FR1A 4ZA2A 4MVJH 4DTIA 1GR0A 3I3OA 2HRBA 4R1SA 3O03A 2NU8A 4BV9A 5L4LA 3I23A 4FFMA 2D1YA 4GGPA 1C0KA 2DPHA 1Y1PA 2JD1A 3PRJA 1KOLA 1HZJA 3ZWCA 4XYLA 1QKIA 4L8VA 3NJ4A 4DMMA 3P5SA 2OBNA 4N18A 1GUZA 4DIBA 4E12A 3R3SA 2BFMA 4FSHA 1P1IA 2FWMX 2O3TA 3KSZO 4Q3DA 5IAAA 3V5NA 1BHSA 3HB4X 4R5HA 4E32A 1AXGA 1PZHA 5JY6A 1GZ4A 2WD8A 3E03A 1ZMTA 1A4UA 4EUFA 3GY0A 3OQ6A 4DLLA 3LF1A 2O23A 2VOEA 4NZ9A 2H6EA 1YOVA 2O48X 3L4BC 4GMFA 3GVXA 4K28A 2O3UA 1BXGA 1Q1NA 1SOVA 4ROSA 3ZV3A 3ZI0A 2X9NA 3QWHA 4TKLA 3D4PA 3WSWA 3DMTC 4TVBA 2EERA 1X15A 1TEHA 4BNFA 1FK8A 5DOVA 4JJGA 4E31A 4PG8A 3FNHA 4J91A 3WG9A 3JQ7A 3EYWA 2Q45A 4NFYA 3RSHA 1T24A 5JDIC 2HLPA 3ZWBA 4D3SA 5IDQA 5L51A 4ZN6A 4DVJA 2QG4A 5JLAA 4CUZA 1TT7A 5JS6A 5DULA 5KJ6A 1XA0A 4JIGA 3DAGA 4BO3A 1HSZA 3IDSA 4QO8A 2ZK7A 3ZU5A 1GCUA 1IPFA 3X2FA 3ASVA 1YXMA 3DOJA 2YY7A 3AOEC 1IYZA 4XA8A 1N9GA 4MKXA 3U0BA 4MKRA 3ETEA 5L3ZA 1Z45A 1BXKA 1O6ZA 2GO1A 4OXKA 2RHCA 5KKAA 4W82A 2PGLA 3E5MA 2VZ0A 4NJMA 3QY9A 1B8PA 2DTEA 4Y8VA 4YJDA 4GMGA 1W73A 3IIEA 2ZB8A 4MINA 3FN4A 1JLLA 1QYCA 2RCYA 1XR3A 2AE2A 1BWSA 3RC1A 2BRUA 3O38A 3ANLA 3WQQA 4DLAA 1LSUA 2CFCA 2Q3EA 3E82A 4HY3A 4E2XA 2G5CA 3ZDFA 1LEHA 1T2AA 3GR6A 4UEOA 1F14A 1E0DA 1NPTO 4MIOA 1N92A 3D4OA 5A5FA 2X22A 3JQFC 5LCXA 3IKTA 3GG9A 3OH8A 4GVXA 5IZCC 4RF4A 1MV8A 4DBZA 1QG6A 2EHDA 1DFIA 1DAPA 1ZSYA 3VPHA 3ITDA 4BO4A 4W7HA 1W6UA 1A71A 5U4QA 4BUCA 1QLJA 3DTYA 3CH6A 1I3MA 1VSUA 3K31A 1KEPA 3AJRA 5TLSA 5T64A 1PJ4A 1R12A 3RU9A 4B8ZA 2TMDA 2WM3A 2C2YA 1UXJA 4IS3A 3PJEA 4BNZA 3FNEA 1J5PA 3JCZA 2DKNA 1IE3A 1U3VA 4NBVA 3GNTA 1DFGA 3PJGA 3L6DA 3WGQA 2R2GA 1N1EA 5G0SA 3WLEA 1ZK4A 4FOOA 3C85A 4DREA 1O94A 5CAEA 3UF0A 4CMKA 3AM4A 1GQQA 5DP2A 1WMAA 2IRWA 2ZJ1A 5J23A 1J0XO 5T57A 4W9NC 5JW6A 1UDAA 3DHEA 5H82A 5CEJA 3RU7A 5EIOA 1TA4A 3BHJA 4HBGA 1ZFNA 2NU6A 3K2BA 2A9FA 1A7AA 3C1AA 3E6AA 1B16A 4RPJA 3VH2A 4Y67A 1ONPA 3WB9A 2OO5A 4E5NA 1VL0A 3OICA 4JXKA 3RIHA 3VPSA 1E1KA 2HKIA 3OA2A 4NBRA 2RAFA 3BHMA 3C1OA 5JCJA 3GGGA 3JD2A 4YWJA 4XR9A 4HNGA 4CQLA 4CLOA 4AJEA 1S7CA 5DZSA 5HTOA 1PR3A 4OHUA 1PQUA 2ZATA 3KTDA 2CMDA 4Z3DA 1VRWA 1KY5A 3IS3A 4NU6A 4R68A 1LLQA 4UULA 1D3AA 1OI7A 3SX2A 2GF2A 3VZSA 1E5QA 4R9RA 5ICSA 1JN0A 4OQYA 1Y8QB 4E4YA 2DBVO 3LDHA 4NFSA 1E7RA 3ANMA 4Q3NA 2P4QA 3AOGA 4IXTA 5EL0A 5G4KA 1NTOA 4D45A 4K9DA 1ZXBA 1N2SA 4QX6A 1IL0A 4AJ1A 3GPIA 1WW8A 5ENVA 1MUUA 1UXIA 4D0SA 1GL3A 2I65A 1KEUA 3UGKA 2H5LA 3I9KA 4JP2A 2BMAA 3OQBA 4GX0A 3VOSA 2QX7A 1HE5A 1IOLA 3VHRA 4YAIA 3T7CA 1DB3A 1R15A 3LT0A 2PK3A 1MXFA 1GQ2A 1X7GA 5G0WA 2IEBA 2NVUA 2X6TA 3U4IA 1K89A 1YBAA 4WNCA 1KVSA 2X0JA 4XB1A 3IP1A 4O6VA 3GOHA 2BFOA 4RF2A 5KJCA 1I24A 3ZW9A 3DEYX 3PJDA 4N5MA 2BD0A 2NTJA 4EBFA 1U5CA 3UUWA 1DOHA 1QYDA 2ET6A 4GKBA 3IUPA 5LDGA 4INAA 3VPGA 1HTBA 1PZFA 5A3JA 3M6IA 3GVCA 2Y0CA 4WASA 1X1EA 4DBVO 1V9LA 4KDEA 5HWSA 2IE0A 5THQA 3FRJA 3X2EA 1LUAA 3NGXA 4M1QA 3QQPA 1U8FO 1WAMA 4CQMA 1O9BA 1B2LA 2NVWA 3GLQA 1KYQA 4J7CA 1U4OA 3A4VA 1ZCJA 5MGBA 4A10A 2UYYA 5K0ZA 3OJLA 4QFDA 1HWYA 3A28A 2ZTLA 5A3VA 4WGGA 1H9BA 4KTVE 3WGOA 1I3KA 2GNAA 4DL9A 4PLVA 1XHLA 4I5DA 4E33A 3DDNA 4Z0HO 1C1XA 3MCVA 4BNIA 2CF6A 3T7EA 4BO9A 3WX0A 3S2GA 3D3EA 1KEWA 4E2ZA 2O3QA 1PIWA 4N54A 1ENYA 2QRLA 4NPCA 4ZQBA 4I5FA 2IODA 4HUJA 1DO8A 4B3IA 4A0SA 5KVSA 4MVJF 1UZLA 4EJMA 1NM5A 2O7QA 1T26A
chains in the Genus database with same CATH superfamily
2DHEA 4RFLA 2IP1A 2VNKA 3UV3A 2ZJ7A 5BN3B 4UVEA 4C0BA 3AF6A 1LDEA 3HL4A 4DV2B 4HH0A 4D9FA 3VNQA 2YJ3A 1K8XB 1HA3A 1P0IA 1VPTA 2J3KA 1KZ1A 4DZTA 2YDXA 4UASA 2CLEB 2Q5LA 5HJ5A 4IX9A 2OC4A 1G66A 2D2FA 2ZB4A 3PFKA 4H7JA 3V32A 1PQ4A 3COVA 3L6UA 2JC3A 2I1LA 1EIZA 2DTXA 4R1MA 3U1TA 1Y1KE 3UMCA 1ZK1A 1X1SA 3W5AA 1E9SA 3RTBA 1WPXA 2D74A 2XJ9A 3D5EA 3X2SA 5CITA 1IBCA 3SC6A 2IX9A 5JPDA 4CT0A 4BVFA 1O08A 4JNKA 5LUAA 1Q95A 2A33A 2GTPA 4ZQIA 3TR6A 1ZUHA 2XOKA 4ZJZA 3CCBA 4TUYB 4LVNA 2O2SA 5B1IA 2NP7A 1PFGA 3PUJA 4YK7A 3LRPA 4MROA 1CJUC 3KLMX 3QV2A 5F64A 1MAUA 1UC9A 2ZIZA 2J5BA 5IDYA 2VRCA 1F6BA 1Z17A 4L0QA 4LSMA 3H04A 1Z88A 4MP3A 2IFTA 4FMCF 5IXSA 3PQDA 5J2TF 3ZWAA 2VSOA 3CZ4A 3DH0A 2B35A 1QE5A 4XCXA 3ZHBA 4UC0A 5FBZA 2Q0SA 2IS2A 4KQ6A 3JAKB 5CYGA 5JFOA 4ND1A 4MHTA 2YWXA 3A4MA 5AVVA 4RZ3A 4QRIA 4GKJB 1WTAA 2UZ4A 1EVYA 1F8YA 1GPDG 1NF9A 4R8RA 2EEPA 3CLUC 4TYQA 1JP7A 3GNLA 2CEAA 3RQIA 1GNPA 1YV9A 3F6EX 4QATA 4OX9Y 3WA7A 4AUMA 2NUPB 3N6VA 4D5GA 2E18A 4I2NA 3GMSA 4Q82A 5BQFA 3P32A 3ZV7A 1YQGA 3PUHA 4Z1MA 4OFWA 5FBVB 3QK7A 1E0AA 3X1ZA 1G8HA 1TZJA 1U6KA 1XRSB 1MG5A 1WLSA 2Y99A 1I0IA 2QQ0A 4A7PA 3KR2A 4BJ5A 3F73A 3FM9A 2R60A 3C8UA 2FUG1 4HDCA 3U17A 5J1SB 1G4AE 3VU8A 2XRZA 5EWMB 3B1XA 4QUGA 3ESQA 2P2SA 1UFVA 2Z4RA 3WICA 3EPRA 1YJCA 2F1IA 4KMMA 3G5UA 3ETHA 2V98A 4A6PA 5C5EA 3UAXA 2GZSA 5B55A 2WBLC 3GN2A 5A4FS 1LQUA 2QX8A 1GTZA 2WMYA 3F1KA 4GZLA 4OO3A 2AOVA 5CXXA 3ZCVA 3NV7A 3VH3A 4GYYA 2XB4A 5A0FA 4DIEA 4DAOA 2WVHA 5CFNA 2F59A 4B4DA 2V9ZA 3TW4A 2MYUA 3GCXA 3PC7A 1W9HA 4GBED 2HHHB 3HK2A 4G4IA 3AR9A 3ONEA 4FR0A 1RWOA 2VXOA 3WYBA 3H9GA 3QFTA 1P0PA 1IQPA 4A6EA 5I9IA 3M82A 2EJCA 4ZCRA 5DNEA 5EIFA 2H4WA 4HWOA 3G2OA 4FYXA 1UJ4A 2ZYTX 1MR3F 2IXAA 1YAHA 4FOSA 3TLGB 2FSVA 2HIMA 3PNPA 3W9UA 4AICA 2ACVA 3DB1A 1HT0A 2J0UA 1MX9A 2ZBFA 4Q3BA 3WOHA 3H2JA 1WL8A 3AJAA 3TFWA 2PUEA 3D6JA 2RH5A 4HYQA 2BBWA 1IUNA 5AKEA 1WETA 3OD1A 4C0AC 4ZGBA 3O4VA 4D5EA 4C0WA 1LJ8A 2GAFA 3B1ZA 1CF4A 1FTNA 2Z8XA 4JWTA 4AMGA 3MJ4A 3OBIA 4EBBA 3FI9A 3ZGZA 4WXPA 4MWCA 1T1RA 4QO7A 1QTRA 4L7VA 5K3DA 3L4BA 3RC8A 1TT5A 1Z33A 2B1QA 3NT5A 5C8YA 1MJFA 4HN4B 3RBZA 4F1WA 3R7DA 4NIMA 1NLMA 3I1FA 2I2XB 3FFAA 4TL8A 1QCZA 1YQUA 2O19A 5AKZA 2I3AA 3TTWA 2CLOB 2QUAA 5ALWA 4FYHA 4EJSC 4EZBA 1T5OA 2R25B 3LL4A 1NUQA 2WKPA 3CLTD 3M1AA 3D8SA 1E2IA 1K3FA 1T5IA 1N6OA 2RONA 2BM8A 2VAXA 3I5MA 3I8XA 3QA9A 4NZMA 5DW0A 4A4DA 5AVXA 5EMHA 4G01B 4XM0A 1J09A 1IZ9A 3M6WA 4F97A 4NU0A 1SBYA 2NPFA 3VSCA 1TOAA 4GOMD 1EFCA 3JQAA 2BMJA 5TJ9A 1FX1A 4ND7A 5JDIA 2PUBA 4P5PA 2NUBA 4YQYA 4ARIA 4LV5B 1HQYE 1QE3A 1T3GA 2FLWA 2G88A 3EGOA 4D9CA 1GQSA 4O59O 4HQKA 5NULA 1KQNA 1DWOA 1EWKA 4W1QA 4S24A 2R47A 7REQB 4MKGA 1KYVA 4R16A 1YR1A 3LWNA 4K40A 5H8WA 1EB8A 3C43A 5H02A 4B9AA 4GKKB 1KWKA 3CFYA 3SXJA 3DGFC 2I3ZA 4FCCA 4K9RA 4KVAA 1KYZA 2CUKA 1EGVB 3DCYA 1I51A 1MNQA 2FH5B 4X8OA 1MVNA 2W70A 1Y7TA 3I04M 2CYBA 4O4HA 1A88A 2H1HA 3V4FA 2KPOA 4BL5A 3L0IB 1Z2DA 5MHTA 3I9JA 4P58A 2IHTA 1LI4A 4C88A 1L5YA 5LPNA 1LBEA 2ZRIA 5I7WA 4XAQA 1M8PA 3BGVA 4I19A 3UCFA 4YTEA 1XTVA 4DC0A 5ERGB 1ZONA 4N9WA 2GRJA 1WDKA 4IIJA 1JQKA 4GH5A 3T9FA 1LZLA 4A03A 4P4SB 3MBKA 2JI4A 2ZB7A 1ZH8A 3LKBA 3OJCA 4KIUA 4OXNA 4CCYB 1E69A 3L0OA 4MV5A 4W8HA 3UOAB 2GCGA 4KPUA 4HB4A 4EH1A 1I9GA 4EGCB 3KL4A 2DLCX 1CZRA 5K1ZA 1ONSA 2WRZA 3ZKAA 3U49A 1XN1A 1C9YA 1XJ5A 2WEKA 3RODA 1TE2A 4JASB 3EXIB 3W6PA 4Z4EA 3KQQA 2B82A 5ANRB 2HJHA 4DXHA 5FWNA 5LQAA 2ZJAA 1K8QA 2JEYA 3DE5X 4BQSA 2A0XA 4DLPA 1H0KA 2VAMA 3E9NA 3JQFA 4J4HA 1IATA 2EC5A 3OO1A 3F6CA 4NCJA 4OGGA 5FWYB 5IZCA 2C7PA 1Y1SA 1JR4A 1RNLA 2QJTA 2ZJZA 3GEPA 2BCEA 3NX4A 3AY6A 4KQWA 2G1KA 5CD1A 4MW7A 1JALA 4MV4A 3I3SR 3SIWA 3P5BA 1NNI1 2D0IA 2RG1A 4FD3A 4B4KA 1G20B 4GW3A 4NAHA 4Y2XA 3T9DA 3B60A 3ETLA 2CL6X 4FK8A 3C45A 3KLBA 1WZIA 1K4KA 2KWIA 3U9LA 1QYVA 4MO2A 1NM5C 3F46A 2CWWA 5EJGA 1VRVA 5FNVB 1UINA 3PPYA 3TECE 1MN6A 4DXDA 3L7DA 3K6KA 1O7JA 1PKEA 4AX8A 3IVRA 4G8BA 2FAXA 1CUWA 5IJAA 1O6GA 1ULTA 4CM4A 5JWRA 5CXQA 4MV9A 2GLXA 1JIJA 1IN4A 2PFSA 1SC4A 2PS1A 2LDXA 1KZHA 4UDOA 1U3CA 1MT3A 1XZNA 3U4QB 4GQBA 3TL2A 3AFHA 2V9CA 3RFXA 2VLBA 4RADA 4FYVA 5LMNB 2UZ1A 2B8TA 4GSYA 4B1FA 4DSOA 1UM9A 1F2DA 3ITEA 4JBIA 4KNVA 4OQQA 2ARKA 2E7ZA 1NURA 4UEJA 4A1FA 2JIOA 1L8QA 4DC1A 4RESA 9GPBA 2WA1A 4I14A 3QWFA 1BGVA 2AG0A 1SU8A 2BY4A 3OSUA 5EFOA 2GZHA 1KAMA 4IO0A 3U56A 2V74B 3MGAA 1YQWA 5TGTA 3PQFA 3JSAA 3H99A 1GYQA 1FNMA 3AR7A 2BR5A 5JZBA 2B1JA 2COEA 4C2UA 2VI5A 5FWXA 1DE0A 1Z8FA 1X8LA 4P83A 1DG1G 1QFZA 2TECE 3RTAA 5LMZA 2F8SA 1KK2A 5FX2A 2RAPA 4PGHA 1STOA 1IN5A 3OP1A 4LN1A 1YWGO 1CDDA 3QGMA 1PG5A 2YDYA 4B74A 3KT8A 2V7QD 1ZCZA 4MCHA 4TLCA 3SEFA 1IN1A 4EB6A 2J7PD 3LCJA 4K9SA 2VPPA 3KLOA 3SYMA 1QDEA 3BKXA 3K72B 4FBMA 4FHDA 4QOSA 4R4JA 3JALB 4TOIA 2LCQA 1H8HD 1L5MA 3S29A 1VOTA 1YRLA 1HYHA 3B5JA 4X71A 1PR5A 2O06A 1A8QA 1H0HA 2I2BA 5CK4A 4QTZA 1HR0B 2R3SA 2ZS8A 4XD2A 3JQGB 5DCUA 5ALXA 4DCOA 4JI4B 1T3SA 2C8LA 4JLOA 3PE3A 4ZQHA 2W11A 1SCAA 3FCOA 2G40A 2PLFA 3A31A 3OJWA 4OKNA 5K8IA 3OPXA 2JFUA 5L45A 4O3FA 2AOUA 1NG9A 2WG0A 2PEYA 3OIGA 1DX9A 4MWOA 1EFTA 4CTOA 4YV0A 4RVGA 2GF9A 1K66A 1ULSA 1XXLA 2GK7A 1A1VA 3KJEA 5DTIA 4DLYA 3LF2A 2P2CA 3L7IA 4IDGA 3PTZA 1OLXA 3IXQA 6REQB 2QRUA 3AI3A 4AM8A 1UKEA 5EPEA 1WR8A 5IAKA 3QUCA 1Q17A 5ALKA 2C9ZA 2JIBA 4EGFA 1XEAA 2L42A 3SZ3A 1H5QA 3KT3A 4MUYA 2IS1A 4Y1GA 4U2GA 2QIPA 1QH1A 3BB4A 4K88A 2O14A 4JP8A 1WXWA 5DNWA 2ZSKA 2WPDD 3FZGA 5GVSA 3V1LA 3KYCB 2QRMA 2XMRA 1MXHA 4HJRA 4U00A 1AQYA 4Z99A 4DPMA 3I62A 4WCFC 1CZKA 4B3BA 1UBGA 4NR0A 2G63A 5LYYA 1M2HA 2AI1A 1M7HA 3NT2A 1ESEA 4J16A 1HEYA 4KI0A 5BYJA 4Y9DA 4J9VA 1KAQA 1I2ZA 2ZT6A 4UVGA 5CDUA 1W0JD 2AE1A 2FW0A 4DR4B 3I2GA 4RTSA 2YV2A 4JDUA 1P9OA 5DGTA 4FSXA 5CB4A 3LT4A 4XIJA 1E2LA 1XV5A 2QE7A 1SG9A 4XD7D 6YASA 5M7EA 2ZIEA 4CUJA 3X1JA 3E7PA 5HKOA 1JKMA 2VBIA 1FY2A 1YOVB 1G6Q1 3KHUA 1N2JA 3GA5A 1PZMA 3I8SA 4FCTA 3X1YA 1RC8A 1QH8A 2OQIA 3KZNA 1K6MA 2C7GA 2NUAA 1NUAA 1FEZA 5EE9A 1ZSVA 3G0CA 1IPEA 2B34A 5EZSA 3OT1A 4H7KA 2QK4A 3CSSA 5AKYA 3WBBA 2SICE 4BAGA 2QU8A 3KJIA 5KNDH 3RB8A 1O9HA 5D3MA 2B25A 4W99A 5B3JA 3O4HA 4ETIA 5KWJA 3F5QA 4KE6A 3IUBA 3TNLA 1ECJA 2VUUA 2XE7A 5C1BA 1NULA 3B38A 3A3KA 3ZLJA 2RK6A 1A9TA 4M0DA 4NS1A 1ZU5A 4P81A 1SBHA 4A23A 1XPOA 5AXBA 1JHRA 3FTNA 2AUMA 3KT0A 3LXRA 4LZAA 1H05A 3DF7A 3RD5A 2VJPA 1NMEA 3WL6A 3IUQA 1JQ3A 3OAAD 4Z51A 3VH4A 2Y27A 3IERA 1SQSA 2WVGA 5F23A 4EY4A 5JCXA 2F00A 3GJ7A 4WACA 1OH5A 3B20A 3Q9UA 4LE0A 1P1JA 4IR7A 1L1QA 1P7VA 2PZJA 3O8QA 3OKAA 3NBYC 2C2XA 1YR2A 3CNQS 2VAWA 4L9RA 4YRCA 2V0NA 3SHTA 1F9EA 1UOQA 1AOXA 2Q4BA 2B4KA 1ULBA 4AMBA 4KDFA 4DSAA 1KNXA 5LBTA 1MW8X 5LB2A 4RMGA 4E6PA 3DSRA 3FPFA 2D1RA 4UJ5A 4FWIB 4S05A 4L76A 4R51A 2ZOSA 3EZYA 3CM0A 3RSFA 1D6SA 2XSZA 3HDVA 3MOGA 4BMZA 4NJMB 3BG5A 3MAJA 3UT6A 1CUVA 2EVWX 1O8BA 2GWRA 4EG6A 3ESBA 4TMVA 1D03A 1G7SA 3D7RA 4QASA 5FNZA 3X1WA 1GPAA 4P4GA 3AUTA 4DQUA 1C4XA 4K9PA 1M6WA 4ZT3A 3LCMA 4LHEA 4OV6B 1QR6A 5BQPA 4G4GA 1TU3A 2FQYA 2GN0A 1G4UR 2HO4A 2OSBA 4UMFA 1WDLA 3DCNA 1CUBA 4I9UA 4IFEA 3E7WA 3L9WA 4BMPB 1ZQ1A 3K0CC 4EJ6A 5JRJA 5EFZA 2YIMA 1IK4A 3HDQA 4JY7A 5A4JA 2O8VA 1PR1A 4YB8A 1ZOPA 2X4DA 2R1VA 3S70A 1FUEA 5D86A 1Z29A 1TEXA 4HPWA 5HRUA 4QJ3A 4I4TF 4MI9A 5TPZA 2EGUA 2W6IA 3PQCA 5KDDA 4DMFA 2FLKA 2OUIA 4WK6A 4LYAA 1Y6ZA 4B6JA 1AS0A 4BLRA 2IYVA 3NBUA 1TM7E 2YS7A 4X6LA 3ABSB 2YV5A 4QHSA 1H2EA 4B7XA 3KEQA 4GEKA 4S1VA 3FIJA 2VJNA 2YXPX 2AUNA 1S2MA 3PXAA 4M9SA 4P86A 2I6SA 1UK9A 3LUDA 3RUEA 4AXXA 4D8UA 2F43B 2CW5A 1MB9A 2DHQA 3GJZA 1K1EA 2FE4A 3L04A 3KX2A 1EFVA 1OWOA 5BW5A 5JARA 1I3NA 2A0WA 1NX9A 1AV7A 2F3PA 3QRWA 2QTHA 3TSCA 4IQ0A 1KVRA 2A3NA 3B6KA 3L18A 4D9HA 1C0LA 5JWOA 4URVR 3V6MA 3V80A 4XX0A 1KFEB 2D0PB 2I03A 2MMGA 3KVOA 2AFHE 4D4HA 2GO7A 1YDFA 3BDVA 2PL5A 5JANA 3PYMA 2B7CA 4QDZA 3VNSA 4EPWA 4Y2JA 4M6WA 4JH0A 8LDHA 2R6HA 1PJSA 3FOWA 2BBOA 2XI4A 3FDZB 2H1IA 1SBNE 1NBOA 5CAEB 2ODEA 3BXOA 4UM8B 4X93A 3W5HA 1P5FA 1PW5A 2IQIA 1XL1A 1RT9A 1NMXA 2H92A 2R2AA 4BGDA 2OBXA 1G1AA 1P4GA 1JWLA 1TAGA 4WBXC 4A73A 4EL5A 4URFA 4HAIA 5HBRA 3RWOA 4DAEA 1IJEA 1DKRA 1G3RA 1R5JA 1D1TA 2PZLA 2VJQA 4LS3A 3VDXA 3NB0A 3F5DA 1WBJB 4GPBA 3RYTC 3TBKA 1XTJA 3NU1A 3OOJA 5JXHA 4JQOA 3G2IA 3KSRA 4F5EA 4IV8A 4Z9XA 3OIDA 4WCDA 3FMIA 1LPAB 3O8LA 5KOHB 1T25A 3N8KA 4QOIA 4MR9A 3EZGA 2E6KA 2HXSA 3TO5A 4D8TA 4UUPA 5DBGA 5TF0A 2NAFA 1WP4A 2DQSA 5ADUS 4NJEA 3TZQA 3FMVA 1DX4A 4CLXA 1AKQA 5CTJA 1SUWA 5CK5A 3ANTA 4X64B 3C6ZA 2QSJA 2QYTA 3AU9A 4TVOA 2XEDA 5L53A 3SIPA 3H5WA 1BDIA 1BEUB 1T8PA 2DH6A 2RGEA 3NYIA 5AJXA 2IP4A 3W8DA 5CVDA 4B6EA 2NPOA 4KWIA 2IYUA 2WU4A 1KO1A 3RG2A 4C5AA 1PR0A 4G0WA 2H4JA 2X76A 2ZBDA 3V00A 3ZEIA 4C7OA 1R6AA 2YXBA 2WINI 2P68A 2XYVA 3UC9A 2XHZA 3R77A 5DLDA 4IOKA 2PKQO 4BNYA 1KI4A 5JNLA 1H42A 2JJ8A 4D79A 5L3VA 3B1JA 3K73O 2O20A 4BRWA 2AT1A 1Z4IA 1W5AA 1QIGA 1PBTA 1X7WA 1ZJYA 3LPDA 5DB4A 3HDYA 4K05A 3UK0A 3ZQUA 1KL7A 1BEEA 4HNRA 2P9GA 4YP9A 1NJ2A 4NCHA 4NU8X 3ZXSA 5DKFA 2UVDA 4QVIA 1J8QA 4PYQA 3SQOA 1KARA 3CE6A 4LF4B 1NBEA 521PA 1VG0B 2IUTA 5LQJA 1L7MA 4JI5B 2XXAA 4EPTA 1UBEA 4MWZA 3ASYA 4RH3A 5AK4A 3EC2A 1NHGA 3SF0A 4IJQA 3QLUC 4BC0A 1U8TA 1J5EB 3W3AD 3I09A 1F0KA 5FHQA 3L07A 3ROMA 3S44A 1VLZA 4EFLA 2F3SA 2M6KA 1XC7A 3PFIA 1T4GA 4HAZA 3VYSB 1BWRA 2I0FA 3HR7A 4FX5A 4D4KA 5JY1A 5AK6A 1BCRA 2BFBB 1R5NA 3FSGD 2AXNA 2YV1A 2W58A 3X3HA 3IUJA 3QF4B 5FQNA 1Y3BE 1NJ6A 1Q14A 1ODTC 2HWUA 4GI7A 1UZMA 3N2NA 2PVCA 1YUNA 4JNCA 3EXHB 3M4YA 1TO1E 4J90A 1KP2A 3TQQA 3OECA 1JEEA 3N59A 2YZKA 1F48A 2R1TB 3HY3A 4HWSA 4JUBA 3EC7A 4NP6A 4QJ5A 5DM1A 1KI6B 3CLUD 1EINA 5FFMA 4QC2A 3TTYA 4G37A 2EHJA 2QY9A 4HB0A 3OM9A 3VDRA 4TT8A 2GB4A 2X7XA 1FOEB 3PGVA 4U9UA 3RS0A 3N2IA 1EM6A 4DSNA 3ZHXA 1R16A 2IS6A 1P4JA 1YASA 5EIEA 3QU9A 4XIIA 5JD5A 1COWA 2O8FB 2QQ5A 2GI4A 4WRRA 2J67A 3SKVA 2D2IA 4RFSA 4OHKA 3ZU3A 1FNBA 3HEBA 4IBOA 1ZNWA 2BGTA 5TMEA 1AKMA 2YJNA 4C4SA 4DG8A 3WK6A 1QXSA 3LM8A 2ZI9A 4OK6A 2VCYA 4DB4A 1C80A 4GZ5A 2FJUA 2GJSA 3VYRB 1T5HX 3W6UA 2HJWA 3DZCA 3TI9A 5B36A 5DNCA 5G41A 5JSQA 2JCYA 3BAZA 3KQPA 1BGXT 2SCUA 3HYCA 3ISTA 4EHJA 4QWWA 5A5EA 1NBMA 1QGUA 1NR5A 3ZHCA 1SM4A 2ZBEA 4KLNA 2OZLA 3DE3X 5JBIA 2V7UA 1G64A 1CY6A 4P5EA 3UHOA 1ZMBA 3QZUA 4MRRA 1M2EA 3I61A 5EYPA 4UFNA 4M1MA 4KW7A 5BWCA 2OK8A 1RKQA 3LSTA 4NNPA 1NVVR 3IB3A 2PH1A 3UZUA 1QU3A 1SHZA 2VCHA 4B35A 5FO0A 1J33A 1NC3A 3RS8A 4QPZA 3TJZA 4EKEA 1V7ZA 4ZQFA 1RRMA 3G59A 2Q29A 3G8YA 3GRUA 5FR1A 3R3ZA 1J9EA 3DEFA 4G5GA 3RFCA 1G21E 1NJ1A 5LOVA 5CRIA 4AD8A 5BUCA 4RVDA 3A06A 2JVIA 5ALIA 3N74A 2GDJA 3C16C 4QAJA 3TTSA 1V1RB 1SQ6A 5IN5A 4WZZA 2XKBA 1I1QB 3U4CA 1TZMA 2CYCA 3V6LA 2E5LB 2WWGA 1RZRA 4RA9A 3CSDA 4TLBA 4US1R 4V0OA 3T4XA 2WSMA 1UBFA 2I4MA 5FOVA 2FPSA 1XHEA 4DDUA 2ZAOA 4Z0NA 3KEFA 2FPWA 3QENA 4HLNA 2Q9BA 4HDSA 1RXWA 3OO0A 4GZ3A 3KKOA 3ZJ5A 5KOYA 5FPQA 1BQEA 5BWOA 2NQ2C 5AI4A 4EJ0A 2R85A 1L7NA 2EKBA 4Y30A 1OYYA 2I80A 1ORRA 3GWGA 4RKWA 1NL3A 3ZD9A 2NU9B 1WMSA 4EM6A 1KK1A 1KQPA 1XCLA 3EYAA 3HNOA 5KB3A 3HBFA 2O3JA 1MVOA 2B9VA 2HWWA 1GQOA 1DEXA 1NVTA 5DYTA 5BOVA 4AB1A 1Y48E 4ZCTA 4ZU1X 1I4EB 5C0OE 4CIBA 1MW9X 3X0DA 1NFRA 3BMCA 4HQ0A 5IAEA 2FEOA 3CVYA 2GASA 1K06A 1XXHE 3OE5A 1YS9A 4PU0A 3L6EA 4TXLA 3MD0A 1E3MA 3HZOA 4HQRA 1JW9B 5ICMA 3ABOB 3PCXA 2F64A 2GCEA 1LDBA 3L0YA 1PYDA 2HLDA 2FTKE 1K0UA 1TVKA 3B70A 5F52A 3FPBA 1AS3A 4RY0A 4CM9A 3TDMA 1N2CE 4CMGA 1HDGO 5CLLA 2VYQA 2IDZA 1DIBA 2Q3BA 1E2DA 4WX2B 2A9RA 1NYRA 3DVSX 1CBUA 1Q7EA 1HYGA 2FOIA 4RD3A 1KO7A 2IOFK 4ZWNA 1DJNA 4IHJF 4LKOA 2WMNB 5EEGA 3S0JA 5AI9A 4ZI7F 5BN1A 4S1WA 4DMLA 1T34A 2IUFA 1JH8A 3FPGA 3KYDA 4JL8A 1QBKC 4CW7A 3UK7A 2Y0EA 1XZIA 5SZKB 2BFNA 5EKDA 3ETNA 3FUWA 4KC0A 1GKUB 2CNKA 1DC3A 3F9IA 3HQ4O 3K92A 2KW5A 1P44A 3LK6A 3BXGA 4PXYA 4Q3EA 4QEDA 4XYBA 4PZUA 4Y2HA 3VDQA 3VSEA 3SOZA 4K46A 3F5MA 4CFZA 3DHYA 3TAXA 3ZXXA 2AOTA 3HP4A 4B3SB 4B3TB 3Q98A 4AZWA 5KOJB 2HA2A 1BRTA 2GEFA 4U0KA 1Z13A 2QNRA 3D8BA 4Y9SA 3KUDA 4D80A 1WCYA 4AFNA 2HYDA 4MJ3A 3TK1A 1GUAA 5EJAA 1UANA 3WJ2A 4RELA 2ZPUA 3P9QA 2HIGA 4MKFA 4X94A 1UJNA 1JVNA 5AI8A 4EVRA 2JLXA 2BH2A 1HC7A 1ES9A 2ZP1A 1P77A 4RPIA 1ZXXA 5TS2A 5IBPA 2PR2A 3TTTA 1J8VA 4Q47A 3LHSA 1V96A 1SD5A 1TDJA 4CN8A 4F45A 2FDXA 2R8ZA 2XWQA 3E84A 3OZBA 3BS4A 3ETDA 3T1OA 4B84A 4O4LA 1E9DA 1C7QA 4YJGA 4B2IA 2JHPA 5KNCA 3D7MA 4N7RA 4AJHA 3F7OA 4EG1A 2EKQA 1MA3A 2FGJA 3KEGA 4ETMA 3OLZA 4DYHA 4YAEA 2XCOA 3RCBA 2O3SA 1NDHA 3H9QA 5DGHA 1OASA 3A58B 5CURA 3CZQA 5FPKA 1A96A 1N5KA 2PH5A 2V7TA 3LKDA 3K9BA 1PGNA 2A3RA 4JVNA 1E6LA 1ISFA 1HL3A 3O84A 2B98A 1GP2A 4J2OA 2DQYA 2XUKA 1Z5PA 4PRYA 4Q9JA 5DEIA 3TE6A 3GBVA 1H65A 1UP7A 3OPYA 5ETJA 4IM7A 1W87A 1D2CA 4HATA 5FT9A 4UD2A 3WGIA 3EEQA 2QLTA 2IHZA 1G59A 1GRCA 3LDFA 1S2GA 4LMPA 1NXWA 1JIIA 4F06A 2I5PO 1MABA 3EQ7A 1ZD3A 2Q4DA 1EDBA 4RTNA 5TGZA 4NYMQ 4IHQA 2ZPTX 2H2IA 3AEXA 3TLZA 5T41A 5DK6A 2J4FA 4M0MA 1Y5RA 2EBWA 1D07A 2RJOA 3KQWA 4O8ZA 2Q9CA 4PICA 3COSA 3ZU4A 4JYAB 2AFHB 1MOPA 2DP4E 2XNDA 1OA1A 5ULLA 2JGEA 2MSCB 2OKGA 3L1KA 4LKRA 4REQB 1TI7A 4ID9A 3UHFA 5TPWB 3UQYS 4U7DA 4FZ3A 1C1HA 1TAQA 1IH8A 3FCSB 4Q7LA 4RMIA 4OBWA 2WD7A 1F8XA 1FFEA 5BWBA 1QP7A 1N6KA 4KPGA 1XEXA 1DTWB 2VDLB 4KYIB 4F3KA 5C9ZA 2FEKA 1TMOA 2CLIB 1HM5A 4DKXA 1PT8A 1DC5A 1QTNA 4B5LA 2PZKA 3GJ8A 3KV3O 2RAVA 5FPTA 2CLLB 4C21A 1XZDA 2A6PA 3G5LA 4LJSA 1C9MA 5CU7A 1GN9A 2FZVA 5LP6A 1F7UA 5DNVA 2EU8A 2YWRA 3FPEA 4QXAA 3S2UA 4K3VA 3C6YA 4CI0B 1GFWA 3IVMA 5A05A 4CZ2A 2WJPA 1OTHA 1L3CA 1SKUA 1TYBE 2RHMA 3LD9A 1KBZA 2O1WA 4OUDA 4UPEA 3FNFA 4JS0A 4TTQA 4J0FA 1TC2A 1SH7A 3MJCA 4XFKA 5JECA 4L4XA 3D3WA 3EUAA 1WV1A 3WA6A 1QGDA 5KYVA 3ZBQA 1OZAA 4MX8A 4COKA 3SPXA 2PXXA 5JSZB 4UHKA 1CY1A 4K81B 4TVSA 2NW6A 3B12A 5JHGB 3K71B 2ZUUA 1SN7A 4PC2A 4E4TA 2JKYA 5H5JA 3G2QA 1HFJA 3K0FA 3K20A 3VR6D 3QU5A 1W47A 3TL6A 4E5PA 1L4NA 4W7SA 1GZ5A 2AK3A 1GGHA 3RWBA 1R37A 2FR8A 2WFZA 2YWGA 3A2MA 1QC5A 4GX2A 4QUAA 3CBQA 5KAMA 3WDSA 2VHUA 2QENA 1Z5NA 2I9PA 4HS9A 1QDUA 1PLKA 1QHYA 1C7IA 3SBDA 4DCTA 5IWCA 4ZOCA 4AUNA 1OT5A 2DCUA 1JFLA 3GOQA 2OC9A 4OHCA 4EY7A 3REQA 1OT3A 4QUJA 5DNAA 4DFDA 3FUUA 1EQUA 1ZBDA 3I01A 4BFWA 4ZI3A 2CXNA 2VT3A 1GGEA 2UKDA 1RYHA 3K5WA 1T43A 4ZJUA 3CMCO 3ESZA 3FTPA 1CUYA 3MLBA 5J2UA 2IIVA 4BFUA 4O2BA 2OQRA 4HX2A 3L8YA 1L7BA 3FNGA 2ONJA 3DHNA 4UNIA 3U4DA 1CJBA 1WZNA 2B2CA 4BKMA 3GFOA 2ZYWX 4HCJA 1D0VA 1F9AA 3BE4A 1M67A 3OJ0A 4RMJA 1LD3A 4FKZA 5THXA 2HPZA 2WHPB 5D84A 3A9CA 4MB0A 1X13A 2C97A 2ONCA 2X3UA 4PPGA 1QK3A 1BTOA 1A8HA 3PEWA 2ZXFA 1G2PA 1Q0LA 3LUPA 2GN6A 1J90A 2R8YA 2YJZA 3Q3HA 4TLMB 3QWIA 3V3TA 3EVEA 5E8JA 4PV7A 3O8RA 1Q0TA 1DRKA 3DBHA 4S2UA 1NX6A 3SSNA 2DH5A 1VQ1A 2X6RA 1R00A 1Y80A 4TS3A 2BI7A 1YMVA 2HNBA 2H7VA 1GQRA 1U9JA 1KF0A 3HA2A 1U2PA 2EATA 3G9UA 1SULA 2OFXA 2BMWA 1X8KA 3GLUA 3AEYA 1BH2A 1E77A 1Q1AA 1Q83A 2ERXA 4EUSA 3K0KA 3PC4A 1ZGGA 3UUEA 3Q41A 1N34B 3EE6A 3P0FA 4JXXA 2VP4A 2QSUA 3OZWA 4O4IF 3GLVA 2G5PA 2QG6A 1I7PA 2R5NA 1K7CA 2HDWA 3LX6A 1WMDA 4HSGA 4XVHA 1ABBA 3ADCA 2Z6QA 4MYCA 3DKVA 4H3VA 1I6WA 1J8FA 3OQVA 1CUXA 3ZHOA 3HLYA 3IQWA 2DHDA 1XKTA 5AQEA 2CBGA 5KDLA 4AJNA 1A3CA 2VDWB 3PVZA 5K4HA 1ZITA 3BIFA 4ZAXA 5DBFA 4ALJA 3EGXB 4B45A 4Z7OB 5H16A 1U2ZA 1CB7A 3LFHA 1S8NA 1KDTA 4RAOA 4UAGA 3AG5A 3IH5A 2GKOA 2XZOA 2HSGA 4ND6A 1J7JA 1RC0A 3KKPA 4FGWA 3IOMA 4L50A 5FOXA 1L5HA 5CBPA 4ND2A 5IRCD 3F9CA 3JATA 4I8IA 2HSJA 5B4UA 2PH3A 1AHPA 1DUSA 2QTTA 4QAQA 2VWGA 5C2JB 2CJYA 4G5SA 1NVXQ 2V6MA 1WVMA 2OESA 2YHUA 3JV7A 5AVYA 2PX2A 4R69A 4PX5A 3QPAA 2QU7A 4MI3A 1PT9A 3G3EA 2QRPA 1U0RA 4NBLA 4M9RA 5HCUA 4MW4A 1G21B 1A8SA 3GI1A 4M9XA 2ZZMA 1QYWA 2H1SA 4NF2A 3RAGA 3EK2A 2Z8YA 1E94E 4ZCQA 3VKHA 2C9BA 1XQ1A 3QEJA 4LXHA 4R8VA 2X5NA 4HYYA 3ILHA 4E0BA 5JNSA 1OD6A 2O1EA 3HA3A 4YP1A 1SGWA 1ZM9A 4CM7A 2WR8A 3BQNB 3HCEA 4QECA 4QGFA 3H9JA 5F2EA 4C3VA 3CVWA 1E3LA 5BSTA 2IPAB 4PF1A 1J24A 1OCEA 3FDIA 3GT3A 4XUGB 3KXLA 1QHFA 5TF4A 1DAIA 3B8EA 3AETB 3HXKA 4DNQA 4ON9A 3BMQA 4YRDA 3B82A 1RLTA 3R5XA 1C81A 3RFUA 4JVMA 2C2HA 1SURA 2H4XA 3MLAA 5CYPA 2PNFA 4P38A 3ZCQA 1MX1A 3SK0A 1RQGA 3ZXUB 5I8WA 4LJLA 1QRUA 1DKNA 2Q1YA 2VUTA 5AKHA 1N2BA 1NXSA 2PTGA 5DNUA 3TFOA 2JFOA 1YULA 5T3YA 1XF9A 4WI1A 4IXNA 1E4OA 2QD5A 2W37A 3MJFA 5HCIA 3ZWOA 3UCXA 5ALLA 5M2QA 4CR6A 1RLJA 3R6DA 3LNCA 2H07A 2XF8A 3DV2A 4DLXA 1PVOA 221PA 4Y1RB 3ACBA 3CC8A 4QQFA 1XXHB 3RYHB 3G7SA 2ZI6A 4IMRA 2HD4A 3R2JA 1GAEO 1RZ3A 2UUPA 2O6LA 3HXQA 5LMUB 3ZD6A 1HURA 2Q7XA 1U0GA 2JFPA 1BOFA 3IHLA 2AXQA 1A9SA 3G0BA 3TM5A 4J2HA 3V1TC 4JB0A 3V1KA 1N2CB 2GCOA 2CFSA 2WIKA 3USZA 3IT3A 2J6HA 2O8CB 5IXJA 1UBJS 2W22A 3EXG2 4LC9A 1AN0A 3QW2A 4KUHA 4DR5B 3T3OA 2QT9A 2Q4OA 4KQHA 1P8AA 4EGQA 1NF8A 1GM5A 1FJGB 1DJMA 1T5BA 1DIRA 2I6UA 4INOA 4O2RA 4PYNA 4CMEC 2VVTA 3LUGA 3SQNA 2ZYHA 1A9PA 3JQ7B 3EEFA 4Q3LA 2CNDA 4NMHA 4I50F 2PLWA 3MJTA 4BE9A 1NVMB 2DBZA 2PT7A 3RSLA 3A1CA 1U2DC 4Y6SA 3VR1A 4DEYA 1SCNE 1SXJA 2W48A 1E1CA 1QFSA 2PUJA 4AYXA 2HSZA 4JJ8A 2CK3A 2QXUA 3N8GA 2P1ZA 1JAXA 2NO1A 1AH2A 2KMLA 1IY8A 1DBIA 3DHWC 3CUTA 1Z28A 4I6GA 3B3FA 3L82B 2P27A 3KOOA 2E87A 4PVDA 1HDOA 2YVAA 4L85A 2WT9A 4XQ0A 2OXRA 3E22B 4LUCA 5K8LA 1M6VB 1J99A 1I7LA 3L6OO 1V9SA 4JJ4A 5IJXA 1I6MA 4C0SA 2BISA 3DE2X 1KORA 4EY6A 3MGCA 2Q3JA 3INRA 3L8DA 3PEFA 1ZNXA 5DI3B 3UXYA 1B3RA 3QVGB 5DIFA 1CERA 1LNZA 1YBFA 1LDMA 2VG8A 3O4JA 1HZZA 5AKJA 3WYAA 3AFNA 4DLRA 1NY6A 4OAQA 3JAMA 4HMOA 5K4AA 2K2WA 4B3DA 1I10A 4ZVOA 3UG6A 4GBJA 4JSRA 1OZHA 1ATIA 3A4NA 3EY4A 4G5XA 4PR3A 1MO3A 1VE9A 1FYEA 1N25A 3HUTA 4H7PA 2WHQA 4JGIA 5K3AA 4L5AA 3GL9A 3DFFA 4UOZA 3EZXA 2Y2VA 2XUIA 3ZHTA 2Q3HA 3TGPA 1A2OA 2OAQ1 2OV2A 5KTOA 2H08A 4P3NA 4D2IA 4BVLA 2FU5C 1H3FA 2OB2A 1Z8NA 3G9ZA 3OT4A 2G7MC 1NQAO 2BGLA 2JLRA 1Z5VA 2WZQA 3DOOA 4AO7A 1YJBA 4CEHA 2EJBA 5GJBA 2C3PA 4GU5A 2DXIA 3C7CB 1U2GC 2F8LA 3DXZA 4BCCA 4D8VA 4YUAA 1TKBA 2X0KA 1U8UA 3CTPA 4JI8B 1MAHA 1FYVA 1V3QE 4FB4A 3WYGA 3CONA 2FSPA 3PFBA 4Y6PA 5CVJA 3TZLA 1Z0FA 2WWIA 3VJMA 1PSZA 3CA8A 3HVRA 1W1UA 1UJ6A 5LMCA 1RMTA 4HV4A 2FW7A 5LXTF 1U7DA 2GPYA 2JIZA 3MTQA 3NW9A 4O2AF 4BVJA 1XRMA 4R01A 1XP8A 3LHFA 4B5KA 5WRFA 1MD9A 3HSSA 4ZYYA 3TIIA 4MVWA 3Q5DA 1WBDA 3BXPA 1ZW1A 1K6IA 3LVBA 5I8ZA 1CRPA 4IQ8A 4RQAA 4ZMSA 2PUAA 4YRJA 3EG9A 4YN3A 2BFFA 3RQSA 3RNOA 3HA7A 5EMNA 4HWRA 4OBBA 1DQYA 4E13A 4ZREA 5K03A 3GNSA 1DG9A 1MORA 1WKVA 4RD2A 1ZD1A 4P08A 4DNOA 4XDYA 2P8JA 5CIQA 3UANA 4BIMA 6GPBA 2GPNA 1L6RA 1USUA 1RYDA 2QN6A 2ST1A 3O8BA 2C5EA 2C99A 2B92A 2WSLA 3QFHA 4IAOA 4J1SA 2DULA 1WV0A 2IT1A 3OBBA 3S2FA 4KREA 3BILA 2Y76A 2C4MA 3BXXA 3JQ9C 2DT8A 3IP6A 1ZK2A 1P0QA 4IJUA 4LOKA 5EMJA 3WLJA 3N3AC 1TUGA 2P90A 3GEHA 5JNTA 1T5DX 5D01A 2WWYA 1A9QA 2HT1A 3RHFA 4TZ0A 3E8XA 2GHTA 4LZWA 2J5KA 2P65A 1PLJA 3A9UA 2Q6KA 3EF3A 4IWXA 4D4MA 1D4ZA 4NCNA 4G2NA 4M1OA 4LRSB 1KFKB 1Q0RA 1YB1A 3LECA 4Q1VA 5AHWA 1CUIA 4CQLB 1WUJS 2VDPB 2G08A 2Z57A 2GAOA 1T8RA 5EZYB 4F6LA 1TC1A 1X9IA 4V1CA 1XMSA 1RBYA 5IBCA 3FLMA 4PYOA 3N6RA 2VYND 4FMDF 3ZK8A 4CEIB 2YIJA 4MDFA 1LK7A 4BPBA 3QJYA 4IUCS 1K2VN 4NONA 1RI5A 1KJYA 2BFEB 3ZV5A 4I55A 1KYIA 3AF4A 4WQMA 3HJTA 3QOFA 4DSZA 1GU7A 3O9ZA 2ECOA 2I66A 4QVKA 5BNFA 3KJXA 3AO0B 3UJ6A 4GLJA 5JISA 2QBYA 2GWHA 2EKPA 1UFOA 4MVJA 2C20A 2ICAA 2RGDA 2WF7A 2XBLA 4FFBA 2M2IA 5JCZA 3F3YA 3BE8A 4JD5A 4PNHA 1PNVA 3WZ2A 3RBAA 3UMBA 4KO8A 5CDYA 3HJFA 3Q2KA 1KPHA 2A1TS 2W8BA 4JB2A 1N9ZA 3K3PA 1GDHA 1R0LA 2C96A 3VJRA 5IMSA 1N2OA 1Y8QA 4Z49A 3I1IA 1V5FA 3WBKA 1M66A 3ZDQA 4PG4A 4GOJA 1U1IA 1CUFA 1V8BA 1Z6YA 4B73A 1U0BB 4L6IA <