3RSLA

H-ras soaked in 90% r,s,r-bisfuranol: one of 10 in mscs set
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
156
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 156
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rslA00
1UF9A 3VR6A 3ADCA 1N6PA 4XOIA 5J47A 3NBYC 4HYYA 1WBDA 2QGZA 3AF1A 4RZUA 1E2EA 3RABA 3LBIA 2W6JD 4G01B 2PEYA 1OFTA 3Q7QA 5EXSA 1HA3A 3ZIAA 2RGDA 3KUDA 3SFVA 4C2UA 1PUIA 2ORWA 1DG3A 1OIXA 2BBWA 1TAGA 1EWQA 1PLLA 5EP1A 2J7PD 2ZJOA 3CH5A 4IVQA 4W9MC 2O8BB 1CS4C 1KK3A 4BZQA 5JI3E 2DPXA 1YQTA 3IBYA 1Z28A 3Q3JB 4TL9A 1C4OA 2RMKA 3BRWD 2QP9X 2BC9A 1KMHB 2RAPA 3EARA 2ZYVX 4HLDA 2WWHA 2YJTD 4LHVA 4DB2A 3GEIA 1G3MA 4QL3A 2ZI9A 4C3ZA 2GJKA 1P2VA 4PQRA 3ICEA 2BBTA 2PJZA 2GK6A 1LNZA 1OFHA 4D25A 3TUZC 3ICQB 4GOKA 5KOYA 1U8YA 2BDTA 2IXGA 4R98A 1R0XA 4BFVA 2WVJA 4QGHA 3CB4A 2PZFA 5FTMA 4D4KA 5EE3A 3T1QA 4DRZA 2VPPA 2GNOA 1KO7A 1NIPA 5FBLB 4PAQA 3S1AB 3IEVA 1GNRA 2WZQA 1FNNA 1HE8B 1VECA 3CX6A 3DMNA 4YONB 2C5LA 2RGCA 3VFDA 5JFGA 1OHHA 1G16A 1ZINA 5FUYA 5H1YA 2QE7A 3X1XA 2OCYC 1S3GA 1LB1B 2JJ1A 3SBEA 5HE8A 4QG7A 1GWNA 3ONWA 4LYFA 4B75A 1HQCA 2J0UA 4FI3C 5BWMA 1T3LA 1IY2A 2C99A 3LBNA 3L0IB 3ZS8A 1FQKA 1TMKA 4Q00A 5B58C 2GEVA 2GZAA 4CEIA 2XXAB 1XD9A 3NKVA 3U61B 3CO5A 4Q1BA 3G5UA 4US1R 3SFZA 3FKSA 3KFXA 5J5CA 8OHMA 1QHIA 2CE2X 4V0KA 2ZRJA 1HH4A 1BKDR 4KFTA 1EG7A 4KFUA 4MKIA 1G4AE 3KJGA 3Q9LA 2NO6A 3BD9A 3RWMB 1ZM2A 3LRPA 4PFSA 4P32A 1VMAA 5FTNA 5GJCA 2BMJA 3TKLA 4G5GA 1AJEA 1NLYA 5HKKA 1A5TA 4PHHA 4ZV4A 3MCAA 1A2KC 1KJZA 2VIIA 1YZQA 3BH6A 4M22A 1DAIA 2QAGC 1DVRA 4UNNA 4WVFA 4DZZA 3HWSA 2QT0A 3KQNA 2FFQA 4URXR 2AHOA 3UWOA 1WBBA 2YWGA 2MSEB 3AF4A 3DM5A 1IN5A 1VKJA 3B85A 3L8ZA 3CRRA 4G5OA 2NPFA 1J90A 3K0EA 4YMWA 2L0XA 3KXIA 4OQFA 1KK0A 2IF0A 1JECA 2Q9BA 4ZCLA 3SYKA 3DEFA 1Z0JA 2XGJA 3HP1A 1BYUA 1NMZA 2W0MA 1P7CA 2WMNB 3IIJA 2ZJZA 2GRJA 5JS8A 1XMVA 3BJIC 2OBMA 1S0UA 3PENA 1IN8A 1SXJC 3TAHA 1QDEA 2QSZA 3IHWA 3VAAA 3LW8A 1PVOA 5KNDA 5FUWA 2IYLD 3RVBA 3UG7A 1G5RA 2FSHA 2HDNB 4HSEA 3TUJC 5FPSA 1GNPA 1BMFA 2J0UB 3UXMA 2QZ4A 1EX6A 1R0ZA 4BFYA 3BIFA 3OIYA 3MWJA 1IONA 4M4SA 1X3SA 2NIPA 3B7GA 4CEIB 2UZIR 1XCGB 2C77A 3EZFA 4NYJR 3CPHA 5AJXA 5SZIA 4KFRA 2BHRA 4GP7A 4IOKA 1G41A 4NYIQ 4PTLA 4D6PA 1OH7A 5HPYB 1KJWA 5FFMA 4L16A 4FMDB 1OHHD 2IYUA 2WOOA 3CNLA 3R20A 4C0BA 1O3YA 3CPEA 1B23P 4DBLC 1KSJA 2OFWA 5D3MB 5EP2A 3SYNA 3ND8A 2ZI4A 1G8GA 2C2HA 4TL7A 2H18A 1P5ZB 1WP9A 3TLXA 1T4GA 4PR0A 3LXXA 1GL6A 2QRZA 3LXRA 2CLCX 4IRUB 1RW4A 5AJVB 4DDUA 2FSIA 4QFMA 3AM1A 4M1YA 2ZRLA 2ZROA 2YWHA 3H4MA 2QPAA 3Q5EA 2EFEB 4JT4A 5EP4A 1Z63A 4LJ9A 2J59A 4Q7LA 3AVUA 3MRSA 1SHKA 1SVSA 3UMFA 1TU3A 4KV9A 1NVWQ 1G3QA 1ZVQA 2ERXA 1LTQA 1MO4A 3THXA 2QEQA 5HKKD 3PG5A 2GF9A 2YOHA 1AS0A 2BEJA 4RFSA 4M9XA 2JDIA 3DHWC 3QKRA 5FL7D 3T5DA 3TIFA 2GK7A 3W90A 621PA 3M0EA 4JSYA 3EZ7A 4X8LA 3I4LA 2VQSA 5FUXA 2OAP1 2XZPA 1RE0A 3NBFA 5G41A 4PHFA 4IKEA 4NL4H 4ZO4A 4QGFA 3V4FA 1W36B 1YZUA 5A4JA 4TMTA 4MGZR 3TR5A 1QHYA 4F91B 1Q0UA 4Q03A 1G8YA 2PX0A 1XD2A 2MMCA 4ESVA 1NSFA 3WMEA 2PH1A 3QXXA 4D0NA 3U3RA 1YVDA 2KBEA 1KKMA 2J0SA 4FWIB 5B57C 1GILA 3RC3A 1LFDB 2HEIA 3A1VA 1UFQA 5BN3A 2XAUA 3QQ5A 3PQCA 2R6DA 3M6AA 1Z0AA 2RH5A 4OBEA 4QBIA 1IBRA 3TW8B 4RKFA 2GZHA 4HAZA 2FGKA 4MQBA 2VL7A 1XMJA 3AKYA 2OHFA 4KSBA 2QA5A 2JATA 2WTUA 4NDZA 1BMFD 1EFUA 4B32A 4M1KA 3QIAA 4Q1DA 5DH9A 1FP6A 5GJVC 3T15A 1W36D 2YYZA 1G1MA 2WJVA 4RSGA 4B3GA 3WYAA 1R6BX 2YC4C 1A7JA 2O8DA 2QTVB 2IYYA 2A5DA 2C98A 2ZPTX 3CPJB 3IIMA 4LJ6A 1E32A 3ZZUA 3PEYA 2DB3A 1Z6AA 5FOVA 3U2QA 1I4TD 2JLWA 2Z83A 4TQUS 2VRWA 3SYLA 3BB3A 3VU9B 1TTTA 1P3JA 2FEMA 2PL3A 4Q4HA 4JLVA 4HB4A 1G7RA 3EIQA 3TGPA 1N25A 2ORVA 3SBDA 5G3YA 1ZNXA 2Q0HA 3IQWA 3THXB 3H0KA 1C9KA 2GCPA 3K9HA 3E70C 1UDWA 1ZIPA 1JAHA 1GNQA 4NTZA 1YRBA 1L2TA 4ITRC 4RFSB 4BZXA 2QL6A 2OE2A 3QKRB 4K81B 2FSFA 4D80A 2ZSBA 3TSWA 3IO5A 4GL2A 2ATVA 4POAA 1U0LA 4PHTA 3REFA 4UNRA 2OM2A 4MKHA 2DWOA 1ZC4A 1YZGA 5KDOA 1GAJA 1SULA 1GKUB 4HAXA 4HLUC 4M9QA 1U2RA 4LJ5A 5AWFC 1VYTA 3X1DA 2ZJ8A 2OUKA 1XD2B 3K9GA 3CBQA 3FFAA 4F93B 1T0JB 3ADKA 1FTNA 2F7SA 2GBLA 2H16A 2IEYA 4TL6A 2RGNC 2QENA 2IX3A 1NKTA 1T8UA 4JBXA 5E3HA 1UKEA 2AK2A 5E7MA 4Q4LA 4UQOA 1Z6YA 3FFBA 2JDID 4RY2A 1Q57A 2CLDX 4R2IA 1Q1ZA 2HYIC 2X8AA 3U7HB 1FMLA 3ZJYA 1KZ7B 2BBOA 3KL4A 4JLBA 3LAWA 4IFEA 1OXVA 3LX8A 1I4LD 2ZTSA 1X8LA 5H68A 3AP1A 2N1BA 3CR8A 4NCKA 5J40A 1CEEA 3AB3A 1U8AA 2D74A 4RCZA 1G64A 4JLPA 1U94A 2PT5A 4ZKEA 2QPOA 2WJGA 2E1RA 2ONKA 4C7OA 4P31A 4XWOA 2O8DB 1KO1A 2H17A 4F4CA 2KJQA 2AWNA 1MO6A 2QPTA 1N6IA 2ANCA 2BKUA 4AC9A 1II8A 1HTWA 4LCBA 5EUQB 2ZI5A 4L5BA 3EXAA 3CNNA 4B2IA 1Q20A 1ZNWA 4MYTA 1K8RA 4Q4HB 1ONBA 5CJ2A 5FBRB 521PA 4BASA 5TMPA 4XSHA 4CEJA 1GP2A 4Q1AA 2IS2A 5BYJA 3TR0A 1OYYA 5FUVA 1ZUHA 2Y8EA 4JJZA 1AGPA 2NTYC 3C7KA 3DO6A 1M34E 1U0JA 2FN4A 2REBA 5E4FA 2YHSA 3HPRA 3NXSA 3H86A 4ASUA 4D26A 4HAVA 1W0KD 3QBTA 1T3HA 2FNAA 3LX5A 4FWTA 2NOAA 4QM6A 4DIEA 3RS2A 5KSOA 3B9QA 4XSGA 3MD0A 4UNPA 3SN6A 1KK1A 2FZ4A 1U8ZA 2OO7A 1OH5A 2QROA 4DLTA 4B76A 1Z07A 4KVAA 4PZLA 4TMWA 2ZSDA 2EFHB 4FCWA 1W46A 2QMUA 1XTIA 2PT7A 3D3QA 3GEHA 3LY5A 5C4MA 1E94E 1E4VA 1Q3HA 1H8HA 3SU8A 5KPJA 4BRWA 2OESA 4TYWA 2G77B 1CKEA 2OZEA 3AVWA 4BLRA 1W5SA 1VYUA 3MWLA 2Q6TA 5FOUA 4GT1A 4BGDA 4FCVA 1IQPA 3B1WA 4O3MA 2FPLA 2ZYWX 2QT1A 3KQUA 2K5UA 1ZUNB 3E1SA 3VKHA 4DHEA 5L8VA 2QORA 1GVNB 3DKPA 1ZUIA 2ZSAA 3I5XA 2F9MA 3LDAA 5FR2A 4C7OB 1ZM3A 2GTPA 3SJCA 5CM8B 4OKSA 4GOJA 4URUR 5LBIA 1E2NA 1II8B 4ABYA 4D4MA 5B30A 1UDXA 1AKEA 5JECA 2BV3A 2PLRA 4TSFA 4V0MA 4CVNA 3NEJA 2QSYA 4NYIR 1SQ5A 2QQ0A 3QXSA 4Q48A 4CEJB 2WAXA 1VCMA 4EFMA 1MABA 1JI0A 2B8TA 4OQXA 4Q9KA 2ZI3A 5DHAA 2F3RA 5HCIA 3LD9A 4XIGS 5JS7A 1NN0A 3U6KA 2G88A 1WXQA 5FBWB 1ZBDA 1ZW6A 1Q1QA 2YOGA 5IT5A 5F9FA 3B1VA 2QTHA 1IN4A 2UVQA 2OLJA 4OI4A 4G5QA 5CLLA 4A0HA 4PO9A 2JLUA 1YR7A 1RJ9A 2WKRA 1JNYA 1VYVA 3CUEF 1EWRA 3EX7C 3AUYA 4YDSA 2ZRHA 5C18A 4PPNA 4C30A 4CT5A 2IBMA 2WWXA 3KB2A 3MMPA 2FPMA 3TSOA 4TYNA 2ZAOA 3JVUA 3K09C 2A7QA 2XJ9A 2Z43A 4BFSA 4B2LA 2ZVQX 4EPYA 1GRRA 221PA 2RKOA 1DS6A 4HDCA 4MRPA 1T3SA 1G7TA 1NN1A 2R9VA 3QEJA 3GJ0A 4E09A 1P2TA 3BAFA 2WSSA 3GJ3A 4ASUD 1CP2A 2IYZA 3P4XA 1FQJA 1NI3A 4I1VA 1LY1A 1ZCBA 1FOEB 1CTQA 1TU4A 5IDVA 5TB5A 4CEHA 3TAUA 3ZQJA 3ZVMA 1KI8A 4PC6A 4DVGA 2EU8A 4D4JA 2KWIA 5AJWA 1IXSB 2HJVA 4GZMA 3RRYA 1P9NA 1TUEA 2EQBA 4OQMA 5LD2C 5CK4A 2IUSA 2ZRKA 1D9ZA 2GILA 1Y3AA 4EQ6A 5CYPA 4P4SA 3T5GA 2H8KA 1KI1A 1H8HD 4F4JA 1XMIA 4HAUA 5BQ5A 4CT4B 1GSIA 3OFNA 3WNCA 4OI0A 2QY9A 4PPFA 3GJ7A 3RS3A 1EK0A 2G1KA 1IXZA 2A2ZA 3GLHE 1T91A 3U44A 3Q85A 4A9AA 2LKCA 2V54A 1MABB 3GJ4A 4W5HA 3RDPA 4UNSA 3I1FA 3FHTA 4DLWA 1DARA 2XSZA 1E2LA 4Q9IA 4DCVA 3HJNA 3VX3A 2QRNA 1IN6A 1KI4A 4PZZA 3DMDA 3VMFA 2J7PA 5LPNA 2FEOA 1LVGA 2QAGA 4Q02A 4N1AA 4QJ5A 1RJ9B 4Y0AA 1E0JA 4OJQA 3ZS9A 1Z5ZA 4IVPA 4URYR 2NO7A 1XFAA 4JL5A 3CX8A 4TSFD 5FTLA 3U6BA 2V3CC 5DIFA 5F2EA 5SZJA 1NLFA 4Z8YA 4XWKA 3EZ6A 3KX2A 4TZ6A 2WV9A 4L9SA 5JLJA 2O8CA 3BBPA 3CW2A 3T61A 2ZS8A 3GLGE 1Z0DA 2HXSA 2ZAMA 3OIWA 4ACAA 3ZVLA 1UKYA 4B71A 3TNFA 3WBJA 3ZGXA 2XNSA 3A1TA 3EC2A 2D2EA 3N2EA 4OI2A 1SXJA 3AQ4A 3VQTA 2IS1A 4CEHB 2IYSA 3D6TB 1W0JA 2OBNA 2WJJA 4A36A 3OHMA 4ZDKA 2V9PA 3AVPA 4RD2A 3Q8XB 2PCLA 3ADBA 1U81A 2NQ2C 4P4UA 4DLRA 5C2JB 2Z0MA 4TLAA 4B48A 4B73A 1FUKA 4KLNA 4GOXA 1JXMA 2G83A 1IY1A 4LYHA 3LFUA 4O2LA 4URZR 3IBGA 2ZRPA 4EQ6B 1YZLA 4P4SB 1N0VC 1T8TA 1ZYUA 3ASYA 3ZVNA 2JEOA 2YZ2A 1R2QA 1Z6XA 4PPQA 2G3YA 4IOMA 2BMDA 3AGQA 1MRSA 3B78A 2WSSD 2ZU6A 4LHYA 4I4LA 3DM9B 4JYCA 4B3DA 4JLKA 2RHMA 1WRBA 3U44B 2CMKA 2CCJA 4IDNA 3PCRB 1NG9A 4A4DA 2MMGA 3I62A 1TNDA 1N5LA 2D7CA 2ONJA 2I1QA 5EP3A 1QVRA 1XPRA 1J8MF 1OB2A 1Z2CA 1KO8A 2DFNA 2HF8A 2EYQA 2QAGB 3CNOA 1ZD8A 3GLFB 4KLZA 3THWB 2G0TA 4MRNA 1W4AA 1DTSA 5EE1A 4LWZA 3QI2A 3KKQA 4PQFA 1FW6A 1P60A 2QM8A 2CHGA 2AWOA 1KNQA 2LKDA 4Z51A 1AZSC 3LVRE 2XTNA 3I73A 4BFXA 1QG4A 2O8CB 1CJKC 4FMDF 2EYUA 1MR3F 3PUWA 3ZYCA 5J4LA 5KSYA 2XSZD 3W3AA 1RRCA 1QVAA 4D81A 2JLQA 3WHLA 4LBYA 3P27A 2GXAA 1SXJB 1E2PA 3U7GA 3TVTA 4FINA 3QXHA 3KJEA 4LRWA 4OHYA 2FV8A 1BIFA 1QHNA 2OFOA 1PZNA 4NZYA 4A92A 3NHBA 1GTVA 1OFIA 2FFBA 3QE0A 2JLRA 1N2CE 1J2JA 2DWPA 3W5IA 1E98A 3QEOA 1D6JA 4MUBA 4LGMA 4FIDA 5L3SA 2EWVA 1P2SA 1XNJA 3GLFE 2FZLA 4M8NE 1G18A 3ZLJA 3JZMA 1ZU4A 2UKDA 3BC1A 4ZIRA 1SXJD 1F3OA 2J0QA 4K46A 4U02A 1G6OA 1W0JD 1IJEA 1M7GA 4AKEA 3LBHA 1CF4A 4V0OA 3VHXA 4ZKDA 2IHBA 5FOWA 3NC0C 1U90A 4ARZB 4DWJA 4LBVA 1XCMA 4OHVA 4NU0A 4YMTA 2OV2A 4US0R 1OH6A 4HZUA 1CJUC 2O52A 1KKLA 1M7HA 5HZKA 2RGGA 3KFVA 2F55A 2CK3D 1NBMA 2J87A 3P32A 3CONA 5FTKA 3QF4A 1FFHA 1G3IA 4D82A 2JLYA 1DE0A 3A37A 1LF5A 3Q7PA 4JVMA 4RFVA 3SQXA 4LHZA 1II0A 2NO1A 4EPVA 2F43A 1R5BA 2XX3A 4H1VA 5H70A 4EJSC 5K8LA 1OFUX 4HAYA 4RJLA 4DCSA 3K8YA 1NG1A 1EX7A 1AQUA 4A2PA 3V00A 3AVYA 4TZ0A 4OHZA 4BLPA 1N6KA 3GFOA 1Q1EA 4LK2A 4OK5A 2CL6X 4QOSA 4FN5A 5EZ6B 5JJIA 1N5IA 4AYXA 2O0KA 4JVLA 3I92A 2IXFA 1NF3A 2ZQ5A 1KI6A 3D8BA 4I1SA 3W6NA 3FE2A 4M9ZA 2YKGA 5F9HA 4JVNA 2WHXA 1E79A 4HAWA 1IXRC 1OXSC 4MKGA 4V02A 2WWWA 2C04A 3BORA 3DOEA 3NC1C 1ZRHA 4WBSA 1XZQA 4HLUA 1TPZA 5FL7A 5L3QA 2AL7A 1G19A 2JLZA 3U3OA 2QMHA 3M1IA 2HT6A 3AVQA 1IM2A 4GZLA 4HB0A 1OSNA 1I2MA 1KO4A 5L3SB 2RGNA 2CE7A 4JLNA 1X8JA 4BQSA 4DSUA 1YE8A 4IOJA 4PHGA 2HXYA 1I4DD 3VKWA 4ZIRB 4UXJA 4GDFA 3F3YA 1GM5A 1NKSA 2W2VA 4OI1A 1R0WA 3KXLA 1YU9A 1JB1A 1UEJA 2ZRMA 1ESNA 3R7WA 1OYWA 1VG8A 4Q4JA 4LBWA 4HZUB 2Q21A 3C41J 1JPNA 3VR1A 3QVUA 2EW1A 3C5CA 4OHWA 2CCKA 4LV8B 2OBLA 4F38A 1M7BA 1PLKA 5BXQC 1GUAA 4OK6A 2A5GA 4LJ8A 3THOA 3QF4B 5TVKA 4QBHA 3U7EB 2VSOA 4TYYA 2HJGA 2P5SA 3EC1A 3CX7A 4V0LA 3D31A 1OW3B 4LV5B 2F43B 1Q3TA 3ZQ6A 3K0FA 3NDPA 2ZJ5A 1AM4D 1XBTA 2VSXA 4NCJA 4N0EA 1UBCA 3LQRA 1R0YA 2ZSEA 2C9YA 4PSVA 3BS4A 3SS8A 1TF5A 4US2R 1G21E 1X86B 2ZIAA 5KSZA 3KKPA 1E2DA 2JA1A 3DVLA 2CHQA 5CDFA 4G0NA 4TLBA 3BXZA 1KI6B 1NBMD 1DOAA 1J70A 3RRZA 1RC8A 3GP8A 2OEPA 3AGPA 1IY0A 2ZVPX 3SZRA 2WAYA 4BLSA 1K6MA 1A82A 2WJHA 3CKLA 4Q21A 3C4JA 2G9NA 1AS3A 3TE6A 5L3QB 3NVAA 1MV5A 1W48A 2GVZC 3UG6A 1CR0A 4FMCB 1QHXA 3CZPA 3R9WA 1P4SA 1ZM4A 1KAGA 1E9FA 3NBZC 4JYBA 5J4YA 3PEUA 4CYMA 4AWXA 2GJAA 5JCZA 1VHLA 3T35A 5JCPA 2ZSFA 1KI7A 4IW3B 1SZPA 3ZZ0A 4A82A 1QF9A 3KKNA 3U3KA 4QNRA 5TDHA 1N0UA 4GP6A 1E79D 4MGIR 3O8RA 3CM0A 3R7WB 4WZAE 4AG6A 4Q4JB 5FOTA 3OIUA 3FMIA 2ODEA 2WSMA 5AUNB 5BYKA 5AUQA 2FFHA 4C0AC 5M04A 2ZE6A 1CULC 4IJMA 1T5IA 2QGNA 1F5NA 1AS2A 4A8JC 3U7FB 2R65A 3AVVA 3OIVA 3RYTC 2BJVA 4QHYA 3GEEA 2RGAA 2FE4A 4JBYA 1E4YA 1VIYA 1VPLA 4ESHA 1G3UA 1QHSA 4DDWA 4Q1FA 1AQYA 3IILA 3CR7A 1E1RD 4MYHA 3IEUA 2QUZA 2GETA 3LLMA 3O8CA 3SE0A 4QC2A 2FH5B 4QJ4A 4CW7A 1SVKA 5BW8A 5SZKB 1CBUA 1GL9B 2N42A 2ZE5A 4HZIA 3B82A 1TF2A 1N6NA 1S4QA 3KDSE 4YMSA 3RWOA 1G3RA 3JVVA 1Z06A 3WYFA 5AUOB 4NPHA 5JWRA 1QZXA 3ND9A 3KB1A 1BOFA 4JT2A 1YR9A 3C5HA 2GZDA 4PO8A 3TUIC 5CITA 1GFIA 3N5CA 3B1ZA 2ZE7A 4RD0A 2DY1A 2QTFA 1W0KA 4F92B 3P1JA 4OYHA 1ZD1A 1DAMA 1TEVA 2VEDA 5DI9A 2GXQA 3TQFA 3K09A 2HUPA 4PX9A 1KSFX 1OXXK 1JR3A 2XITA 2VA8A 2DCUA 4IVRA 1Z29A 3CF0A 4TT3D 1GITA 4P3YA 4AYTA 5JZVA 5A5GA 1AIPA 5G3ZA 1ZAKA 4PAOA 4DUGA 2WPDD 4Z54A 2R8RA 1OKKA 3AP3A 1HUQA 1PLJA 3EZ2A 2GXUA 3LLUA 3WHKA 4WXPA 1S1CA 3QKSA 1VG0B 3RS4A 1HURA 2AK3A 1KOFA 2PMDA 1ZMXA 3EIEA 3QXJA 2ZU0C 3C15C 2QU8A 4KYUA 1SGWA 1NJFA 4OJKA 1P62B 4DXAA 1S9HA 2VH5R 4NH0A 4XD7A 3AVOA 4XH9B 5CDFE 3RC8A 1NJGA 1G291 4JKIA 3A58B 3OZXA 4XJXA 721PA 2WICA 1M8PA 2IT1A 1QHGA 4RCYA 1KSGA 4JL6A 4N3NA 1RPZA 2VYFA 3IUYA 2JASA 4D4LA 1E0KA 3W9YA 1SKQA 2OCAA 4JLAA 4WAUA 1NSTA 2ZANA 1KHTA 3VNUA 2OG2A 3DPUA 2J46A 5C1BA 1BO6A 1TF7A 4LJYA 421PA 4L4UA 3EG5A 5TXGA 4H9GA 1WF3A 2DFLA 5EQTA 4B6FA 2AD1A 2VP5A 4O25A 3BWDD 4XVUA 3L0OA 3PITA 1Z0KA 3T06B 3PV0A 1F2TA 2XB4A 4QHTA 4Y0VA 4B47A 2A30A 1DO2A 1JQJC 2XTMA 1IN7A 1W1WA 1G6HA 1GDDA 2O8EA 4HLQB 1S2MA 2P6NA 4U5XA 3QOFA 1U99A 3X1WA 3WRYC 3IIKA 1CLUA 4B2PA 1ZP6A 4BFTA 4I1OA 5AJYA 3LV8A 2NG1A 1T0HB 2AX4A 1CR2A 1RYFA 1MT0A 4P4TA 5FBQB 1FPMA 1VCNA 2GAAA 3D7MA 5FL3A 3T1VA 1E9RA 2CCGA 1NY6A 2D4HA 2H7VA 3FHCB 1KY3A 1JJ7A 2D06A 4B3FX 2VHCA 3AVXA 3R9XA 3QPVA 3MG9A 3SDZA 1E2IA 1EFHA 1J8YF 3EPLA 1YRAA 2VF8A 4R2HA 3RS0A 2V6IA 5AUPB 3QXCA 2F6RA 4QHSA 2FPKA 1T6NA 3F5FA 5JRJA 1RRGA 1XCPA 2OCBA 2DR3A 2V7QD 2CDNA 4Q47A 2C95A 5LD2B 4C0QC 4RD1A 3A1UA 1XPOA 1IOZA 4PQYA 2N46A 5KUTA 2FDCA 4ZPXA 1JR3D 1D8TA 1FZQA 2R44A 2AXNA 2BCJQ 2JLXA 4C0JA 1GKIA 1IAQA 1P73A 2YWFA 4LI0A 2RB4A 4DUGD 1OKKD 1XEXA 1XTRA 2NZ8A 4IFBA 1KJYA 4FCTA 2FF7A 4QBFA 2ZJYA 3WYGA 3BB4A 4HDOB 5FPKA 2ZUCA 4TQAA 3TVDA 1CJVC 1OV4A 2REOA 1YZKA 2BKEA 2XTZA 2BVNA 4YC7A 3TH5A 5HZHA 2F1RA 3KQLA 2ASEA 4XD7D 3J81k 1F2TB 3A36A 3F0TA 5ELXA 3W8RA 1P9WA 4EPTA 4ZCIA 4GPTA 2O8EB 1UJ2A 3ZH9B 1KI3A 4RKEA 3AVTA 1NRJB 3PEWA 1JALA 2ERYA 3BK7A 3W6OA 4TLEA 4TLDA 1KDPA 3L82B 2WWGA 2VF7A 4TL8A 5GVSA 1D5CA 4Q66C 3BH0A 1GRNA 3QKTA 1AGRA 1RYHA 4NCNA 3FWYA 3EA5A 3KUCA 3GCGA 1KDRA 4H1UA 4DDVA 2BOVA 1CU1A 1BH2A 1W44A 3L8YA 1UBFA 1UM8A 2ECKA 1P72A 4LJ7A 5EE0A 4KO8A 4LYJA 1Z6GA 1TUIA 2R62A 2DFKB 5KSPA 3RS5A 2ZJ2A 2FOLA 3H2YA 3W8NA 3UIEA 2AD5A 2CNWA 1Q12A 2CEAA 4QKQA 3GJ6A 1E9CA 2DHRA 4W5JA 1Q22A 4WZ6A 5B2ZA 3MSXA 4C0SA 4EAQA 3ZD6A 3G82C 4AY2A 2ZUDA 3WMFA 4X8HA 2WJYA 3GLIA 2H57A 4MDFA 3VX4A 3QBVA 3O8DA 4M1TA 3OF5A 2FX3A 5FOXA 4DT1A 3QG5A 2JGNA 3PXGA 3DZDA 5G53C 5DI3A 2EFDB 1XEXB 1E0SA 2DWQA 2X77A 1CRQA 2Z5FA 2ODNA 4LDJA 2EFGA 3MWYW 2IA5A 1WA5A 4IDQA 3EPHA 2IW3A 3R8CA 4KYIB 2GVDC 2ODBA 2RGEA 2IWRA 5IF9A 2P6RA 4WA7A 3CIOA 1XTQA 3B8HA 4M53A 4D2IA 2ZRIA 1MOZA 1FL9A 1Q1BA 1ZU5A 2JCSA 3LVQE 4HB3A 1AK2A 3U60B 4NONA 1E1QA 4QGGA 3RSOA 1CXZA 5K8UA 4TYQA 5JJLA 1OH8A 3QG1A 3W5JA 1V43A 4EUNA 3EPJA 2ZI7A 2I4IA 2IK8A 4EJSA 2CBZA 2QP4A 2B6HA 3EA0A 1LS6A 2FA9A 1E6CA 4BZPA 4QBGB 4E5UA 1G8PA 2ZUBA 1XDBA 1XEWX 1Z47A 2VHQA 1Z2AA 2C9CA 2Z6VA 4G5SA 3CH4B 1RRFA 3NWJA 5KNCA 4TLCA 1TQ4A 1RFLA 2ZE8A 4YMVA 3L0PA 1DAGA 3TW4A 4HATA 1TQ2A 3REGA 2Q3MA 5K8TA 1XP8A 2VO1A 4O0MA 4ON9A 3FVQA 5AK0A 2JAQA 5FTJA 5KDDA 2XOKA 4HDQB 1OT3A 4KHZA 4MH0R 3OEHA 5JRZA 3W6PA 2VP0A 4NYJQ 4S2EA 2DFTA 3QPWA 3KQKA 2XEXA 4J0QA 3GLIB 1SVMA 3W3ZB 3IKJA 1W4BA 4DT1B 3VR4A 4HUTA 3K70C 3IDQA 3U3MA 3I32A 3MJHA 2ZR0A 5DI3B 4C0KA 3SJBA 5K8IA 1OJLA 1G7CA 4EFLA 4GMDA 1E9EA 1Z0FA 1E9SA 3MWKA 4YXWA 2O0HA 2DBYA 3CF2A 1E96A 2GEDA 2WM9B 5F98A 1U0HC 4MDEA 2IYRA 1G20E 4V0ME 1XF9A 2CNWD 3IPXA 1PUJA 3ETLA 1E99A 4BLTA 1SHZA 1K5DA 1N6OA 4A0RA 4LOAA 1UBGA 4WIAA 4TQ9A 3X2SA 5IK2D 3BFXA 5DN6A 4CF7A 5LB2A 5F3WB 4URVR 2V4ZA 4PC1A 2J41A 2GEUA 4B35A 3FPAA 2FWRA 2JJ2D 1H65A 1BYIA 4PXAA 2CK3A 4EJSB 1COWA 1ZD9A 1AKYA 2AR7A 3AKDA 5P21A 5CIQA 2JIZD 3U5ZB 3SEAA 4Q9LA 3CRW1 2A3RA 4TTPA 2XJ4A 1XD8A 1T9HA 4PC2A 4RD4A 3PJRA 1NLZA 2BM0A 1R8SA 4C0HA 2J45A 1BS1A 2OXRA 4BFUA 5JJKA 3I72A 3FOZA 4B33A 3SC3A 1ZNYA 4LV6A 1C1YA 4MYCA 1R8QA 1E1QD 4MRRA 4CDGA 2ZRCA 4KCGA 2EWWA 2CJWA 4PSAA 3V4RA 1OIVA 2PZEA 1GRQA 5FH9A 3WXMA 4L8GA 3VTKA 4Q18A 821PA 5B64A 1RVDA 4BECA 1XJCA 1KTVA 2PZGA 1S96A 1MH1A 1D2NA 2ZRNA 4A0FA 1U9IC 3QKUA 4I81A 4K8OA 1Z8FA 2GA8A 121PA 1D2MA 4XWAA 2QM7A 1E2FA 3NG1A 3K53A 3S1AA 2VHTA 5EE9A 3AEZA 3DL0A 4CZ2A 2ZEJA 1Z83A 3HYTA 1LF0A 5CM9C 1DBSA 4DLXA 5JEEA 1GL7A 2LCFA 4M1OA 1KI2A 2WWYA 5HTKA 1KDTA 4RZXA 2XOKD 3TSZA 3OEHD 5DGXA 1F48A 2ZRGA 3TMKA 1DG1G 1NMXA 1VCOA 2P65A 4MITA 1VDZA 2CL7X 1WMSA 2GXSA 2OT3B 4FMCF 4ZI3A 4DEXA 2XXAA 4A8JA 2XNDA 1QHHA 2VHJA 1NMYA 1N6HA 4DEYA 1QG2A 1XTJA 2IWHA 1TL7C 4V03A 3GD7A 1HT1E 1MKYA 2CXXA 2HCBA 3AKCA 3IO3A 2C9OA 4IEEA 3UK6A 2F3TA 4YXWD 1JEEA 1Y63A 1JXOA 3FKQA 3FYHA 2IXEA 4OL0A 2VP2A 1KDOA 2X1VA 3KKOA 5FOSA 2G0NA 3X1YA 3RRNA 3SQWA 3K0CC 1YJ5A 2GJSA 3MUFA 4BUJA 3Q5DA 4DCUA 1Q21A 1UKZA 3MGCA 2C78A 3MFYA 4B3CA 1W2GA 1H8ED 4MGKR 4NMMA 1TEXA 3SHFA 2OCPA 5DN6D 4NE2A 3I61A 3G0HA 3NEYA 2J1LA 4W5WA 2CJWB 4JJKA 2W6IA 4A6XA 3QPUA 4Q7KA 4Z1MA 1COWD 4ZDWA 2F1IA 5A0FA 1SXJE 2GCNA 1MO5A 3LNCA 5E7IA 1YR6A 1E9BA 1P75A 1XU4A 3O47A 4AK9A 4Q1EA 2O5VA 4RD6A 3WBKA 1ANKA 3IHLA 5EXXA 2ODWA 1P61B 4PPGA 5KYKA 1NVUQ 1OF1A 5L3VA 1DAKA 3OESA 5DSZA 4AKIA 4IXNA 3KKMA 3CZQA 1E2HA 3V9PA 4JVSB 4E03A 4C2TA 2A5FA 2FSGA 2ZJBA 4QNMA 3FGNA 1ZJ6A 2HLDA 1X1SA 2IEZA 1R4AA 3NH6A 3NBXX 1E2KA 4DLZA 3MJRA 3EASA 3TK1A 4FXPA 4IDHA 3EPKA 4F4IA 5CIWA 4L15A 3UMRA 2H92A 4PC7A 2R6GA 2F9LA 4A8JB 1QHHB 3BGWA 3I8XA 3B60A 5FPYA 4KI0A 3GPLA 3EW9A 2H5EA 1XPUA 4GSYA 1B0UA 2YNMA 1M2OB 3ASZA 3CWZA 4D0GA 2D3WA 1P2UA 4WOPA 1XJ0A 3UANA 4OHXA 4PAMA 4XVRA 5JMTA 2QBYA 5C4GB 1CRPA 1JAIA 2W2XA 4Q19A 2PJRA 3NH9A 4DCNA 5DE3A 2X19A 5E7JA 4PZYA 1HV8A 5JEDA 3OEEA 1CR4A 1DAFA 4LC0A 2WBLC 4G1UC 5D3MA 2P2LA 1DAEA 1E2GA 1E1RA 4EPXA 2HF9A 3A1SA 3HU1A 1LS1A 1ZNZA 3C8UA 2RGBA 4Q7MB 1UEIA 4LC1A 3A4NA 4QM7A 4EFNA 1XRJA 4BEBA 2XNDD 2KI5A 4DSOA 4R7ZA 2WWFA 4M9SA 3B2EA 2P0EA 2O0JA 1HT2E 1KIMA 2GWHA 3ZIAD 4B3XA 1ZIOA 1Z22A 2XB2A 2NMVA 1NVXQ 4DB4A 3VR2A 2PCJA 3RS7A 1QBKC 5J4HA 4P0TA 4TTQA 4KITB 1ZC3A 3L43A 4F7WA 5HR5A 3R8FA 2OFXA 3SJAA 4BPBA 3L2OB 2Q9CA 5TARA 4PO1A 1EGAA 2VLIA 4I1UA 3CRVA 4JSTA 3IGFA 5DLQC 4DSTA 2GAOA 3X1ZA 3VKGA 1OPXA 1US8A 2I3BA 3E2IA 1CJMA 1N0WA 4TT3A 2AKYA 3B1YA 1KSHA 1LV7A 2C8VA 4UXIA 2ZYTX 4ZDJA 4OQNA 4B74A 2W6ID 2DYKA 4QJ3A 2WPDA 1R5OA 2KB0A 4Z1MD 2BJWA 2B21A 3HU3A 4GRAA 2IUTA 2R6FA 3O8BA 4JLMA 1KAOA 2GKSA 3N70A 3SNHA 5UKDA 3CF6R 4C0LA 4DCTA 4W7SA 4HB2A 1ZM7A 2P5TB 1NBME 2QBYB 1VHTA 3RNLA 1M6NA 2XZOA 2QE7D 3QUSA 2ANBA 2VP4A 2JJ1D 1XTSA 2HLDD 1AZTA 2GF0A 2QN6A 2WJIA 5DISB 4M0LA 5KU1A 1IHUA 4UJ3A 5AR1A 2ZR9A 1XMSA 2A9KA 2WKPA 3F8TA 4DLUA 3QNUA 4LPKA 5FI0B 2ORIA 3NIBA 3RLFA 2EFCB 1XXHA 1CR1A 2XZLA 1T5LA 2WOJA 3TRFA 1E2JA 2UZ3A 3ADDA 3HDTA 3EIHA 3UWKA 5EJEA 5BN4A 3CWQA 1CJTC 4ERNA 3P26A 4MRSA 5CJPA 2G1JA 3T1TA 3FKSD 4MA4A 3OAAA 1GIAA 4B3BA 2JLVA 2ZR7A 2ZM5A 3B13B 3VU9A 3I8SA 4L9WA 3C14C 4DJTA 1CIPA 3UPUA 3AF0A 4A15A 4WW0A 4LJ4A 1JBKA 2HV8A 4KODA 4PSKA 1MO3A 2EVWX 4JKYA 3OEED 4N0DA 1ODFA 3K0FB 2P67A 1S1MA 2IYQA 2QP3A 3M4YA 2NO9A 2AN9A 4O2RA 1OXUA 3E5HA 2VP6A 1XEFA 5HE9A 1V5WA 1KGDA 1US8B 1FP7A 1KY2A 2WWIA 3NDBB 4FD2A 3SHWA 3WMGA 2NO0A 1G17A 4TMXA 1SVWA 1E2QA 2Q9AA 1NVVQ 3QY0A 1G8FA 2B7BA 1N3BA 3FTQA 1VCIA 2IUUA 4DLYA 4JIMA 3HPQA 3AH8A 3B6EA 1X6VA 2J7KA 3I5YA 2ZETA 4HI0E 4MGYR 5FI1B 1FX0A 2H1LA 4NKRA 4YMUA 1JEDA 4BFWA 4BEJA 4IHQA 1II9A 1XB2A 5SZHB 2PX3A 2V7QA 4AIIA 4TMZA 1WB9A 1J7KA 3LQQA 5CK5A 3GJ5A 4LY6A 4AD8A 1D2EA 2RGXA 4GFDA 3ZDQA 1LW7A 4NCIA 2KBFA 4EIWA 2D2FA 1GKYA 4GNKA 3ZVRA 1ETUA 3H84A 1AA9A 4JMPA 4UNQA 1D9XA 2GJ8A 3A8TA 2KSQA 4XTRA 2C96A 3GMTA 4M2LA 2YV5A 1XXHB 4BRUA 4YLGA 2HYDA 5LB4A 2CHVA 2RHDA 1JJVA 1UADA 1Z0IA 3SOPA 4NP6A 4JLDA 3UMSA 2GHIA 2NGRA 2A5JA 3GFPA 3LW7A 3PUYA 4Q9HA 2OLKA 2AFIE 1Q44A 2JLSA 3K1JA 1UAAA 3LH5A 2FJUA 4NYMQ 2BCGY 2SHKA 1WCV1 4M21A 3VNVA 1JR6A 1HY3A 1A2BA 1SVIA 2Q3HA 5FBVB 5D3QA 3QSYA 3R9IA 2HT1A 3FHOA 4HEJA 1DEKA 3SR0A 4BLQA 3AP2A 5AJZA 3EZ9A 1SKYB 1F60A 1X8KA 3HR8A 2CLSA 4LHWA 1XJQA 3HR7A 4AKGA 4FW9A 3ZZTA 1SVLA 2IL1A 4GMXA 3CRMA 2IYXA 2P3SA 2W0SA 3OAAD 4KFSA 4Z8XA 5DO9A 2IHYA 5CYOA 3OE7A 1KMQA 3W34A 4R71A 5LDDC 3VHLB 4LHXA 3ZD7A 3A6PC 2ZITA 1XZPA 3RANA 1EESA 1S3SA 5FR1A 5TY0A 1XXHE 1E0AA 2A78A 2QQEA 2GCOA 2QMOA 1NN5A 1FX0B 4GBMA 2P6UA 1OB5A 3K9LA 1TQDA 3GJ8A 1G7SA 4LSGA 2D7DA 5ANRB 1ESMA 1EFCA 3WY9A 5EXPA 1XX6A 1X1RA 3TBKA 2IS4A 4CGZA 3NTUA 2D62A 2QG6A 1OXTA 3IPYA 4MUAA 1MRNA 2OXCA 5FPHA 2QNRA 4DLSA 2TMKA 3H1TA 5JBQA 2ZREA 2Z4SA 4UKDA 3QKSB 3K0AA 3B5JA 4JL8A 3DDCA 2ZJAA 1SKYE 1S8FA 2ZYUX 1KYIA 1L4UA 4IEIA 1W36C 4LZZA 4B34A 1WQ1R 2Q3FA 1VIAA 2BIFA 1JQLB 2V8OA 1IJFA 1P6XA 2FMXA 3BOSA 4IDOA 2IYVA 3FMPB 3CLVA 2VP9A 5J4VA 2G6BA 1Z3IX 4B44A 3RRMA 4WXRA 5JHGB 4V0NA 4NBSA 4KAXA 1VG1A 2W00A 4PANA 1PJRA 5L3RA 1ZCAA 1E2MA 3BB1A 4U00A 4UJ5A 4UXHA 4CRWB 4DSNA 4I99A 1J99A 1JR3E 1NY5A 2R6CA 5HCNA 3KTAA 3RAPR 4YQFA 1E69A 4R9UC 1ELOA 4RVCA 3P20A 5J4KA 2YC2C 3GLHA 1A4RA 4TMVA 3KXKA 3L0SA 2BM1A 3KJIA 2QMEA 3PR1A 2X2FA 2BEKA 3BFKA 1E9DA 2GCOB 5GVRA 4DDTA 1FMJA 1U9IA 5KDLA 2IC5A 4LJAA 4E07A 3VR3A 3SI7A 3K70B 2WIBA 3AV0B 4BWYA 3DZ8A 3T34A 4LPSA 1FTSA 4M1MA 5JWOA 3KZ1E 3B1XA 5GADl 4ZI2A 1R10A 2W83A 1WE2A 3CRQA 4Q1CA 2ATXA 1TQ6A 3MLEA 4HLCA 2CVFA 4X8MA 3GQBA 4KBGA 3BERA 5DYIA 3T12A 3OE7D 2J0VA 1RZ3A 2MSCB 2HCJB 1E3MA 4DLVA 3PVSA 2OSBA 2E87A 3T1OA 2QI9C 5GJWC 2PLFA 4AURA 3K0AB 3GLGA 1W4RA 1N6LA 1TADA 3FMOB 1RIFA 4AKHA 1KZGB 4ACBA 1GOTA 1YZTA 4D0LB 2YOFA 3K70D 1Z08A 4IOLA 5EE5B 3RSLA 2J5XA 3QVVA 4A0GA 4HUQA 4Q4AA 1W47A 2VHUA 3C16C 3A4MA 5CB6A 2WMOB 4RZ2A 1HYQA 5IK2A 3WRXC 1JPJA 5KO2A 1G8HA 2VTKA 1OLOA 2JJ8A 4Q5IA 1NNEA 2ZS9A 3BH7A 2I1VB 3ECCA 2JJ2A 3WP0A 1R7RA 1ZM9A 4EPRA 3BFVA 1RRPA 3PUZA 2AXPA 1KNXA 1I2DA 3DKVA 3K0CA 4GI7A 3U4QA 2PBRA 2JIZA 2IS6A 2E9SA 3GJXC 5GJBA 2PMKA 5JWHA 3KTAB 2IF2A 2V55B 4G5RA 1UBEA 4MRVA 1YZNA 2KE5A 2V6JA 2C03A 1XTKA 3GLHB 2WKQA 1SVOA 2BBSA 4KBFA 3FDIA 4OQLA 1EXMA 4YDHB 3SJZA 1TX4B 4LYAA 5DNYB 3RHFA 1A1VA 1VG9B 4WZBE 4DKXA 1N5JA 1L8QA 3K0SA 4X8OA 1NL3A 3KJHA 2PEZA 1HQYE 2R6AA 1KK2A 3HYRA 4DIDA 5KHOC 1XEWY 4IXMA 1DELA 4BLOA 3EWSA 3WNBA 1PV4A 1DO0A 4G3XA 1XWIA 1GZSA 2BMFA 4B43A 4JZKA 5EUMA 5G40A 1U98A 4RD3A 2ZI6A 3HU2A 4EPWA 2FGJA 2V1XA 3AF3A 4AYWA 1F2UA 1UPTA 3QF7A 3PEVA 4A2WA 5EXTA 2ZS7A 1HEIA 2R2AA 5EZ5A 1EFRA 4A6PA 3NHAA 4EKDA 4JLOA 4LUCA 4U7DA 3I3SR 4AI6A 2FG5A 4TYPA 3GLGB 1G9XA 1NVVR 5FPTA 5KNBA 2F1HA 1P9RA 5C46F 2O8FA 2X2EA 2MSDB 4TN1A 4XVQA 4ILEA 1O87A 2GJ9A 2VBCA 1YKSA 1FUUA 2A5YB 1S9DA 4TTRA 1W5TA 5JI2E 3WNDA 2F1JA 3QENA 1W49A 4TWZA 4NHOA 1NN3A 3WP1B 2ZXUA 2GBLC 4HUQB 4LBZA 4Q4AB 3A4LA 3LWNA 2BWJA 1N6RA 2ZRAA 4LX0A 4KSCA 4IDPA 2IYWA 2OAQ1 2Z4RA 3PUXA 4RZ3A 1G5PA 2YWEA 2WIAA 4BE7B 4PC3A 2W6JA 3P4YA 1GG2A 5BN5A 1W2HA 1K5GA 1N5KA 1NP6A 3U4QB 4M1WA 3EAQA 5IRCD 5IHPA 1VTKA 3U3JA 4MKFA 1W7AA 1WDTA 3K9NA 4JLJA 3TJZA 3GLFA 3THWA 2ZRBA 1RKBA 1M74A 1AN0A 2FU5C 1HE1C 2AFHE 2GDJA 4CIDA 4C9BA 3EWAA 4NCHA 5JSZA 3THYA 2FFAA 4P33A 1H8EA 1G5TA 5DHFA 4KXFB 1YR8A 2RCNA 3A1WA 4A1FA 4KVGA 2J3EA 3MAAC 1DAHA 4NYMR 1UKVY 4QXAA 2NZJA 5E95A 3LA6A 1YHNA 2YINC 1OE0A 4II7A 3KQHA 5JHHB 1F6BA 4EDHA 5TV2A 3TQCA 2VSFA 3IQXA 4B6EA 2GESA 5DYGA 3GLIE 4JBWA 2O8BA 4XTCS 2ZRFA 1F2UB 2CL0X 4KU4A 2B92A 2CVHA 5CLQA 3VR5A 2YVUA 3BE4A 2LWIA 2NPIA 4Q9JA 1KMHA 1KI9A 3DOFA 2W58A 4KJZA 4MYUA 4FMBB 4E22A 3PUVA 4AG5A 2O8FB 4QGAA 3UATA 2W2TA 3UKDA 2QAJA 3QJYA 4URWR 4OK3A 5KPDA 4BFZA 3JZAA 1QRAA 4S35A 1M1YE 3FMFA 1OIWA 1NIJA 4A2QA 1DADA 4Q01A 3PIRA 5H8WA 2AKAB 1W4CA 4QRHA 4C4PA 1FNMA 4ARZA 2ZRDA 3LO5A 6Q21A 1Z6TA 1R5NA 4ZCMA 1EFRD 3GFTA 1L7VC 3B9PA 1E9AA 1G4UR 2BMEA 2J9RA 3FB4A 4DC9A 2IYTA 2REXB 4JS0A 3AKEA 3PFIA 1KO5A 1EFTA 2V1UA 3OFND 2B7CA 4ZDIA 4Q7JB 5CB8A 3AUXA 1DPFA 3Q72A 5JSZB 2B8WA 5KTYA 3THYB 4M1SA 4TMKA 2OILA 3N2IA 1L4YA 3AF2A
chains in the Genus database with same CATH superfamily
4XUGB 5HK8A 3VR6A 1OWLA 1F0NA 3LNTA 3VV3A 5K0CA 5J47A 4DA0A 3MCUA 3AF1A 4RZUA 3IUPA 1K0FA 2Y27A 3AEQB 2QSJA 2ADFA 3HKEB 3BWMA 1YS9A 3ZHVA 5CFQA 5I9IA 2J31A 4R0VA 2RGDA 1PUIA 4L22A 4TVKA 4X94A 5HTOA 2HR1A 1XIVA 1U8XX 3G2NA 2I3GA 1TAGA 2JGMA 1EWQA 1PLLA 5EP1A 2C3MA 5E4TA 3HEMA 2AQKA 3CH5A 1O6GA 1SC1A 3OCCA 4IVQA 4XLLA 3ISJA 3OLXA 1KGSA 4KUHA 1M2HA 3JD3A 3ZTYA 4B9AA 3NFYA 1J22A 1YZ3A 2V9CA 4BZQA 1YQTA 1T6BY 3C7AA 4DYVA 1KP9A 3O2JA 3LJKA 3D6FA 4PIVA 5EJFA 1QU3A 1X0XA 1KMHB 2BC9A 3KZXA 2ZK7A 16PKA 4B17A 1LLFA 3AEYA 5AW3A 3KJFA 4PFQA 3EEYA 1A5BB 3RWBA 1TM7E 2OGUA 3D8NA 1F8UA 2ZI9A 1GPWB 4HNTA 2DTXA 4E4YA 3ELYA 1RCTE 3IAAA 2BBTA 3NDRA 1BWPA 3PFNA 1OFHA 1LSSA 5KYYA 3WBBA 3DHYA 2V7TA 3ROFA 5ERGB 3AJRA 5KOYA 2NYVA 4KGDA 1QGYA 1XXLA 2IXGA 4R98A 1DJLA 3COPA 2O7SA 2WVJA 5IF3A 4QGHA 3CB4A 2VTDA 3S29A 1Z5WA 4OBBA 4LGYA 1I4EB 2WILA 2VPPA 4QPDA 1WLYA 3FUVA 4BGEA 3SG0A 1F06A 1YGYA 1R6XA 1T26A 2DVMA 1VECA 2D5LA 2O9JA 1ZO8A 3AZOA 4YONB 2RGCA 1SVNA 2NSDA 2CNLA 1EK5A 4J90A 1YULA 3X1XA 4KR6A 3VYUB 3X3HA 3N07A 4LKRA 4QG7A 2V3VA 1GWNA 1JEYB 3NBKA 3RK4A 2CYBA 1DC7A 3FETA 3GL9A 5F7ZA 3V4ZA 1T3LA 5CBKA 4YAEA 1Y33E 4K6FA 4KUEA 4E32A 1AUPA 4E5NA 3L0IB 2WHPA 5TIIA 2VJMB 3E81A 1EGQA 2DKNA 2XMBA 4Q00A 3DV2A 5B58C 4EX7A 3U9SA 1TRKA 1XD9A 3NKVA 3WWYA 4YP9A 5BW6B 1ZQ1A 2WSIA 2XF2A 3CZCA 3P0EA 5AQ1A 3GZNB 1MQAA 2I9PA 2P1ZA 4US1R 1C2TA 4L4SA 3SFZA 2QIOA 3KFXA 4KW7A 1AKTA 3PZBA 1WSWA 3KD3A 3TL6A 1WABA 1W5FA 3P7MA 5J5CA 1RHMA 1MH9A 2B9EA 3PNKA 3UWMA 1NR7A 2QTAA 3TTVA 1BKDR 1F0PA 2Z5GA 3LC7O 2I0FA 4ETIA 4FNMA 3Q9LA 3O0DA 2WIGA 3BD9A 1TVKA 1NNI1 5ICEA 2RK4A 1VMAA 3H2KA 4G1EB 4P32A 1DO8A 3KFLA 1WUYA 4FDVA 3LXMA 4YRTA 5LQNA 3D4NA 4JI1B 2I67A 2QAGC 2P9QA 2V9ZA 3H1GA 1LRLA 3PX2A 4HOYA 1EFLA 1WG8A 5GV7A 4QPCA 1L7XA 1QP8A 3JATA 4UFNA 3VR6D 2YWGA 4CCYA 3QELB 3AF4A 1SCUA 1D0VA 1JMKC 3B85A 4G5OA 4I6EA 2JAHA 3K0EA 2FRDA 1ZHFA 2I78A 1T2FA 3VVBA 4AP5A 3SKVA 3UAXA 2JRLA 3KT3A 3KXIA 3MAGA 2HMVA 4CNQA 3ZDDA 2I80A 3I05A 1Z0JA 5BSEA 1NMZA 3HB5X 3E23A 5CDHA 4UVHA 4YI3A 1RYMA 3DUWA 1BJTA 5TGDA 3TFQA 3ZCPA 3IIJA 2ZJZA 4EMUA 2GRJA 1RQ7A 3QVKA 4JVOA 5JS8A 3BJIC 2ZB8A 2R3SA 4QREA 1ORDA 3G02A 2Q6VA 1DQYA 2PXHA 4DJFC 4JXXA 1P1JA 3EXEA 3LW8A 1PVOA 3W5UA 3A4TA 5FUWA 3O3MB 2WIJA 3KBBA 3ONNA 2HDNB 5E4JA 1F0YA 1LWNA 2IZ1A 4D9EA 5FLKA 2MYTA 1GNPA 1KQFA 3ENVA 2EKPA 1MX9A 1V1JA 2QZ4A 2RBKA 3BMNA 1R0ZA 3JQ7A 3OCUA 4GYWA 4JZYA 4BFYA 5HRAA 1BQEA 4FHZA 3IAHA 5JY6A 2IXBA 2NIPA 3B7GA 1B8PA 4CEIB 5JISA 2UZIR 2VDQB 2JLAA 4NYJR 2QOEA 3RS8A 1KQ3A 5C1DA 1Y98A 2BHRA 3GP3A 3MTIA 4WESB 1G41A 5AHRA 4S1PA 1QBGA 2WIFA 2DBZA 1OH7A 4TWAA 4FMDB 3UV7A 1ZW1A 3DB2A 3HRIA 3VI3B 4FYVA 4TUYB 4F96A 2G9RA 3TW8A 4W5QA 3PC8C 5LQDA 4X93A 4C0BA 3R6GA 4ENRA 2H08A 3GUVA 1XZJA 3HRKA 4YH1A 1EHCA 5D3MB 4RH3A 2ZI4A 1H2RS 1NOJA 1QZTA 2D1RA 2H18A 4PCVA 1P5ZB 1C0PA 1WP9A 3GUYA 1WUTA 2P2CA 4WUTA 5KQGA 2GN9A 2QRZA 4HNSA 4L2IB 2QTVA 1L5GB 1T2CA 2MSKA 1RW4A 3NTOA 3QEMB 5AJVB 4PX2A 5ALKA 5FYDA 2I3ZA 4M1YA 3SKXA 1JHPA 1K0UA 4ID3A 4KWEA 3CZ5A 4U2CA 5K8JB 4JT4A 2EFEB 5EP4A 5DNDA 1UBRS 2IE0A 3CVWA 2J59A 3TR5A 3QV2A 1JXAA 3CF4A 4JHLA 2H54A 4QDXA 1GGNA 1TU3A 2VK4A 2ERXA 3FOWA 3L06A 4JC0A 1QGED 3H04A 1K7FB 3N0XA 4TTAA 3JQCA 1MO4A 3HDGA 3Q87B 2J6IA 1N9GA 5EG5A 2YOHA 1AS0A 1U0TA 1WY5A 1P1RA 2PUHA 3AOGA 3KYBA 4Y6PA 2XKBA 3C74A 3IAM6 3ORYA 3TIFA 3M0EA 5T6MA 3UMJA 3KSZO 3EZ7A 5D8DA 4X8LA 3PQDA 2I03A 4QYXA 1BXRB 2WSLA 5FUXA 2OAP1 4KQGA 2XZPA 4KQHA 3V4PB 1EDEA 2G1AA 4U2BA 2FPPB 3E84A 4IKEA 1QO7A 4NL4H 4ZO4A 3GFSA 3ISTA 1W36B 1YZUA 2JIBA 2I54A 2ZAIA 1J21A 2BCEA 3L7LA 4L5YA 1Q0UA 1N8SA 2RSLA 4MGZR 2MMCA 1H0KA 2P8SA 3OP4A 1OBVA 3DULA 2OLEA 3WMEA 2EG5A 3NWPA 3TKYA 2KBEA 2P9JA 5ERYA 4JQZA 5B57C 3WRXA 1RR6A 2DOKA 4UCXA 3O74A 2HMWA 2HEIA 3P9PA 1UFQA 2XAUA 1IUNA 2R6DA 3M4ZA 5ECDA 3HNPA 4P9NA 4IV8A 1P5RA 4Q93A 5F1PA 4OBEA 3IAM1 3UHOA 5CA1F 4F6RB 1YOVB 2ZIEA 1TD9A 2GZHA 2YHAA 4G9EA 2ZJ6A 3RASA 2R00A 3PFFA 2M98A 4O08A 4CF4A 4ND8B 1CUZA 2PZ8A 2WKWA 3TLEA 1IC6A 1QFYA 1W1UA 2JATA 4YFVA 4AP6A 1EFUA 5JD4A 4MPDA 1S6YA 1D07A 2PT6A 4HYTA 1FP6A 4M1KA 4Q1DA 1KMMA 2YYZA 5GJVC 3TMAA 1ZVVA 2Z6QA 3WYAA 5FLYA 5IYZA 4FFSA 4GR5A 1R6BX 2YC4C 3ZHQA 2WD7B 4FPXA 1RLTA 1UZMA 2A1UB 2A5DA 1Z8DA 3ZGZA 3PEYA 4LFAB 5LL6P 5FNZA 2AVNA 2HSDA 2LDXA 3HA7A 4W6ZA 5KYUA 4E7PA 3ZKWB 3TG2A 4UDNA 4TQUS 1P0MA 4EARA 1RXYA 1YTUA 5KQPA 3PEEA 4FS3A 2OXTA 2X14A 1P3JA 2FEMA 5IMBA 1DWOA 4E1VA 4PXSA 5IJWA 4QRDA 4PPYA 3EEIA 5G2OA 5TF4A 2IYNA 2NVUA 2CVQA 3V48A 3SBDA 4MHTA 1JHRA 4EWLA 3LGAA 3PGA1 3E5RA 4FP9A 4KXWA 1NPYA 1GZ7A 3K9HA 3THXB 1JBQA 5AVJA 1GSOA 2WA2A 1KOLA 3ONDA 4WLOA 2JEYA 4BZXA 1CQIA 1KFKB 3QKRB 1O58A 2JIQA 2BKAA 2BPOA 2H2FA 2ZSBA 4GQAA 4ZFNA 3IO5A 4BLUA 2CSXA 1XQ6A 1S8NA 2G09A 1JG7A 1MJGM 3REFA 5LP6A 1HNZB 3BSFA 4HDSA 2DWOA 5HNKA 3TPZA 3EVDA 4GW3A 1LFAA 3GT0A 4HWTA 4JYPA 3B89A 1ID8A 3MIZA 1GAJA 4HAXA 3N58A 1U2RA 2VDLB 4LJ5A 2J4DA 4RTQA 2F00A 3AOEC 1DRUA 2OUKA 1XD2B 3K9GA 3CBQA 3FFAA 1GFSA 4GD3Q 1BCSB 3IBSA 1B0ZA 4R1LA 4YIKA 5IEBA 1FTNA 2F7SA 2GBLA 4ZOCA 4YAUA 3GNTA 3LHFA 1KTIA 2RGNC 1Y9JA 1T8UA 3OTOB 1I3KA 1ZIDA 4NAUA 1LJLA 1I1NA 1YXMA 3PIIA 2AK2A 3HVUA 1NZDA 2I2WA 3FFBA 4YJ2F 2NUTA 1V8PA 1H4QA 2WUDA 3I45A 3QIVA 4O4JA 4KR2A 3RRXA 1JSRA 4OLJA 4J0IA 2BBOA 2BI4A 3O2QB 4W7HA 4P7FA 5F78A 3W0LB 1ZUNA 1A9QA 4KE6A 1C9DB 1X8LA 2VDWB 3GUCA 2N1BA 3KHKA 1FJ2A 2ZDHA 5DF1A 5J40A 1CEEA 2PSSA 3AB3A 3ZNPA 3HDJA 2D74A 5BMVB 3CCFA 1SU6A 4HX2A 4D92A 1Z7YA 4AO7A 2WJGA 2O8DB 2E1RA 2ONKA 5HQ3B 3A25A 1MNAA 4C7OA 5JC1A 2JRCA 2NP7A 1D1SA 3FR7A 2KJQA 4F4CA 4CG1A 1MC1A 2PQ0A 2QPTA 3C1UA 3M34A 1N6IA 4OAQA 4UTOA 2BKUA 1ZK4A 1II8A 1D2RA 1HTWA 3A6PC 1N32B 2ZI5A 5EIBC 4PZEA 2JI7A 1Q84A 4MV6A 3HYNA 4MYTA 1PSWA 1K8RA 4MW7A 521PA 5B1HA 1L7PA 4OJYA 2JFHA 4XSHA 4GMKA 4X66B 4GC9A 2F8LA 3CUVA 5ESDA 3WLIA 3AG5A 2AUNA 3RVSA 1VRWA 1XT6A 1ZUHA 4JJZA 2IHKA 4ZOAA 3C7KA 2PSJA 5AVKA 2GN4A 1EU1A 3KCQA 3B3GA 3OKFA 3HPRA 1UC5B 3RVNA 1DDGA 4ASUA 3BTOA 4OH7A 4D26A 4MQMA 3QBTA 1YFLA 1T3HA 1K3FA 4FDMA 1QH1A 4WMLA 1YV9A 1H6CA 3MERA 3V4LA 2NOAA 4HDNA 4EH1A 4A03A 5IJ9A 2C2BA 1VFNA 3PF8A 1RWMA 5KSOA 2UZ1B 2VJKA 3B9QA 2FLVA 4XSGA 5DCYA 3AUKA 3MD0A 4UNPA 3ZK8A 2W2QA 3DPSA 1KK1A 2FZ4A 4Y18A 4QGSA 4GUDA 3GEMA 1REQA 3GGGA 2V4UA 3IPAA 2IOQA 1KR2A 3QHAA 4PZLA 3BWCA 1UK9A 3IAUA 4O1HA 1TYCA 1SG0A 3RJZA 3GAFA 3M1LA 4RM2A 2D1YA 3EVEA 1IE3A 3AFMA 5WRFA 3D3QA 4FK8A 1E94E 4L57A 4NZNA 3KR9A 4PCAA 5AM4A 4R81A 5JZOA 4Y2VA 3CNHA 3C98A 2FSSA 1JDSA 4DCJA 1LBSA 1I9CA 3N6XA 3H4VA 3V33A 5EMHA 1KAEA 4NMWA 5JNRA 4BGDA 4FCVA 3K30A 1SHLA 1T29A 3MRTA 3O91A 3UWPA 3FX2A 4D1YA 4GOND 4REQA 4O3MA 4QFBA 1J25A 1JIUA 3E1SA 4FFOA 2CDAA 1I0ZA 2KMLA 2B1RA 2FWPA 2B6NA 5BRNA 4Y9RA 2VJAA 4Z9FA 1Z0ZA 2RH4A 3QHPA 2DLCX 3PWZA 1ZUIA 3KG2A 2XGOA 4HNAA 1O5IA 2C2XA 4DRXA 3LDAA 4E1AA 4HDRB 1D3AA 3ZGYA 4BX0A 5L9AA 2AR9A 3NAZA 4BXOA 3ON5A 3R3YA 4QVKA 1R8XA 3O8OA 5F12A 5JNSA 4KO2S 3ETGA 1PI3A 4GOJA 5LBIA 3CMMA 4HS9A 5ALVA 1JQ3A 1Q17A 2PLRA 3CLHA 4TSFA 3ZXXA 4RTNA 1CS0A 2AF4C 1CK4A 2QSYA 3PB3A 4J9VA 4N5IX 4DQ0A 3WL3A 1GGMA 3AR2A 3SY8A 4N3BA 1ZSVA 3QXSA 1YO6A 4WKGA 2ST1A 1DEAA 1NU6A 4PCUA 4MI9A 4AMBA 4OB8A 4AMVA 1O6FA 2VWGA 3VKUA 3ETJA 1IM5A 3L46A 5DGCA 1NN0A 1T9AA 2G88A 1JTVA 4RV4A 3R4VA 2C61A 2B2XA 3L79A 1PSZA 3OVMA 4MNTA 1CZOA 1NKVA 4YALA 3RS9A 4LRSB 5JXGA 1YB5A 4OI4A 4NRDA 3Q11A 1JGTA 3RFVA 2HK8A 4YPVA 5AVXA 4X0EA 1TFUA 4LF5B 1H0SA 1RI3A 3E05A 1RHQA 1RJ9A 3NETA 4RHTA 1Y81A 3AHCA 1DU4A 4Y6SA 4B1FA 3VKVA 4YDSA 4C01A 4BN4A 1EGMB 2W2PA 1TZCA 2W8BB 4N3GA 3Q0EA 1JRLA 1M5TA 1X15A 3AWIA 2WWXA 1NW9B 3CRZA 4MARA 4DR3B 4MINA 2QM0A 4TYNA 1R6UA 2FP3A 3JVUA 1NRWA 3K09C 2Z43A 4B2LA 5LIRA 4RTLA 1MMFB 3FVVA 5T4EA 1GHTA 2YN4A 2OFFA 4M89A 5B3AA 3CURA 4Y2TA 3UKJA 3NTRA 1OTXA 4E31A 3GJ0A 3MLBA 1M73E 3VGPA 4ASUD 1CP2A 1J2UA 1VSTA 4I1VA 1WPGA 3B20A 2VATA 4PYIA 4LZLA 5F35A 1EFPA 4I19A 2Q2WA 2VJDA 5TB5A 4KZPA 1DEXA 1TZ2A 2D5BA 4G41A 5KJFA 1N1DA 2PS0A 3SFTA 3VYRB 4CV3A 2RHTA 5JOQA 3E3MA 3F5QA 4FFBA 3VBCA 4KGXA 5LMCA 1IXSB 2HJVA 3E03A 3MTBA 4I2NA 5H3HA 3RRYA 3FAZA 1SXPA 1OLUA 4X90A 2IYAA 2ZBVA 2F9FA 3MCWA 2PD4A 2V5AA 2GILA 3OSZA 4JUCA 3H11B 4X45A 1ZGJA 2FWJA 2Y1GA 1TW3A 4HYQA 3Q0IA 1GSIA 4JUFA 4MWCA 4CL0A 1YBMA 1DTEA 3U3DA 1PBTA 1G20B 1Z0SA 2JC3A 2QTCA 3HCBA 3O4FA 4PPFA 4H7DA 5ALPA 3RS3A 1KQGA 2O19A 1EK0A 3L9WA 3H8SA 4BRZA 3C4VA 3GLHE 3Q85A 4A9AA 2JIDA 4IY1A 1V1MA 4AZ0A 3S2EA 1OC4A 3GJ4A 4Q05A 4R01A 4LOHA 1VBNA 4NAHA 1DIOB 3G89A 3I1FA 3UMBA 4LOLA 1U63A 1RLUA 1A8SA 3ECSA 2XSZA 2WJ3A 3ZWKA 3HRHA 3F7TA 3NTQA 1KI4A 4PZZA 4LRUA 4DLNA 3HVRA 2CDRA 2QAGA 4W5NA 5DRYA 1VPWA 4GXQA 4B7AA 3IJEB 2BZ0A 4URYR 3C6BA 5FTLA 2V3CC 3SZMA 4TSFD 1B6GA 2AG8A 5JAMA 1N1MA 4NK4A 5F2EA 5CLGA 4COKA 1H9CA 3KX2A 3H19A 4ARVA 3NDJA 3PQ6A 4UUPA 1G8JA 4PWZA 2IOHA 2O8CA 3LQ2A 1M8KA 4L6IA 4CM1A 2LBPA 1M6EX 5B55A 4XQGA 2C4NA 1DX6A 2HXSA 3DWIA 3OIWA 1UBUS 3FCXA 4G23A 4MS1A 1Z0UA 3PCXA 4NENB 4UQLA 4UE2A 3Q8WA 1BDJA 3L7CA 4EVIA 2XNSA 3EC2A 3LPAA 4EA8A 1CEYA 3D8HA 3L49A 3AQ4A 3EDRA 2Q27A 4GPEA 4EHFA 4JP1A 4OJTA 3KTDA 4DYDA 5SY4A 2QX7A 4MPRA 3Q8XB 4JFRA 4QOJA 3RIMA 2QF7A 2GVNA 4HADA 4ZVRA 4P4UA 4DLRA 1T4CA 4B48A 1NXVA 1V96A 3N59A 4B73A 2DRIA 4KQIA 1KYYA 2UXDB 3SM3A 2WP8J 1FRQA 3ZQ4A 3IBGA 2ZRPA 3F4LA 1YHYA 3ZE6A 4P4SB 1N0VC 2HFJA 2IFTA 4L6AA 4PVCA 4U6SA 4WBNA 5AW2A 3A6GA 4RHUA 1IBKB 1ZYUA 3I83A 4R68A 4JI0B 4Z0NA 2YZ2A 4IKOA 3S68A 2G3YA 3PQ5A 4QULA 4XX0B 5CEJA 1RJEA 1P4JA 4EYEA 1HL7A 2Y6UA 2X2OA 2H2AA 3BXXA 3DOUA 4JYCA 3L6RA 4YJHB 3G5AA 1J06A 1SB9A 4QXOA 3RFXA 1JDPA 3U4DA 2CCJA 4XJVA 5M5BA 2X1MA 4MPTA 3MHTA 3CVYA 1BN7A 1UBKS 3AJ9A 3PC8A 4A4DA 1OVMA 5IAAA 4MW5A 5JSKA 1E1LA 3Q9NA 2R8XA 3QM1A 5EWJA 4DPLA 3PQ8A 5DP2A 5BN5B 2ONJA 3ZUPA 4GM1A 1BDIA 3PT9A 4BV8A 3N28A 3VR4H 5JNVA 1U6IA 2DWUA 3DBLA 1Y48E 2HF8A 1YDWA 3M6WA 3F96A 3DONA 3L8DA 3D6VA 1T3ZA 1W34A 2IXTA 3PXAA 3CB2A 4KLZA 4BVKA 3WGMA 1N2JA 1W4AA 1DTSA 2NUPA 3THWB 1BXKA 3WO0A 3ROMA 1AKQA 3WK4A 3PKIA 4LN1A 4NWIA 4XUEA 5FD8A 4ODIA 3CSUA 2QM8A 2CHGA 2AWOA 2LKDA 1AZSC 1GVHA 4P3KA 4COOA 1EXNA 3I73A 1WR8A 2QYTA 2G7MC 3WK5A 3TPCA 1CJKC 1ABBA 4FMDF 3EXHC 3PUWA 4UW9A 4BJ3A 1MGOA 2X3FA 2XSZD 1RBMA 3W3AA 4EZBA 4DV5B 5IC6A 3ZWAA 1Z35A 2GXAA 3H3FA 5CT9A 2D0PB 1E2PA 1DRWA 5I51A 3KJEA 5I47A 3LHIA 1TUBB 2IH5A 1XYVA 1MJNA 3FUTA 3QNWA 3LRXA 2YMMA 1XVTA 1BRTA 1ZRMA 3A0UA 3FZQA 1M5UA 3IP6A 1K8YB 4MAAA 5I5GA 2RKBA 3EGDA 3LLSA 3NHBA 3I34X 3K8QA 1OFIA 1Z75A 5B4UA 2AR0A 2R1TA 4WDQA 5KAMA 1D6NA 1N7IA 1FVXA 5IS2A 1N2CE 1J2JA 2DWPA 2EC5A 3DL4A 1U28C 1VGRA 1F4VA 2NZUG 3IV7A 4ZAVA 1E98A 4MUBA 4FFLA 4ZICA 4H0NA 4YBRA 1P2SA 1XNJA 4U7GA 4FHEA 2FZLA 3PR3A 5JTUA 3DEZA 4X7PA 2FUCA 4QPZA 3RGGA 3BWEA 3LA8A 4LOKA 1I33A 2C3OA 5AW5A 4F8EA 2TMGA 3BC1A 1QZZA 2EIHA 2O7NA 4EKNB 3EGIA 1BMQA 1J0DA 5DNCA 4BJ5A 4FLEA 4BVFA 3KLNA 2FUEA 2IHBA 2JI8A 2WB2A 1S89A 3H75A 5A7FA 1U90A 4DWJA 1NW8A 4LBVA 1CDZA 2AH5A 2K87A 4OHVA 4NU0A 4RQAA 2OV2A 4HQ0A 5EXEA 3SE7A 4YMTA 1KEKA 3KELA 3V7FA 2O52A 5EAIA 1KKLA 5B53A 3ZNQA 1M7HA 5HZKA 4OMUA 1VQ1A 3JQAB 4G63A 5LA6B 3WLNA 2J0EA 4AB1A 3GROA 4D4GA 3KTOA 1A9TA 1RWWA 1FFHA 2GOYA 2JLYA 4RGVA 1DBRA 3AHEA 3Q7PA 4JVMA 1Q0LA 3SQXA 1RZRA 3KLMX 4FUTA 2HI0A 4LHZA 2F43A 4S24A 1R5BA 3MYRA 4Q3OA 1Q77A 4J75A 2ZIWB 4RJLA 4XKJA 1V11B 2NXJA 3C39A 5J1SB 1QF6A 4H7HA 5CLFA 3H8JA 1Z4QA 5C7OO 4G81A 2QW1A 1N6KA 1NU8A 3GFOA 2FK8A 1FC0A 5LQMA 2OKCA 5HUQA 4FN5A 5AK6A 3ZWDA 1T10A 4FJ1A 4F5WA 5JJIA 2CKDA 2HTEA 2UZ0A 3RAFC 1TA9A 2ZUUA 3SSAA 1EK2A 2XIQA 1HO3A 4XIYA 2JGDA 3D8BA 3GMDA 3SX0A 1F12A 8GPBA 2C00A 3I12A 4M7WA 2F8TA 5F9HA 3SC6A 1V2GA 2A9PA 3SVZA 1YB6A 4LSMA 4HAWA 1JBEA 4OB7A 1T36A 4Y7CA 3RUPA 3S7TA 1AX9A 3C3KA 3L7NA 3IOMA 5FL7A 3U1BA 1JFSA 3HB1A 1WZCA 4M36A 4C5CA 2JLZA 1K7EB 3AOEA 3U3OA 1VXRA 4AMYA 3M1IA 3UYLA 2HT6A 1X74A 3ZBUA 2JW5A 4GZLA 3TZKA 4MR9B 4ZHQA 3CKMA 1OSNA 1CUUA 1JDBC 3ETEA 3Q9UA 1Y80A 2RGNA 3KHUA 1JQAA 1Q1GA 3W3AD 4DSUA 4ZCRA 2Q07A 3PD0A 2OCXA 2X76A 3EZYA 2PGXA 2VAVA 2W2LD 3NKFA 2QXUA 4UXJA 4ZIRB 9GPBA 5DNVA 1MXFA 3JU3A 4NIMA 5DBIA 4QE3A 1GM5A 3VJMA 5DX1A 3VHXB 1WW3A 3SXUA 4ZMSA 3D7NA 4BQFA 4O33A 1QFSA 3ZIUA 2HA3A 2QI9F 4QYTA 3OQPA 1P8JA 1Y1LA 4HZUB 1SG9A 3C41J 1XEAA 3WIDA 1GUZA 2EW1A 2CCKA 1RYNA 5CG1A 1PNOA 3QGMA 1UCFA 1ADBA 2QDXA 1U8FO 4QBHA 4QGBA 4TROA 2VSOA 2GGSA 3U7EB 2EARA 4TYYA 2HPZA 4CM6A 3CX7A 4V0LA 5JBNA 3D31A 2C3UA 4FQ7A 3DTVB 5IW8A 1U5AA 1MGPA 1RI2A 5KJEA 2K6GA 2VT3A 3OZAA 2X15A 3WYNA 1CZRA 4DV3B 1C3EA 1HQKA 3KHTA 3K0FA 3ZQ6A 3ANNA 1AM4D 5EINA 4IDEA 4N0EA 4CG3A 4ZYYA 2YRXA 3QYJA 3CT6A 1UZUA 2WUEA 4P1ZA 2C9YA 1MTZA 5LYJB 1NATA 3BS4A 4MUYA 2X41A 2HEGA 3UC5A 1EK1A 1G21E 1CSEE 3PI6A 3EBOA 1NF8A 3BWVA 4BO6A 2JA1A 3PJFA 4D9FA 4DM4A 2CHQA 3NHUA 4QA9A 4ESEA 1I3OA 4AROA 2G36A 3BZBA 2PJUA 2B34A 5FWYB 5BMVF 1O7JA 1X7GA 2FW8A 1FP4A 1AK1A 2GT1A 2YYSA 4UVEA 5ALIA 3RRZA 1U4OA 1C7EA 1X7YA 1X7ZA 4PNHA 2JHFA 2ZVPX 1RZRD 2ZW9A 2W70A 1VHQA 2ZIZA 3ZXUB 2WJHA 4OH1A 4DWVA 4S05A 3C4JA 2G9NA 3TE6A 5JPCA 4RDHA 1ACJA 1LDMA 2C5HA 3NVAA 3U16A 1XKTA 3UG6A 1MPTA 1OC2A 4O2AF 1QHEA 1X42A 2IDKA 4M1EA 3VYVA 3PGVA 4HGRA 1ZM4A 1CPYA 2R8BA 4JKOA 2WTXA 4L02A 3NBZC 4KXLA 1PIWA 4WUVA 4JYBA 4YRQA 2PUTA 1J2TA 1EP2B 3PEUA 3DZFA 3SIPA 3MBOA 1RT9A 2VXYA 1D4FA 3ORFA 4A23A 2ZSFA 3ZDEA 5IN5A 5EQDA 1SZPA 4M9RA 1OXBB 3WOHA 4H0CA 1QF9A 3QXGA 3ROZA 3WFZA 4A82A 5LMZA 3KYCB 3SF8B 4I6GA 4QNRA 1VJ5A 1N0UA 4GP6A 2ZLBA 3O8RA 2ZJ4A 1FP2A 3TTSA 3PQFA 2OGWA 1E3DA 1F51E 3DLAA 1RAIA 2C2YA 3FGZA 3NTLA 4AG6A 1XQVA 1TIKA 3FMIA 5DLPA 2ODEA 3EOAI 2ZPAA 5J1TB 3HS3A 1BTOA 1YC5A 5D87A 3SQNA 3B7PA 1A95A 1NQOA 2YNMD 1PT5A 2DSTA 2I1WA 3RREA 4C0AC 3MT7A 1UT6A 1PVVA 5B1YA 1TYBE 4GVXA 1V25A 3T3IA 1K4MA 3NGXA 3RM3A 4YUWA 3H5VA 1E1CB 2CXQA 5IFLA 4YT5A 5COQA 4DQDA 4O63O 4QHYA 3KPYA 1K7XB 2JD2A 5A3VA 3GEEA 1MU0A 4JBYA 3SHQA 1G3UA 4Y2HA 2G8LA 2B3TA 2H8GA 4NBTA 3CR7A 5IUKC 3TOVA 3TDKA 2QUZA 3UH0A 1LSOA 2OBBA 2QDKA 2XCLA 3R5KA 4UVDA 2CXPA 3IDSA 1GTMA 3L6UA 1EQUA 3QYPA 4UD2A 4QJ4A 3W9UA 1E3WA 3NT4A 4CW7A 1SVKA 4KO4S 1F9EA 3P9SA 5SZKB 1W75A 3REOA 3HCRA 2ZE5A 2I4NA 3O8QB 3HKDB 4KH0A 2II6A 4RDIA 1Q7EA 1TF2A 2PKWA 1S4QA 3FLBA 4UPEA 3KDSE 1SKBA 4NQRA 3CIFA 4AN1A 5BR4A 1GQQA 4UU1A 3I6IA 2YHBA 4TV9F 4MMXB 1XZHA 3VR2D 2G04A 3KB1A 1HE3A 2GZDA 2JFGA 3ESRA 4RVFA 3D0OA 4MWGA 3N5CA 5FAXA 2VT2A 4UNIA 3QPCA 1P4AA 4FGWA 4IIBA 2ZE7A 3UAZA 2DY1A 2QTFA 4W99A 3FOCA 4F92B 1E3SA 3ZLUA 4EGFA 3Q4GA 4RWZA 1NGSA 1RYZA 2J08A 1BXGA 5DI9A 1KOJA 3K09A 2HUPA 3FZYA 3F47A 4PX9A 5KB3A 2H4HA 2YRFA 1IEQA 3LLVA 1Z29A 5CVCA 3WXBA 4F2GA 4TT3D 1WEKA 4IICA 5L7YA 1YH3A 2BFMA 3FTFA 3BICA 5A5GA 4KE7A 1R0CA 1TA4A 1ZAKA 4J0EA 4U2GA 4CTKA 4DUGA 4Z54A 4MVXA 1DEOA 2OZLA 2QXTA 2R8RA 2Y0CA 1OYOA 3DMYA 3EB9A 4HY3A 3EZ2A 4YMGA 4X62B 3M33A 3ZDFA 5J63A 2WE8A 2YV3A 2Y0BA 1D0IA 4YBZA 2WF6A 4H4CA 3OUTA 1KOFA 2A84A 2PMDA 2HBRA 4JAVC 4REMA 2RI6A 5IBCA 1WHTB 3MC1A 2IGTA 3L6BA 1DG9A 4KXQA 4DMMA 5CA0A 3GF4A 2VH5R 4R05A 2HF2A 1DAOA 1T24A 1T9DA 4FYXA 4UEKA 4WVLA 4RFLA 4XH9B 1NJGA 1G291 3QW4B 4G97A 4XJXA 1U31A 1GTZA 1I2ZA 4JJFA 1KSGA 2O05A 1BVYF 4N3NA 3EXIB 1R3UA 2B1GA 2VYFA 4LDAA 1RPZA 3NRJA 1HMPA 1PGOA 3H5IA 4I4CA 3WGGA 2VTBB 3W9YA 2OCAA 3MINB 3BMCA 4RIGA 4WAUA 2C0CA 3DLPX 3EUAA 3OCZA 4AY3A 1WL8A 4QAQA 4G84A 3T3DA 3IJ5A 4BKRA 2OG2A 1IL0A 5AVUA 2J46A 4BUCA 1S7CA 1BXZA 1TF7A 2GFIA 2H5IA 2JKYA 3C70A 4U9UA 4CQJA 3EG5A 4F72A 4RAOA 1WF3A 2XNCA 2VDOB 1ZI9A 2JFFA 4HGPA 3OURA 3OZVA 5E1OA 4H1WA 3L0OA 2VAPA 4OJMX 3T06B 3PGJA 3TJMA 3PV0A 2ADMA 2Y1XA 1IRXA 3OG9A 4RPIA 1WULS 4YO7A 4X65B 3T5PA 4DMRA 1G6HA 1GDDA 2CMDA 3EQ8A 1XF1A 2DQ4A 3K1YA 4GPBA 1LU9A 5M3BA 1UBHS 2EWMA 2P6NA 2ZWOA 3FB1A 2WQZA 4B2PA 5TPZA 1Z7GA 1ZP6A 2BFDA 5AJYA 1XHFA 2GZMA 3EGWA 2AX4A 2GAAA 2VPZA 3ZLBA 4MS3B 3UAOA 4R6XA 2IZ0A 2EJBA 1KY3A 2H2WA 3MXTA 1JJ7A 3UFXB 2D06A 4JT8A 5E4YA 3T95A 4M9UA 3UGTA 4YB8A 3S27A 5FEUA 1NUTA 4E5DA 3R9XA 1PE0A 4C1NA 1W5EA 2JGIA 2QE6A 5E1MA 4ROTA 1E2IA 2Z04A 4B81A 3K20A 1O0BA 3OCJA 1WKBA 5JLAA 4FB5A 1YRAA 4R2HA 3HXPA 1FQWA 3RS0A 2YVQA 1Z5VA 1BVRA 3NEAA 2DPGA 2W22A 4RJKA 3F5FA 1DXYA 2GO7A 2Q3LA 3GLRA 4HVLA 1XCPA 2OCBA 3JQRA 3PPYA 3GCZA 5A7GA 5LWHA 2P4SA 2G40A 3DYIA 3E3LA 1A3CA 3RAEC 1G5FA 2CDNA 3E7FA 2C95A 5LD2B 5CVUA 3MPUA 3A1UA 2G63A 3O4JA 4OAPA 3OCWA 2XBMA 1FZQA 2C4TA 2BCJQ 3GHYA 2V7UA 3CVJA 3KKLA 4IFTA 4FJ2A 3V8QA 3SBXA 3IVXA 3K32A 1IAQA 2MDTA 2YWFA 3QU2A 4LI0A 4ZPJA 5DLEA 1JEOA 3RUHA 4DUGD 1ILWA 1KDZA 5DTJA 1PW5A 5KTRA 1XEXA 2CD7A 2NZ8A 4JOSA 2DE0X 4QBFA 3PHHA 4RJTA 3BB4A 2C4HA 4WY5A 3ROQA 4TQAA 1YMUA 1BVUA 1SPBS 1TFRA 4P4NA 4EEKA 1JLLA 4OBXA 4PU0A 4TTVA 2XTZA 3O3CA 1U3FA 3TH5A 1T15A 2F1RA 3GNQA 4P8RA 2CLFB 4R1NA 2FN9A 3TNJA 3ZYZA 1Z33A 2P40A 4BNDB 4C22A 4EG1A 3KQLA 1T13A 3IDAA 5ELXA 4EJMA 4MV1A 3F3SA 4AZVA 4ZCIA 4B3TB 2G80A 1VMKA 2ON6A 3KRTA 3ZH9B 3DDNA 3NO4A 1SEPA 4RKEA 5ITZA 3PEWA 4OQ4A 3UGJA 3AFGA 1L5KA 4ZCSA 2ERYA 2JGRA 3BK7A 4J43A 3GGSA 3FBGA 4TLEA 3WNVA 1KDPA 5CW1A 4E3WA 4RTSA 3L82B 3CG0A 2FDXA 1XZAA 4CMBA 4BRSA 5ERXA 5GVSA 1V6SA 3EUWA 1U0BB 3BH0A 2NNWB 2RHGB 4U4AA 3A9SA 1RYHA 1PFYA 1NFFA 4NCNA 3UH1A 1FFYA 4BKMA 2AXQA 1X80B 5K51A 2ZFUA 1VHJA 1KDRA 4H1UA 3UA4A 3EXHA 4Y2YA 1V48A 3RYCA 1FSSA 3W06A 2BOVA 3Q7IA 3QP9A 3TCXB 4OMFG 3H17A 4IVNA 2AFVA 1NJ1A 1XZCA 1JIIA 4OLFA 3SWWA 1COZA 1UM8A 2VHWA 1JIVA 3RF6A 5EKUA 1ZD2P 4LYJA 1Z6GA 2X4GA 1RC0A 2V98A 4G0MA 1EAMA 5KSPA 3W2TA 4EHBA 5AKIA 1V16A 2ZJ2A 3H2GA 4FDTA 4K3UA 1ZEJA 3DE4X 4EHIA 2JGKA 2L69A 3W8NA 1OI2A 3W2FA 4NF2A 1B43A 3OMLA 1WV1A 4IPTA 3W5AA 1Q12A 1VLZA 2JH3A 3UHJA 4W5JA 1Q22A 4EAQA 2ZJ0A 3MSXA 1T2DA 1U3TA 4CM8B 2A14A 2IHNA 2ZUDA 1UT8A 4DYHA 1U28A 1NVFA 3O82A 4PQEA 2I6XA 1O89A 4LZOA 5K5EA 3V8NA 2ZT8A 2GHRA 1OVGA 4ZVNA 4OYLA 2WYOA 4F71A 2AQHA 4DT1A 2BFAA 4U7WA 1XZBA 1ZL2A 4DUZB 2OUIA 3LQYA 3U0BA 2XY4A 2X6QA 5DI3A 3K9FC 2MSLA 4NOMA 4JC8A 5DHUA 2DWQA 1TJ4A 4UHFA 4MCJA 5KYXA 2NACA 2H1OA 1CRQA 4MA5A 5DBHX 3ST7A 2ODNA 3BN3A 1KC1A 2EJVA 4NOLA 4XFDA 3I52A 5MN5A 1E18A 2ZBRA 4K5QA<