3RSLA

H-ras soaked in 90% r,s,r-bisfuranol: one of 10 in mscs set
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
156
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 58
structure length 156
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rslA00
3I8XA 2H92A 4JVNA 721PA 3A4LA 5F98A 1V43A 4M0LA 5H8WA 5TDHA 2ANBA 3D8BA 2WJGA 4TZ0A 3BJIC 1D6JA 5IDVA 2PEZA 3RLFA 2YOHA 1KYIA 1EG7A 4LJAA 2VF8A 1IJEA 2HF8A 1YZLA 2HYDA 1YZGA 5JBQA 1GL7A 4L16A 1EXMA 4URYR 4ZI3A 1E0AA 2ZUCA 1HE1C 3FHOA 4QKQA 2W83A 1IQPA 4FINA 3KKNA 8OHMA 2YHSA 5IK2A 3R20A 4OQMA 1PLLA 5JLJA 3DPUA 1JJVA 4Q1BA 1KO4A 1JPJA 3AKCA 2X1VA 2ZRNA 4M9QA 1Z0AA 4W9MC 5IF9A 3BFXA 1KK1A 1YU9A 1N0UA 2C5LA 1XEWX 1GSIA 4B2PA 2FH5B 2OXCA 1BOFA 4M2LA 4LV5B 1NIJA 1PUIA 2G1JA 4QC2A 4NYIQ 4B34A 2QG6A 2X2EA 2PZGA 3QUSA 1WBDA 3EG5A 2GXQA 2RGDA 1GRNA 2YNMA 4M1YA 5HTKA 4C0KA 1UKVY 4LYJA 3V00A 5KHOC 1R0XA 1Z8FA 1S0UA 1KI1A 2CBZA 3FE2A 3GFOA 5CYPA 5J4HA 4TMVA 3JZMA 4DLRA 1HURA 3A37A 3K70C 3NH9A 3E70C 4EPRA 2HCBA 4DCVA 4Q02A 5KDDA 1E9EA 3OEED 1CRPA 3L8ZA 4TT3D 1G8PA 4PQYA 1VYTA 1F2UA 4AWXA 2AFIE 4Q01A 5A5GA 1KSFX 1XMJA 4U02A 1G6OA 3WBKA 2NPIA 1JXOA 5G40A 5JI3E 2JCSA 2ZROA 1UKZA 1XEFA 1T0HB 1G3RA 2NO0A 2KBEA 4G0NA 2IS4A 1KTVA 4FMCF 4QFMA 5EUMA 1YZKA 1W4BA 3PV0A 4ILEA 4Q4HA 3R9IA 1RRFA 5GVRA 5CB6A 2WAYA 5K8IA 1LTQA 2ONJA 4QM7A 4ACAA 4DLYA 2OILA 2XZLA 4E09A 3EZ6A 5BN4A 4RZ2A 5E3HA 3SJCA 3TSOA 5SZHB 2W00A 3NBYC 1JEEA 1M6NA 4POAA 5TXGA 4RKFA 1XEXA 4YMUA 4YLGA 3PUYA 3FHTA 3AKEA 2GVDC 3BGWA 3I73A 4LJ9A 3TVTA 2OAP1 3ZVRA 2ZS7A 3VX4A 1UPTA 1S2MA 1QBKC 2IBMA 4FMDB 1OYYA 4QHSA 5KO2A 4ARZB 1NN3A 1DAFA 2NO1A 3EPJA 2ZS9A 3CLVA 3W9YA 4DLVA 3VQTA 1JR6A 1IONA 4EFLA 2QL6A 1XTJA 5FBLB 2YV5A 1Z2CA 4Z8XA 4JYBA 1H8EA 4A8JA 4RD1A 3ZIAA 4HATA 1T3LA 1W2HA 1XXHB 3FMPB 1VIAA 5FPSA 1NG1A 1GKUB 2ZANA 3GD7A 4QBGB 3RS4A 1IN4A 1MO3A 2QY9A 1TF5A 2ZSAA 2YINC 2DY1A 2D2EA 1K5GA 3FB4A 5CM8B 4HB2A 3K9NA 2ODNA 2JLRA 2PL3A 4AG6A 2GRJA 2F1HA 3KJGA 5KNDA 1ZNXA 1K6MA 2VBCA 3B1VA 4DLZA 1LNZA 4M22A 2R6CA 4HAWA 4A0HA 3HR8A 2EFGA 4DLXA 1T91A 2CK3A 1OXVA 2IXFA 2RGGA 3B9PA 3MWKA 4DDWA 1Z47A 3ECCA 1AGPA 1ZNYA 4JLVA 2XGJA 4FW9A 4OI0A 3EIHA 3Q5DA 3U7HB 1VCIA 4LOAA 2GAOA 2YWGA 4XVUA 3MWYW 3RS5A 2GXAA 3CUEF 2L0XA 1B0UA 3FOZA 2AWNA 2ZIAA 3NHAA 2P5SA 2PMDA 2VIIA 4JKYA 2J41A 4MGZR 2LKDA 3CX7A 3D3QA 1GNRA 4PO9A 3SR0A 4B43A 2ZRFA 2QGZA 3LBIA 3X1ZA 1Q44A 3QI2A 1NBMD 1G17A 4OI2A 2FWRA 2QM7A 3AKDA 3JVVA 5FUWA 2OXRA 1CXZA 1T5LA 3GEHA 3KUCA 521PA 4DZZA 3CNNA 2O0KA 1I4TD 1UF9A 1ESMA 1RIFA 5KU1A 2FGJA 2GBLA 2YYZA 4OYHA 1ZUHA 4O2RA 1Z0IA 5GJCA 3VU9B 1XBTA 4FD2A 5KNCA 3DZDA 1YKSA 4NBSA 821PA 1P2TA 2W2TA 4UXIA 1T0JB 1G7RA 1DO0A 4YC7A 5FTKA 5BYKA 4XWOA 4MKHA 4CEHA 3CW2A 4DLWA 3GFTA 1Z6GA 4RZ3A 3ADDA 3I62A 3Q7QA 1S8FA 5J4LA 4B3XA 3CONA 4Y0AA 2B6HA 5ANRB 4QGAA 3BB1A 4PSAA 3SI7A 1KAGA 1SKQA 1Z28A 5L3QA 1KO8A 4URUR 2EQBA 3CKLA 2NZ8A 2O8CA 3FPAA 4IHQA 4EJSC 2CCJA 3CNLA 4DSTA 4EAQA 2RKOA 3EX7C 2OCBA 1OXSC 2DBYA 4JLMA 2FSGA 2GETA 4JL8A 3AVWA 3PUWA 2KJQA 5D3MA 3FKQA 3C4JA 4B73A 2F7SA 1AS0A 1KI6A 1QG4A 1FTSA 4IDNA 3HPRA 1NLFA 4RD2A 1R8QA 3HR7A 2UKDA 4DRZA 2VHUA 3ZIAD 1XJ0A 1JPNA 1YR8A 3R7WA 2NMVA 3TUJC 3MSXA 4FN5A 4D4JA 4F92B 5JRZA 1A2KC 1GIAA 4B76A 4E22A 2AK2A 2C9CA 5BYJA 3R8CA 4YXWD 1DE0A 2QPTA 3TSWA 5LD2B 3K0AA 4XTCS 3BD9A 3QG5A 1U2RA 2IW3A 1II8A 3KTAA 2JLWA 2VRWA 2GXSA 3SYNA 3VMFA 1UKYA 1IN8A 1XWIA 3M6AA 2CNWA 3NEYA 4JSYA 1QHNA 4JL5A 4IFBA 2CVHA 1OKKD 1ODFA 2Z83A 4JT4A 5C1BA 2PX0A 2RGEA 2J9RA 4A82A 2OSBA 4US1R 3K0CA 1U8ZA 2J3EA 3N2IA 3QKSA 1YZQA 2ATXA 4US0R 2H57A 2JLVA 4K46A 1TQ2A 5EP3A 3BERA 2QENA 2VHJA 4P31A 1JJ7A 3RAPR 3SQXA 1CR1A 4G5SA 2BEJA 621PA 4AI6A 1XRJA 2G6BA 2BJVA 3CH4B 1XD2A 5BWMA 2CJWA 3GEIA 2NO6A 2QUZA 4TTRA 5G53C 1HY3A 3HU3A 3VTKA 1Z6TA 5BXQC 5JSZA 3Q3JB 4ON9A 1SVIA 3WNCA 3A8TA 1N6OA 2GZAA 2WOJA 5J47A 1QVAA 3A58B 4ZCIA 2QBYA 5KSPA 3U6KA 1JR3E 4I99A 2HLDA 4B74A 4PC3A 1TF7A 1Y3AA 5CIWA 3K0FB 1F2TB 2PZEA 2BOVA 1G64A 2ZSEA 4HLQB 3IIKA 3QKTA 3RYTC 4LGMA 5AUOB 3IPXA 1WF3A 3LNCA 1QHXA 1VHLA 1VYVA 4LJ7A 1KAOA 2OT3B 3T12A 1W36B 4Q9JA 3ZVLA 2WBLC 1DELA 4MGKR 3QPWA 3BS4A 2VP9A 1S96A 3GLGA 2QTHA 2ZE5A 4FXPA 2G1KA 2JLQA 1VG9B 2QTVB 3K0CC 2JLZA 4KFUA 4MYCA 4EPXA 1Z0JA 4Q9LA 2ZEJA 3K9GA 3IGFA 3TAUA 3C14C 4MRNA 1G9XA 4AIIA 4GP7A 5SZKB 4Q7KA 5J5CA 3KJIA 1XX6A 5AR1A 4OQLA 4EPVA 4KVAA 3AF1A 4LC0A 4RY2A 3G0HA 5SZJA 5J4YA 1QF9A 2CCGA 1R8SA 3N70A 1E2MA 4PQFA 3WMGA 2IHBA 3FTQA 2ONKA 4D25A 5TVKA 2X2FA 1PJRA 1DAHA 3DMNA 3LA6A 2ODBA 1VCNA 3P4YA 3DMDA 5EP2A 5K8LA 3EC2A 4PHHA 1VECA 2LWIA 5L3VA 4Q4JB 3U3RA 2C95A 2QGNA 4Q21A 1X3SA 2H17A 2W2XA 3BORA 4Q9KA 2J59A 4LHVA 4D82A 2IHYA 4KU4A 3PUVA 2CLDX 4HUTA 5DH9A 1PZNA 3P26A 1GKIA 3RWOA 1WA5A 4CDGA 1W36C 5IT5A 3TUZC 5AJYA 4TL9A 2AFHE 1XCPA 2PLFA 3A4NA 4NDZA 1XNJA 3L0IB 5JWHA 1OFHA 3T1TA 4WXRA 4EJSA 2GDJA 1IM2A 1COWD 3EARA 4I1VA 4E5UA 2GK7A 1KY3A 2JDIA 5HPYB 5KPJA 3GLGB 4MDEA 4MQBA 3BFKA 3WYGA 2F9MA 3CPJB 4PO8A 4EFNA 1F2UB 3QY0A 1NNEA 1Z0FA 1N3BA 1E2PA 1FX0B 1MO5A 3NVAA 3LWNA 2WWYA 4A8JC 2YWHA 1SXJE 2F6RA 2FGKA 2PEYA 2WJJA 5E7JA 5FPYA 2BM1A 2OUKA 5LPNA 1P2VA 3EW9A 1J8MF 1J8YF 4BFWA 3MWLA 3EWAA 1E9SA 4C2TA 1A5TA 3RC3A 2MMCA 4NYIR 1VYUA 3NC0C 4Q4HB 5JEDA 1XEWY 5FR1A 1T6NA 1CTQA 1E0SA 1SQ5A 3OAAA 1H8HA 3TR5A 4C0LA 3A1TA 3OE7A 4R98A 2Z4RA 4D0LB 4EPYA 5HR5A 4G5RA 2GK6A 2VH5R 4F38A 2JEOA 4P3YA 2QI9C 4OHXA 2C04A 2ZJ8A 2ORWA 5DHFA 4PO1A 4YMTA 4HLUC 4Q9IA 3KQLA 1F6BA 4ZIRB 1XD2B 4NCKA 1XTSA 3AV0B 4YQFA 3FVQA 1JAHA 1FL9A 3GLFE 3W6PA 1GL9B 4QBHA 1LS6A 4ZCLA 4MRRA 3I5XA 2DPXA 3H86A 2IL1A 4LSGA 1XCMA 4B6FA 3AVQA 4BLPA 4CT4B 2OFOA 3TJZA 3B1ZA 2GJAA 5AJVB 1VG1A 1NMXA 3TNFA 5HKKD 2VP0A 2NO9A 4GNKA 4L9SA 5TB5A 1XB2A 1DEKA 1JB1A 1IXSB 2C9YA 2WIBA 4PSVA 3W5JA 4HAVA 3RABA 1G7CA 4DCTA 4AKHA 2W6ID 1EWRA 4DT1B 1BO6A 3LXXA 2NZJA 1YR6A 5EXXA 1G5PA 4JZKA 1P72A 3ASZA 3HYRA 4HI0E 3UMSA 2YWFA 3NXSA 2FFQA 3JZAA 3WHKA 3R7WB 4ERNA 5HZHA 2QP4A 2XSZA 1NSFA 3TAHA 4ARZA 1OH8A 1TUIA 4JIMA 1G7TA 1ZC3A 3AGQA 2ZI4A 1SVOA 3GJ6A 3MRSA 5CB8A 2GCOA 5TARA 3HWSA 1X8JA 1XMSA 2WZQA 2ZSFA 4FMBB 2XOKA 1EK0A 4KFTA 1AQYA 2W6JD 4R2IA 4YONB 5FOSA 1DAIA 1NBMA 5FPKA 3BWDD 4XWAA 4LI0A 1UAAA 1E96A 1UBGA 4V0NA 5IRCD 4UNNA 1A4RA 3MD0A 3SJBA 3LDAA 4JBWA 3K0EA 2I1QA 4RZUA 1Z2AA 2CNWD 1HUQA 1NJGA 1VPLA 4TSFA 5TV2A 5JS8A 1T3HA 1NKTA 4TYPA 1X6VA 4GSYA 3WNBA 1U98A 3CB4A 3VR6A 4HLCA 1Q1ZA 1TPZA 2BHRA 3SYLA 1OFTA 5LD2C 2K5UA 4M4SA 1EFCA 4HDCA 4TTQA 4CEHB 1KJYA 2PBRA 5DSZA 4DDVA 4MUBA 4DDTA 1P61B 2ZJ5A 3QOFA 1X86B 1VIYA 4RD6A 1WBBA 3EPHA 3UATA 2GBLC 4Q4AB 4Q47A 3HJNA 2AX4A 3RDPA 5B58C 1J99A 2J7PA 3R9XA 3FMOB 3ZQJA 1E79D 4AD8A 1E2KA 2HJVA 2RGAA 1QVRA 1F60A 3IQXA 1W4CA 1LS1A 4KV9A 1XJQA 1EFRA 1J70A 2C98A 4UKDA 4AC9A 3ETLA 3CNOA 3QVVA 4C30A 1M7BA 2A5DA 1US8A 1N5IA 2R2AA 3QXSA 4B48A 3ICEA 4GFDA 3H84A 1SKYE 2FF7A 1SZPA 3K09A 5AWFC 3ZJYA 1G3IA 4D4KA 1A7JA 1ZUNB 4EIWA 2DHRA 1P73A 2VQSA 1OSNA 1P75A 3MJRA 1T4GA 1TQ6A 4C7OA 2BBOA 4L9WA 4MKIA 1DG3A 3BH6A 1KMQA 1D9XA 2GNOA 1R5BA 2D3WA 2D74A 4TQAA 4AURA 4FWTA 4NCHA 3SFZA 2PLRA 3VR4A 1N6HA 1U90A 2JJ2D 2W2VA 3CPHA 2QSYA 1E1RA 1IXZA 1NJFA 2I4IA 2NQ2C 2ZJ2A 2IYVA 1RC8A 1G8GA 1G21E 3EA5A 2F55A 3ZH9B 3CRMA 1OKKA 4RSGA 3T61A 4HDOB 1EWQA 3W8NA 3GLHE 5C2JB 3DOFA 2QRZA 4OJKA 3WMFA 3PITA 3F3YA 2ORVA 1W5TA 2JLXA 1FZQA 1OXTA 3LFUA 1YR9A 2V6IA 2WWIA 2ZR9A 5J4KA 4TMKA 3PUZA 1E9BA 1MT0A 1QHIA 4KO8A 4CRWB 1Z63A 1R10A 2P67A 1VMAA 2OBNA 3LLUA 1Q12A 4GOXA 4W5WA 1FMJA 2NOAA 5FOXA 1E2JA 2KB0A 3FMFA 4HB3A 1DOAA 1N6RA 4KLZA 4GMDA 1KI7A 2QMHA 4BGDA 1CF4A 4L4UA 2W0MA 4M21A 1NSTA 2J0UA 4XWKA 1Q1BA 5E7IA 2WWFA 4NYMR 2O8FA 4GL2A 3MLEA 1WB9A 4NKRA 1TX4B 1Z83A 4XH9B 1LFDB 3QEOA 2F9LA 3SBEA 5DI3A 1KIMA 3K9LA 4JJKA 1AIPA 1Q0UA 1HH4A 4UNQA 3MUFA 4DC9A 4URXR 121PA 5EZ5A 2F1IA 1IBRA 4B32A 1FP7A 2NGRA 2J0UB 1G19A 1T9HA 2C9OA 2QQEA 1W0KA 2R6GA 2R8RA 3HP1A 5FL3A 1P7CA 2V9PA 4E03A 1DAEA 2W6IA 4GOKA 4XSHA 4D0NA 5GJWC 3RWMB 3EA0A 1OIVA 2FEMA 4BASA 5L3SA 1ESNA 3EIEA 2J0VA 4KAXA 1IOZA 3AP3A 1KK0A 2F43B 5B57C 4RD0A 5FBQB 5KOYA 1G20E 4D80A 2DFKB 2IEYA 2A2ZA 5F9HA 4LV6A 3FHCB 3OAAD 3T1OA 5CITA 2AKAB 1EESA 2IT1A 3SHFA 1ZVQA 1ZC4A 2QT0A 4Q9HA 1KMHA 1BH2A 1WE2A 5JWOA 2OM2A 4RKEA 2V1XA 3FDIA 4OQFA 4FCWA 5CM9C 2CHGA 3WHLA 1QHSA 3AH8A 1MV5A 3L0OA 5EP1A 5FFMA 3WRYC 3GJ7A 4K8OA 1CJMA 1TUEA 3U61B 1GFIA 3LQQA 4TLCA 1Q22A 4P4TA 3TRFA 5KDOA 2OE2A 3H1TA 5M04A 3C15C 5C4GB 1G3UA 2XTMA 2N1BA 4C0HA 2IYYA 2BBWA 2P6NA 3QIAA 2GAAA 2AXNA 2ZXUA 4A4DA 2EWVA 3BOSA 1SVWA 4JJZA 2IYWA 3W34A 4PTLA 1E9CA 2BKUA 3CM0A 3W3ZB 1GG2A 2P5TB 2DFTA 2ZE8A 5IK2D 1RPZA 3IUYA 2GEDA 2IEZA 4Q1CA 1AN0A 3B2EA 1US8B 4MUAA 3RC8A 1RJ9B 4C7OB 1OB2A 3T5GA 1M34E 3U3JA 2CL6X 3IIMA 2H1LA 4PR0A 3E2IA 1ZCBA 2P6RA 1ZD9A 1FUUA 2AXPA 1I4LD 3L2OB 3CX6A 3M0EA 2WKRA 5AUPB 5EXPA 4II7A 3WXMA 4A0RA 3Q85A 3L0SA 4HSEA 4US2R 3IKJA 3HU1A 1ZU5A 3DO6A 5EE1A 6Q21A 1HV8A 2AKYA 1IAQA 2J1LA 2EFHB 5GADl 1GRRA 2B92A 2DCUA 3MGCA 3LW8A 1W5SA 1E94E 2QMUA 1J2JA 3J81k 2HF9A 1U9IC 1L2TA 1YE8A 2XITA 1D8TA 3TIFA 2ZRGA 1ZW6A 1NBME 3TKLA 2ODWA 2ZRJA 3EXAA 4ZDKA 1OW3B 3DM9B 1W49A 5L8VA 1QG2A 4B71A 2I3BA 4PFSA 1P5ZB 4DVGA 4PPNA 3LVQE 4BZPA 3X2SA 1W4AA 4IEEA 4M8NE 1DBSA 2CE7A 3ONWA 2DWQA 4L15A 2Z0MA 4A8JB 3REFA 1Q1QA 4Q4LA 3HPQA 4QXAA 3GLHB 2ZRIA 1RRCA 5KUTA 3CX8A 1UDWA 4NE2A 2VYFA 4UNPA 3H4MA 4R7ZA 3KQKA 3B6EA 5CDFA 3CRQA 5HE8A 2ZR0A 4G1UC 4TLEA 3QJYA 4FMDF 4LPSA 1P9NA 2D06A 2IS6A 3A36A 3GEEA 2WMOB 4QBFA 4LRWA 3LVRE 3GLFA 3B60A 3QE0A 1R5NA 4Z51A 4KJZA 3GMTA 1M1YE 2J45A 1D5CA 3IBGA 3QENA 3REGA 4BLSA 1QHGA 3C5CA 1N6PA 2NO7A 4YXWA 4G3XA 2ZTSA 3LH5A 1JXMA 1WCV1 1CJTC 4PZLA 1SXJC 1UM8A 2ORIA 3A4MA 1W2GA 2G88A 3GJ4A 3KXLA 5FR2A 3W6OA 1TTTA 1KK2A 1D2EA 1SGWA 1Z08A 2MSEB 4UJ3A 2WWHA 2CL7X 4F4IA 2B7BA 2XEXA 3CF2A 4HAYA 3RSLA 2W0SA 4FMCB 5DI9A 2GXUA 4S2EA 3LW7A 4ZDJA 3K9HA 5DISB 1BYIA 1XZQA 2Q3MA 1N5KA 1Z29A 3OIVA 2BM0A 4KSCA 3Q7PA 3GJXC 3U3OA 4TYQA 1RRGA 1G7SA 4KITB 3KQHA 1ZRHA 3EASA 2WSSA 3KL4A 4ZPXA 2FG5A 3FFBA 4K81B 3L0PA 1E99A 4MGYR 4Q5IA 2O8BA 2GJSA 2QAGB 3CRVA 2CJWB 4WA7A 4Z8YA 1I2DA 2B21A 2QAGC 3VHLB 3AP2A 1ZU4A 4LYFA 1JR3A 1ZD1A 3DOEA 1KDRA 2DFLA 5EE3A 2NIPA 4B6EA 2YC4C 2PX3A 2G0NA 4JLJA 4P4SB 3MFYA 1CU1A 1OPXA 2QE7D 5FTJA 5DNYB 2Q3FA 2ZJOA 1OFIA 1D2MA 2D4HA 3T06B 3QF4A 3L82B 2JJ1D 3K1JA 4TQ9A 1CULC 3ZGXA 3GLIE 4IDOA 2IA5A 3DKVA 3NBFA 2V8OA 3BE4A 4OK3A 5AJWA 1G3MA 2MSDB 4MGIR 1VTKA 4M1WA 4OJQA 2ERXA 4QJ4A 4RD4A 4YMWA 1QDEA 1UBFA 1VCOA 5KNBA 2JASA 3VKGA 1G4UR 1E9DA 2CL0X 3G5UA 3QVUA 2RGNA 2BKEA 2O8FB 2O8EB 1SVLA 3QPVA 4PXAA 5GJVC 3AVXA 3SNHA 4V0ME 3PENA 4DIEA 1YZUA 1E4YA 1YR7A 1L7VC 1VG0B 4XVRA 1OH6A 3AUYA 3WRXC 3QSYA 3M1IA 2BMFA 2BWJA 1ZM3A 3KFXA 2WPDA 4IXNA 5JCPA 4TMXA 2GZDA 4LV8B 2J0SA 5EQTA 4P4UA 1CS4C 2RHDA 2ERYA 2VPPA 1KNXA 1MH1A 1XTIA 1T5IA 1R0ZA 2FE4A 4W5HA 3WNDA 1Z6YA 2GILA 2JGNA 3C5HA 3X1XA 2V55B 3AM1A 221PA 3HU2A 2WKQA 2WJYA 2B7CA 2X77A 1E98A 1XPOA 2PJRA 3PXGA 2OG2A 4Q7JB 4D0GA 2KSQA 1FQKA 5CK4A 4A6PA 2CHQA 5CLLA 3IPYA 3IO3A 4JVSB 2RB4A 1UADA 1OIXA 4KFRA 1LW7A 1FTNA 2HCJB 4WZBE 3SN6A 5J4VA 1GVNB 3GLHA 4QHYA 1XD8A 2PT5A 2YOFA 4IOMA 4OHWA 4C0QC 2RGCA 3U5ZB 2ZI6A 2RAPA 2QT1A 3O8CA 1DG1G 4RJLA 4LC1A 4XD7D 2XJ4A 1CR0A 2F1RA 5JEEA 2XZOA 3O47A 1P4SA 3A1WA 3TW4A 3THWB 4JT2A 1NP6A 1GP2A 4S35A 1KSJA 4NP6A 1UJ2A 3CO5A 3ZVNA 5FBWB 3EZ2A 5HCNA 4NYJR 1X1SA 2JDID 1Z22A 5EP4A 1ZINA 3RS0A 2FNAA 2ZREA 3IIJA 5JWRA 3UWOA 3TMKA 3ZLJA 2WJHA 2J5XA 1Z6AA 1JR3D 1KI4A 2GEVA 4D4MA 4DIDA 4EQ6A 4DCUA 1F48A 4C3ZA 4J0QA 3W5IA 2BMEA 3QKUA 4I1SA 4B3GA 1IY2A 5FOWA 2WOOA 2ODEA 1DAGA 3H2YA 1CBUA 4L5BA 2A5JA 2QTFA 2Q9BA 4BZQA 1R0WA 5FUVA 3TK1A 1OJLA 3OE7D 3T35A 3M4YA 5KSZA 1OYWA 2QBYB 2OHFA 1ZIPA 2PT7A 2ZYVX 1XMVA 1W44A 2O8DA 2IC5A 3LX5A 3UIEA 2JATA 5P21A 3PCRB 3EPKA 3PR1A 2B8WA 1AGRA 1E2EA 1C4OA 1LB1B 4KI0A 1FP6A 3CIOA 3KTAB 2HDNB 1JALA 3C16C 4JLBA 2FU5C 2Z4SA 4BFTA 2CEAA 2VTKA 5DYIA 3U2QA 4FI3C 4HZUA 1NL3A 4AKEA 4JVMA 4NYMQ 4JL6A 2QU8A 4LK2A 4GP6A 1M2OB 4NH0A 1MR3F 1HTWA 3LX8A 4GPTA 1XCGB 2FSHA 2FFAA 5KYKA 3CWQA 1ZIOA 4ESHA 3AQ4A 5KSYA 3AF4A 4BRWA 1TNDA 2REXB 1EFTA 3OHMA 4AG5A 4CW7A 1NLYA 5FI1B 1W0JD 1C9KA 2WMNB 4HUQA 4I1OA 1E2IA 2Z6VA 4G01B 3OEEA 1K8RA 3QG1A 4TT3A 5EZ6B 1S3SA 2CVFA 2ZYWX 5CDFE 4QNRA 1VG8A 1JNYA 5EXTA 3KB1A 1WQ1R 3VR1A 2DR3A 2HEIA 5EJEA 1AM4D 1UKEA 2HV8A 2GJKA 3T5DA 5CK5A 3T1QA 3EZ9A 1HEIA 3ZZUA 2Q0HA 2GJ8A 2ZVPX 2ZM5A 1U0JA 2IUTA 3SU8A 1WP9A 1DAKA 4TYYA 1ELOA 2XNDA 4IW3B 2AN9A 4N0DA 1J7KA 1Q3HA 2GTPA 1NY5A 4JVLA 2ZI7A 4LDJA 4LYHA 1KSGA 4JLPA 2WHXA 4OQNA 4ZDIA 2O5VA 2ZYUX 1KJZA 5J40A 5H68A 3V4RA 1E2LA 4XTRA 2XNSA 2HJGA 2OESA 1FFHA 4TYWA 1ZBDA 1E2HA 2O8CB 3BBPA 2GHIA 1ZM7A 4LUCA 4Q18A 4AYXA 2I1VB 3UXMA 4HYYA 4RCZA 4LY6A 4ZIRA 2D62A 2BDTA 4B3BA 4Z1MA 4DLUA 3UWKA 2P0EA 2QQ0A 3LQRA 3FFAA 3THXB 1TEXA 1KZ7B 2FFBA 3F5FA 2WSSD 4P32A 3N2EA 3GP8A 2H5EA 4IVQA 1F3OA 4DCNA 3WY9A 3NBZC 2RGXA 2MSCB 3U6BA 4P4SA 2GKSA 4KYIB 1RE0A 2YOGA 4N3NA 3MAAC 4R9UC 4ZKEA 4C0JA 1OXXK 1NN1A 5AK0A 2JLYA 2JA1A 4UNSA 1E32A 2IYTA 1S3GA 1KO5A 1F5NA 1U94A 2XZPA 1MO6A 2IYUA 1JECA 1Q21A 3I3SR 4EQ6B 1GUAA 2VHCA 2YVUA 3UMRA 5FTLA 3NIBA 1KDOA 3FKSA 3UPUA 1DARA 3U7FB 2DB3A 1OF1A 1FQJA 3GJ8A 3I61A 5DYGA 1MO4A 5JSZB 4CIDA 4MA4A 1YZTA 4NPHA 1BKDR 4TYNA 2OO7A 2HUPA 2WSMA 3Q9LA 1ZM9A 5AJXA 2IUUA 5GVSA 2EW1A 2OLJA 1KO1A 5B64A 4MYHA 3SEAA 5EE5B 2ZUBA 4IDHA 4WW0A 1N6NA 3RHFA 5CYOA 1P2SA 3KJEA 2E1RA 4L8GA 4N1AA 3QQ5A 4URVR 5C18A 2GEUA 3K70D 3SZRA 4IOKA 4U7DA 3I32A 2E9SA 3P32A 3ZQ6A 1E69A 3ADBA 4M9SA 1BS1A 3PEWA 1E2DA 4CGZA 2ZJZA 1II0A 4QJ5A 3KXKA 2OAQ1 3AF0A 3VHXA 4U5XA 2R6AA 1XPRA 1OLOA 2ZRAA 3AVUA 2PCJA 3C7KA 3E5HA 2A9KA 3ZZ0A 4LJ5A 1VHTA 1KK3A 1CJUC 1PLJA 2FPLA 4WAUA 2J46A 1W1WA 4HLUA 1OH5A 2VSFA 4F93B 2IYQA 1HT1E 1NVVR 1SXJB 2N42A 1CLUA 1XXHA 1DPFA 4MYTA 2FPMA 1RYHA 4FIDA 1RJ9A 3BFVA 1RKBA 4NCJA 4BECA 3L43A 4DXAA 4TZ6A 4V0OA 3W90A 1Z0DA 3BAFA 2O8BB 1RFLA 3IILA 5KPDA 4MRSA 4CYMA 3B8HA 3WBJA 3GLGE 3K70B 1DADA 1TAGA 4BFZA 2XAUA 5DIFA 1TF2A 4Q66C 2QE7A 4NU0A 4H1UA 2FPKA 5C46F 2IYSA 2OCAA 3W3AA 4KBFA 3UG6A 2E87A 2XX3A 1YQTA 1VCMA 4AYTA 3GFPA 1KKMA 2XOKD 1KZGB 2ZRLA 2OEPA 4PANA 2ZRPA 4DUGD 2AD5A 1NVUQ 4DBLC 3ZS9A 4GT1A 2FV8A 5FL7D 3QEJA 1ZP6A 3SHWA 3KKPA 2ZRHA 3GJ3A 3RRNA 3A1UA 2WJIA 4HZIA 4I81A 2PCLA 2BBSA 3O8BA 4O0MA 4QOSA 4D81A 3ZVMA 1A1VA 3DZ8A 4OHYA 2DWPA 1N0VC 4LWZA 4M9ZA 2OBMA 3MCAA 2ZJYA 4RCYA 4ITRC 4NHOA 2ZRKA 3I72A 4QGGA 2JIZD 4OK5A 1RZ3A 3U7EB 2IYZA 4RZXA 4C4PA 2PJZA 2RGNC 3KDSE 2QRNA 4X8MA 3I4LA 2V54A 1M7GA 2CLCX 1G6HA 1NVVQ 1ANKA 5L3QB 1J90A 4AKIA 1G5RA 1OIWA 3AB3A 2AL7A 1Z6XA 4JSTA 3I1FA 2KI5A 3T34A 1CJVC 3B1YA 2FN4A 3NC1C 2FX3A 3U44B 3KKOA 3FYHA 3QBTA 1QRAA 1HA3A 2OLKA 4DDUA 3OZXA 2ZI9A 4PSKA 2V7QD 2G9NA 4XD7A 1MRNA 2ZS8A 1SHKA 1I2MA 2BMDA 2WKPA 1SKYB 1CEEA 4V02A 4KODA 1AZSC 3AVPA 2BVNA 4B44A 4Z1MD 3ZD7A 3CPEA 3KQNA 1B23P 3LO5A 3UANA 4UQOA 2QAGA 1IJFA 4PHGA 4QHTA 1FOEB 1S9HA 2Q9AA 4V0LA 3SE0A 3UK6A 2N46A 1WDTA 4D26A 2WWXA 2WVJA 4DWJA 3LRPA 2C77A 4IKEA 3D7MA 1N5JA 3TGPA 4A92A 2CMKA 1E2QA 1WXQA 2ZRDA 3LY5A 4IRUB 4HAZA 2BMJA 4EPWA 5IHPA 1KGDA 2GF0A 1Q3TA 3IHLA 2GVZC 4H1VA 2CHVA 5GJBA 3MJHA 1S9DA 4URWR 2IF0A 2CCKA 2QROA 4GI7A 1CP2A 4LBWA 2IF2A 2YZ2A 2VP4A 2XNDD 4Q4AA 2IWHA 4AYWA 3ADKA 3IEUA 3EAQA 2VA8A 1ETUA 4KXFB 3RSOA 3QXXA 3WYFA 2ATVA 1AA9A 3B1XA 4NYJQ 2WWWA 4F7WA 5FL7A 3CR7A 4V0KA 1EX6A 2D7DA 3E1SA 4YDSA 4C0SA 5FUYA 3GLFB 1Q1EA 1DS6A 4BLRA 1NLZA 3D6TB 4TLDA 3PQCA 2HT1A 2ZYTX 3X1YA 4CEIA 1R5OA 3W6NA 3IDQA 4B33A 3B82A 4PX9A 3U60B 2QMOA 3CWZA 5CJ2A 2AWOA 3P20A 4CEJA 5JHGB 1ZUIA 2GESA 3CBQA 5AUQA 2PZFA 2WWGA 1AJEA 1G8YA 1ZNZA 1W47A 2ZRCA 4HLDA 1GRQA 2XTZA 5TMPA 3R9WA 1SULA 3KX2A 2XTNA 4EJSB 2J7KA 2ANCA 2P3SA 3CZQA 3THOA 2QEQA 1Z3IX 4QNMA 1KI9A 1R2QA 1S4QA 4Q03A 3RNLA 4UJ5A 3UKDA 4DSUA 4KCGA 4PC1A 3P4XA 1GNQA 4EFMA 5JS7A 1E2FA 1N5LA 5HZKA 1W0JA 3PEUA 4NCIA 5E95A 1AKYA 1W0KD 4IVRA 3THWA 4JMPA 3ADCA 5KDLA 2ZVQX 4UXJA 1M8PA 1O3YA 3KQUA 1PLKA 2GA8A 4GZLA 5B30A 2VEDA 3TLXA 4ESVA 4LHZA 2IYRA 4ZO4A 3IEVA 1GOTA 3EZ7A 1CR2A 5JJIA 3VR5A 3FKSD 1R6BX 2VLIA 1NMYA 4A15A 1G1MA 1XTQA 1NY6A 1U8AA 1OHHD 3DVLA 1W4RA 4BFXA 4QRHA 2J87A 2NPFA 1II9A 1GM5A 5L3RA 2FZLA 4GDFA 3EPLA 3VAAA 4HEJA 2DYKA 1AS2A 3Q8XB 4KFSA 1NRJB 2YWEA 2IX3A 2F3TA 1AK2A 2FOLA 2QM8A 1FUKA 2G0TA 1T3SA 4YDHB 5HCIA 3SJAA 1FNNA 4F4CA 3GJ0A 3FWYA 4P33A 2QA5A 5CIQA 5G3ZA 5BW8A 4LPKA 2D7CA 2ZI3A 1GDDA 4C2UA 3QKSB 3TW8B 4V03A 2YC2C 2B8TA 4TN1A 3QKRB 2UZ3A 2A5YB 5AJZA 1U0LA 1NMZA 1QHHB 3S1AB 3KUDA 3VR2A 4DT1A 4PAMA 4LJ4A 4URZR 1N6IA 3A1SA 1OH7A 2GCNA 1EFUA 2C78A 1YRAA 4DKXA 4LYAA 3NEJA 3HDTA 1KNQA 3WYAA 1O87A 1U81A 1LF0A 4WXPA 2REOA 3SYKA 5BN3A 4TMWA 5FPHA 1BMFA 4HDQB 3TE6A 4P0TA 1NN5A 4TLAA 3CH5A 4Q1DA 2O8DB 3NDBB 1SVSA 3ND8A 1CIPA 4BUJA 3D31A 1EGAA 3L8YA 1RW4A 1P9RA 2F1JA 4EKDA 4LBVA 1KKLA 2RH5A 2JJ8A 2JAQA 2ZU6A 4M9XA 1G16A 3BB3A 1ZM4A 1VKJA 3MMPA 1HE8B 4AKGA 2BEKA 3R8FA 1KY2A 4LHXA 4M1TA 2QP3A 1NIPA 2W6JA 3U7GA 4RD3A 3AF2A 4OI1A 2A30A 3ZYCA 1C1YA 1MOZA 1Q57A 2Q9CA 3NDPA 4QBIA 4XVQA 3LAWA 3AVTA 4IEIA 2F3RA 4TL6A 2ZSDA 1S1CA 3SOPA 4IDPA 1YHNA 3KJHA 1E2GA 1NVXQ 1G8HA 4Q00A 4XIGS 5JI2E 3CRW1 2CK3D 1KI8A 2EFCB 4DHEA 3SQWA 2AHOA 4DLSA 2J0QA 1T8TA 1II8B 1UEJA 5JRJA 5LB2A 1NKSA 2WM9B 1HT2E 3RANA 4PC2A 3K0AB 2HXSA 4QGHA 2OCYC 4Q48A 5F3WB 4E07A 2FMXA 2O0JA 1TU4A 4O3MA 3OIYA 5FOUA 1IY0A 2QP9X 4IXMA 4X8LA 4CT5A 4PPGA 1G291 3PIRA 2P65A 3K09C 5LDDC 3TBKA 4WBSA 2OFXA 3AUXA 4ASUD 2OFWA 3NWJA 4MH0R 2ZAMA 5DGXA 1IN7A 1G5TA 2EVWX 4OKSA 1IHUA 1X8LA 2FSFA 3NH6A 5EE0A 4HB4A 3UMFA 4ABYA 1MKYA 2HT6A 4GOJA 3SDZA 4HAUA 2ZRBA 2FDCA 1SXJA 4LJYA 4LX0A 3SFVA 3I5YA 1TU3A 3WP0A 1TADA 4DLTA 5KTYA 4DEXA 3Q72A 2EU8A 3THYA 2RGBA 1N6KA 1D2NA 2V7QA 3QPUA 4H9GA 4LBYA 2QNRA 2REBA 3QXCA 4UXHA 3AF3A 4Q7MB 2BBTA 3VR3A 4A0GA 2WPDD 1ZJ6A 5LB4A 3CR8A 2PMKA 5HE9A 4M1MA 4A2WA 1E3MA 3BH0A 4ZCMA 2HYIC 2LKCA 3B13B 4Q7LA 4NONA 4KVGA 1F2TA 3BH7A 5DO9A 1MABB 5DHAA 5JZVA 2YKGA 5G3YA 5CLQA 4QGFA 2J7PD 1Z06A 1JQJC 3B5JA 2EFEB 3VNVA 1EX7A 5E7MA 2RCNA 1CKEA 4A0FA 2WAXA 2XJ9A 4LZZA 1XMIA 4HAXA 1N0WA 2AD1A 3B78A 2XB4A 4MITA 2RHMA 4A1FA 1E9AA 3PVSA 3QNUA 1EFRD 3T15A 4A2PA 2R44A 1OB5A 4G5GA 4JKIA 2LCFA 4BLQA 1I4DD 2C03A 2IK8A 4Q1FA 2JJ1A 2HXYA 2R9VA 3KKMA 4MRPA 5F9FA 4Q19A 1W48A 1W36D 4QG7A 5CJPA 1HQYE 4JLAA 3THYB 2KBFA 3PFIA 4A2QA 4XSGA 1FMLA 4B47A 4MKGA 4JBXA 3WMEA 1BYUA 3BRWD 4GRAA 3U3KA 4C0AC 4B35A 2OZEA 3BK7A 2VSOA 1IN6A 2FZ4A 1E1QA 4IFEA 2WV9A 4W7SA 2O8EA 1XP8A 1XD9A 2H8KA 2OBLA 3AVOA 2IS2A 2H7VA 4CVNA 3GLIA 2EYQA 4ZV4A 1E9FA 4M1OA 421PA 4BLTA 1NG9A 4YMVA 3OF5A 3K8YA 1GTVA 2NG1A 2QSZA 4ACBA 2VSXA 3OEHD 1OT3A 4RFVA 3CF6R 2Q3HA 3F0TA 4PC7A 2DFNA 1KO7A 1L4YA 2O52A 5FUXA 2YJTD 3THXA 4BFUA 5FOTA 4BEBA 1P60A 1QHHA 1Z5ZA 3KB2A 4RFSB 2A7QA 2SHKA 4JLNA 3I92A 4AY2A 2VHTA 4DEYA 5KSOA 3ZDQA 4BPBA 3ASYA 2EWWA 4GMXA 4JLOA 3CZPA 4OQXA 2R6DA 5SZIA 3AVYA 2VHQA 3I8SA 4PZYA 5DN6D 4B3DA 1FX0A 1SXJD 1SVMA 3AP1A 2GCOB 4Q4JA 3SBDA 2V4ZA 3LBHA 4M53A 5EXSA 2F43A 5D3MB 4FCVA 1BMFD 5E4FA 1RYFA 4JYCA 3TH5A 1A82A 4G5OA 1E9RA 2A78A 2BCJQ 1A2BA 1NVWQ 1XDBA 1KI6B 1FPMA 1XF9A 4RFSA 1AS3A 3K53A 3SJZA 5A4JA 3B85A 4PZZA 1TMKA 4HZUB 2C2HA 3A6PC 1LVGA 3OFND 3TSZA 2WICA 3RRZA 2CXXA 1JBKA 3ZS8A 5F2EA 3RS3A 1P6XA 4OI4A 1COWA 3LXRA 3MWJA 2IXEA 2VP2A 5DI3B 4EDHA 3QXHA 3GJ5A 2MMGA 4O25A 1Z0KA 1XZPA 3ND9A 4B3FX 4LBZA 5FH9A 1TQ4A 4FWIB 3KZ1E 3GLIB 1VDZA 4DB2A 3RRYA 4JLDA 2H18A 3B1WA 4WIAA 2ECKA 3TVDA 1UBCA 3F8TA 4RVCA 2FEOA 3UG7A 4HUQB 1GWNA 1GZSA 3SS8A 4X8HA 2A5FA 4I4LA 4PHFA 3NHBA 3KFVA 4NTZA 5B2ZA 4B2LA 1R7RA 5AUNB 3PJRA 2RMKA 2WIAA 2JLSA 5JMTA 3NG1A 3PUXA 1ONBA 3DM5A 2JLUA 2FFHA 2GJ9A 3LBNA 1JI0A 1P9WA 4NCNA 4TMZA 4KHZA 3WP1B 1KI2A 4N0EA 3V9PA 3QF7A 1KI3A 1GL6A 5DLQC 3TQFA 4AK9A 3TQCA 3IQWA 2BIFA 4A6XA 3S1AA 1Q20A 1ZCAA 2TMKA 4LHWA 3X1WA 1GITA 1SHZA 1GKYA 1AKEA 1ZAKA 2GZHA 1PVOA 4B2IA 4BZXA 2QORA 3GPLA 3OESA 1RRPA 4OK6A 1UDXA 3VU9A 1E0KA 1OHHA 4ZKDA 3SC3A 4B75A 3PEYA 2BJWA 1L8QA 3AGPA 4PPQA 4XOIA 5HKKA 1N25A 4LCBA 4YMSA 3FGNA 1WRBA 5FBRB 4BFSA 2Z5FA 5FPTA 4D6PA 1ZNWA 1ZYUA 2D2FA 2QPOA 1G41A 1G3QA 5EUQB 1DTSA 1EFHA 2CE2X 1TQDA 3LD9A 1GAJA 1DAMA 1YZNA 3PEVA 5JJKA 3LV8A 1AQUA 4Z54A 4JLKA 2XXAA 4M1KA 1AZTA 2IYXA 4D2IA 1WMSA 1P3JA 1U99A 3KKQA 3LLMA 2ZUDA 1M74A 5BQ5A 4R2HA 4I1UA 5JFGA 4KYUA 3X1DA 4ZI2A 2A5GA 2FJUA 3V4FA 1LY1A 5G41A 4DSNA 1YRBA 4JBYA 1RVDA 2WTUA 1UEIA 3U4QB 4NMMA 2FSIA 1MABA 3NTUA 3BC1A 1V5WA 4A9AA 3OFNA 2XB2A 2GWHA 4CZ2A 4LJ8A 1QHYA 5H70A 3CRRA 4CEJB 2BC9A 3HYTA 4UNRA 1XFAA 3VX3A 3PG5A 4CEIB 2IWRA 2ZI5A 2VP5A 4QM6A 3RRMA 1KOFA 2G83A 4KSBA 1KDPA 3TR0A 2DWOA 5FOVA 2X8AA 3O8DA 3VNUA 2CLSA 1G4AE 2IUSA 4HB0A 2Z43A 2CDNA 3IHWA 1DO2A 3QXJA 4BRUA 3U3MA 2O0HA 1JAIA 1E0JA 2AK3A 3W8RA 2UZIR 3DL0A 4TSFD 1XPUA 4PAOA 3K0SA 3CF0A 2ZR7A 1M7HA 5LBIA 3RS7A 4X8OA 4KBGA 4LJ6A 4EUNA 1CJKC 1U9IA 3NKVA 1E6CA 3B9QA 2QN6A 4BLOA 4CF7A 3QKRA 5BN5A 4KLNA 5UKDA 2ZPTX 3B7GA 1JQLB 2IYLD 1YVDA 3OIWA 4PAQA 1HYQA 1PUJA 2PH1A 2VO1A 3H0KA 3BXZA 3RVBA 1GILA 5L3SB 2ZQ5A 5DE3A 3P27A 1UBEA 2ZJBA 3KXIA 1TEVA 4IOJA 4Y0VA 1MRSA 2GCPA 5DN6A 3OIUA 3VKHA 4BWYA 2NTYC 1E79A 5C4MA 4TL8A 5ELXA 1X8KA 2EYUA 2XSZD 1N2CE 2FA9A 3QBVA 4NL4H 3VFDA 3JVUA 1QZXA 2C8VA 3EC1A 1ZM2A 4OL0A 1NI3A 4WVFA 4PC6A 1OV4A 2Q21A 1X1RA 3QF4B 1SVKA 3ZZTA 1H65A 4BQSA 1KJWA 2P2LA 4BE7B 4DSOA 4ASUA 1DVRA 1H8HD 3P1JA 4PQRA 1L4UA 3DDCA 2ASEA 4NZYA 2R65A 5A0FA 1Y63A 5K8TA 4G5QA 1CR4A 4TQUS 2EFDB 4XJXA 2ZITA 1XU4A 1P2UA 1IXRC 2ZE6A 4TL7A 2R6FA 1E1QD 3DEFA 3BIFA 2QPAA 3C41J 3EWSA 4MDFA 2ZETA 4GBMA 3EIQA 4TLBA 1CRQA 2VL7A 3N5CA 1FW6A 3AKYA 4IVPA 5JECA 2OV2A 4WOPA 5H1YA 4C0BA 5D3QA 3O8RA 3ZD6A 5FTMA 1K5DA 4U00A 1W7AA 1JEDA 1ZD8A 1XJCA 4O2LA 2IS1A 5EE9A 4IDQA 4PHTA 4TMTA 1LV7A 4GZMA 3FMIA 4PPFA 1OE0A 4W5JA 4WZ6A 1OFUX 3AVVA 2GF9A 2WJVA 3T1VA 1YJ5A 3U44A 3NBXX 1D9ZA 1XTKA 4F4JA 4C9BA 4JS0A 1PV4A 2ZRMA 1KDTA 4B3CA 3MG9A 2AR7A 2OCPA 4DCSA 2ZU0C 4BFYA 2ZE7A 4MYUA 4ZDWA 2V1UA 4D4LA 3AEZA 2V3CC 3BB4A 1UFQA 2A3RA 1IY1A 4Q1EA 1T8UA 3DKPA 2VF7A 2IXGA 4TTPA 1TL7C 1H8ED 1XXHE 1HQCA 4BFVA 4OHZA 1U8YA 4IOLA 1R0YA 2KE5A 2UVQA 1OXUA 3EZFA 3Q5EA 4DUGA 4DB4A 2R62A 1XTRA 1IN5A 1KMHB 1NN0A 1ZMXA 3ICQB 2G3YA 5FTNA 4F91B 2V6JA 3C8UA 3IO5A 2BCGY 1S1MA 2ZJAA 4BEJA 2VP6A 1G8FA 1N6LA 2C99A 3DHWC 1KSHA 2QZ4A 4WZAE 4IJMA 4R71A 2W58A 1E2NA 4M1SA 4EPTA 1XEXB 2JJ2A 1U0HC 2XXAB 1G18A 1E1RD 4FCTA 4MKFA 4V0MA 2P6UA 4MRVA 5FI0B 4A36A 2C96A 1LF5A 1KHTA 2Q6TA 1R4AA 3GCGA 3OEHA 4TWZA 3G82C 4OBEA 5JHHB 5JCZA 1P62B 5TY0A 2JIZA 2KWIA 3TUIC 4Q1AA 2QAJA 3K0FA 2Y8EA 5K8UA 2BV3A 3U4QA 2HLDD 3A1VA 1Z07A 2QMEA 4LHYA 3GQBA 4OHVA 1GNPA 2X19A 1W46A 3VKWA 4DJTA 4QJ3A 2G77B 1E4VA 2ZAOA 3IBYA 3RS2A 2H16A 1BIFA 5JJLA 1NF3A 5FBVB 4QL3A 2ZSBA 1FNMA
chains in the Genus database with same CATH superfamily
3I8XA 4UU0A 4NDNE 1BXZA 3A4LA 3BQ9A 2P62A 3Q6MA 3VJMA 1MP0A 5B4TA 5KCMA 1V43A 4I8DA 1XZGA 4M0LA 4E11A 4ZD6A 1K7CA 4H6PA 1TVCA 4OB8A 4UDXX 2HY7A 4AJLA 1KQGA 2FHPA 4PPYA 1VP3A 5FQOA 2PEZA 4OD0A 4OUDB 5JYBA 4LJAA 2VF8A 1IJEA 2DR0A 2HF8A 3E8XA 1YZLA 1E3WB 2HYDA 4P9NA 1PL6A 4TWAA 3UPDA 3D4IA 4JJGA 4MW2A 2OTCA 4L16A 2DKNA 4YK7A 1L5GB 4H18A 4ZI3A 2JGDB 2MSKA 2ZUCA 3FHOA 1GPMA 1U3WA 1N7JA 3F8SA 1ULHA 3KZMA 1IQPA 1K88A 4HTAA 3WGLA 2BEVB 4OLFA 4TWIA 3LYLA 1ZNQO 2E4XA 1MGPA 2G63A 3R20A 2B4TO 4YGYA 5JAMA 3PQDA 1PLLA 3H2JA 3KTFA 3DPUA 5E4JA 2QQFA 2H1HA 3M4NA 1Z38A 3NTXA 3P9PA 2QD4A 1JPJA 1PQPA 3PHGA 4QX6A 2JGEA 4C88A 1WD7A 2C5HA 2ZRNA 3OSUA 1B8PA 2PKCA 3FIJA 4I9NA 4AWAA 5HQTA 1EE9A 4MWZA 1Y9AA 1GSIA 2PHZA 4FU0A 4B2PA 4D74A 2FH5B 1D2RA 2OXCA 1X9IA 1FPQA 2V9ZA 4TV8F 2AUMA 3WLJA 5AFSA 2IPMA 4QPCA 5BQOA 4QC2A 1K0UA 3QUSA 1XJWA 1V2HE 1MJGM 4LDQA 5AM4A 3EG5A 3TFWA 2GXQA 1HL7A 1OLUB 2YNMA 1Q16A 3JXEA 2RJOA 2ZT6A 4C0KA 5FCDA 4CUZA 1UKVY 1WIWA 2E4ZA 5KHOC 4EY7A 2IV2X 1P2FA 2D1YA 4Y9DA 5K01A 4RLSA 2IPXA 1KI1A 2C5BA 3FE2A 1M6YA 1JR4A 5CYPA 1L1EA 4MB6A 4TMVA 5H02A 3KQQA 1WUKS 3LRXA 4L4ZA 3UICA 1A9YA 1MA3A 2VP3A 5BSEA 3NH9A 3BTSA 2RIRA 2OPHA 3S4YA 1P7PA 1W88A 5FUQA 3H83A 4O4JB 4Q02A 1JAYA 5KDDA 1E9EA 2NACA 2YY6A 3TLEA 3WGZA 4QTUB 4TT3D 3PRHA 4MMYB 2ZUFA 2OL4A 5JMWA 2Y9MB 3W2FA 4OXNA 5C8DA 2H3EA 2AS0A 3K35A 4U02A 4HH0A 4W5OA 1SBTA 3HGTA 5JI3E 2A1UA 1UKZA 3A9RA 1T0HB 1J0CA 3S99A 4D43A 3QYFA 3UW3A 3VZPA 1JA9A 4Q7EA 2IS4A 1JW9B 4WKOA 1KTVA 5EAIA 5B55A 4YCLA 1UXIA 2RI1A 4QFMA 1USKA 5LIPA 2FY8A 4UHEA 1LVHA 4KQ2A 4Q4HA 1RRFA 5CB6A 2NZXA 4MUXA 5K8IA 1GU7A 2ONJA 3G2QA 4QM7A 4CGYA 3JY6A 3HRHA 2XZLA 5FNVB 2Y6VA 1YDWA 3D8UA 2BFPA 2N3ZA 4L8WB 2ZTVA 4I7EA 1L7XA 1N2CA 3J7AC 1TRHA 4MS4A 4HTFB 3FVVA 3IUBA 1JQEA 3F78A 2BE7A 4YLGA 4FIZA 1TAHA 4PGAA 1HK7A 3FFTA 2QRLA 4LQCA 4HDSB 2XNKA 2HADA 3I73A 1U8FO 2V7VA 3JWEA 4NARA 5DRYA 2VUHB 4YPVA 1RXVA 2HA6A 4C06A 2OHOA 2VATA 2OBFA 3N2KA 4ARZB 2PZMA 3OOSA 3MELA 2ZS9A 4CKBB 4RK7A 2P9HA 3MRVA 2IDKA 1KAEA 4DLVA 5BWOA 1GN9A 3RFCA 3K1AB 4KMMA 4FLEA 2ZWAA 1XTJA 3CLTD 2YV5A 4G09A 4L0DA 4Z8XA 1H8EA 3X1KA 5KQLA 2B30A 4RD1A 3ZIAA 4GEKA 1LDBA 1T3LA 3A06A 3FMPB 1VIAA 3JPWA 4D8YA 2X7HA 5JDCA 4F3TA 3VOSA 4QBGB 4B7XA 1FSSA 1LA2A 1MO3A 1QIIA 2UYOA 3DL4A 3SZLA 5BUQA 3CCFA 3RADC 1A95A 2YINC 3Q3VA 1P3DA 3K9NA 2JIQA 3H9CA 1GYQA 1VSUA 3S70A 2MTBA 3OQ1A 3FI9A 5EJ4A 1K6MA 1S8AA 1QQ7A 2FW0A 4TRJA 4M22A 5GONA 1J0AA 2QTRA 4LWQA 4L72A 5B6JA 3HR8A 5DULA 2BUCA 2P2CA 2CK3A 2BGJA 1T0PA 2RGGA 2XE6A 3AV3A 3B9PA 3DEZA 3MWKA 1Z47A 3ECCA 4BNFA 5H59A 3GB9A 2WQ6A 4R8MA 2VK2A 1AGPA 1ZNYA 4E46A 4JLVA 1DJLA 2C5EA 2RHWA 4RJTA 3EIHA 2Z6UA 2VZ0A 3Q15C 2QLLA 4F5YA 3HE3A 4BJ3A 2VJYA 4S1TA 5G0UA 2IHZA 3AXSA 3DBVO 3GIWA 1NBEA 4BBAA 4ZZ0A 1JFVA 2L0XA 5JS1A 1C80A 1POWA 4CUJA 4Q6WA 2AWNA 2ORYA 4Q3EA 3C3XA 1LU9A 3O2NA 2YIMA 1WU7A 2J41A 4JKYA 4MGZR 1D0SA 4TPKA 2R8BA 5CMLA 5T5QA 1GNRA 3DXXA 4MV8A 3SBOA 3AUAA 5EQJB 3KM0A 3PC4A 1NXOA 1KDYA 4DWVA 2IZ1A 1Q44A 1GQYA 3QI2A 1NBMD 2HEGA 3AKDA 4JBIA 3JVVA 4H7EA 4H4DA 2C2GA 2CKMA 4UVDA 3KUCA 3NBQA 3HXMA 4KQGA 4IL5A 4MVJI 1OI3A 2FP3A 1RIFA 5KU1A 1PEKE 2GBLA 1ZQ9A 3WNZA 3ETNA 4NU8X 1UDBA 4EA8A 4OYHA 3PTZA 5ALFA 1GUBA 4LA4A 2YJZA 1Q1NA 3UCFA 3VU9B 1YKSA 4N3AA 3A04A 3PPWA 4GLFA 4IUYA 4OG2A 1P2TA 1C30B 4AZ0A 2PVCA 1T0JB 1G7RA 1GKLA 1DAPA 1DT3A 4QPPA 1CRWG 1HE4A 1QO0D 5AP9A 4FOPA 3HCPA 4MKHA 2FR1A 3KEQA 3WLHA 2Q5HA 1Y1PA 2ONZA 1QFZA 1Z6GA 4LTDA 5F23A 4K28A 1S3FA 3TKYA 3ADDA 2YH2A 4YJ2A 3RUCA 3R3VA 3NRCA 3S3TA 5ANRB 4QGAA 1SKQA 3RSQA 2HRQA 4AJJA 5DF1A 3D6MA 1K89A 3KUUA 4Z0TA 3AYXB 3ZGNA 1D2AA 1E4EB 1SKUA 1QVVA 1I7NA 2FK7A 2P6MA 1MC4A 5FFNA 5CTJA 4EUHA 3SKXA 2RKOA 1MC1A 5ALUA 2HA3A 5U4XA 3EX7C 2OWDA 2Z56A 5KI6A 4KOEC 3PKJA 3W79A 5K3EA 5ADVA 2F7SA 1DT5A 1KI6A 1QG4A 3TEJA 2P2NA 3QZUA 3RFTA 2AMFA 3VPDA 4UVHA 2DE0X 3UQYS 3KOXA 3HKEA 1YS2X 4NOKA 2PFKA 1XJ0A 5L6LB 3BEDA 1D07A 2EL7A 2JJQA 5H82A 1X7GA 5LDGA 3TUJC 2M6SA 2VKTA 4F92B 1BXGA 2HSEA 1INLA 2IZ6A 3VHQA 3D0OA 1A2KC 3PWZA 2WD7B 2Y0EA 1NULA 3DOHA 1CR6A 1CQZA 3BGIA 4GX1A 5FXMA 4AP5A 2BLNA 5D6OA 4EEZA 3IT1A 3NHJA 1V9SA 4J3JA 3U9LA 1II8A 1ZN8A 1QCZA 2Y77A 3GLUA 4EKYA 3KTAA 1Y89A 4OU4A 4QT4A 1NDQA 1RXCA 1CP3A 1IN8A 1V9LA 3KV1A 5CT4A 5TPWB 2CNWA 3NEYA 3VRHA 1W5FA 3JQ8A 1IY9A 3BCSA 5IWCA 1TO6A 4AZVA 1D7AA 2CFTA 4RVOA 1PHPA 2VK8A 2Z83A 3TTXA 2PX0A 1GZVA 2XWJI 2HBZA 5DJ5A 1L5VA 5IJWA 3AJDA 4Y7CA 1ZGJA 3PRYA 4UHDA 4CCYB 4G1EB 4N3CA 1SEPA 3WIBA 3EXG1 1P4JA 2YRXA 3DNFA 2H57A 4US0R 1F06A 3LUJA 4K46A 5EP3A 2D1RA 2EIXA 2I7DA 5KREA 1NNI1 2JANA 1T10A 1JJ7A 3OU7A 3QMMA 4KL8S 4P31A 3RAPR 4B80A 3GUCA 1CUBA 2BEJA 2TMDA 2G6BA 4GL4A 4AI6A 3ASUA 3COJA 1K6IA 1EYZA 4A5OA 1H5QA 2WINI 2B25A 1Z6TA 3HU3A 4LYDA 4WXYB 4UU7A 4DJEC 5DU2A 3WNCA 4KREA 1DKPA 1OXBB 1GGEA 3FRJA 4RWEA 3ZLVA 4D45A 3MC1A 2GZAA 5GTDA 4JI2B 1J39A 1KEUA 3SF8A 4BCCA 1MNAA 3A58B 3IAUA 4MQUA 4EI8A 2JC3A 5HGJA 1EWYA 4ZCIA 5CXQA 2PLAA 2J9FB 1N2XA 1SHLA 1SCBA 2JAXA 4R5HA 3U6KA 4KXYA 2YVQA 3VR4H 3TAXA 3BWCA 5TF4A 4EGQA 3F7TA 5D01A 5F7ZA 5C3MA 4L8FA 1DTWA 4UPEA 3J81A 2R86A 1NW7A 1TVKB 1VLMA 4C87A 1A9XA 5ESRA 3A6HA 1WF3A 4Y2YA 2HK7A 5ALTA 4F6CA 5FWXB 4GLLA 4R8RA 2OT3B 3T12A 4CJXA 1SXIA 2P2ZA 1HNWB 5JYEA 4F46A 2DKOA 2GF2A 2VP9A 3L6UA 4QVGA 4MW9A 2JD2A 3RROA 3TTYA 3DTVA 2JLZA 1UK9A 3UAGA 4FDUA 1V8ZA 1T9KA 3HFJA 2E4VA 1PK7A 3PA8A 4MYCA 5K9ZA 1RRVA 1RKUA 1TCBA 1VCHA 2WTEA 2J6HA 2ZEJA 2GCEA 1UPAA 4MJXA 4V0RA 3Q8LA 2Z6AA 3GRKA 3RO7A 4MRNA 3C3PA 4AIIA 4LY9A 5CDTA 4CFZA 2C8LA 3HN6A 4EZIA 1XX6A 3VNSA 4ZC8A 4CMGA 4EPVA 1QWOA 4BNYA 1YOVB 3E3OA 4DPKA 5IT0A 4LC0A 1Y8RA 2D1QA 4EFDA 1CJSA 1LX7A 4FEEA 1R8SA 4NU6A 2RHTA 3FWZA 1QGYA 1SXGA 3EMKA 4INZA 4MUYA 3BN3A 2IHBA 2O8NA 3AI1A 4PQFA 1X2BA 4LRUA 3WMGA 3SJ7A 1E3JA 4KH1A 2EBUA 3PGJA 1WKCA 4MQFB 1JHUA 3DMNA 3G02A 3P4YA 1VCNA 6REQB 1U0OC 3LOPA 5K8LA 4KB5A 4PHHA 1Z4LA 2LR0A 3U3RA 3VPGA 2SBTA 1EK1A 4LHVA 4B82A 1BWQA 1SMKA 2WVAA 1UJBA 3ELBA 1E1CB 3VO9A 1O94C 4AJEA 4LZNA 3TPCA 9ATCA 1PX2A 4IQGA 1RJWA 1PZNA 2FZWA 1GKIA 4IAOA 1MEOA 3QLVA 5BWBA 1PDOA 4CDGA 1SCIA 5DNDA 1LFAA 3DOUA 1GZ7A 4CM8A 5C8XA 4K9KA 3FYUB 4TL9A 2AFHE 1P1KA 4BMVA 3L0IB 4H1HA 2HNKA 4P5EA 4IXWA 1AQIA 4WXRA 4EJSA 2E18A 4J4TA 4AT1A 4EEXA 1KF0A 2TSYB 2ZCVA 2ZW9A 4MDEA 2NP7A 1KY3A 3R5KA 5BMVA 3BTOA 3GLGB 1A8QA 5EEHA 1DLIA 3DT8A 1IJBA 1RM0A 2F9MA 2YV1A 4MQEA 4YJKA 1HNNA 3WYGA 3PI6A 3QY0A 5IUKC 3L3BA 1QSGA 1E2PA 4DR6B 3ITKA 3LWNA 4R9SA 2Q5CA 3V1LA 4ENUA 8ATCA 2TMYA 4BNMA 2F6RA 4NENA 2Y1DA 3AM4A 3CEJA 5A6SB 1PG2A 1W88B 2I2AA 1P2VA 2Z3VA 4RJKA 1J8MF 3MINB 1T1SA 3AINA 3C1UA 2W5UA 2WFZA 1KQOA 2Z95A 3E53A 2XMZA 2Y4OA 3NIWA 1MVOA 2E82A 1JT2A 2WZBA 1F9EA 4NJMA 4ZVLA 3F6EX 5JEDA 4KYTA 2H11A 3FXAA 1B2LA 3TR5A 3KPYA 4LOLA 4R98A 3X0DA 1TKCA 2I4RA 1MOPA 3BF7A 4EPYA 2GK6A 2VH5R 2Y0CA 4M9UA 4F38A 1P77A 2JEOA 4P3YA 4OHXA 5AW8A 3QHQA 2DT5A 1NW8A 3CU5A 4MIKA 1DX4A 3ZG6A 4PO1A 4BKOA 2R68A 3KJXA 1ACMA 1Q11A 2ID8A 3AV0B 3C7TA 3T7EA 3ZEIA 4F9GA 1MMFB 3FOBA 4OB6A 3ZV3A 1RZVA 2AG8A 1FL9A 4BXOA 3W6PA 2WTAA 1YAHA 2DPXA 4ZOLB 4YUAA 2IL1A 3PD0A 4FGZA 5GZ1A 1LI4A 5I3CA 1JJAA 4D3SA 3ZDZB 1RBYA 1V3VA 2P4UA 3G2IA 2HREA 3EF0A 5ALMA 3VNQA 4Z7OB 3FUTA 5AT1A 2OFOA 5T4HA 2GJAA 4W1SA 1EDDA 1NMXA 1H42A 4E21A 2QIPA 3IUPA 1Y8QA 3C98A 2B1GA 3TOCA 1AVTA 2BKLA 4L9SA 4YECA 4MVJH 1E3WA 1JSZA 2ZTMA 4J49A 1FUIA 1JB1A 1GJRA 1Y80A 1YOBA 5KQRA 1YK0A 2B8NA 1WXIA 1Z74A 4XWWA 5EINA 1GCGA 1O9HA 1RU3A 3L7DA 3CZCA 5P8WA 1GQ2A 2R1VA 1NPTO 1P5JA 3AC0A 1RLUA 2X2PA 1M1ZA 1VBKA 1HLDA 3RODA 2F59A 4CODB 4P7FA 5GINE 1V71A 4QUHA 1G5PA 4DV5B 4IVNA 3ASZA 3HYRA 3UMSA 4BAGA 1JTFA 3STHA 2V65A 3AFGA 4UHFA 2ECFA 2FSVC 2VJOA 2QP4A 5HZHA 3NEAA 1WBJB 3L4JA 4CHGA 4ARZA 1NRWA 1DEXA 3EZGA 3FUWA 4D3XA 2QWXA 4KUHA 1C7ZA 3LXUX 4JIMA 3VR6H 1G7TA 5LZ8A 3AGQA 3DE6X 1SVOA 3HNOA 3JWIA 4NBVA 3HWSA 2HZ7A 1XMSA 4HN4B 3EVAA 3G2OA 4XB2A 2DZDA 2XOKA 2RG7A 2X4DA 2BFOA 4KFTA 2ACKA 2R8YA 2HJRA 3BCUA 4U7GA 4X20A 4R2IA 1FBTA 4YONB 3WLFA 2CZCA 4MKRA 2EKLA 5EHGA 4F4HA 1DAIA 3I2HA 5IJZA 4XWAA 2OWEA 5KOHB 1C9MA 1E96A 1UBGA 1SQ0A 4V0NA 4X1KB 4UNNA 1A4RA 3DEHA 4U3JA 3MD0A 4H7HA 4UE3S 1CUEA 2FQXA 3E9CA 3EFHA 3LDAA 4Q3BA 3K0EA 3KUKA 4BO9A 1XQ6A 2AR9A 3NAGA 1X7YB 4FYIA 1FE8A 2CNWD 1VPLA 3TI9A 4YRDA 3UJAA 1T3HA 1Y3BE 2LP4Y 3LO8A 3MMZA 4YAEA 2FHSA 4ZK6A 3JTMA 3DUFB 4BUZA 1U2GA 4YJ3F 3ETHA 3F3SA 4YUXA 1KVQA 2DH6A 3SBXA 1UEXC 2HFJA 1C30A 2JVIA 2Z2YA 2UUPA 1BVYF 4AZ0B 4TMYA 3HK2A 2QVZX 1R74A 2I8CA 5HKLA 5LYYA 3AY0A 3PRKE 4M4SA 4OPMA 4EGJA 2N47A 1FJ2A 1EFCA 3FI0A 3DT9A 1QYXA 1UK7A 3H1PA 4HD8A 1RPAA 4OA5A 4TTQA 4XIYA 4NZZA 2NTJA 4MUBA 1P61B 1NE2A 1DUSA 4DDTA 4H1WA 1OAKA 8ABPA 1T6YA 5KQGA 1LD3A 1Y1RA 3U4AA 4LCEA 2AX4A 5B58C 1J99A 4UDOA 1V48A 1XVIA 3BULA 3LQ1A 5J2UB 2IPOA 3KBBA 1XNGA 2VYND 3LUCA 2ZYSA 4ZVKA 4MHTA 2NYVA 1QVRA 2OOKA 4IJWA 4MLDA 2H4XA 3U40A 5FRDA 4EUKA 3H5OA 1W4CA 3LVFO 3MPOA 5AKGA 3CX3A 3G3EA 3Q3HA 4KV9A 4RXUA 2C98A 4H1TA 4UKDA 4FN4A 3GUVA 3QVVA 4WT7A 3WFZA 4C30A 3A9SA 4BQEA 2I7XA 2BKXA 1M7BA 2O2YA 3QXSA 1H1TA 1PR6A 2J3KA 3F6BX 1TYCA 4NZ9A 4PINA 1R4MB 4QA9A 4GFDA 3H84A 5TX7A 1SKYE 2FF7A 3GGDA 3K09A 4DNFA 1K1EA 4N49A 1G3IA 3KQWA 5HDQA 3TYXA 1A7JA 1BRMA 4WLFA 3R41A 1IPEA 1BMQA 1HZJA 2IITA 4MW7A 5HIAA 3NHPA 3DO5A 3M2PA 3E9ZA 1LX6A 3OEWA 3V48A 3VMMA 2DPYA 5NULA 1R3UA 3AI2A 1R5BA 2D3WA 3VUFA 1Z0SA 3IH5A 2IV3A 4H3SA 3ZX4A 5B1YA 5TIIA 3IMGA 1JEAA 2PLRA 5LZ4A 2HW8A 3VR4A 3HJCA 4LQDA 3BILA 4MPDA 1CZLA 1N1DA 2QSYA 4UUOA 3T41A 1E1RA 1IXZA 2UZ1A 1NJFA 4P4LA 2YYSA 4TWRA 2NQ2C 3VSEA 1LQTA 4CL0A 4EECA 4AXXA 1XMQB 1G8GA 1RC8A 3OBBA 2WJZB 5I7HA 2F55A 3ZH9B 2XQKA 3CRMA 4OXQA 2JHGA 2BI8A 2LCIA 3MT0A 1TKBA 5HTOA 1ISSA 3GLHE 3PFWO 3I9LA 1WY7A 1NHGA 3DOFA 3LG2A 2JLXA 1NU8A 5JJ5A 2W8BA 1W5TA 5K3AA 2AI3A 1OXTA 3O21A 3FPKA 5EHXA 1JKFA 3WMRA 1YBFA 2WWIA 1XNRB 2R2GA 2DFDA 4CCYA 5C8VA 3PUZA 1E9BA 1QHIA 4KO8A 4G5FA 1AY0A 5TQ2A 1Z63A 4IP0A 1VMAA 2P9TA 3SQLA 1Q12A 4YRPA 1FMJA 1E2JA 5BW6B 1TD1A 4TS9A 2W2MA 3GCXA 4BGDA 1P5RA 2FI1A 5ALRA 1VPEA 1N7GA 1NSTA 3A2LA 3IMKA 4BC1A 1YR2A 3NPAA 1T9GR 3GA0A 4QREA 3FA2A 4XB6B 4TM7A 1D8AA 3EDMA 4YFYA 4EUEA 3TE7A 4GL2A 2O8FA 2WUFA 1Q0LA 3FPBA 4WFJA 1Q0RA 4XH9B 3VYSB 3WO1A 2NT3A 5F77A 4EL0A 4GE0A 4D41A 2DWUA 3W9SA 1F3LA 3D7LA 3QEOA 5A0VA 1HYEA 2DHCA 2NTEA 4OIFA 4A8HA 5CEJA 1XMXA 2C83A 4GLBA 3DONA 4PRKA 1U4NA 3SZMA 3AEQB 1O54A 4OHFA 2GBCA 1M34B 2DSNA 2EERA 2F1IA 4V2IA 4B32A 1SELA 1EINA 3K9WA 4B09A 3D2AA 3D2CA 2BR4A 4QT0A 4X1KA 1HDGO 1T9HA 3COZA 2R6GA 3FLMA 4GI5A 5FL3A 1U63A 1PN3A 3PK0A 2G07A 3MWEB 2CLKB 5C52B 1EFPB 1NQWA 1RAHA 2PRJA 2X9LA 3BKWA 4XSHA 2Y1WA 5L3SA 1V35A 1CB7A 5CAEA 6ADHA 1O8CA 4CV2A 5B57C 3WOVA 2PG3A 5KOYA 3DKKA 1G20E 2H4HA 2IEYA 2ZUUA 2R4TA 3R44A 4U2DA 5DDIP 5J3JA 3DSRA 3KQMA 3ADOA 3FHCB 4M7WA 4PBRA 3OAAD 2AEMA 5F9HA 4N82A 3T1OA 2IHKA 3NCHA 3KOUA 3SHFA 1BROA 3V1UA 3I01M 4ZQBA 3RFXA 4B8WA 4NFSA 2OM2A 4RKEA 2RSLA 4OQFA 5CM9C 2B20A 1TZKA 2VXCA 3IVCA 3OZTA 1XNQB 3SYTA 2B82A 4OKIA 5A3VA 5FPQA 2ABWA 2CNLA 1VE3A 1TT7A 2A58A 2PGIA 3A6GA 3ANTA 2IU0A 5FFMA 3WRYC 1YQQA 5ECGC 1TUEA 3ELDA 5DWVA 2Z9CA 1OWLA 4PRZA 1PZGA 2YS6A 4OATA 1IDN1 4RTNA 1GFIA 2H1SA 4OGKA 3P4UA 4RTMA 4YAUA 1IAVA 1R12A 4H60A 1GYRA 2OE2A 1WLYA 4GDMA 1YVEI 1X15A 1P74A 5C4GB 1V11B 4C0HA 1GLGA 1WXGA 2IYYA 3KPUA 1FLNA 4PONA 4ZOEA 2AXNA 1P0QA 5CVVA 3ZHVA 2EWVA 1SVWA 1PNOA 2WG0A 4P7BA 4MPRA 5SY6A 4PTLA 2NVUA 3UWDA 5AVKA 4KN9S 3HZRA 2PO5A 2ZE8A 4Q0MA 2ZIWB 2QTNA 4Q1CA 5BSHA 4IH1A 4FNMA 3B2EA 4C7OB 4UTOA 4YI5A 3DMFA 4RH0A 4X90A 2BZ0A 1T1GA 3NHLA 3T5GA 4BNXA 3FGOA 2CL6X 1C9EA 3IIMA 3KQPA 4UAJA 4PR0A 3E2IA 2P6RA 2VHZA 1ZD9A 2D8AA 2BI4A 4XDGA 3H4VA 4X60A 1Z7WA 5FAXA 2HKIA 4L4XA 3CX6A 3M0EA 4RY9A 4EI2A 3UTDA 4FYMA 5AUPB 4A0RA 5IAOA 3L0SA 1XLTC 3HU1A 2A0XA 1ORHA 3DO6A 5A3SA 5T57A 5FT9A 1HT3A 2B1RA 4K86A 5GADl 4JUDX 1GRRA 3HVKA 4FYPA 4B8ZA 1HKUA 4B83A 5A4IS 5DHQA 5IJAA 1Z88A 1IM5A 2B0JA 2HMWA 2YJNA 2QIOA 3Q6NA 4KQXA 2HF9A 1YL7A 1U9IC 3EOAI 1EA5A 3VZSA 3KZOA 1K86A 5EJ5A 5JQGB 3M1YA 2X5OA 1P8AA 2AMYA 3ETDA 4UBIA 3UOGA 2YIVX 4Y2QA 2ZRGA 4B3SB 1ZW6A 2EBFX 4G5XA 1TW3A 1W94A 3EG9B 1VRWA 5JSUA 1W6UA 1XKLA 3GRCA 3HZOA 4RU1A 1OW3B 3C3WA 4YP7A 5FUBA 3SDSA 4M37A 4UC0A 5HOQA 4A27A 5LWHA 4PFSA 4DVGA 1FC0A 2VEOA 2V6BA 3X2SA 4DIKA 2XUOA 4I08A 1P4HA 1P81A 3KE9A 3BT7A 4V3BA 3ONWA 4PG7A 3TXXA 5M5BA 1JQ5A 3C3EA 3HPQA 3L7YA 3NTQA 1R88A 3OX3A 4K0RA 5CXSA 3AG6A 1C0LA 1VOTA 2NXEA 5IH3A 3PGA1 1DI0A 1YTUA 1Z4JA 1Z4QA 1W8DA 2OYSA 3P0FA 2YY7A 2GK4A 2A94A 4UNPA 3H4MA 1VI5A 2WB4A 1AGNA 1RWKA 1I3MA 4F06A 3D7SA 5LQKA 2M1XA 3EIOA 1GKKA 3DO8A 3NHUA 5E9JA 2O3UA 3QE9Y 1P9NA 3E6AA 2PH7A 4CE6A 5EJ8A 4ZO6A 1RACA 3A36A 4MNTA 1XU9A 2K7ZA 2UV8A 3F9IA 2H48A 2Z2ZA 3B60A 2GSWA 3DLAA 3LUFA 3QE0A 4L02A 4MDYA 3WA7A 5KYXB 1PS9A 1M1YE 2J45A 2MJLA 1RKQA 1RS0A 2WM3A 7YASA 2IVZA 1BH6A 2NO7A 2W8ZA 4G3XA 2WABA 3SHOA 4UUNA 5LYJF 4FGUA 3RVPA 4AKSA 3GMIA 4WLOA 2PANA 2NQTA 2YUTA 1UM8A 2ZSUA 3BIXA 3MMSA 4KQFA 3A4MA 1W2GA 2G88A 4YJHA 3UMJA 3W6OA 2BRUC 4ZMSA 3GPDG 4R5MA 4EJMA 1G59A 1TTTA 4A0QA 1YS7A 2VK1A 4QBTA 4R16A 3W05A 1KH2A 3K2EA 4L28A 1Q19A 5DI9A 1FS5A 1E77A 4S2EA 1YWGO 3BMNA 3PXDA 4P4NA 3STWA 1K7SN 1ZONA 4MWTA 4U6NA 5DISB 1EXVA 1NQXA 1WY5A 2Q3MA 5JTTA 4J07A 4BO4A 3OIVA 2BM0A 4DIMA 3Q7PA 4XQEA 3KS9A 4A16A 2H08A 2QYOA 4GICA 4LECA 3PFFA 4OFWA 4XWTA 4DV0B 2UDPA 2B2XA 3BQMB 1OUMA 1TE2A 2XWPA 3DKIA 2XQVA 3KL4A 4HWRA 4ZPXA 2O8BA 1LPSA 3WGIA 2HXGA 4Z8YA 2HU5A 1I2DA 3VHLB 2GH1A 3C8ZA 4HYEA 2J8ZA 2NV6A 2FMFA 1ZD1A 3TB6A 4UQLA 5JDIA 2VZLA 4UD6A 3RCBA 4ZT3A 2FZKA 3RJ9A 4Z0HO 3WYBA 5TMBA 1UDRA 2X1HA 3D3KA 1UK8A 1WXDA 3NLLA 3GLSA 4MVWA 1O7JA 5FV7A 4B6EA 1KHHA 5LMZA 4IZOA 1A04A 1OPXA 1P4RA 2I6UA 4OLAA 2XODA 3O5AA 3OZUA 2D4HA 2RKWA 4GXRA 1WKVA 3QF4A 3ZIDA 3TFOA 3B89A 1OI7A 1E3IA 2UVPA 3ETCA 2D2XA 1I3LA 1YDHA 1CULC 3ZGXA 4IDOA 1W581 2IA5A 3KPVA 1QVWA 4XASA 5KHLB 3BICA 3GFGA 1KQFA 4JC8A 4OJQA 3JATB 4NK5A 3G9UA 1CQWA 1XEAA 2Q4RA 1FXWA 3B6MA 4RD4A 1YA6A 1UBFA 5IBRA 2I2CA 1I36A 5IEBA 4BO1A 5K0BA 2JRLA 5IVHA 5JALA 3HVJA 1R6VA 2CL0X 1BVHA 2UZ4A 3NM4A 3QMPA 2O8FB 2O8EB 1SVLA 1Y3FE 1ICIA 4COKA 2WAMA 4DILA 5TPZA 3VDMA 3QE4A 4CLOA 4F9EA 2QD3A 3T9FA 1C8KA 2O5RA 1ZGAA 2FPUA 1G38A 2P69A 5M2QA 5E6UA 3QSYA 1DUVG 1R9MA 4E4YA 2DAPA 1SG9A 1U31A 1UBOS 3LT4A 1JQDA 4PG5A 4CKXA 1F20A 2C9ZA 2CLFB 2BW0A 4IXNA 4A8PA 4LV8B 3HO6A 3OF2A 5ECWA 2RHDA 3WG9A 4MRMA 2C59A 3IVMA 2FE4A 5LMUB 2D00A 1FXUA 3DNMA 3K0BA 4RACA 3WNDA 2GQ0A 2EJVA 1WHSA 1X77A 4DQLA 3AM1A 3A6JA 5JD3A 2G1PA 1UBSB 1FVOA 2LRHA 2PYZA 2WKQA 5KTRA 3VTFA 4O1IA 4PFJA 4BMSA 2PJRA 3I9KA 3TIXB 4D8TA 5AICA 5YASA 5J63A 4QG3A 3IAXA 4MUFA 4N5HX 1WXFA 4Q7JB 3Q4GA 5CK4A 5CLLA 1J22A 5DB4A 3H9JA 3IO3A 3WNQA 1TI7A 3PNYA 4KFRA 4ZKDA 1LC3A 3GJQA 5JATA 4COOA 5K03A 4JC4A 4XJTA 3L4BC 1A4IA 3DBLB 1SCDA 3GLHA 4TRMA 1SBZA 1I3OA 1ISIA 2PT5A 4IOMA 1E0DA 1O03A 2B1JA 2B4RO 2WA2A 3D81A 2RGCA 4KIUA 4FFMA 3S8MA 3WK4A 1W5BA 3MEQA 5M34A 3OC0A 1GNLA 1GPLA 1RWNA 3H9BA 3M5WA 3OCYA 1DG1G 3HN2A 4LJRA 3OE1A 4JUBA 4LC1A 1GRCA 3C6YA 4LGYA 4WBXC 4ND8B 5JEEA 5JVDF 2DJIA 1GP2A 1L1QA 2G4CA 3GUUA 1VE7A 2GSDA 2E21A 2ZTUA 3O4VA 4BMYA 1HDCA 3CO5A 2WJ3A 2IY9A 1IRXA 1Z22A 5DTQA 3ZWNA 1ZINA 3P0HA 2FNAA 4RLFA 4WZZA 1W4LA 3GRRA 1E3QA 2VDRB 1NHWA 1R0CA 5CT5A 3VDNB 1JR3D 1KI4A 1M0SA 3IDAA 4PYIA 3WLSA 4F2WA 5T6BA 3U13A 4D4MA 2GYYA 1YQGA 2XI4A 3KEMA 4C22A 4J0QA 3W5IA 1T2AA 3SC2A 4KE9A 3M6LA 4EHNA 1C9YA 2WOOA 1ZJYA 1CETA 4QUKA 2HRDA 4G86A 4L5BA 5BQXA 1CBUA 3EN0A 1A9ZA 1GR0A 3UC9A 3NBKA 3W6UA 4YP6A 5L95A 1NRXA 1HORA 4LMPA 4ZVPA 1TYEB 5AK6A 3T35A 4D9EA 1DGQA 4IO0A 3H42B 3GR6A 1HDZA 2QG9A 3O2JA 4IBOA 4HC4A 2QTWB 4CV1A 2I3AA 2DM6A 2AN1A 4PSUA 1CT9A 2SKEA 5FNVF 4Q05A 1FU8A 3PR1A 3Q8WA 5AD1A 2B8WA 2OENG 3OWXA 2GA9A 2R4QA 1ZH4A 2X3YA 4MRAA 4PSCA 4D8VA 4KI0A 5I48A 2Q5OA 2HIAA 3DEJA 5FBZA 5AOCA 1PTJA 2Q62A 1HTBA 4OJTA 1JALA 3SSNA 3C16C 3EVTA 2FU5C 4R2XA 2HCFA 2Z4SA 4BFTA 5CA1A 2BFDB 4H3VA 1DKOA 2TS1A 3UENA 4C4XA 3O1LA 1NQ5A 2QU8A 1ADFA 1YZYA 4GP6A 4R7GA 2QL5A 2CBGA 3PWKA 3T3MB 4BNZA 1M2OB 1L5HA 5HYVA 1HTWA 3LX8A 3V2UA 4GPTA 3UGTA 4EHJA 1YMVA 2FFAA 3GMSA 2DGDA 2L17A 2OB2A 5FWAA 3U26A 1QZZA 3AQ4A 3FLBA 4CMBA 2M98A 2OY0A 4J8PA 1CQXA 4BRWA 1DBRA 5KSYA 4W5TA 2R1TB 3H3XA 3OHMA 4BQFA 5FI1B 3T3GA 2NUPA 2VPTA 1NX9A 5IT4A 3FBWA 3FTEA 3PZRA 3IESA 2ZSKA 2CVFA 2ZYWX 1B2RA 3PXUA 1CPYA 4ZHSA 4ME6A 3Q11A 3VKUA 1RYEA 1L4KA 1JNYA 1PJTA 1CVIA 1WQ1R 2PLNA 2QNBA 1VSTA 2HEIA 3O90A 5HF5A 1T8PA 1HI9A 3P9KA 2HV8A 3DBHA 5HRCA 2JFQA 3D64A 3T1QA 2ZUVA 2PKXA 3LDUA 3NRJA 3ZCVA 4CIWA 4OYLA 1VKZA 2Q0HA 1P0MA 4UARA 5ALIA 3WV5A 1MXFA 4OP1A 1U0JA 2XRFA 4G81A 2ZM5A 4XSVA 4C07A 5JCJD 1ELOA 4IWYA 3HO8A 2GASA 1IRIA 16PKA 2R1UA 5LU9A 3FTPA 1KOLA 3L07A 4CM5A 3OCCA 1XOIA 5JDIC 4S1OA 4KLCA 1Z6ZA 4BATA 1RSZA 3HCWA 1PVDA 2Z2KA 3ETEA 2R6HA 4OQNA 5LOVA 4ZDIA 2O5VA 2ZYUX 5J40A 1E5QA 1JFTA 5H68A 4ZI7A 1YBAA 2DECA 4CDNA 4HVCA 4PG8A 4CMCA 5TGDA 3HCEA 4D8WA 1DCMA 1P1HA 1QMPA 1PWXA 2UU9B 4JQSA 4TYWA 1E2HA 3QU9A 4LN1A 3LY7A 4XX0B 2YZ7A 1KU6A 4KK4A 2HA5A 1AE1A 2ISCA 1Z5OA 4HG2A 3KWMA 2WHPA 2BDTA 3DWFA 4B3BA 3C70A 3LMKA 3SKVA 3MXOA 1TM4E 4DLUA 4B3HA 3UWKA 2JI6A 4DCMA 3KV3O 3FFAA 3D7KA 1BHO1 2FFBA 3F5FA 1NW9B 3GU3A 1GZHB 3PFCA 4G2NA 3GP8A 4IVQA 4LG1A 3HUTA 4K40A 4LXGA 3F1KA 3NBZC 4RM2A 2BI7A 2MSCB 1I2BA 2YWBA 4YHBA 4D97A 2VYQA 4YAWA 1FJHA 4L5CA 4MJ7A 2YOGA 1RAIA 3HXQA 3QWIA 1YTLA 4R9UC 4PBSA 4ZKEA 3GDFA 1IZ0A 1HSOA 2XCTB 1OXXK 1NN1A 2JCGA 2YW2A 4G5HA 2JA1A 4RE6A 4FEGA 1H2AS 2JKZA 4G24A 4UNSA 5F51A 1F5NA 3C2QA 5DM1A 1A8HA 1C2TA 1JECA 1M66A 2F9FA 2R5NA 3LTEA 2ISSD 4NPCA 2QJRA 4EQ6B 5EXEA 2H2FA 1DARA 2YN0A 1KAHA 3UA3A 3UMVA 4WK6A 1M0TA 4OHRA 3ZBUA 2P9GA 1T1JA 1VIDA 4P80A 1JAZA 4OYRA 3DTVB 3M9XA 1NFRA 3QFSA 5DYGA 5FI5A 5AESA 3W7AA 5DTRA 3QUAA 4G8JA 1YZTA 4XKJA 2HU2A 1Q50A 2I4TA 5SY9A 2OO7A 4PCAA 3SZOA 4C08A 4OQDA 2WSMA 2X0IA 3C8HA 3GY0A 3Q9LA 2H8GA 5GVSA 1MX1A 3FAKA 4ER5A 4MYHA 1Y4AE 4LOJA 4L5JA 4DY6A