3RSLA

H-ras soaked in 90% r,s,r-bisfuranol: one of 10 in mscs set
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
156
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 58
structure length 156
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rslA00
1II0A 3TK1A 2PMKA 1HURA 4I4LA 4Q5IA 2HCJB 2WAXA 1JPJA 2RMKA 4H1UA 2XEXA 3A36A 5UKDA 3BS4A 4NH0A 1M34E 1NLYA 3PVSA 2AX4A 2CMKA 1GKUB 3PITA 1W48A 2RGBA 4BFVA 2WSMA 1Z6GA 4NYMR 2Q9CA 4FCWA 1E6CA 2J41A 1GP2A 3G0HA 4O2RA 5AR1A 1W0KD 1E4YA 4IDPA 3WP0A 4BUJA 5J40A 4RZXA 4ZIRB 2C98A 1US8B 4YMVA 5KNBA 3C15C 2CCKA 4WVFA 4KCGA 4D82A 5LD2C 2J1LA 1K5DA 2ZTSA 3ZQJA 1FX0A 3JZMA 2WMOB 1RJ9A 621PA 1HYQA 3AP3A 4Q01A 1Z83A 2ATXA 1OF1A 4P33A 2ZR9A 4JJKA 3IBYA 1EXMA 2QN6A 1KI4A 4LOAA 2NPFA 4LSGA 2XNDD 1XJQA 4C30A 2DWPA 2CLSA 3UMFA 4YMWA 2V3CC 1RVDA 4C9BA 3R8CA 1TU3A 4CEIB 4M1OA 2VSFA 4IFBA 4F7WA 3P26A 5EUQB 4AG6A 1N5JA 3TQCA 3Q85A 3I8SA 2REBA 2G0NA 2XB4A 4K46A 1IHUA 2WWYA 2NPIA 1W4AA 4IKEA 1E9AA 2J3EA 4Q1DA 1E98A 1RKBA 3ZZTA 1W4BA 1Z6AA 4GPTA 2OHFA 4M9QA 1AS3A 1HH4A 3QBTA 3AGQA 2DY1A 5FOSA 2GTPA 4JLJA 4MRVA 4XWAA 1XXHA 1GM5A 2IS1A 4TMTA 5GJVC 3TR5A 2QTHA 5KDDA 1TL7C 2MMGA 2IF0A 3M0EA 1VIAA 3NXSA 4A0HA 1FX0B 3ASYA 2FNAA 4AURA 5H70A 4PSKA 2HCBA 2NO0A 1U0LA 1EX6A 2GCPA 3AF4A 2AK3A 1SVSA 2F9MA 2FOLA 4JL5A 2QU8A 1NN0A 2PX3A 1WA5A 2BCJQ 1I2DA 3K09C 1XBTA 1OYYA 1G7RA 4KLNA 3NC1C 3SYKA 3K9HA 2P6UA 3AVOA 3K53A 4YXWD 2DFKB 1QVAA 5E4FA 5AUOB 3ZIAA 5JEEA 2QMHA 2GXSA 1N2CE 2FEMA 2O5VA 2PX0A 1Q44A 3I8XA 3HP1A 5AJYA 5EJEA 1R8QA 4D2IA 1PLJA 3K0CC 1Q22A 3W34A 5KTYA 1KTVA 2JGNA 2IYVA 1JEDA 4IEEA 3VU9B 1FZQA 1D2MA 2ZE8A 3T35A 5CB6A 1OXVA 3BFKA 3RHFA 2QAGA 3U6BA 3PIRA 5DISB 1ZMXA 4AD8A 1JQJC 4TQAA 4ZPXA 3RS0A 1FMJA 3HR8A 2YZ2A 1XEXA 3D31A 4P32A 2A5DA 3DEFA 3QPWA 3SOPA 4C0QC 2YINC 3T1QA 1JJVA 1FNNA 4DT1B 1NMYA 1D6JA 2ZUBA 4G5RA 3KTAB 1KKMA 1GRRA 2B7BA 2WJJA 4EFNA 3THYB 1OW3B 2QENA 1HEIA 2AWNA 2GHIA 3R7WB 4PPFA 3B9PA 3NBFA 4BFWA 1O3YA 5HZKA 1GWNA 1GRNA 1KMHA 1VTKA 2WOOA 5EP1A 1CJKC 5AJVB 2ERXA 5TARA 1Q20A 5KSPA 4F4CA 4D6PA 4JLPA 1CP2A 5E95A 2VQSA 1V43A 1K6MA 2FDCA 1XTRA 2CL0X 5FR1A 3CKLA 1JBKA 3F3YA 1KI2A 4OQXA 1I2MA 2GCOB 4KSBA 1NBME 3E2IA 4A2PA 1M7GA 4AC9A 1UBEA 4Q9LA 2GJ9A 3EZ2A 2ZRGA 2W2TA 4PR0A 1GSIA 4DB4A 3O8CA 2JDID 4MGYR 4TYQA 2WWFA 1M1YE 3VR4A 4KBFA 4KHZA 4KV9A 5AK0A 1ZC4A 4JT4A 1G8YA 4ZI3A 1X1RA 2HLDA 3VTKA 4P4SB 2GVDC 1W49A 3CX8A 3AM1A 3PENA 1DAMA 4ASUD 4GMDA 4BFSA 3RLFA 3PEYA 2BC9A 3EW9A 1GUAA 3A58B 1A5TA 1O87A 5D3MA 4AKHA 2MSEB 2O8EA 1LB1B 2WJIA 2Z43A 4FXPA 4GFDA 4XVRA 3CPHA 4R9UC 3SQWA 3I72A 5M04A 1IY1A 2ZYUX 2IS6A 3DO6A 3LH5A 5H68A 2B92A 2GK6A 1F6BA 2G6BA 2F43B 3VR1A 2QROA 5HPYB 2O8FB 3OEHD 3OIYA 4M2LA 5D3QA 3U61B 2QQEA 3SJBA 3I5XA 1OFUX 4LJ9A 221PA 4MRNA 3KFXA 1VHTA 4X8OA 4CEHA 1Z5ZA 2IEZA 4DLRA 3KQHA 2GEDA 4B76A 1ZINA 3K1JA 4R2IA 3AKCA 2ZEJA 4LYAA 1TUIA 2XSZD 3MJHA 4OBEA 4EJSB 3K0FA 3TAHA 5FOXA 4HAUA 3N2IA 2JLZA 2QM8A 4L5BA 1JJ7A 3IQWA 1T0HB 3HPQA 1R0YA 3FFAA 3FFBA 3CW2A 1XEWX 3CRRA 2XB2A 3AVTA 4HUQA 2FF7A 3THWA 2V1UA 2NOAA 1EX7A 4U5XA 5HCIA 1Z0AA 1KI8A 3D7MA 2QBYB 3W90A 1NKSA 3PFIA 1U94A 4WAUA 3SR0A 3HPRA 5H1YA 1XD8A 2ZI5A 2OCPA 2JJ2D 3VNUA 1IN8A 3A1UA 1NG1A 1H8EA 1QG2A 1P6XA 2A2ZA 2CCJA 3GLHE 2AKAB 5KUTA 4PZZA 4Z1MD 5CDFE 1E99A 4LJ5A 2A78A 1E69A 1CKEA 4I81A 3N70A 4MYHA 5IF9A 2B7CA 2QG6A 3V4FA 2ZRMA 1Z0FA 1WE2A 2X8AA 3GJXC 2W6IA 4TLBA 1P3JA 4BLTA 3GJ4A 1HA3A 3QG5A 1UDXA 4BECA 1B0UA 2FSFA 3NG1A 3HU3A 3LBNA 4B75A 3TKLA 3GMTA 4TWZA 5JS7A 3PUYA 4P4UA 3D3QA 3K0FB 1UJ2A 3IIKA 1E79D 2E1RA 2J7PA 2MMCA 1E0KA 1UADA 1CTQA 5KU1A 2RGCA 3C7KA 3LBIA 1R0WA 3W5JA 3OIUA 4DDVA 2IEYA 1M2OB 4GOKA 1FTSA 4FN5A 2I3BA 2YVUA 1YKSA 5EXSA 4OQMA 2QMUA 4PC1A 1E96A 1NG9A 3X1DA 4Z8XA 1AA9A 1QHSA 5AJZA 1JPNA 4Q18A 1E32A 1T8UA 5FH9A 1MABA 2V9PA 1VIYA 1KDRA 1KO5A 4E5UA 1AS0A 2HJGA 2IS2A 2R9VA 3PUVA 4XD7A 4B3XA 4JL6A 3B78A 1SXJD 4P4SA 5EZ6B 1UBCA 2H17A 1Z63A 2I1QA 3THXB 3CH4B 3NHBA 5DLQC 1OIXA 1QG4A 4FD2A 2FX3A 2Z0MA 3L0PA 4RCZA 5EUMA 5JLJA 1XMSA 2YJTD 4NE2A 1G17A 2IUTA 3FWYA 4TSFA 4US1R 2CNWA 4Q03A 1KI7A 4ARZA 1TF5A 1KZ7B 1GG2A 1II8B 3QF7A 2BEKA 4A2QA 5G40A 1KDOA 4OHXA 1ZD8A 3SU8A 3IGFA 4MYTA 4URWR 3KL4A 2YWEA 1RZ3A 4GOJA 4IDNA 3B1XA 2ZVPX 2V55B 1XNJA 5HZHA 5CLLA 5K8TA 4HAXA 3QPUA 1PUJA 4TZ6A 2FA9A 1J8MF 1W36C 4KITB 5JCPA 1CRQA 4NCNA 4UKDA 3MGCA 5L3SB 3FMIA 4YMTA 3ADDA 1Y63A 5J4VA 1KSFX 3AVYA 1DTSA 1VYTA 4R98A 4PHTA 4WZAE 4ZCLA 2CHQA 4G1UC 3Q5DA 1KSHA 4MRSA 1HUQA 1W46A 2P5TB 1YZQA 3QXJA 4MUAA 4I99A 4M21A 3GLGB 1KK0A 4LHZA 4TMKA 1Z07A 3ZH9B 1E2IA 3DMDA 3QXCA 3W3ZB 1AM4D 1CRPA 1J2JA 1Q1EA 3BWDD 1DO2A 3KQNA 4RD0A 5DH9A 1Z22A 4GDFA 1EFTA 1XEXB 3EIHA 2YWGA 1VDZA 1CJTC 3OE7A 1DAHA 2OAQ1 4L9SA 5HKKD 5TXGA 4QL3A 4RZ2A 2VHJA 4KAXA 5GVSA 2IYUA 1CR1A 5SZHB 2Q6TA 4UXIA 3QPVA 5DGXA 4A36A 2V6IA 4TN1A 4QJ3A 2H7VA 2LKDA 4OK5A 1W36D 3PUZA 4MYUA 3GLHB 5CIWA 2R6CA 1DG3A 1XB2A 4PANA 3B60A 2OBLA 2BEJA 2QPTA 3W6NA 1TQ2A 1M7HA 1FTNA 1EGAA 2D3WA 3EZFA 2CHGA 1YR6A 3IDQA 3PUWA 1COWD 1WCV1 1G4UR 5KDLA 1H8HD 4HB0A 3X1WA 4B33A 5AJXA 4HUTA 5FPSA 3KKMA 1NJFA 4JBWA 3CNLA 3LBHA 3DPUA 1G5PA 3WY9A 2VP2A 3TLXA 4EPWA 2EW1A 4B2PA 3O8DA 3TR0A 2IHBA 3K9NA 4KI0A 3U3KA 1AK2A 3K9LA 4FMCB 2Z83A 2HV8A 3LD9A 2OCBA 4LWZA 3CX6A 2NTYC 421PA 4FMDB 3K0SA 1VCNA 3L0SA 5BXQC 1XTQA 5J4HA 3IIJA 1X3SA 1E9SA 2PT7A 3AGPA 4D0GA 821PA 2RHDA 4KYUA 1W0JD 3PG5A 5JI3E 2BBWA 3TMKA 1XXHE 2FU5C 2O8CA 2DCUA 5F3WB 3L82B 2GESA 1FNMA 1OHHA 4BASA 3ZD6A 1R8SA 2F3TA 3F0TA 2IHYA 1L2TA 4IXMA 1NIJA 2QP4A 3T06B 2JLVA 4RCYA 2IK8A 4TL8A 4AK9A 4AWXA 1Z08A 3VHXA 2ZRPA 1OYWA 2NG1A 2CVFA 2ZJZA 5FL7D 4TL6A 1HV8A 5LB2A 2KBEA 3NVAA 1CR2A 2G83A 5A4JA 1RFLA 4YDSA 5FTNA 4B3CA 4PQFA 2VF7A 3PXGA 4HLUA 2JAQA 4FIDA 2EYQA 5JWRA 4YXWA 1S1MA 4PC2A 3P4XA 3BOSA 5D3MB 3ZIAD 4ERNA 1E2PA 3LY5A 2XGJA 2XX3A 1D8TA 4XSHA 4JJZA 2FZLA 3OEED 8OHMA 3A6PC 1NN1A 3CBQA 4PPNA 2EVWX 3BB3A 1IQPA 2EYUA 2YOGA 1N6KA 2C95A 3QF4A 2D2FA 4A6PA 3LDAA 2XNSA 1IN7A 2AFHE 1GTVA 1G41A 2ZRKA 2OCAA 3MLEA 3PR1A 2AXPA 4C0JA 4OJQA 1S4QA 3GEEA 1XFAA 2JATA 3EWSA 1TPZA 1K5GA 4RKFA 3KQLA 4M8NE 4F38A 1JXMA 3GEIA 3U7GA 4JLDA 1FOEB 1VHLA 3B1YA 4TMWA 4GZLA 3PQCA 1MOZA 3KXLA 3CR7A 1JEEA 1NNEA 3M4YA 3OAAA 3VAAA 1SGWA 1CS4C 1TQ4A 4MDFA 1EFRD 3RS4A 2ODEA 3IUYA 1KO1A 2BJWA 4RFSB 1UAAA 2JJ1D 2IC5A 2GA8A 4V0MA 2ORIA 1KI6B 4DDUA 2AK2A 4URZR 3VKWA 4FI3C 2RGXA 3ADCA 1KO4A 1SXJB 5DN6D 3QKSB 3W8NA 1RE0A 4R2HA 2C96A 3HDTA 2EWWA 3HYTA 4JLMA 5FTMA 4A2WA 5L3QA 5CK5A 2R44A 1OJLA 1D5CA 4Q21A 1R0ZA 2BBOA 5DYIA 1JALA 1KI6A 4LHWA 1GILA 2QT1A 3GJ7A 2Q0HA 4Z54A 5AUQA 4Q9IA 1OKKA 2WAYA 3NBYC 4JLAA 4BWYA 2HT1A 3VFDA 1YU9A 1OFTA 4DB2A 2ZQ5A 5CDFA 2XITA 4D4LA 4Z51A 4PO8A 4MYCA 3BXZA 5FUWA 2H1LA 3U60B 1WBBA 2PCLA 4OHYA 4ASUA 2RGDA 1YE8A 4XSGA 1E2JA 4HAWA 4TTQA 3R9WA 4B3FX 3QKSA 2WTUA 5GJBA 3RYTC 3VKHA 1UDWA 1E9FA 1NN5A 2ZAMA 2HXSA 2ZJ2A 1G21E 2OBMA 3WYFA 3EARA 4UNNA 4ARZB 4FMBB 1NMXA 4C0BA 2MSDB 4M1MA 3EPKA 4IW3B 1CEEA 3B8HA 2ZS9A 1N6NA 2FH5B 3C4JA 3GJ0A 1AJEA 4URYR 3NEJA 4O3MA 4HDQB 4PO9A 5GJCA 4EFLA 4ACAA 5C18A 4RD4A 4B74A 2JIZA 3EA5A 2GJAA 5TDHA 2OAP1 5E7IA 4ITRC 1E9DA 2CBZA 1PZNA 5G41A 2C04A 1Z3IX 3RC8A 1K8RA 1LS6A 1T0JB 1W4RA 2V7QD 3BORA 3GFTA 4GOXA 1IXRC 2W6JA 3CM0A 3THOA 1YR9A 4PC6A 2G3YA 3IBGA 2B6HA 3TVDA 3K9GA 3AKEA 4URUR 1EWRA 1WRBA 1G6HA 1U9IA 2OBNA 4IFEA 1JR3E 4JLVA 4Q1CA 2G0TA 4QHSA 5EE0A 1OIVA 1Z6TA 3CWQA 2R6GA 2JEOA 4LX0A 5EXTA 4LYFA 5CM8B 1KDPA 2D62A 4II7A 2JLYA 4GNKA 5AUNB 1DE0A 1ZW6A 3U5ZB 4Q9HA 1NY6A 5DI3B 4DZZA 3PUXA 3SQXA 2ZRHA 3KKNA 1Z0JA 1PV4A 4NP6A 4JT2A 2X77A 2BMJA 1HE1C 2IYZA 4CT4B 4JSTA 4LHYA 3RWMB 1NY5A 2KWIA 1HT2E 4WIAA 2R65A 5J47A 2N42A 2WSSA 2XOKD 3FKQA 4G0NA 4OQNA 3P20A 1FFHA 2ZRBA 4YDHB 3QSYA 4KFSA 4D4MA 5BN4A 1ZM4A 1J90A 1LFDB 2ASEA 4TL7A 4ZIRA 2BMDA 2WPDA 4OQFA 2X19A 2P0EA 2PCJA 1GRQA 2DWQA 5K8LA 4ZDWA 3DM9B 1F60A 3IO5A 3DZ8A 4MDEA 2BMFA 2AR7A 1IY0A 2ODBA 2RHMA 2J0UA 3UMSA 1G3IA 1OV4A 2P5SA 5EXPA 4EDHA 4URVR 2O8DB 1ZUHA 2GF9A 2IS4A 4ZDKA 1KIMA 3EC1A 2YV5A 1NVWQ 3MWLA 4HUQB 5EE1A 3THWB 3LX5A 4DRZA 2BKUA 2OXCA 2V1XA 1NSFA 3K0AB 3AVQA 4JVNA 1P2TA 2EQBA 3I61A 2XZOA 1E0SA 5JECA 3Q72A 3WXMA 3IEVA 1ZM7A 1RRFA 4FWIB 2Z6VA 1T5IA 2CLCX 4HLUC 1SKQA 2B8TA 1YR8A 4IDQA 5FBWB 2FN4A 2ZANA 5C2JB 3QKRA 1OT3A 3B1WA 2IYLD 2QY9A 2QA5A 5LBIA 4XVQA 2IXEA 3EIQA 4C2UA 4C3ZA 2P67A 1XEFA 4QJ4A 1R5BA 1E9CA 2F43A 3LV8A 1KNXA 4QBFA 4YC7A 5IT5A 1XPRA 3LFUA 3CB4A 3T1VA 1G8PA 2QSZA 1BOFA 4IXNA 3VKGA 3ZS9A 1T3SA 3O47A 4UNPA 5J4LA 4BFXA 3DOEA 5KPJA 3CRW1 2XJ4A 4HZIA 4A8JB 2QP9X 3MCAA 3RDPA 4QBIA 5FUXA 4MKFA 4U00A 1TMKA 1DBSA 4N3NA 1XTSA 4LJ6A 1SVOA 5GJWC 3AV0B 3UMRA 2CVHA 3FKSD 4MRPA 4BLOA 1W5SA 2ZRJA 3NIBA 1NSTA 1XCGB 1EFHA 2GNOA 2C8VA 2CCGA 3QI2A 2UZIR 4BEBA 4BPBA 1XMJA 3CUEF 1D2NA 3BH0A 1ESMA 3SDZA 2BJVA 4QXAA 2BBSA 5HCNA 1PLLA 1RW4A 4XWKA 1II8A 2IX3A 1X1SA 2Z5FA 4HB2A 4DUGA 2C2HA 3Q7PA 2YHSA 4OQLA 1ODFA 1W0KA 2RKOA 3PEUA 3TBKA 5A5GA 3W9YA 1G3MA 3AP1A 4WW0A 3CPEA 1YZTA 3L0OA 4K81B 1X8LA 2J59A 4C0SA 3THXA 1CR4A 4LJ4A 1RC8A 4M1KA 2EFHB 5GVRA 3KB2A 2W58A 1DVRA 2FG5A 2G88A 2FSIA 4V02A 5KO2A 1GDDA 2NQ2C 3B9QA 1CIPA 1A2BA 5CK4A 1W2GA 1A4RA 1VG9B 2RB4A 2RGAA 5FOUA 2ZU0C 1I4LD 5L8VA 2D4HA 2CXXA 4LYHA 5DO9A 2C99A 2O0KA 1GL6A 1NIPA 1S9HA 2WIBA 4DLUA 2IWHA 1C9KA 4NYIR 4LJ8A 1J99A 2MSCB 3MG9A 2FEOA 5EE5B 1ZVQA 1COWA 1MKYA 4Q9JA 3EZ7A 1H8HA 2HF9A 2Z4SA 2ZJBA 4ZDJA 4GI7A 3CX7A 4OI2A 4IOLA 1Z6XA 4CW7A 3BFVA 3AKYA 3M1IA 2V54A 4NPHA 4MITA 1XCPA 2Q9AA 2WKRA 4ZDIA 2FGJA 2VHQA 3LAWA 2VIIA 1UFQA 2IYSA 3BC1A 3QXXA 4B2LA 1S1CA 3C5CA 4KODA 4F91B 4MGZR 2OEPA 3GLIA 2ZYTX 3SI7A 4FWTA 3TUIC 2CDNA 2IL1A 1N0WA 3C41J 4EPTA 4PSAA 3GFPA 3C5HA 1KAGA 3X1XA 1ZM9A 2DYKA 1G6OA 3OESA 1BO6A 4HEJA 1W7AA 4E22A 4LHVA 1E0JA 4KXFB 2ZRDA 4TLAA 3U6KA 1TNDA 1A2KC 4V0OA 1KOFA 5FPTA 4GBMA 2RCNA 1VG8A 3ADKA 3CF6R 1II9A 4C0KA 4QFMA 2FFQA 4XVUA 1U8AA 3DKPA 4Q47A 5FL7A 1UKYA 2QI9C 5EE9A 4PHHA 2BKEA 1S9DA 1VCOA 1SZPA 1U8ZA 1CJUC 2QQ0A 1ZD9A 3CWZA 1AGRA 3QJYA 4OHZA 2VEDA 3U3JA 1CR0A 4A4DA 3SBEA 1JR6A 1LTQA 3QG1A 1TF2A 4BRWA 1AS2A 3BBPA 1NP6A 1R10A 5AJWA 4YMUA 4IOMA 4F4JA 4DDWA 3T1TA 3EPLA 3ETLA 1ZNZA 3LQRA 3OEEA 5JCZA 1VCMA 1W36B 4B2IA 5BYKA 1OH5A 1Y3AA 4RKEA 4EUNA 3QQ5A 1AIPA 1G9XA 1QHXA 2FGKA 2ZR0A 2P6RA 3C8UA 2VRWA 3FGNA 2GILA 4Q02A 3CZQA 4POAA 3VX3A 1KK3A 2CHVA 4NL4H 4XTRA 3ZDQA 4D4KA 1D9XA 3ASZA 2Q3MA 1U90A 2F7SA 4RD1A 521PA 4I1UA 3MD0A 4QGAA 3ZS8A 2QNRA 3BJIC 1DS6A 3RRMA 4KSCA 1NF3A 2ZITA 4JLNA 1N6LA 1YZNA 4DCNA 3UPUA 1QHHA 3LW8A 2WVJA 4RZ3A 3CF2A 2CK3D 4PC3A 5FTKA 2XTZA 3AVUA 2QE7D 4Q7MB 1ZUIA 1ZCAA 1GNQA 4G5GA 4LC0A 1N6RA 2VF8A 4LI0A 2OFOA 2ZUDA 2ZS7A 3BGWA 5KSZA 2V6JA 4DXAA 4QNMA 3RRNA 3OAAD 4QOSA 1EFRA 3KTAA 3T5GA 3DOFA 1KHTA 3AB3A 3HU1A 4LYJA 4M9SA 4DT1A 2JJ1A 3ONWA 3FYHA 4U02A 1P2UA 2G1KA 1EFCA 2GCNA 2VP4A 3GJ8A 3HU2A 3MRSA 5JWHA 3LO5A 4Q4AA 5DN6A 3UATA 2ZI4A 4O0MA 1R7RA 4O25A 1XDBA 2I1VB 2QAGB 4NDZA 1ZIPA 3GJ5A 1Z6YA 3TJZA 4OK3A 3CR8A 1MR3F 1T91A 2ZRLA 4JSYA 5FOTA 1GVNB 4B32A 2A30A 3S1AA 1FQJA 2HLDD 1Z29A 3SFZA 2W2VA 4TMVA 2GJKA 4A8JC 3QOFA 3W5IA 1P60A 4MRRA 4ZCIA 5BN5A 4HSEA 4IRUB 4RD6A 2G77B 4BQSA 2QZ4A 1E1QA 2NO7A 5L3VA 1XZPA 1HTWA 1UBFA 2ZRCA 3KXKA 4X8LA 2HYDA 2KB0A 5DE3A 2AD1A 2HXYA 3TW8B 5JWOA 1FP7A 3H1TA 4AKGA 1T6NA 3K8YA 1ZIOA 3CZPA 1E2DA 4CF7A 1OE0A 2WJVA 4GMXA 3IIMA 4OJKA 5KSYA 1P73A 1NKTA 4PC7A 1JECA 4A15A 1SULA 2ZRFA 1Q0UA 2KI5A 2A5YB 1TAGA 3Q3JB 4QBGB 5FTJA 4BLSA 1OB2A 1OH6A 3SE0A 3PEVA 4G3XA 1KSGA 3GLIE 4KYIB 5C4MA 1KMHB 4PSVA 3TIFA 3PJRA 2RAPA 4NONA 1CF4A 2IW3A 5IRCD 2ZRAA 3TVTA 4QGGA 1G5RA 1RRGA 3BH7A 2OT3B 5SZJA 3VU9A 1TU4A 4AI6A 4BE7B 3CRQA 4PAOA 3I32A 2YOFA 4TTRA 5FBLB 2JIZD 1Z47A 3P1JA 2JA1A 4JBXA 1E94E 1A7JA 2GK7A 2YC4C 3WMGA 3Q5EA 3RSOA 2W6JD 1Q21A 4Q1EA 1AN0A 4EJSC 2JJ2A 4Q19A 2ZAOA 3GLFE 4NBSA 3J81k 3U3RA 1BMFD 1N0UA 3QVVA 4HB4A 2P6NA 4C2TA 4QC2A 1KGDA 4O2LA 1F2TA 4B35A 4B3GA 3V9PA 3IPXA 3ZVLA 1FL9A 2KBFA 4Z1MA 3X2SA 1U98A 2IYYA 2RH5A 3PEWA 1E3MA 121PA 2ZM5A 1ZD1A 1FQKA 1YZGA 1KI9A 4OI0A 2IA5A 3IEUA 4DCTA 1QZXA 1YZLA 2Y8EA 1XP8A 1F2TB 2FPKA 2H5EA 4I1SA 2JLWA 3VHLB 3SHWA 3ZZ0A 4NZYA 4HAZA 1G3UA 1T4GA 1NBMD 2D7DA 2CJWB 4L4UA 2XXAA 3K0EA 3MWYW 1JAHA 1G19A 5JJIA 2ZROA 2C5LA 2KSQA 2XOKA 1KO8A 2OM2A 2XZLA 2C9YA 4TLDA 2WZQA 4N1AA 4OI4A 1OH8A 1N6PA 3KX2A 3LNCA 3H4MA 1G8FA 2WPDD 1FPMA 4LHXA 3R8FA 2QGZA 4CEIA 4LZZA 2VLIA 1GKYA 1E2LA 3AEZA 2ONKA 3GLHA 1WQ1R 4MKHA 4IEIA 4BZQA 1CULC 3DDCA 3K70C 2ZPTX 1IN6A 2FFHA 4N0DA 4V0KA 1M8PA 1BS1A 5HE9A 3P27A 2ZE5A 5B57C 1OB5A 1RJ9B 4XD7D 3HR7A 1GFIA 1R5OA 2O0JA 4DSNA 1U0JA 4XWOA 4JBYA 2JLUA 1SQ5A 5FL3A 1RIFA 3EXAA 2BOVA 2HDNB 4P4TA 5P21A 4B71A 1NI3A 2WJHA 3A8TA 3K0CA 5KNCA 3AUXA 2R2AA 1TF7A 3KKPA 4DIDA 3H2YA 4BLPA 4QGHA 1DAIA 1U81A 1ZNYA 2ORWA 1JNYA 3NEYA 1TUEA 4GRAA 5F98A 1FUUA 2OXRA 3NKVA 2QTVB 1XF9A 4NCJA 4LY6A 3JZAA 4AY2A 5JJKA 1XTJA 2ZJOA 4F93B 4Q7JB 3KZ1E 3NBXX 2PZEA 4CEJB 1US8A 5EE3A 2VSOA 4B48A 3SJAA 3LQQA 4PX9A 4PHGA 4MQBA 1XTKA 4ON9A 2EWVA 2F1RA 2PL3A 1E2MA 2IT1A 2AN9A 4ZCMA 5JRZA 3RS3A 4U7DA 2FE4A 1B23P 3ZD7A 1KJYA 1E2GA 2QMEA 2FJUA 1DO0A 1U9IC 3AF3A 1YJ5A 3VR5A 3FKSA 4NKRA 2OV2A 3BAFA 4RD2A 2BVNA 5JJLA 3VQTA 721PA 1QRAA 4DCUA 5B64A 3REFA 1G20E 2ATVA 2QEQA 4C7OB 1UBGA 5G53C 3I5YA 4UNSA 4DSOA 5CJ2A 1KYIA 3TE6A 5FI0B 1U2RA 4Q00A 4NCIA 3OE7D 1Q12A 4JYCA 4W7SA 4LUCA 4PAQA 5HKKA 1WDTA 3T15A 3FE2A 4B6FA 4G5SA 3FPAA 3OIVA 1S8FA 5J5CA 1E2KA 4YMSA 1DAEA 4G01B 4ZO4A 4PFSA 4TL9A 4HLQB 3F8TA 4LJ7A 1UPTA 1N6OA 2RGEA 3H86A 2YYZA 1XJCA 1YR7A 1LNZA 4Q4JB 3W6OA 1NVVR 5J4YA 5JRJA 4J0QA 3P4YA 3QKTA 2WJGA 3AKDA 3I62A 3RWOA 1MH1A 3UANA 3WNBA 4M0LA 4TT3D 1OPXA 3ICQB 1VG1A 3L0IB 5FUYA 2NZ8A 2QORA 2K5UA 3S1AB 3G5UA 4CIDA 3DKVA 3FDIA 2VBCA 4Y0AA 2W2XA 2WHXA 2PJRA 4DJTA 3KKOA 4A8JA 2VP0A 2WKQA 2X1VA 3OFND 2RGGA 4HLCA 3TSOA 2R6DA 1Z2CA 4TYNA 3GP8A 1R2QA 4DLVA 5FFMA 4LV6A 5ANRB 4UQOA 1MT0A 2DBYA 2IYRA 3UK6A 2EFCB 2ZYWX 5AWFC 4E07A 1IJEA 3A4LA 4NYMQ 1QHYA 3CRVA 1JR3D 3EIEA 4W5WA 1P62B 4DDTA 3QE0A 2ANCA 3MWJA 3QBVA 5IK2A 4B73A 1VPLA 4KFTA 2PEZA 2IYQA 3BIFA 4Q48A 3QKRB 1X8KA 3WHLA 4L16A 1W2HA 4V0LA 1W0JA 2Q3HA 3WP1B 2ECKA 4P0TA 5GADl 1VECA 3ADBA 4DLYA 1OHHD 1E0AA 3LX8A 1IXSB 4EIWA 4Q4LA 4Q1FA 3HWSA 1G8GA 2ZJ8A 2JJ8A 1W47A 2GXQA 3D6TB 1L4UA 2BDTA 3HYRA 5B2ZA 3TRFA 4P31A 4C4PA 2E9SA 2GAAA 4MGIR 3DZDA 4PTLA 1P9RA 1TEXA 3MUFA 5HR5A 5KOYA 4NMMA 4CGZA 2ZRIA 1OIWA 4DC9A 3T34A 2BBTA 2YOHA 4M1WA 4EQ6A 1ETUA 4M1YA 2N46A 2REXB 2J87A 3QNUA 2FFBA 1VMAA 4XIGS 2GKSA 4TYWA 2A9KA 4R71A 1T3LA 4TLEA 1DAKA 1KK1A 2OLKA 3PCRB 4C0AC 2BCGY 1E9RA 3WRYC 1VYVA 1MO6A 3CLVA 2Z4RA 1UEIA 2GAOA 2OZEA 2WWIA 3U3OA 1P2VA 4DCSA 1A1VA 1XPUA 3U2QA 1G5TA 2ZSDA 2DFNA 2PZGA 2GBLC 2XTMA 3ZJYA 1AGPA 2R8RA 4PQRA 3ZLJA 1SXJE 2ERYA 1UM8A 3GLFB 2O8BB 1WBDA 1LY1A 1XU4A 2OFXA 3DM5A 3QENA 5JBQA 3LLMA 5H8WA 2JLQA 1ESNA 5BWMA 4D26A 1I4TD 3JVVA 3VNVA 1T5LA 1WP9A 4BLRA 4JYBA 3N2EA 4WBSA 2G1JA 2IBMA 4QM7A 1KNQA 3FHOA 1N25A 3G82C 2QPOA 2GWHA 3A1VA 4QM6A 5FBRB 3RAPR 4OI1A 2KE5A 4WXPA 4G5OA 2O8FA 3LLUA 3EA0A 1P9WA 3ND8A 3WHKA 1CJMA 3I1FA 4HAYA 3NTUA 4JLKA 4JS0A 4WA7A 3X1ZA 2GEVA 2VTKA 3GD7A 4MGKR 2VH5R 2AD5A 4XJXA 3QVUA 2OUKA 2P2LA 1Z28A 3O8RA 3OF5A 1T3HA 1WF3A 1FUKA 2ODWA 4HZUA 4NCKA 2D74A 2FZ4A 1ANKA 1S2MA 4HDOB 2GF0A 1NVVQ 3U3MA 1OXUA 3KJEA 3FVQA 1AQYA 2WICA 4TZ0A 2OO7A 1JQLB 1FP6A 1ONBA 2SHKA 4LBVA 2C9CA 1E2NA 4OL0A 2IYTA 1OKKD 3CO5A 5BQ5A 2UZ3A 3EC2A 1G64A 1R4AA 3P32A 2Q3FA 2ODNA 4AYWA 5JMTA 3LW7A 2ZU6A 4DSTA 2TMKA 4OK6A 4M9ZA 3SYLA 1SHKA 3B7GA 1P5ZB 1TADA 4GL2A 3K70D 3I73A 4QHYA 2HJVA 4US2R 5F9FA 1UKEA 2R6AA 1M7BA 2HT6A 5TY0A 1R0XA 3UG6A 1N5KA 4DVGA 4Z8YA 1ZM3A 4IVQA 1E2FA 1RRPA 3THYA 3I4LA 5J4KA 4TQUS 4CT5A 2P3SA 3WMFA 2WV9A 2H92A 4GP7A 1GL7A 2ZXUA 2QGNA 4I1OA 2ZI9A 1DELA 2O8EB 3GEHA 1QBKC 3A1WA 5JHGB 3B5JA 4DLZA 5K8UA 2CLDX 4H9GA 3SZRA 5SZIA 1XMIA 2GEUA 4NTZA 3R7WA 3TSZA 1AQUA 1QHNA 2FV8A 1PLKA 1NJGA 2QMOA 4KFRA 1RYHA 3A1TA 3WMEA 3B13B 3CONA 4OKSA 3C16C 4QNRA 5CB8A 1X86B 1ZUNB 2FFAA 4B44A 2WMNB 2W00A 4FMDF 4UXHA 3LWNA 3UWOA 3DHWC 2FMXA 1L8QA 3M6AA 4IDOA 5FPHA 1Q1BA 2GBLA 2QAGC 3SEAA 4NCHA 3O8BA 1Q1QA 2C77A 2ZETA 2ZE6A 3A1SA 4JLBA 4PO1A 5E7MA 3ZVNA 2WM9B 1Q1ZA 1GITA 1N6HA 1W1WA 1GZSA 3WBJA 4M9XA 2IYXA 1KKLA 3DVLA 1BKDR 2QPAA 3Q8XB 3E1SA 2YC2C 2GVZC 3TUJC 2ZYVX 4PQYA 5LB4A 4EAQA 4DWJA 1BYUA 2CL6X 2AXNA 4NHOA 2ZSBA 4K8OA 3NH9A 1F3OA 1OXXK 3FHCB 3QXHA 1VG0B 1X8JA 2J0UB 3TH5A 2VA8A 5AUPB 5JHHB 4XH9B 4MH0R 3SBDA 1E2QA 4YLGA 5B30A 1XWIA 5FBVB 1NBMA 4AIIA 3BERA 5DSZA 3BRWD 5KSOA 2J45A 2J7KA 5DHFA 2VP9A 4EKDA 4KO8A 3DMNA 1XEWY 5CYPA 2PT5A 1G4AE 3NDPA 1GAJA 4LV5B 2GXUA 2ZI7A 3SNHA 1KY3A 2EFGA 3AUYA 3OEHA 3H84A 4D81A 4X8HA 1D9ZA 5BN3A 2FPLA 3CIOA 1CLUA 3AQ4A 2R6FA 3BK7A 3KQUA 1F5NA 3WNDA 2NO9A 5K8IA 3A4NA 4CYMA 3C14C 3VR2A 5A0FA 1DOAA 3AH8A 2HYIC 4JVLA 2WJYA 4W5JA 1NRJB 1IM2A 3B1ZA 4LBWA 1J7KA 3VX4A 4CEHB 4Q4HA 2IYWA 3EZ6A 4LBYA 2GRJA 3T1OA 2ZE7A 2ZJAA 1OFHA 4LC1A 2GZDA 4CDGA 1E4VA 3FB4A 5DHAA 5EQTA 1NMZA 1J8YF 1ZAKA 1OFIA 3WYAA 4US0R 3TGPA 5FTLA 1Q57A 5BW8A 2OILA 2ZS8A 1XXHB 1NVUQ 1H8ED 2VHTA 2JCSA 5FPKA 2OLJA 2C9OA 1KMQA 6Q21A 4AYXA 1E1RD 3KJHA 3FMOB 1KO7A 4RVCA 2AWOA 2LCFA 1I4DD 4TLCA 4D25A 2VPPA 3SJCA 1S0UA 5EP3A 4ESHA 1ZYUA 2Q21A 3EPHA 2DB3A 1TQDA 3ZZUA 4JLOA 3SJZA 3U4QA 1Q3HA 2E87A 4EPYA 4KU4A 1P75A 3EAQA 3RNLA 1FMLA 1EFUA 2IUSA 1C1YA 1XRJA 3A4MA 5FPYA 4GT1A 2H8KA 1KZGB 5DIFA 4GZMA 3EX7C 3ICEA 4IOKA 2J0QA 1DARA 1E79A 2J7PD 1KK2A 4IVPA 5EXXA 1DEKA 1HQCA 4D4JA 3FTQA 4RSGA 2W0SA 5CYOA 4DLXA 1YZUA 4F4IA 1JB1A 4DUGD 5IDVA 5JSZB 2JLXA 2ZSAA 1M6NA 3U44A 1GNRA 3AVPA 3RANA 4BZXA 3UG7A 2J0VA 2NIPA 1L7VC 2QRZA 2VSXA 4PPGA 1ZRHA 2XZPA 4DLTA 2QSYA 1DAFA 4HATA 2NGRA 3QY0A 1FW6A 4D0NA 1E9BA 4CVNA 1UKZA 2ZI6A 4R7ZA 1TTTA 1HQYE 4AKIA 1PUIA 1UF9A 1LW7A 1ZM2A 4AYTA 2CE7A 1F2UA 3JVUA 4EPXA 3IHWA 1HY3A 3LRPA 2ZRNA 3H0KA 4B47A 1EWQA 1YQTA 3BH6A 4NYIQ 3MSXA 3KJGA 3W6PA 4D80A 1HT1E 2CL7X 4A1FA 3KKQA 4TSFD 1BIFA 4M4SA 3EZ9A 3LVRE 1JXOA 2IXFA 3OHMA 3SFVA 4DLSA 5JSZA 3U44B 4GP6A 3MWKA 3GJ3A 1S96A 4ILEA 4WXRA 3KDSE 1KAOA 4LV8B 2PH1A 4ZKEA 2IUUA 1BH2A 2P65A 4B6EA 5CITA 1Z2AA 2BM0A 2PLRA 1V5WA 2CEAA 2R62A 3R20A 2BMEA 3EPJA 4PAMA 2NMVA 3BFXA 2WWWA 5TV2A 3SS8A 3ZQ6A 3CPJB 2GJSA 1GNPA 5EP2A 4LCBA 4LPSA 2BHRA 2QUZA 1NLZA 3B6EA 1HE8B 4IHQA 1P2SA 4RFSA 1MO5A 5JI2E 3R9IA 2O8CB 4I1VA 3GPLA 1IBRA 3QF4B 3LVQE 1E2HA 4JMPA 2D7CA 4M53A 5IK2D 1W4CA 4DKXA 3RS2A 5KHOC 4LPKA 5TVKA 1RPZA 3ECCA 2XJ9A 1JAIA 4PZYA 2CE2X 4PXAA 3AF2A 4KFUA 3TUZC 1KSJA 4Q1BA 1EK0A 3KXIA 1G16A 1ZNWA 4MKIA 2UKDA 2DWOA 3CH5A 1WMSA 4RJLA 3TW4A 2YWHA 4JKIA 1KDTA 3B82A 1MABB 1M74A 1Z06A 4LGMA 1G1MA 2JLSA 2F6RA 4C0HA 1G8HA 2J46A 2AFIE 2PEYA 4NYJR 5CM9C 5FUVA 3NDBB 4L9WA 1VKJA 2GETA 1IY2A 2H57A 1AZSC 1WXQA 4FCVA 2ZI3A 2XXAB 2B21A 1DADA 1RYFA 4Q4HB 1XJ0A 1F48A 3CNNA 2CJWA 3NWJA 5LDDC 4MKGA 1ZP6A 2RGNC 3V4RA 2BV3A 2XNDA 3TQFA 3WYGA 2F55A 1IONA 4BZPA 1DG1G 3RRYA 2X2FA 1T8TA 3KB1A 3SHFA 5FI1B 5BYJA 1XX6A 2YNMA 1G7TA 3I92A 4GSYA 1EG7A 4LJAA 3IO3A 1X6VA 1H65A 2PZFA 3E70C 1ZJ6A 4A92A 2B8WA 2LWIA 3NHAA 4OHVA 1ZCBA 2NZJA 2RGNA 4RFVA 3MMPA 4QHTA 2CK3A 3LXRA 2LKCA 2A5FA 2VL7A 1DPFA 2DHRA 2QE7A 3L8YA 3MAAC 1CU1A 3Q7QA 3GLIB 4Y0VA 5C4GB 1SKYB 2IXGA 4X8MA 1A82A 1MRSA 1TEVA 2F1JA 3WNCA 3NBZC 3GLGA 1ZU5A 3R9XA 2QT0A 2KJQA 2QBYA 4UNRA 3RRZA 4W9MC 1WB9A 3MFYA 2WOJA 4WZ6A 1KJZA 4JIMA 3L43A 2X2EA 3B1VA 4RD3A 2GZAA 2OSBA 1IN5A 3IILA 4Q66C 2GDJA 1E2EA 3TNFA 4M22A 2WWHA 4ABYA 2FPMA 4UXJA 2OG2A 4L15A 2A7QA 2EU8A 2AL7A 2VP5A 3U7EB 2REOA 4BFTA 1IJFA 5B58C 4DLWA 4V03A 1E9EA 2GJ8A 1MV5A 3LA6A 5CJPA 2ZUCA 3FHTA 1NN3A 1QVRA 4KJZA 1XTIA 5LPNA 2QAJA 2F9LA 4D0LB 1KI3A 1E1QD 3TSWA 3WBKA 5DYGA 4BRUA 4KBGA 1OXTA 1OLOA 3TAUA 4E03A 2ZJYA 2J9RA 4IDHA 4V0ME 4ZV4A 3BB4A 1P4SA 3REGA 3QUSA 4UNQA 2YWFA 4WOPA 4F92B 1SVKA 3HJNA 1D2EA 1OXSC 2W0MA 4HZUB 4BGDA 1ZU4A 4JKYA 4G5QA 4N0EA 5C46F 5CIQA 4Q4AB 1TQ6A 3T61A 5L3SA 3U7FB 4ACBA 4ZKDA 3ZVMA 4FMCF 2OFWA 2DFLA 4HB3A 2ZREA 4DCVA 1NL3A 2ZSFA 2D06A 3IKJA 3NH6A 2HUPA 2QM7A 1YRBA 3GCGA 4TMZA 1XD2A 3SYNA 4Q7LA 2Q9BA 2YKGA 4HYYA 4Q9KA 5ELXA 2DR3A 1UKVY 1SXJC 3EG5A 3SN6A 4IOJA 1SKYE 2OE2A 4JVMA 1CBUA 1NVXQ 4QGFA 4B3DA 2DFTA 1QDEA 4JL8A 5IHPA 1BYIA 3U7HB 4NYJQ 1QHHB 1MO3A 4QKQA 1CXZA 1U0HC 3N5CA 3RSLA 1YZKA 2NO1A 4IJMA 5TMPA 1OH7A 1J70A 1BMFA 1VCIA 2IWRA 2WIAA 4YONB 2JDIA 1LV7A 1GOTA 1ZBDA 4KVAA 2ZIAA 5FOVA 3SC3A 2QP3A 1SHZA 4PZLA 4P3YA 4PHFA 4A0RA 4BFYA 3W8RA 3KFVA 1XCMA 3IHLA 3F5FA 3OIWA 2PBRA 1U8YA 5FR2A 1AKEA 2JLRA 2ZSEA 4EPRA 1N5LA 4LK2A 3RC3A 2FSGA 2I4IA 1LF5A 1G3RA 1P61B 3DL0A 1Z0DA 1N3BA 2J5XA 2G9NA 1GL9B 4H1VA 3RABA 1QHIA 4FINA 1G7SA 1Z0KA 3QEJA 4BEJA 3K0AA 5LD2B 1U99A 3VR6A 1IAQA 1Z8FA 1PVOA 1G18A 3BE4A 1QHGA 3L8ZA 3QIAA 1G291 2ONJA 3B2EA 4LDJA 4UJ3A 3UIEA 4HLDA 2O8DA 1ELOA 1Z0IA 4JZKA 1N0VC 2PLFA 4KVGA 2BM1A 1QF9A 1SVMA 2F1IA 3LXXA 4ESVA 5FBQB 4QJ5A 3KQKA 3W3AA 3OZXA 3GLFA 3L2OB 2O8BA 1XPOA 3ZGXA 2VP6A 4BFUA 4MA4A 4Q1AA 5FOWA 3BB1A 4EJSA 1W5TA 2A5JA 2XSZA 3CF0A 3KUDA 4S35A 1P9NA 4KLZA 3BD9A 4RY2A 2ANBA 3GFOA 1R5NA 1JI0A 1KJWA 4DIEA 5F2EA 3NC0C 5EZ5A 3KJIA 2DPXA 4M1TA 5JFGA 4B3BA 1SVLA 1MRNA 4TYYA 1IN4A 2PMDA 4HDCA 2F1HA 2V7QA 4EPVA 1AKYA 4EQ6B 5G3ZA 3E5HA 3FMPB 3AVVA 1P72A 2GXAA 4C0LA 5CLQA 2AHOA 3K09A 1UEJA 4Q7KA 2WKPA 1GIAA 5L3RA 2VYFA 4A82A 4MUBA 1YHNA 2BIFA 3I3SR 3WRXC 3ZVRA 3ND9A 4CRWB 2FSHA 3D8BA 2A5GA 5HE8A 3VMFA 1T9HA 2OESA 5E3HA 3MJRA 3VR3A 1CJVC 4DHEA 5G3YA 3EWAA 1C4OA 1XD9A 2VHUA 4W5HA 1ZC3A 4TQ9A 2W6ID 2IF2A 1E1RA 3AP2A 4A9AA 5KDOA 1L4YA 2VHCA 5DNYB 5SZKB 1KI1A 4FW9A 4IVRA 2F3RA 2N1BA 2OCYC 3ZYCA 2VO1A 3KUCA 2ZVQX 2C03A 1GKIA 3Q9LA 4EFMA 4AG5A 2WSSD 1PJRA 2ORVA 3PV0A 4ZI2A 5JZVA 1OSNA 2O52A 2BWJA 3QEOA 5TB5A 3RS7A 4OYHA 3AVXA 2H16A 1R6BX 1IOZA 4QBHA 2HF8A 5C1BA 3GJ6A 3UKDA 1IXZA 2XAUA 4QG7A 4XTCS 5DI3A 4BFZA 4DEYA 3T12A 4B34A 5JS8A 3QXSA 3A37A 1G3QA 4DEXA 1SVWA 4BLQA 1F2UB 4DBLC 4RZUA 1LVGA 4URXR 4TTPA 2D2EA 2ZR7A 4DSUA 5KNDA 3EASA 4FCTA 1XD2B 5E7JA 4S2EA 4A0GA 4LRWA 1RRCA 1Q3TA 2A3RA 2QRNA 4XOIA 2HEIA 4A0FA 4TYPA 1SXJA 2JASA 2WBLC 4CZ2A 5F9HA 2O0HA 3AF0A 4HI0E 2GZHA 5JEDA 1P7CA 1W44A 4PPQA 3RVBA 3CRMA 4CEJA 1LS1A 1ZNXA 4L8GA 2V4ZA 1N5IA 2UVQA 1MO4A 2EFDB 2FWRA 3GQBA 4M1SA 5DI9A 3IPYA 4TT3A 4A6XA 2PJZA 3X1YA 2H18A 2CNWD 1DAGA 2L0XA 3AF1A 4OHWA 5HTKA 4E09A 1EESA 1XMVA 3V00A 4V0NA 5KPDA 3GLGE 3B85A 1YVDA 4HAVA 4TMXA 3T5DA 1S3GA 2WWGA 1N6IA 3UWKA 4YQFA 2QL6A 4LBZA 4C7OA 4WZBE 3RS5A 1S3SA 4B43A 3OFNA 5L3QB 2QTFA 1VYUA 3FMFA 4Q4JA 3FOZA 1NLFA 3QKUA 2W83A 2ZJ5A 4UJ5A 2J0SA 5EP4A 2C78A 4QRHA 3UXMA 1G7CA 5KYKA 2XTNA 2GCOA 1AZTA 3CNOA 3U4QB 2V8OA 3IQXA 1KY2A 4JVSB 1JR3A 2AKYA 2WWXA 1XZQA 1TX4B 3AVWA 4NU0A 1SVIA 2NO6A 1YRAA 2EFEB 3K70B 4AKEA 1LF0A 4LJYA
chains in the Genus database with same CATH superfamily
2OP1A 2NNWB 8GPBA 4Q5IA 1CY4A 5IAEA 2YV4A 4AMYA 1PN3A 2HL6A 1XTVA 2RMKA 2VAMA 4JC5A 3S99A 3TDKA 4Q12A 4L4XA 1ODKA 3EPRA 4L4ZA 3BS4A 2JC3A 4NH0A 4IHJF 1AQJA 5AO9A 3PVSA 3HO1A 4G89A 4DJFC 4LSMA 2CMKA 4BFVA 4AIRA 5EZYB 3HMKA 3I6IA 1R6UA 3LIPA 1IL0A 1LI7A 4KRYA 2AE1A 1SZCA 3RARA 1T0UA 4NYMR 1NZFA 3PU6A 1QG0A 3ORHA 2H2AA 2RAUA 1OUMA 1V9SA 4OY3A 4RTPA 1GCIA 2Q0XA 5AR1A 3DMPA 1V8FA 3KZCA 3QRWA 4BUJA 3Q10A 4JLUA 1UDCA 4LDZA 2V7UA 1Z5WA 8AT1A 4UAJA 2YMLA 3C1TA 4CDMA 2CCKA 4UHKA 5LD2C 1TA0A 2J1LA 3KQWA 1K6JA 4ZV7A 2WD7B 1QAQA 2R751 4GGOA 4TM8A 3RVDA 2PU7A 4CMIA 1KJQA 1RJ9A 2LDBA 1TKBA 3LLCA 4GXTA 3VPGA 4RK7A 3LX6A 2QD5A 1WS6A 1Z83A 2GPSA 4NBNA 2A33A 1QIHA 3BA1A 2OZLB 3KAPA 4ND2A 5F76A 1GNVA 2H08A 4ZOBA 1KI4A 1REQB 3KDPA 4LSGA 3TYXA 1MAHA 1XJQA 2QRUA 2VCHA 3UV6A 4YRBA 2FMIA 2CLSA 5BSWA 4YMWA 1VLHA 2X1MA 3IBFA 4KACA 4C9BA 1KTIA 1YZYA 2XMGA 1TU3A 3HV2A 3CEHA 3VGJA 2VSFA 1CETA 1XC7A 2O3TA 4F7WA 3OZRA 5EUQB 3IC5A 3AR3A 3IHTA 2PRKA 4I1IA 5CPBA 2JZCA 3Q85A 3MXTA 4AN0A 3DMHA 2REBA 1EE1A 1Q83A 3I8SA 3QY9A 4RTQA 2CXPA 3V48A 3L7IA 4EHFA 4RDIA 4LKOA 2HJWA 1W4AA 1QIMA 3U0VA 3LHSA 1BCSB 1Q0ZA 4RV9A 1E98A 1AQ6A 3Q4GA 4R1PA 1QRDA 3M6XA 5EMLA 4FDLA 4UTZA 5TC4A 4S0XA 3ZZTA 2VDJA 1U8CB 3K6RA 2OHFA 1AS3A 1K0UA 2EP7A 3BFJA 3ESXA 3ESBA 4OO3A 3BRQA 3OZWA 4MRVA 1RM5A 4NLLA 3OLQA 1CQXA 5HCUA 3FAZA 1IJKA 1KQ3A 3UJ3X 4WESA 3UJNA 5B1IA 3TKAA 1FRVA 1S3FA 3Q0TA 5CHYA 1VIAA 5A04A 1GARA 1NFFA 1ZIXA 1DOHA 4A0HA 1FX0B 5H70A 1YZFA 3ORYA 1H4SA 3OFKA 5JADA 1U0LA 1ARZA 3FSGA 2OBFA 3AOEA 2GYYA 4HNSA 1FFEA 1C1DA 2QU8A 1O9GA 1UC4B 1ZK2A 4HQ0A 4OP3A 5GAJA 1RXVA 1N3IA 3EWNA 5LL6P 1ISSA 1XBTA 1OYYA 1G7RA 5CDSA 4KLNA 3SYKA 1JSZA 4NS1A 5TVGA 3PXUA 5KJFA 3HBLA 1X19A 3K53A 4IX9A 2DFKB 5AM4A 4RF5A 5AUOB 3DEKA 2QMHA 2GXSA 2OPBA 4BDSA 1WD7A 2Y68A 3I8XA 4U39A 4BNXA 2VUSA 1F9EA 3G7NA 1R8QA 3CKYA 2FPRA 2H63A 2XQIA 3K0CC 1Q22A 3P9YA 5KCMA 3SNKA 1JDBC 1KTVA 3UAOA 3CSSA 4OM7A 4D6YA 2Y3IA 2IZZA 3KTDA 4QEKA 3DMGA 2IJGX 1WLYA 1VKHA 2GOYA 2WVHA 3PFGA 3T35A 5I9LA 5CB6A 3LIIA 4HDRA 4D3FA 1B15A 2EZ9A 2O3SA 1WUJS 2J31A 3BQMB 2X13A 3HR8A 3U56A 1AY0A 1JB9A 1MIHA 1U8UA 2B2CA 2YZ2A 3PE6A 4P32A 3HB4X 5KYUA 2PVPA 2CXNA 4D8WA 3ICOA 3SQDA 2YINC 3CLSD 1TKCA 4H3VA 2C3PA 1FNNA 1GGNA 4TXNA 5TNXA 1NMYA 3H3FA 4TWRA 1E8MA 3KTAB 5FT9A 4U3JB 2P8JA 1GDHA 4EHHA 5EPUA 2QENA 3WL6A 1K97A 2AR9A 5K6RA 5JTTA 4JQYA 4WOBA 4PPFA 3B9PA 3NBFA 2FK7A 1YL6A 1W5FA 4JSRA 3O9VA 2C8JA 1GWNA 2BSQA 5BSTA 4B40A 3EGDB 4ALIA 2ERXA 1QX4A 4EHAA 3U9LA 5TARA 1Q20A 3UTCA 1WPQA 3O1LA 4L51A 5KSPA 5IDXA 1L4MA 3KKZA 3TB6A 1MU0A 2B7LA 3C1OA 1RWNA 2MSLA 1NNUA 2C8KA 2OK7A 1V43A 1QC5A 2GBGA 4M6WA 2FDCA 3MWEA 5B6PA 2C59A 2GUWA 4ZYLA 4PWYA 4G4SO 1N9GA 4OQXA 3F46A 4Y8VA 3L8HA 1OAKA 3FVVA 2NUAB 2EDCA 1A98A 1NBME 4ZREA 3C7TA 5KZMB 2IXAA 4GPIB 4P7KA 1M7GA 4D9FA 2IU3A 4XWWA 4IH9A 2PUBA 1OWMA 4DSZA 1UBEA 1ZBQA 3EZ2A 4DB4A 1J5XA 1BDIA 1P8JA 3VR4A 3SVLA 5AESA 5AK0A 3LFHA 1ZC4A 3KCNA 3KRTA 5C1IA 2L69A 2Q6IA 3DOOA 5TEVA 1YRLA 1B8VA 4BNZA 3P94A 1BX1A 1CP3A 1DKNA 2CXOA 4MEJA 5JO9A 1U0BB 3CX8A 5CJJA 1IQ0A 1DAMA 3PENA 2JD1A 1ESZA 4BFSA 4E2ZA 5BPHA 1JHQA 3ZCQA 2DWUA 4RO0A 3IMCA 1LB1B 4GFDA 2Z43A 4ZQIA 1GU7A 2UYQA 3CN9A 3TNLA 1RMYA 2IY8A 5M04A 1YQEA 2JARA 4XX0B 3VRHA 5H68A 4DCPA 2B92A 5G4KA 5K4HA 2F43B 2XQKA 3EY9A 2YBEA 5P8WA 3VR1A 5DM60 4IRXA 4UVEA 2BM9A 3H5OA 2YHIA 4UDXX 3B6JA 2YJ4A 1OFUX 5TPWB 4M87A 4IHKA 3ZIUA 4UQPA 4CEHA 1Z5ZA 4DLRA 1H2RS 5KTTA 1ZINA 5ALXA 1UEXC 4GX0A 1BZYA 3AKCA 5K2OA 1TYAE 1AB6A 1RWMA 3COYA 1TRHA 3FTPA 1PJCA 2EJTA 3K0FA 3PRJA 4GM1A 4OBEA 5FOXA 3KEMA 5DBEX 5FADA 5TRTA 2QM8A 5IASA 1PGNA 1E1MA 2IPLA 3HCWA 2CV0A 1YI0A 3IQWA 4DNPA 1NVAA 1DSSG 2DHEA 2K87A 4DABA 3FFAA 4KR7A 1XZMA 3DV9A 1MGOA 1J21A 2HGSA 4L9AA 1QP0A 2XB2A 3L3BA 4RSHA 1J7JA 2AJLI 3LGSA 1F4VA 3W8FA 3AKZA 2R2GA 1EX7A 4HEA6 4U5XA 3D7MA 1M9NA 4PZUA 4M55A 4WAUA 4B3IA 3AJDA 4AZ3B 1OA0A 4R3UC 3G2LA 2ZI5A 1KQFA 2I7TA 4JBGA 2VK1A 3CJTA 4HH1A 4BN0A 4D98A 3T0FA 3FRJA 5FWYB 1RBMA 3FCEA 1WY5A 3UHOA 2BJHA 1HFJA 2A2ZA 3CN7A 3GLHE 2H52A 5KUTA 4PZZA 5CX1B 1CDEA 2A78A 2HA2A 1E69A 2Q5EA 1BDBA 1J09A 2OOKA 2QLFA 3N70A 4AM8A 1RQ7A 1H5NA 2AC4A 3OX4A 1X80A 2QYHA 4NPAA 3V4FA 1LBHA 1KAEA 5M34A 3IQFA 4TLMB 2PXHA 1TAQA 4HBZA 3LQYA 4PGGA 1WCYA 4BLTA 3B9RA 1OI2A 1B0UA 3AR8A 3LKVA 4V2UA 1NUSA 2NZWA 4B75A 3LY8A 3E9DA 4TWZA 2BZSA 2EGGA 2UYCA 2VF4X 1N2EA 1XYVA 1F20A 2X5NA 3C8ZA 3D3QA 3ESZA 5ALYA 3F6PA 4TGLA 1E79D 2C7OA 2MMCA 1E0KA 1CTQA 3OZIA 3X1KA 3CNBA 2EIXA 3IE1A 4U7JA 4UUOA 4C7XA 3JX9A 4W9NA 2WTBA 3VI3B 3JQ8A 1MJGA 4FDTA 2YVLA 5EWLB 5C8VA 4YP9A 5ER6A 1VE5A 4K6MA 3D2CA 3V8RA 4YCDA 4EVRA 5ED4A 4XM1A 3WMXA 1I0ZA 1QHSA 5AJZA 2PD6A 2FPWA 1JPNA 3H4VA 1L7DA 1Y37A 2ZIXA 4GWLA 2FUG1 1V95A 1RYDA 4K6FA 3UC5A 4BO4A 3O4JA 1AS0A 4WMLA 1LZLA 2V8BA 4XCVA 1DBRA 4TRJA 3IEKA 4B3XA 4Y1RA 4ZMBA 1IEWA 4JL6A 1X1TA 1M76A 2RH9B 1SXJD 4P4SA 2WZDA 5IAKA 1QGZA 2H17A 2J32A 3PQ2A 3NHBA 5DTJA 3DT6A 3GFSA 3ZJ5A 4XB2A 1X39A 1T36A 5AKIA 2PSFA 2YJTD 4NE2A 3TX6A 3UUEA 4NV1A 1A27A 4QYMA 2XRZA 3QWFA 1QNLA 5C0OE 1HTBA 1S02A 2OCLA 3MM4A 4KDRA 2IXDA 4Q03A 1MG0A 5G1OA 3T4XA 4E51A 4ZGGA 1KI7A 3DBRB 2Y71A 1V11A 1TF5A 5FHRA 5IUJC 1GG2A 1II8B 2Z2IA 4KP7A 4A2QA 3V3TA 2B94A 3WYEA 3GEMA 3G8YA 4DJEC 1SC9A 4EW3A 1USUA 4M46A 1E1YA 3FETA 4ANFA 1XNJA 3O3NB 5K8TA 2JK1A 3HB1A 3QPUA 3P5SA 3UQZA 5DXAA 1QPGA 1CQJB 3LQ1A 4UEWA 1J8MF 4OVKA 1MB3A 3ZBQA 2H54A 1UAGA 1Y6ZA 1ZMTA 5B3JA 3T9BA 1DXQA 5L3SB 4HQFA 4HT3B 4OFXA 1PFUA 1DHTA 3VC1A 5LQAA 1HFEL 3AVYA 1DTSA 1HTTA 3FVRA 4QUKA 1NXTA 3Q2KA 4R98A 2CHQA 1NASA 2HMAA 2HADA 2OAEA 4ZVMA 1G5FA 1Q1AA 3KQVA 4M21A 3GLGB 4IL5A 1VL8A 1H4VB 4NBLA 4BO6A 1KK0A 2YCBA 3H9CA 3UENA 2OWEA 3K72B 3DMDA 2EBUA 5DEOA 5GONF 4TRRA 3WKAA 1DJQA 3WLKX 1CRPA 3BWDD 1Q1EA 2Y1WA 3TLKA 1QRTA 1O8BA 5EWLA 3TIXB 1FFXB 1Z22A 4ZVRA 1QVVA 1QZTA 1KYVA 2RAFA 1I14A 5ALQA 4DADA 2YWGA 4BB9A 2QX6A 3LUGA 4BNFA 5DOVA 1CJTC 1CC1S 3RUEA 1DAHA 4KG7A 5DHSA 4JI2B 1R6AA 2OAQ1 4FJ2A 2CD7A 5ESXA 4EA9A 4YP7A 4ENPA 3O73A 4L7QA 1APBA 5A4DA 1EX9A 1KHHA 4K3VA 5GVSA 4J0JA 4C7OA 1GQRA 2GPAA 3JSXA 4RA6A 2RBKA 4UXIA 4YP5A 1KOGA 1XA0A 5DGXA 3E9RA 4YV0A 3Q7SA 1V1JA 3KYIB 4QJ3A 1NVGA 2LKDA 4XXHA 5TQ2A 4ZYYA 3O31A 2HN9A 3AQIA 2R6CA 1AKUA 1IATA 4RTMA 3VMMA 5F4BA 2VNKA 1Q0SA 2HSZA 2F67A 3AM4A 4XAQA 4U7TB 2D3WA 4D9IA 2C2BA 3H6KA 1YR6A 3BK2A 3IDQA 5CFMA 4YY3B 1E3DA 1COWD 2GO7A 1G4UR 4Z7JA 3AFIA 5KDLA 2FLVA 4HB0A 2ECFA 3PRKE 2E0IA 1NQAO 2YXNA 4LMRA 4PCUA 5LNK6 1QLWA 3BGSA 3ZJ4A 1PL0A 3PX2A 5K6TA 3MELA 3V42A 4AZ3A 3H5LA 4BVGA 1G5PA 5DW0A 4QSMA 1YO6A 3TLXA 4N5NA 4EPWA 5HK8A 2EW1A 2GS9A 1OBHA 4L85A 4U63A 4B2PA 4TYWA 3O8DA 3TR0A 5MDHA 3H87A 4OLHA 4KI0A 1AKVA 1HDZA 3BILA 3U3KA 4CKCA 1AK2A 3K9LA 1OI7A 4FMCB 2VPQA 3TLCA 4EW1A 3F2VA 3OZBA 5G1NA 2HV8A 4X00A 2OCBA 1Z8DA 4G1CA 5LLDA 1W88A 4U9IS 4Z54A 4XQ9A 2J9FA 1GPWB 1M2NA 1E9SA 1X15A 5J5VA 4D0GA 4ARSA 2BBWA 4D74A 1QH9A 3IL2A 2O8CA 5AKZA 1RPJA 2QL7A 2CB9A 1TLFA 1KZ1A 3T3PB 1OHHA 4BVBA 2O6LA 4HNHA 1HK7A 4GKJB 2Q2VA 3F0TA 4EUSA 2QK4A 1L2TA 3D8HA 1MDFA 3T06B 2ET6A 4AWXA 1WB4A 1Z08A 3VHXA 1E3WB 2ZRPA 4RVDA 1C1XB 1OYWA 1RTKA 2O2YA 1KYXA 2CNNA 1JSCA 2VHEA 3EIWA 1HV8A 2PUVA 4MIEA 3VPBA 3WRVA 2Q3BA 2VJAA 4QG3A 3KT8A 3DAHA 1RRMA 5BW5A 2HHHB 1RFLA 1U2GA 1O08A 4Y6OA 2VK4A 4WXHA 3OOJA 4YDSA 1L7PA 4FHEA 3TL2A 1ISHA 4R0VA 4RHXA 5AMXA 1C41A 3GMSA 3P4XA 2NT3A 3L1HA 4ERNA 3LY5A 3WIVA 1J0DA 1KXZA 1YR3A 2FZLA 2K4MA 5IHXA 4W5OA 2I3DA 2GLUA 1U8TA 3WRWA 3RYCA 2HA5A 3EIOA 4OXXA 5EC8A 5F2OA 3A6PC 2EFJA 4TVSA 3S3TA 2CXHA 3PD1A 3K9WA 3OPXA 3GA0A 1EBUA 3QE2A 1KFBB 1E5DA 5JBIA 2C95A 3M6WA 5EHXA 1X87A 4H08A 4YHHB 3G59A 5K1ZA 5T4FA 3R7FA 4A6PA 1BGVA 4TWIA 4Y2RA 5CBKA 3RHSA 2XB9A 3IP6A 2EX1A 2PX8A 1QYIA 3KSUA 1LQ2A 7MDHA 3T1HB 2ZRKA 2OCAA 5AXDA 1P33A 4W6ZA 3EY4A 1BD3A 5KHLB 3GEEA 4B7CA 1MAAA 3NHWA 2JATA 1TPZA 3KQLA 2YWDA 2Q07A 1RYMA 1R4ZA 4IUDS 4U2GA 2DETA 4G1BA 4UDNA 5CXXA 3MPOA 1VPTA 3U7GA 2NU9B 5ICMA 3E61A 4GZLA 4JQOA 4WOKA 5ALIA 1LRKA 5LCXA 1CSEE 2WYIA 3CR7A 3E3NA 4LNHA 4RMGA 1NNEA 3EFEA 3M4YA 4IF4A 1I30A 2P69A 3OAAA 5IVPA 1EMDA 1NWHA 2J5KA 1M1UA 2QW1A 2W48A 3DYVA 3DFZA 4O63O 1KO1A 2JJ1D 1E77A 1VLLA 4KO4S 3UFXA 1RXWA 3D4OA 1PGPA 1Q84A 4WBXC 2GA8A 4V0MA 3AC0A 4DDUA 1GAWA 4IMIB 4URZR 2WSLA 4FI3C 2YWCA 4Q34A 4ND8B 3W8NA 4F46A 2PU5A 3DSRA 3HDTA 4FC7A 1D07A 3LUBA 5CK5A 1Q7EA 1SRRA 1KAHA 1E3JA 1D5CA 3NWPA 3FGPA 4IDCA 3MJSA 3T4PA 3GGJA 1OAOA 2FCAA 2X5XA 2R96A 3UJHA 1KI6A 1O5TA 3FPGA 5GWXA 1L8XA 2CUNA 3HUUA 1GILA 4LHWA 3CC8A 5ICFA 4O1MA 1FFCA 1J07A 2PT6A 4Q9IA 4XVCA 4ZODA 5JNUA 1JHPA 3PDWA 3VFDA 4DDMA 3EEYA 4MI9A 4R2KA 3SWWA 2PH7A 1YU9A 1OFTA 2YHBA 1T8WA 3D4IA 4H6PA 5CDFA 4BNKA 4DB2A 4JOSA 3BSFA 1RC0A 3ORQA 1YCHA 4MYCA 5EHGA 5FUWA 4RH0A 4TMYA 4X90A 4BLVA 4F56A 1WBBA 4BFLA 2HA7A 2EARA 3PT9A 4ASUA 2DAPA 5E6RA 1P9OA 1T3GA 4IWNA 4XSGA 1M8GA 3VAYA 3UICA 5H16A 1PZXA 3KJZA 3KV1A 4TTQA 5LU9A 3R9WA 1DRVA 3QKSA 1KBZA 1K2VN 3RYTC 4MVJD 1UDWA 1M5RA 1JEYB 1B4DA 1CIJA 2ZAMA 2HXSA 4IHJB 2WNSA 1YB4A 1G21E 3ZIDA 3EARA 1FXSA 4FZ3A 4U2KA 4UNNA 1NMXA 5CCBA 1X9GA 1DT3A 4IUBS 4RE5A 4M1MA 1FLVA 2OGUA 3CZ9A 3BM5A 3KD3A 5A0TA 2P4SA 4FEEA 3DW1X 1TUBB 4IW3B 2H1HA 3HU5A 4KEAA 1A9XB 3WMRA 1GQSA 3B8HA 3HI4A 1CYDA 3FTNA 1N6NA 4B9AA 1D8AA 2B3DA 1YNSA 4C6HA 4O3MA 1AKNA 4O4LF 4PO9A 1ZXLA 4G0YA 4Y2XA 4EYKA 4ACAA 1JWBB 1ZXBA 1KERA 1QIEA 3EQ6A 4JI1B 4B74A 4B6QA 2OAP1 4ITRC 1E9DA 2ZR8A 2RGRA 3UJCA 2M9MA 5JTUA 1F3LA 2V7QD 4OJMX 1SUIA 3G1UA 4K05A 4ID3A 5JMWA 3C97A 2XYQA 1G9TA 2G3YA 3TBFA 4IS3A 1WRBA 3AR9A 3KLBA 5EE0A 2O7NA 1GG8A 1QNFA 4QHSA 2G0TA 3GGCA 3ZDFA 1ZMOA 4LZAA 1WXGA 4EG0A 1RLIA 1TFRA 1Y9DA 2QRJA 1JXQA 4YRQA 5BWOA 1KDPA 1C3OB 2RHCA 1LX7A 3HCBA 5I8ZA 2B34A 2I7DA 5LLTA 2JLYA 5IAAA 1M3SA 5AUNB 3WIDA 1D03A 1XLTA 2VDVE 4Q9HA 1P1FA 1GPDG 1DTEA 4DZZA 3SQXA 2PLWA 1KR2A 2IPNA 3ITKA 1QXSA 1O8CA 5IAJA 3GP5A 2CZQA 1M1ZA 4CF6A 4D02A 2W9XA 3R5KA 2B5WA 2OY0A 2A4MA 3AW8A 4PZCA 5C32A 5KNDH 2WQZA 5TF4A 4QGSA 4J16C 2YX1A 3IIIA 2WSSA 2BZ0A 2WIGA 5FNVA 2NZUG 5TSDA 4DAOA 1FFHA 1KFKB 5T64A 3CURA 1QH8A 1J90A 1LFDB 5BRAA 5HIKA 1QZUA 2WPDA 5K51A 3UJBA 4OQFA 3OEWA 1NXOA 3R0ZA 3HCFA 5C5EA 1M34B 2EX4A 2P0EA 2C4UA 2Q41A 4LXQA 1A72A 4ZDWA 1F60A 2DE0X 4RENA 4MI3A 2HK9A 2Q7OE 3O7MA 3N0XA 2BMFA 2CLEB 3DE2X 4D46A 2JW5A 2J0UA 4YRLA 3VC3A 4E88A 1NW5A 4M99A 2WG2A 1EHYA 1WXXA 3O1HB 5BNZA 1OWLA 4ZDKA 1GAEO 4XW2A 5T41A 5KTRA 1UZAA 1NVWQ 5IARA 3MWLA 2O7RA 3P96A 5IXSA 5EE1A 2UVPB 3P2IA 4LW8A 2GKOA 2P1RA 1Z26A 1FYXA 1QIGA 3UAWA 3ZR4B 3CSDA 2BKUA 2UUCB 3PWKA 1HMYA 2ADOA 3Q6NA 4UBOA 3QKWA 3E15A 5KNCD 2PS0A 5IKOA 1E0SA 1FDOA 3M4NA 2W2KA 5LWQA 2SCUB 3P9IA 2Y4OA 3ES9A 3NRJA 3WA6A 3S1LA 4L0QA 1T5IA 2CLCX 2X8JB 1ZKDA 1SKQA 3GNQA 3S8YA 3H3JA 3CCBA 4IDQA 5FBWB 2FN4A 2WYUA 3NDRA 4OHKA 3FTDA 1T26A 5GV7A 2PG3A 1PK9A 4Z6KA 2QA5A 4P0QB 2IXEA 1U2ZA 3O0TA 1ZUWA 4E2YA 1TZMA 3D4LA 1CQPA 1VJCA 3UB4A 1XEFA 4OIMA 4N9QA 4QJ4A 4KK4A 3I2HA 1P0PA 3FAKA 4RHTA 2I4LA 1YFZA 1CUHA 1KNXA 4KQMA 2P2DA 4QBFA 3ICCA 4LE0A 3RBXA 1XPRA 3FLEA 5DF1A 3SHQA 3ZBTA 1C4XA 4JITA 2W8BB 2OCGA 4PFQA 4XGQA 2W6NA 3DPSA 3O47A 1QE0A 3ETDA 5CURA 4ZQCB 4YAKA 1SOVA 3CNEA 3M81A 3OFSA 4MIOA 1RQGA 5LZ5A 2AH5A 3IR6A 3JRWA 4KQXA 1P1IA 3UQYS 4N3NA 5LKRA 3L6EA 1H05A 3AV0B 3UMRA 1Y3CE 2CVHA 2HDOA 1CUSA 2AN1A 2BFFB 4M0DA 4Y2VA 3STTA 4IVNA 1HNWB 3I1IA 4Q6WA 3SM9A 1PQYA 3I9LA 3BH0A 1EWTA 3AIOA 5A6SB 2QAIA 4QXAA 3A3OA 3GGPA 1IY9A 13PKA 1P29A 1RLJA 5L7YA 4EF5A 2P9BA 2FFRA 4AP5A 2RAVA 3IKLA 2PUGA 2EKLA 1X1SA 2Q5JA 4OLBA 2ODQA 1JHAA 1POWA 7ADHA 1ZSYA 1HRDA 1RYZA 4OQLA 5DBIA 3WGNA 1ODFA 3A04A 5A03A 3PEUA 1YAHA 3IUSA 1XT6A 4WK6A 3HZOA 3W9YA 4RGQA 3Q41A 4F5DA 4D56A 1C7EA 4K81B 4P36A 1YIDA 3WX0A 3IEIA 4ZTBA 2IEIA 1DEOA 5GVRA 4LAFA 2UV8A 3KB2A 3PA8A 3CU5A 1PT8A 3BL8A 1GDDA 2NQ2C 1BW9B 3H2BA 3OLWA 4JWTA 2H65A 4GOOD 1A2BA 3RYIA 1O95A 3L1VA 3RIGA 5JPIA 4D9EA 2FW1A 1C30A 1BXGA 2ZU0C 1ZH8A 1I4LD 2R66A 3QTLA 1AOXA 4UVHA 4MMYB 1GT91 3CB2A 4PX2A 5KQPA 1YZ3A 2O0KA 4B79A 3Q2OA 1GL6A 1K3UB 1ZVJA 2WIBA 3MWDB 4NYIR 5BQOA 3FI0A 4FD3A 2PGOA 2VJDA 4HY3A 2J8ZA 3ZV3A 1V71A 2AVNA 1W5AA 4GLFA 3VOBA 4TOIA 1W85B 1M2OA 2H1IA 1JHYA 4Q9JA 3WAGA 1H8HA 4GVLA 4OUDB 4F06A 2OKGA 4D9HA 4KQ1A 4IJQA 3IMKA 2JBAB 3M1IA 2V54A 4KAAA 2R7NA 3SF8B 4M0PA 1XCPA 2BFBA 2Q9AA 4ZDIA 3I30X 4NU8X 2FZGA 3WO1A 4YRCA 5F5XA 1JHDA 2FGJA 1BH6A 3LAWA 3EGCA 3QXXA 2I71A 1HLDA 4DUZB 4JA2A 1QVWA 4M49A 3D59A 4AZVA 3ZCVA 1WCIB 2C5EA 2NV2B 2QTVA 5IKPA 1QO0D 4H7PA 1NMQA 3I2YX 3VGPA 3RT7A 3SS9X 3H8VA 3OCZA 2OPHA 1PWZA 3C5HA 4RQAA 3BJMA 1HRKA 1AUVA 3KPUA 2I91A 3TNDA 2DYKA 4HEJA 1F17A 4FE7A 4E22A 3DFMA 5AKGA 2JD0A 3G9QA 1TK2A 4KXFB 4JXKA 4P4GA 3PD7A 5FO1A 2ZBQA 4KLCA 3V33A 2FZKA 4MROA 1Q95A 1WMFA 2Q3EA 1N5OX 1U28C 2RCNA 3EC7A 3G2MA 3QHQA 4GBMA 4NOKA 3CF6R 5EHIA 4EFDA 1II9A 2FSUA 4C0KA 4EMSA 5IJ0A 1Q17A 1JS1X 1L8AA 2BSXA 4XVUA 4I1PA 1ZVVA 3ER8A 3V4VB 4F8JA 3DKPA 4RXUA 4Y6PA 5FL7A 1UKYA 1QPBA 1S9DA 4QUDA 1U8ZA 3ZXIA 3CWZA 5M3BA 3DTYA 2ZYDA 3RAGA 2R4UA 3VO2A 1CR0A 3C3WA 3FNEA 2TRSB 3KCQA 3L84A 4MUNA 1LTQA 3FHLA 4U9HS 1JKMA 2ZSKA 3BBPA 4X66B 1ENPA 2M1XA 3BT7A 1LI5A 4ESOA 3T1TA 4HQRA 3EPLA 3IOCA 4GYJA 3V1UA 2C3MA 2XUJA 3N7TA 1VCMA 4NEHB 4DVJA 2AJTA 5K5EA 4ND1A 3DUWA 3ANNA 2G04A 1FTYA 2PGIA 4DC0A 2WC1A 3AINA 3CMMA 3TINA 3UK2A 3OKCA 3NEAA 3O3MB 1EM8B 4U2FA 3FPCA 5SICE 4Q02A 1Q7RA 1XZAA 3HXPA 4YB8A 4YQEA 4NL4H 4XTRA 4XI9A 3BTSA 1D9XA 521PA 2X9QA 2I7CA 3F4KA 4NOMA 3T4UA 1WV0A 5C9ZA 2X1HA 3ZS8A 5FF9A 4MW4A 3UIEA 1ORIA 2QNRA 1T1IA 3ETJA 4JLNA 1MEJA 3KYJB 1YZNA 3Q8WA 2FFJA 3TWOA 4DCNA 2IW1A 4NF2A 3KQMA 4FFLA 2GD6A 4DEVA 1QHHA 3HXQA 1PTJA 3IKTA 4GEGA 4UBLA 5IWCA 1DX6A 4PC3A 4BDTA 1QCDA 4GKVA 4BEWA 3H3XA 1P19A 1BSVA 1GNQA 3FNQA 2R3SA 3IQDB 4G5GA 4J1NA 4BYMA 2EKZA 4RYDA 4PZEA 3HVRA 1JAXA 1LLQA 2X0EA 4F8YA 2PWZA 4P35A 2V6JA 2ZT7A 1F6DA 3UJAA 5IANA 3MW8A 2HZ7A 3H2JA 2E2WA 3BZWA 1Q7BA 4J1SA 4REMA 4C4SA 5IKEA 3RK0A 3NANA 4QOSA 1Y1SA 2H07A 3KTAA 1NNI1 1A9QA 3HU1A 4NFLA 4WCVA 3ROFA 3T5GA 4DBLE 1PU2A 3X1JA 1G8MA 5DYTA 4DT1A 3TOVA 3M6IA 3T7TA 3CVJA 4B8ZA 4PYIA 1EZZA 4U02A 1P2UA 1WKCA 1FDTA 2VP4A 3HU2A 5F51A 1OTXA 2AN3A 2BGUA 5DN6A 3UATA 4FLEA 4PO3X 1R7RA 3DZGA 4QTUB 4PCLA 4ZRMA 4Y9RA 2XVXA 3TJZA 4YMHA 5K6AA 3WYNA 1YHYA 2D0IA 3CR8A 5IC5A 4LGYA 2UZ0A 2ZRLA 4Q3NA 3LCVB 5FOTA 3NYIA 4B32A 4NOJA 3HCOA 3OQIB 5IVHA 2VJPA 3O4HA 3HTXA 1F8UA 5FP0A 4WEOA 3QU4A 1N5DA 2YICA 3H7IA 4X84A 1VE6A 4RD6A 4BNDB 2G77B 1TUBA 4BQSA 3QIVA 1E1QA 1XZPA 1RWQA 2E55A 3H6GA 3NYRA 1ZHHA 2HH9A 1KY4A 2BP7A 3AB7A 3FPSA 4X8LA 2AD1A 1I1QB 4U6NA 1X9IA 1NJ1A 2C61A 4HN9A 4OF4A 3TW8A 4E6EA 5BNTA 1GEGA 3AYXB 1T6NA 5IWAB 3PEFA 3WSTA 4GMXA 3IIMA 4OJKA 1GPKA 5G02A 1PCXA 4OU5A 1CX9B 4A15A 2FR8A 4UBJA 3WRXA 2VF5X 2OP0A 3H2GA 4KQGA 3VU3A 4CMCA 1Q0UA 2KI5A 3OETA 4J0CA 5HWSA 1YU6A 1TAGA 2WFAA 3AIMA 4FQ8A 1JLKA 4H6XA 4L02A 4MV7A 1KSGA 1IEXA 4KYIB 1KMHB 5C4MA 5I7EA 2M1ZA 2GHQA 3B5IA 3WWCA 2HU2A 2IW3A 1CF4A 3PE4A 5CH8A 3L7BA 3TTSA 5A4MS 4QGGA 3LCJA 4W8OA 1WUTA 5CM2Z 2ZWPA 4J75A 1FYWA 3CRQA 2BL4A 3EWIA 4X1YA 2DSTA 3ZE1B 4D9BA 4FONA 2I7XA 3PKZA 3TEJA 3T7EA 1SXHA 3QA3E 2JRLA 1RWOA 3PHIA 4U7WA 3P1JA 1KH2A 2OFFA 3DV0A 4JBXA 5F23A 1QANA 4R2JA 1E94E 1O96A 2GK7A 2R8XA 4G0XA 2PKQO 3MQFA 3OSZA 3SZMA 3RSOA 4XYLA 5KYTA 1V5EA 5NLLA 4IIFA 1Q21A 1AN0A 3QYFA 1YDHA 4KAFA 4NBSA 4B3HA 5J2UF 4MVCA 1L4EA 4UHHA 2FQ1A 1IHOA 3Q9UA 4B35A 3RAFC 1FF9A 1FL9A 2V6GA 3X2SA 3GBPA 2A6PA 121PA 2ZM5A 1FQKA 2ZBVA 4NMXB 1N92A 1G63A 1YZGA 5HIAA 4OI0A 3IEUA 4LA4A 2I4TA 2Y8EA 1XP8A 3IPRA 3INTA 5LZ2A 1GUFA 2H5EA 1A7KA 4IZHA 1GTL1 3ITDA 4FMPA 5LLSA 1I7DA 3K4PA 3OUTA 3AZPA 1D1PA 3IMFA 4NZYA 4UUQA 3WNZA 1T4GA 1OLXA 1SUPA 5F5LA 5HHTA 1Z9BA 2XXAA 1I2AA 3K0EA 5KYNA 1SBTA 3V4LA 1G19A 1X1BA 4CKEA 2OBBA 4U8GA 3S7TA 1HOTA 2KSQA 2OM2A 1XXLA 1XGKA 1RC1A 2C9YA 1MQ8B 3FPJA 4N5MA 5IAOA 2WZQA 3ONVA 3L77A 1OX4A 1N6PA 1XL0A 4CIVA 4MWDA 4LHXA 1G8FA 4JZYA 1EQUA 4YV2A 1U9ZA 1DIRA 2AZMA 2IQIA 4CEIA 4CTNA 1OGYA 1PF7E 1FU4A 4HTFB 1B0ZA 1GKYA 3C8DA 3LL4A 2FXIA 3W1WA 2PZKA 3BXFA 3NDIA 3HCPA 2O6HA 4YP6A 3KR1A 4F84A 3TQTA 4JLSA 1WB6A 2CKDA 3DDCA 4Y0NA 3UMMA 3K70C 2YYAA 4BNIA 2P6OA 3BF8A 2FFHA 4A6EA 3FH0A 2CXRA 3B3GA 5J59A 4A16A 2AJCA 3C6QA 3JYHA 5ITVA 4IRMA 5SV2A 3HR7A 3HM9A 2FWPA 2V6FA 1YVRA 4IIJF 2PUHA 2O0JA 4L57A 1NUQA 1OJ7A 4P83A 4RAQA 1DJOA 5AOBA 4DSNA 3PX7A 2R84A 3EXAA 5JIBA 1E3WA 1NF9A 3VHXB 1DQYA 5FRDA 3AERA 1QGOA 3N0TA 4BWFB 3O2NA 3R7SA 1SKAA 2R2AA 1SCUA 3KKPA 3GUCA 3PXDA 4MJ3A 4Z0TA 4BLPA 1BVYF 1IEQA 3UCEA 1C3EA 1U81A 3MHPA 2XAAA 2OMKA 1L5LA 4L76A 1I2BA 2OXRA 2XY4A 3NKVA 4KN8A 3QVOA 2QTVB 2WVGA 4YO8A 2J09A 2V9ZA 3A3KA 4BOYA 3A10A 3T5CA 1HQKA 4QDJA 5HF9A 3F8WA 1K7CA 1ONNA 3EYAA 4V38A 3ZJVA 3KLMX 3SR3A 1QE5A 1H3NA 3UAYA 4E2XA 5KNBH 1NXVA 4Q7JB 2IOFK 5CB4B 5JZBA 4ARAA 2ETVA 2CVQA 4WXEA 1L4HA 4MLZA 5KJ6A 2PZEA 4NIMA 4CEJB 3H5NA 5EE3A 1E7QA 1ZITA 4JJGA 3SJAA 3LQQA 5LOVA 4IBOA 1IJBA 4TX1A 1PD0A 4WY2A 3UA4A 5JRZA 5BR4A 1IG3A 3RS3A 1FXWA 1R0CA 2FE4A 4U7DA 4LFAB 1B23P 1U2GC 2CWWA 2V7GA 3NASA 4NABA 3RIHA 2DKNA 4MV9A 2PWBA 2QMEA 2G9UA 1DO0A 2O23A 2ZWOA 1YJ5A 1KRXA 3LI2A 3E1KA 1I94B 1DQPA 2OV2A 3E5RA 4BKPA 3T5TA 4WOCA 4CTMA 2OFPA 3G0IA 4ENSA 4CCYB 3F6YA 3A25A 3LPDA 3NTXA 3UUGA 4PVCA 1BVRA 2CNLA 1DXYA 2X23A 4RABA 2NVUB 2ZCJA 2FPPA 3O90A 1J0CA 5FI0B 3VH4A 2HWUA 4NCIA 4JC0A 3TTXA 4C87A 1Q12A 3NS7A 1GZ4A 1F0KA 4JYCA 3WO0A 1Z74A 5AQ1A 1E20A 1A1SA 1RHQA 2FCRA 2WTMA 4G5SA 3FPAA 4FQ7A 1S8FA 3T15A 3WLEA 1O2DA 4D79A 3T9DA 1LK7A 4XYMA 4PFSA 1PAUA 2KHZA 4RMNA 3F8TA 1V5GA 1XJWA 1YCFA 3NT5A 1UPTA 3QA9A 1N6OA 1Z4QA 3LTNC 3P0EA 5C5IA 4PU0A 1Y0BA 3QOXA 4ECAA 5JNWA 3IP3A 3GJRA 2L18A 3W6OA 4GOLD 5GP1A 3WK6A 5IZ4A 1QLJA 1NVVR 5J4YA 1SCKA 2IX9A 3HC7A 3W2IA 3AFHA 3QKTA 4HWTA 4TPKA 2WF8A 3IMGA 5KYGA 4TZKA 3PC3A 1OPXA 4MO9A 2BFMA 4BHTA 1TO2E 1VG1A 2NZ8A 5CDHA 2K5UA 3G5UA 5KMGB 1SK8A 3JU3A 2Q99A 4BQFA 5KTPA 3K5IA 5F5NA 2FSVA 4I5FA 4Y6QA 2PJRA 5CLFA 3ZGZA 1GAXA 5CVTA 4A8JA 4U2DA 3WLAA 2HBQA 1JZSA