3RSLA

H-ras soaked in 90% r,s,r-bisfuranol: one of 10 in mscs set
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
156
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Analysis of Binding Site Hot Spots on the Surface of Ras GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 156
sequence length 166
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rslA00
3A1WA 3L0SA 4QBGB 2WJIA 3B8HA 3DZ8A 3IQXA 1R10A 2ZYUX 5CB6A 3EPJA 1AM4D 2IW3A 1XPUA 2RGNC 4RFSB 2HF8A 3THXA 3KTAA 4BLQA 3CRRA 5CM8B 2VPPA 3FDIA 1MR3F 3SJAA 4D4KA 1QF9A 3AH8A 4FWIB 3BD9A 5DHAA 3P1JA 4Q7MB 2QBYB 4Q03A 2BMFA 4BZQA 4ESHA 3AVVA 3K0AB 1S4QA 1TUEA 4CIDA 5CITA 1P2TA 4IOMA 4EAQA 2KB0A 1CTQA 4ABYA 4YMUA 3PV0A 2ERYA 5DO9A 1XEFA 2HDNB 5HCNA 2Q0HA 4NTZA 1S3SA 4DIEA 3I62A 4I1SA 3GLHE 1H8HD 1W0JD 2ATVA 3FYHA 4N0EA 5CJPA 5GJBA 2KWIA 4IDNA 3TSZA 2QAGA 1O87A 4LHXA 2ZVPX 3PFIA 1VHLA 5IT5A 3PEUA 1ZIOA 1JR3E 1N5JA 5K8TA 3EPLA 1SVIA 5DN6D 3UWOA 4CEJA 4DSNA 4NH0A 3TIFA 3DZDA 4HLCA 3B1ZA 2QT1A 4B3BA 1OKKD 4C7OA 4UXHA 1ZUHA 3VR5A 5G40A 1ZW6A 1UADA 1TEXA 4IKEA 1KO8A 4CEIB 3T1OA 4QC2A 3MAAC 2HLDA 3CR7A 4PPFA 3WYFA 1N6OA 2A9KA 2ZR7A 2I1QA 1UKVY 3TUZC 5JFGA 3EA0A 4HDCA 1WDTA 5EE3A 5BW8A 3SBEA 4F4CA 2ZRLA 1E1RA 2EU8A 3AP3A 1GRRA 2BOVA 3CBQA 3ZDQA 2OCYC 4QGFA 4G5OA 1X3SA 2IS4A 3HU1A 2JJ1D 3LXRA 4RD0A 2ZR0A 2AX4A 2BM0A 1KMQA 5SZJA 3MGCA 3FOZA 2GCOA 2WMOB 1YZLA 4C0SA 5EXPA 1Q1BA 4KVGA 2J0QA 3VMFA 4ZKEA 3VX4A 3U4QA 1KSJA 1UBEA 1CJKC 3VKGA 2ONKA 3NIBA 2AKYA 4LV6A 1COWD 3GCGA 4QBIA 4JLKA 1HV8A 1Q21A 4ZCIA 2JJ2D 1J2JA 2JEOA 4BASA 3QXHA 2FGJA 4A6XA 2EFHB 4HLDA 2KE5A 4YXWA 1CS4C 3EZFA 4IFEA 1R0ZA 2YOFA 4JL6A 1OT3A 4TLAA 2BM1A 3AUYA 5DYIA 3TSWA 3VKHA 1UKEA 3DDCA 4KYIB 3RVBA 2WTUA 1XZPA 4RD3A 3TGPA 4OQMA 3O8RA 3EZ2A 1R7RA 2BMDA 2IYUA 4IVRA 4Q48A 4KFUA 4QM7A 3QF4A 3CO5A 2J0VA 2H92A 4KVAA 1H8EA 1QHHB 5L8VA 2D2FA 4GRAA 4QKQA 4DZZA 4OI0A 3ZS8A 2JA1A 3V00A 2P2LA 5AK0A 3OFND 3VX3A 2C78A 4NP6A 4Z8XA 2A5JA 5LB2A 1A5TA 1MO3A 2ZUCA 3EIQA 4ZO4A 3SYNA 1N25A 2LKCA 1KK0A 3PUYA 3THOA 2VHJA 1E98A 2ZRMA 3EZ7A 4FN5A 2RH5A 2FZ4A 5GADl 3KUCA 2UKDA 2BKEA 2J0UA 3QEJA 2ZSDA 2ZITA 4L8GA 5EP3A 5FI0B 3GFPA 4I1OA 4EUNA 1OIVA 4MGIR 1SVLA 3BK7A 3OHMA 4YLGA 3WBJA 4P4SA 5IF9A 1JALA 5A4JA 3IEVA 1VKJA 4B3GA 2AR7A 4LPSA 3B1WA 3REGA 2IUSA 4C0JA 4QJ4A 1P73A 2BBWA 1Y3AA 5C4GB 3IQWA 4JBXA 2FSHA 2BJWA 1IY1A 3QJYA 4LC1A 4DLRA 1WCV1 3VU9A 4ZV4A 5EP1A 2NO9A 1RZ3A 4R2HA 3D7MA 2IYXA 3QVUA 1QG2A 4Q1DA 2GHIA 1XJCA 1Q57A 1S3GA 3IIKA 1SVSA 5K8IA 1IXRC 3AF2A 3CNLA 2G1KA 2ZROA 3VR1A 5EE5B 1E9CA 4TTQA 3K0CC 4OQNA 1R0WA 4NYJR 4OHXA 1NBMD 3P27A 1L4UA 5TV2A 1LW7A 1IOZA 1YZNA 2WHXA 5H68A 5G3ZA 2FSFA 2P0EA 2W6ID 3N70A 3RNLA 5KNCA 4Q01A 5H8WA 4IXMA 1NN0A 1N3BA 2GJ8A 2E9SA 1T3HA 3FMIA 4OHVA 4XWAA 3O8DA 1T5IA 3BRWD 4ZDKA 1OPXA 4H1VA 2ZVQX 4AKEA 1X86B 2D7CA 3AGQA 4W5JA 1YZGA 1OW3B 1RJ9A 1LTQA 2FE4A 3VHLB 1G9XA 1KY2A 5BWMA 1W7AA 2VA8A 4I1VA 2IS6A 2CHQA 3R8FA 2RAPA 1G291 1E96A 4DJTA 1KIMA 1KO5A 2OCAA 3QIAA 3GLFB 2H17A 5JRJA 2I4IA 2NO1A 3B9PA 2RCNA 1DE0A 1CRPA 4HI0E 2CLCX 1X6VA 4D2IA 2XITA 1G1MA 1SZPA 4L4UA 1C9KA 1R0XA 5J47A 4JYCA 4LV8B 4P0TA 2ZXUA 1E1QD 1TL7C 3E5HA 3NHBA 5AJZA 2VP4A 4TMVA 5FPKA 4V0NA 4IOKA 3PENA 3GD7A 2VQSA 2CK3D 5CLQA 4ACAA 1AKEA 1WXQA 3MD0A 4WOPA 5JEEA 4DLZA 1E79A 1BYUA 1O3YA 3IPYA 3AVWA 2D3WA 5K8UA 5K8LA 2FG5A 1W2HA 2XXAA 3U44B 4RCYA 4EPVA 5HE8A 3QXJA 3BAFA 4NCIA 4JKYA 2OHFA 4JVMA 2XB4A 4GFDA 1F5NA 4E09A 3OIVA 4C2UA 2YINC 2ZRJA 4LBVA 5HKKA 3K09A 2WKPA 4RY2A 5D3MB 1KNQA 3THYB 2V9PA 2ZANA 4B3FX 2R44A 1CR4A 2PT5A 4C0LA 1P3JA 1G3UA 2IS1A 1DAGA 4B34A 1D2EA 2V7QD 4PHTA 2ZE6A 2MSDB 1E3MA 1GKYA 3FHCB 2VLIA 1X8LA 3EPHA 2D7DA 3D31A 2EFGA 2DFKB 4HAUA 4B74A 4D4JA 3EG5A 5LPNA 2ZEJA 3S1AA 3T1QA 1W46A 3BJIC 4AKGA 2IYLD 2VSOA 2V8OA 1GNRA 3FVQA 4JLMA 3KZ1E 5KTYA 1DAIA 2E87A 4DLYA 3AVPA 3MRSA 3P20A 4TTRA 2G1JA 2JIZD 1W4CA 3I1FA 5LBIA 1OSNA 3AVTA 4GOJA 4NCNA 3SU8A 4D80A 1D5CA 1Z0JA 3FE2A 2EQBA 2LKDA 3A36A 2ZS7A 5FBVB 4NZYA 1PVOA 4NBSA 3AVUA 1S1MA 2PT7A 2XZOA 2FFQA 5AJWA 4GL2A 4IHQA 3RC3A 4Z54A 4MQBA 3ASZA 3I61A 1II0A 2N46A 1T3SA 2R6GA 2CCKA 5DI9A 2JDID 1WQ1R 3NBYC 4LZZA 5KNBA 3EIEA 3QG1A 2YWEA 1U99A 1G6HA 3B5JA 1HURA 3G82C 1HA3A 1E0SA 1PZNA 4UXJA 3WYGA 4X8LA 2PCJA 4A8JA 5B57C 2WAYA 4IRUB 2HYIC 2RB4A 1HYQA 4R71A 3NBZC 1XEWY 1XMVA 4BFUA 3EWAA 2VSFA 2ZQ5A 1HE1C 2ZSFA 4UNQA 1FP7A 3SN6A 2V6JA 4XSGA 2A78A 4GBMA 4MKHA 1U9IC 3J81k 3BFVA 1GRQA 3OEHA 5BQ5A 5EE9A 2WM9B 5F9HA 2CJWA 4JJKA 3BFXA 1T8TA 5P21A 1ZCBA 4LDJA 1TQDA 2Z4RA 4KAXA 3F5FA 2IL1A 1TU3A 1CULC 1E69A 1GWNA 3CR8A 3EX7C 1ZU4A 1NVVQ 1DG1G 3EXAA 2V4ZA 1F2UB 4QNMA 2RGGA 1NLYA 5JJKA 1EG7A 3CX6A 1ZM7A 1EFRA 1NVXQ 4KSBA 3ZVRA 2VHQA 4KU4A 2GNOA 5L3RA 4GNKA 1AK2A 1NKTA 2X2FA 3EC1A 4JLJA 4TT3A 3NTUA 5H70A 2QEQA 1SKQA 2UVQA 4A92A 4RJLA 1FOEB 3BOSA 5IK2D 1OHHD 3H84A 1GM5A 5JS8A 2AFIE 4MRNA 1D2MA 2WIAA 2ZIAA 3K9NA 4CZ2A 3U3RA 3TUJC 4V03A 2W58A 3NDBB 4OI1A 2G88A 4E03A 2H16A 2QORA 2FNAA 1ONBA 5FTKA 2J45A 4TZ0A 4LHWA 4Q4LA 5CJ2A 4MRSA 4POAA 4EJSC 1IN4A 3E70C 2NZ8A 1NG9A 5DNYB 4MA4A 2ZM5A 2Q3HA 1DAKA 3GJ4A 4Q02A 1W1WA 1BMFA 2X1VA 3E1SA 2F1JA 1P9NA 1U98A 1BH2A 4LJ9A 5HCIA 4EFLA 3SJZA 2QPOA 3AF4A 5HTKA 5FBLB 1G7CA 1HQCA 2IWHA 1KK2A 4DLUA 3BE4A 3LDAA 3GFTA 1MV5A 2ATXA 2IK8A 1J7KA 1GP2A 1H8HA 1F2TB 1XZQA 4PAOA 4ESVA 1NLZA 1GDDA 3KQLA 4OL0A 4ARZA 1G8GA 2C5LA 1RVDA 1HQYE 1OXVA 4NHOA 1NN5A 2EWVA 4LCBA 1E2LA 5KSYA 3CF2A 1J70A 2Q3MA 5DN6A 4XTCS 2O8DA 1AS2A 1JAIA 2CVFA 5C46F 1IJEA 1KI6A 1EWRA 4BZPA 1KK3A 1P61B 3CWZA 2F55A 2XOKD 1R2QA 2JLVA 4XJXA 1E2PA 3H2YA 1OB5A 2EYUA 2O8BB 2FN4A 5F3WB 1Z0DA 2ZRPA 4OQXA 3A1VA 4HAYA 1NY6A 1CBUA 3RAPR 3W90A 3TNFA 1US8A 3BC1A 3FWYA 4G3XA 1JQLB 2H1LA 1WE2A 3W6OA 1G8YA 3KL4A 4C0BA 3GLGB 1ZAKA 4LJAA 4P32A 1E9AA 1IQPA 3NEYA 2BCJQ 4UNRA 2JJ1A 3OESA 2ZRIA 1GIAA 3THWA 3KQKA 1P2UA 1U8AA 4MH0R 4TL8A 4OK3A 4B3XA 4QHTA 4LGMA 6Q21A 1M7HA 2HCJB 3ONWA 3T1VA 2ORWA 3ZS9A 4G01B 2FPMA 5SZIA 4B75A 2HT1A 5FFMA 2QRZA 4E22A 1JEDA 4MDEA 4IVPA 1NRJB 4WXRA 3TK1A 1XF9A 2X19A 4PHHA 1KHTA 1COWA 3EZ6A 3O47A 2NPFA 2QE7D 1ZYUA 3K9LA 4GMXA 4DSTA 2BBOA 4M22A 3D8BA 2Q3FA 4WXPA 3VR2A 1FUKA 1DAFA 1IN5A 5C2JB 2PH1A 5FOWA 5EJEA 3RC8A 4Q9IA 5EUQB 3FKQA 3LVQE 4A0FA 3NC0C 1ZBDA 4Y0VA 4NDZA 1NJGA 3TBKA 4DLSA 2BV3A 2JGNA 1AGPA 3U7HB 3SR0A 4QHSA 2R65A 1Q20A 2QENA 2Q9CA 3ZGXA 4DCSA 4EPXA 2ZJOA 4OJKA 1G7SA 1XWIA 2Q6TA 1GG2A 2R6AA 1DG3A 2RHMA 2NO0A 4HAWA 2ZUDA 3DL0A 1XU4A 2F43A 2VP9A 3QPWA 2PL3A 4Q9HA 4O2LA 2JAQA 1OIXA 3NKVA 2YHSA 4MYCA 3A4MA 2IYYA 1HT1E 1I2MA 1BS1A 1UFQA 2GVDC 2FPLA 3TUIC 1JXMA 4AKIA 3NG1A 3NVAA 3MG9A 3DOFA 1Z29A 5ANRB 4QL3A 4QJ5A 4KSCA 5EXTA 4CRWB 4FXPA 1YRAA 1IY2A 1XD2A 5JWOA 4KV9A 1ZINA 2D62A 621PA 1E2IA 3DMDA 2DB3A 1VIAA 5EUMA 4CVNA 1XTJA 2DCUA 3LX5A 1E2QA 3C8UA 3QPVA 5D3QA 2O8CB 2QP3A 2YNMA 2BVNA 2PJZA 2OXRA 3UMFA 1L8QA 4D81A 721PA 1E2FA 2VP2A 1ZM9A 3M4YA 1P5ZB 4GP6A 4HLQB 4Q4HA 3V4RA 2ZJBA 2X77A 4QHYA 1IHUA 1DAMA 5JWHA 4W5HA 2QNRA 1OF1A 3EZ9A 4URUR 2DWPA 1NMYA 1C4OA 3PJRA 4EDHA 2VYFA 2YKGA 1XCPA 5KPDA 4PC7A 1JR3D 3TMKA 4MYUA 1EXMA 4MKIA 3KXLA 2ZAMA 5AWFC 1EK0A 1G7TA 1QHXA 2RGDA 2XNDA 1KDPA 4LX0A 5B30A 3FPAA 3HDTA 2IUUA 3P26A 2CL7X 2GCNA 4P4UA 4JIMA 5CLLA 5GVRA 1W0KD 2F3TA 1NBMA 2Q21A 4RKEA 2GXAA 1AZTA 3GJ5A 3MWYW 1OLOA 1TAGA 3X1YA 2AD1A 3WNDA 2QBYA 2F9LA 2UZ3A 2OFWA 2W6IA 2VRWA 2QP9X 1GRNA 2WKRA 2CNWA 1JR6A 4LUCA 1KTVA 1UDXA 2WWIA 3AEZA 3QNUA 4NYIQ 1Z08A 4NMMA 2JCSA 1G17A 1YVDA 1Q1EA 3LAWA 2O5VA 1E2HA 2ZJYA 3O8BA 4NU0A 4OI2A 5SZKB 2CVHA 3WRXC 3VHXA 1XEWX 1EFHA 4KLZA 4F4JA 4URYR 1AQYA 2FWRA 3OAAD 3Q7QA 2WSSD 1Z6XA 2ZRGA 4RVCA 5JSZB 3RRMA 5JS7A 4D26A 1W5SA 4GZMA 4OHWA 2OUKA 4MRVA 1KY3A 1CR1A 4B32A 1XD9A 3CPEA 1SXJB 2AXNA 2A2ZA 4TYQA 4HAXA 4AY2A 4IOJA 4JLOA 3TW8B 3LA6A 2WJYA 3B78A 3ZVMA 4B2LA 1E1QA 4P33A 1IONA 1YZTA 3PXGA 4CEIA 1LY1A 3LQRA 1KZ7B 3OE7D 3B60A 1S2MA 3MFYA 2B7CA 1D9XA 2VL7A 2NQ2C 3REFA 4TL6A 1Z0FA 2C95A 2QTFA 2ZRKA 4QG7A 3H1TA 4IOLA 2REBA 1UF9A 1DO2A 1GZSA 1ZC4A 1U94A 2IX3A 5JJIA 1W2GA 1L4YA 3VR3A 3RS2A 4C3ZA 3CW2A 4WBSA 5H1YA 1U8YA 1II8B 5J5CA 1NMXA 1DEKA 1QVRA 1MKYA 1P60A 2XSZA 1YR9A 4I4LA 4EPYA 1Z8FA 1FFHA 3DM5A 4PQFA 5FUYA 3U3KA 4RCZA 3LY5A 4Q1AA 3A6PC 1EWQA 3QXCA 4BGDA 4JLAA 2B8TA 3WP0A 4PFSA 4PX9A 4PSKA 4X8OA 5EZ5A 4Q4JA 3THXB 3VR6A 1XEXA 2ZI5A 3SDZA 5LDDC 4G5RA 2AN9A 1N5LA 3PITA 4D6PA 4LK2A 1P9RA 5AUPB 1G18A 5J4YA 3AQ4A 4PC1A 3KKNA 3FHTA 1XTRA 2J3EA 3MMPA 4Q9LA 3PQCA 4US1R 3B1VA 2LWIA 3B2EA 2XB2A 2PEZA 5IRCD 5UKDA 1R6BX 4J0QA 4G5QA 4XH9B 2N42A 2OILA 3MWJA 2JIZA 3TH5A 5BYJA 3QVVA 4V0KA 1P62B 3KX2A 1DAEA 3CRMA 4AYWA 5E7JA 1S0UA 3B82A 3KDSE 4MGYR 4XSHA 4ZPXA 1IXSB 4YMTA 1QHSA 2AD5A 4ON9A 2QSYA 3PEYA 1TQ4A 1G7RA 4PZYA 5E4FA 4Q7JB 4KHZA 5FL7A 3SQXA 2G6BA 3ZIAD 4L15A 4RKFA 1QHHA 2RGNA 3AF3A 1G8HA 3W3ZB 3I72A 1Z3IX 1P7CA 2RHDA 4JLBA 2ZI3A 3EAQA 1MABB 2HCBA 2IUTA 2JDIA 4Q1EA 5GJCA 2RGAA 3PG5A 1UDWA 4GP7A 3A8TA 1XMIA 4BQSA 1R0YA 1Z28A 3FMFA 3CONA 5FBRB 1KI1A 3VAAA 3Q5DA 2MSEB 1HH4A 3NBFA 3QKTA 1K6MA 4BEBA 3CRQA 1XCMA 3WMFA 3N2IA 2FJUA 4BLSA 2GXSA 3H0KA 4HZUA 4KBGA 2FOLA 5DI3A 2J7KA 4US0R 3CH5A 3UG6A 2O0JA 5DHFA 2IYZA 3I32A 1Z6YA 2WKQA 4LYFA 4G5SA 1XPRA 5LD2C 1F3OA 1XXHE 4MRPA 3TRFA 5KOYA 4WW0A 2OESA 3K0FB 1E2MA 1IXZA 3WMEA 4TYWA 3TVTA 1KSFX 1OXTA 3U4QB 3NDPA 4TTPA 4B3DA 3HJNA 3NH6A 4M1OA 2F7SA 4MUAA 1AQUA 5KSPA 2VIIA 1M74A 1OE0A 3M0EA 2XEXA 5FPHA 4A6PA 4TYNA 2REXB 4PQRA 1JPNA 2C8VA 5TY0A 3RS3A 1KMHA 4JBYA 3UANA 2CLSA 5TXGA 1GNPA 4XVQA 4BFWA 4QXAA 3KQNA 4M0LA 2F1RA 2G77B 4LHVA 4Q19A 1C1YA 1RRGA 2J0SA 3T35A 4ASUD 4A0GA 1YRBA 4LI0A 1CR2A 4JS0A 1OHHA 1TF5A 3CNOA 2GILA 4PO9A 2GAAA 2QTVB 2K5UA 1KJZA 3U6BA 4JZKA 2B7BA 1KNXA 3QF4B 1AGRA 4TWZA 3QOFA 3VQTA 3OIYA 2WIBA 5FOVA 2W6JD 3RWOA 1GILA 4OBEA 1WP9A 3SI7A 1MT0A 3K09C 4JT2A 3EASA 5E3HA 2QMOA 4IFBA 1YZKA 3KQUA 4EQ6B 1ZC3A 3ICEA 4FWTA 1DO0A 3TW4A 3GLFA 2V1XA 2DYKA 2FFBA 4JSYA 1Z2AA 1SXJD 2V54A 2BEKA 1OH7A 2ZJAA 521PA 3OIUA 5KDOA 1II9A 4OK5A 1VCOA 2IF2A 2WWFA 2YJTD 4UQOA 1GSIA 1VCMA 1SKYE 4RZ2A 5AR1A 4GI7A 2PZGA 3LQQA 4OHZA 2H57A 2ORVA 1K5DA 1E0AA 4PO1A 4P4SB 2ZI4A 1J99A 3IBGA 3C5CA 3OEED 4DUGD 4NYMR 4IEEA 1FMLA 2W0SA 1ZP6A 3RSOA 2GCPA 3PUVA 4ERNA 4KXFB 2OG2A 3U3OA 4QGHA 2AWOA 4BRWA 3FKSD 2A3RA 3U44A 2QTHA 4M1MA 4I99A 3VU9B 2GXUA 2B6HA 1WRBA 3SHFA 2ZU0C 2AFHE 4MUBA 5FOSA 2YOHA 4BFYA 4BWYA 1VECA 2XOKA 3HP1A 4MITA 5D3MA 3THYA 3QY0A 4B6FA 3Q85A 3BB4A 4DB2A 1NP6A 2OLKA 1E9DA 2WPDA 2R6DA 3ZZTA 4PO8A 1JECA 2EFDB 3GEEA 5FI1B 4TL7A 2ZPTX 2ZR9A 4H1UA 4PPQA 4JT4A 5FTJA 1LS6A 2GEUA 4FCWA 3IUYA 2G3YA 3GEHA 4A4DA 4F92B 2PCLA 1W49A 1E2DA 4MYHA 3U2QA 1K8RA 2TMKA 4LC0A 5AJXA 2GEVA 4NE2A 3CUEF 4UKDA 4A8JC 4QGGA 2J87A 2NIPA 5LD2B 4LHYA 4ZIRB 4RD6A 1E9FA 1I4LD 5FBQB 2D74A 3LH5A 5TARA 2G83A 2Z43A 1KI7A 1X1SA 2A7QA 1DPFA 2ZAOA 3I4LA 4KJZA 1FX0A 1TF7A 1S8FA 4RFVA 1NIJA 1QHNA 2YZ2A 1T0HB 2HJGA 5FUXA 4Q7LA 2C9CA 4C0KA 3AM1A 4S35A 3AUXA 4IW3B 4JVSB 3CX7A 4GZLA 4PANA 4PPGA 2DFTA 5KSOA 1CJVC 4GSYA 4DCUA 4CGZA 2LCFA 3LBHA 2AWNA 3DPUA 4BLTA 1BYIA 2CLDX 2HXYA 3A4NA 3U61B 3KJHA 5JMTA 3T61A 2GAOA 3LLUA 5F2EA 1NBME 4JLPA 2YWFA 4V0LA 1LB1B 1R8SA 2YVUA 4UJ5A 5CK5A 4BUJA 5FR2A 4GDFA 2GF9A 4AC9A 2GBLA 2DWOA 3B9QA 2ZRDA 3ZQ6A 1ZU5A 4FW9A 1N5KA 1YZUA 4IEIA 1CJMA 4B44A 3QXXA 1A7JA 1VG8A 5DGXA 1DARA 3K1JA 1VCNA 4XD7D 4HSEA 4K46A 1E1RD 1U0HC 1G3QA 5BN4A 2IYTA 5FOTA 2R9VA 1UM8A 1GL9B 1QBKC 2H5EA 1G5TA 2YYZA 1PUIA 4URZR 1E6CA 3AP1A 3L43A 3ZD7A 3U3JA 4B33A 4US2R 4OKSA 5FTLA 1KDRA 3ETLA 1G4AE 1JXOA 2JATA 1E2NA 1KO7A 4Z1MA 5B64A 2AKAB 2WJVA 4ITRC 4LJ7A 2F1IA 1ANKA 1HT2E 1F2UA 4N1AA 1S96A 3W5IA 4U7DA 1NJFA 3EPKA 2N1BA 2HJVA 5SZHB 4D4LA 2IT1A 3AF1A 4CEHA 5M04A 2BMEA 4UNPA 1FQKA 1AZSC 2W83A 3FFBA 1QHGA 1EFUA 1M34E 2CE2X 2GF0A 2HEIA 3MJHA 4TQUS 2XZLA 2BBSA 3LBIA 1HE8B 4DDVA 1OFUX 3ADDA 3BS4A 4LYAA 4PZZA 1AKYA 5JHGB 1EFTA 4TQ9A 2GJAA 4LYHA 4TL9A 1P75A 4D0GA 1NI3A 4JSTA 1GKUB 1LS1A 4DVGA 4NYJQ 1IJFA 4X8HA 4XOIA 1Q1QA 3IBYA 3LBNA 3PIRA 1XCGB 2JLWA 1Q0UA 1KJYA 1Z0IA 1U2RA 1GNQA 3IHWA 2WWHA 4MKGA 4WVFA 1EFCA 2H18A 2HF9A 5FH9A 1W0KA 4DT1B 2G0NA 3GLHB 2CCGA 3U3MA 1KJWA 1XFAA 1SVWA 3GFOA 5J4KA 3HYTA 1FMJA 3M1IA 4NYMQ 2XTNA 4KCGA 1S9HA 5CDFA 4Z8YA 4DB4A 3UKDA 3RRYA 4BFTA 1RIFA 1Q12A 4XWKA 4FI3C 2HUPA 2EVWX 4M9XA 4EIWA 1XPOA 1KDTA 4F4IA 1VYUA 1XTKA 1MO4A 4JBWA 4GPTA 1DELA 4EPRA 2CJWB 4BFZA 2ZI9A 3X1ZA 2QU8A 1LF5A 1AIPA 2VO1A 2HXSA 2Z5FA 1NN1A 3KQHA 1JJ7A 2WWXA 3A1TA 4JLDA 4LOAA 1Z6AA 5FOXA 4AD8A 1NY5A 3P32A 2O8EB 3IIJA 3UIEA 4M4SA 4CYMA 2FV8A 5DH9A 3IKJA 1Z06A 2O8FB 1DTSA 2OM2A 2QP4A 1LNZA 2OXCA 2GDJA 3TSOA 1J8YF 2R62A 1W44A 1W0JA 2O8BA 3I92A 3OE7A 1PLKA 5FPYA 3QF7A 1S9DA 3Q72A 1UPTA 2O0KA 1EGAA 4Y0AA 4TMZA 3SC3A 4C0HA 1XXHA 1RRCA 1CJUC 1Q3TA 2GK7A 1IN8A 3BIFA 4L16A 2QAJA 3LW8A 2R2AA 1M7GA 2BC9A 3GJ3A 1D6JA 2PMDA 2W2XA 1OKKA 4F38A 3KB1A 2XNSA 2PX3A 2SHKA 3K70C 3BGWA 3K8YA 4W9MC 1F48A 2GKSA 3ZZUA 3IPXA 1KDOA 1J90A 1E2KA 2ERXA 2QM7A 2OV2A 4RD4A 2P6NA 2IWRA 5AUNB 2QGNA 4OHYA 4G0NA 3QQ5A 4XVUA 3ICQB 3L0IB 3V4FA 5L3SB 1N6LA 5G3YA 2OEPA 4JVNA 1N0UA 1GITA 2JLQA 4YDHB 3QKRB 3SS8A 4TSFD 4TMTA 4G1UC 4NCJA 2O0HA 1R5OA 1UBCA 3F3YA 4KO8A 1TPZA 1VG1A 5HPYB 1KAOA 5FTMA 3GLIA 2X8AA 2ZS9A 1E2EA 2CBZA 2FX3A 3LV8A 4JVLA 2ZYTX 4M1SA 3W6PA 3UPUA 4TLEA 1LVGA 2C04A 3HR7A 1OB2A 4WA7A 1GOTA 2KBFA 2FFAA 1FNMA 2PX0A 2VHUA 1E79D 5G53C 1FUUA 1VTKA 3T15A 4TMXA 1CJTC 1OJLA 2IYQA 3AVOA 2QT0A 2QMEA 3SEAA 1KI6B 2OFOA 4N0DA 5KNDA 3L8YA 4TQAA 3P4XA 5HKKD 2JJ2A 3ZIAA 4DLXA 3C4JA 1G64A 2L0XA 3GPLA 1ZM3A 1CKEA 2W2VA 4JJZA 3WBKA 4NCHA 3RS4A 1Z63A 3GLFE 2QG6A 3T1TA 3BB3A 3X2SA 4A82A 2GZAA 4DSOA 3R9XA 3SQWA 2FEOA 2DBYA 1OH5A 2ODWA 821PA 5KHOC 1KSGA 3HR8A 3FB4A 1TNDA 4ZKDA 3R7WA 4DDTA 3ND9A 5CYPA 1AS0A 2WWGA 1PJRA 3UXMA 4AYXA 5CB8A 2AK2A 3C16C 1ELOA 1TUIA 1XJ0A 1ESNA 4GMDA 5A0FA 4WIAA 3UMSA 4AG5A 2ZU6A 3THWB 2O8CA 3CPJB 2ASEA 3ZLJA 3LNCA 4ZDWA 3NWJA 2WZQA 1WA5A 4EJSB 5JCPA 1OYYA 1E9EA 1JEEA 3OFNA 5EZ6B 4CT4B 4M1KA 2F1HA 1ESMA 2X2EA 1P6XA 4KFTA 4PXAA 1XJQA 1FZQA 4HLUA 4ILEA 3TAHA 1TQ2A 1XP8A 3LLMA 4M8NE 3SZRA 5F9FA 2J41A 4PPNA 5EP2A 1W5TA 2F9MA 2C99A 1G41A 2KI5A 1A1VA 3ND8A 3QSYA 3SFVA 3JVUA 3FMOB 1Z0KA 2REOA 1KI8A 2RGBA 4L9WA 1TX4B 4TYYA 4FD2A 3G5UA 3AV0B 3SFZA 4PC3A 3KJEA 4LWZA 2OLJA 1U81A 2P3SA 4Q9JA 4BFXA 1CEEA 4HB4A 4R9UC 1A4RA 2EYQA 1NNEA 2QAGC 2WJGA 2J9RA 2C77A 1UKZA 2WMNB 1GL6A 4JLNA 2ZE7A 4LJ8A 1ZNYA 2O52A 5L3QB 4JKIA 1VHTA 4DEYA 3W3AA 3K70B 2P67A 5DSZA 2Q9BA 1T9HA 1ZM4A 2GZDA 2XAUA 3I8XA 3OF5A 4Q18A 2YWHA 4RZ3A 3H4MA 4L5BA 3DMNA 2CHGA 4OJQA 1M7BA 3QKUA 4QM6A 3L0PA 3RRZA 4HUQB 4DBLC 3GJ7A 3OEHD 3G0HA 4HAZA 3RDPA 2D06A 3EIHA 3MSXA 3OZXA 1IY0A 2YV5A 4PTLA 4RFSA 4BZXA 4C0QC 3V9PA 3DHWC 3CZPA 3GQBA 2WJJA 3TAUA 2J1LA 3GMTA 3QE0A 5JSZA 3ZVNA 2B8WA 3CF0A 4YQFA 2V1UA 4II7A 4X8MA 5TB5A 5BN5A 1N6PA 1UAAA 3K0AA 4Q4AB 1SXJA 3WNBA 2NOAA 3QKSB 1N6NA 4W7SA 3P4YA 2J7PD 1NLFA 1RYFA 4OI4A 1EFRD 4JMPA 2CL6X 2ODEA 3HPRA 4DUGA 4BFSA 1VYVA 2QROA 1E4YA 3KXIA 3VTKA 5AJYA 1E99A 1Q44A 1QHYA 4QOSA 1Q1ZA 4TT3D 1A82A 4NL4H 3GP8A 1XB2A 1Z47A 1CR0A 3FKSA 1DVRA 4LPKA 4DIDA 5GVSA 3RWMB 2PBRA 1Y63A 4KFRA 1VDZA 3NXSA 3TJZA 1U0JA 3AKCA 4KODA 1W36C 5JJLA 4AG6A 3C7KA 3DO6A 2R8RA 1IN7A 4QNRA 3F0TA 4U00A 2B21A 3ZVLA 1SGWA 3LRPA 5KUTA 1KI9A 2MMGA 2KJQA 2Q9AA 4GOKA 2B92A 3L82B 1XX6A 5JHHB 1V43A 1VG0B 2CK3A 3C41J 4M9SA 1QZXA 1XNJA 3SNHA 3EARA 1OH8A 5ELXA 1ETUA 1F60A 3C15C 1JAHA 4K8OA 4DCVA 5B58C 5JEDA 1XRJA 4U02A 1UJ2A 2GJKA 5FBWB 2GEDA 4EFMA 3IDQA 1GKIA 5AJVB 3TKLA 1BMFD 1E0JA 4OK6A 1NIPA 1N0VC 2Z4SA 3IO5A 1E9BA 5FPTA 5TVKA 5KSZA 1U90A 1N5IA 3PUXA 5KU1A 3B1XA 5GJVC 3A58B 1DBSA 4YC7A 2ZREA 3BH0A 3TQFA 1M2OB 4EKDA 2MSCB 3TLXA 4OYHA 2WWYA 2EFCB 3AP2A 3KJGA 1G19A 4KBFA 3A37A 4TLDA 3WY9A 5BXQC 3CKLA 3KTAB 2WJHA 5E95A 4B35A 4C4PA 2V7QA 1JI0A 3EC2A 2IEYA 1MOZA 2PLFA 1Z22A 1J8MF 3DEFA 3C14C 3LXXA 4V02A 2ZE5A 3LWNA 1GTVA 1L7VC 3DOEA 3RRNA 2XX3A 4FIDA 1DOAA 4FMDF 2ZI6A 2FSGA 4HDOB 3HYRA 4UNSA 2IBMA 1YJ5A 2XJ9A 4F91B 4ZDJA 4ZI2A 2DFNA 5BN3A 1YR7A 2Z6VA 3TR0A 2G0TA 1MABA 4DLTA 4XVRA 4JYBA 1WB9A 2QAGB 2C96A 4K81B 2WICA 4B2IA 2FZLA 3CM0A 2J46A 1RFLA 2AK3A 5JWRA 5CDFE 5KDLA 4HAVA 2IXGA 1X8JA 2OZEA 4CEJB 1VMAA 4XD7A 5FTNA 2QQEA 3I8SA 3IHLA 1HY3A 2ZRHA 3I5XA 3HU3A 4IDHA 2ZJZA 4C7OB 2GJSA 2NO7A 4AWXA 4A36A 4BECA 4DRZA 1MRSA 4D4MA 1LF0A 3ZH9B 1TF2A 2F6RA 2HT6A 1QVAA 2C9OA 3CX8A 4RD2A 5JZVA 4Q4JB 3K0FA 3T06B 1P2VA 1XEXB 4L9SA 3BORA 4KITB 2YC2C 1PV4A 2VTKA 4PC2A 4A2QA 1LV7A 3QG5A 1QHIA 1XTIA 4AYTA 3LVRE 3Q3JB 2CCJA 1GVNB 3FMPB 2ECKA 1UEJA 4TYPA 1N6RA 1WBBA 4H9GA 3KFVA 3RHFA 3KKOA 3PR1A 3VR4A 4PC6A 4RZXA 1Z07A 3AVYA 2D2EA 1BIFA 2VP0A 1T3LA 1W4BA 3F8TA 5JI2E 2GCOB 4BLPA 4I81A 4ZI3A 4LBZA 1RPZA 3I3SR 2OBLA 3H86A 3GLGE 4FMBB 4N3NA 5DIFA 3FTQA 2FA9A 1OIWA 2RGEA 3BH7A 3HU2A 4C2TA 3JZMA 4IDPA 5EXSA 1I4TD 3X1WA 2GZHA 1W36B 1BO6A 3K70D 1ZNWA 5C4MA 3BB1A 3B13B 3DM9B 1PUJA 1Z6TA 2VH5R 4KI0A 1FW6A 4HYYA 5L3VA 3PUZA 4NONA 3MLEA 5J4VA 2ZSBA 3BFKA 1GFIA 4A9AA 4CF7A 1S1CA 3FHOA 3SJCA 4EQ6A 3JVVA 1WF3A 3R8CA 2HYDA 3RANA 1EX7A 3O8CA 2QUZA 2ZTSA 3QI2A 1JJVA 3PVSA 4O2RA 5IK2A 3R9IA 4B47A 5CK4A 4AURA 1HTWA 3GLIE 5EQTA 4DLVA 2VF7A 4HZUB 2CMKA 5DI3B 4U5XA 1G5RA 2I3BA 1WBDA 1CIPA 3IILA 3Q7PA 4XTRA 4UXIA 4BLRA 1AS3A 4Q21A 5JBQA 3L8ZA 1KYIA 2A5GA 2RMKA 3WRYC 4Q5IA 4Q1CA 3ASYA 3KJIA 4FMCB 4FCVA 3BBPA 3AKDA 1I2DA 4YMVA 221PA 5J4HA 1FP6A 1ZD8A 2C2HA 2P5TB 4IXNA 1OFHA 1V5WA 4B48A 1Z2CA 5G41A 3T34A 2OBNA 1B23P 2J0UB 4HEJA 1KMHB 3K0EA 3WHLA 4DSUA 5A5GA 3LFUA 1JPJA 1XTSA 2XNDD 3CLVA 3VFDA 4BEJA 1GL7A 1YR8A 3WNCA 5KPJA 2QMUA 1NVVR 4HUTA 3AKEA 1ZIPA 1NF3A 2KBEA 4B2PA 2XJ4A 1ZNXA 5HZKA 2WSMA 5KO2A 1GAJA 2FF7A 2GBLC 2IHYA 3IIMA 1R5NA 2F3RA 2IEZA 2IHBA 1E94E 1FNNA 3IEUA 1KI2A 2CNWD 4URVR 3LD9A 2FDCA 4WZBE 1E0KA 3CZQA 1YR6A 3KKPA 4WAUA 4DDWA 2OE2A 4ZIRA 3KKMA 3RLFA 1ZJ6A 1OFTA 1DS6A 2A5YB 1D2NA 3PEVA 2PEYA 1U0LA 5IHPA 4JL5A 2FFHA 2YOGA 1NSFA 3UG7A 2ANCA 1XMJA 4LHZA 4E07A 4GOXA 3DVLA 2ZRAA 4M2LA 4OQFA 2BWJA 1CLUA 1IBRA 4D25A 1VG9B 4AKHA 5KYKA 4BPBA 4KYUA 1OH6A 3AKYA 4TSFA 1SVOA 1DAHA 2E1RA 3TQCA 1UKYA 1G5PA 1QDEA 2GETA 3CIOA 1ZRHA 2GVZC 3VNVA 2MMCA 4P4TA 4A0RA 3QEOA 1G8FA 4KLNA 2XTZA 1YQTA 4Z51A 2Y8EA 3CRW1 3IGFA 3TR5A 4Q7KA 2YC4C 1N6KA 1PLLA 4LJ5A 3ADBA 4JL8A 5JI3E 1RJ9B 2GK6A 1RYHA 1G21E 2UZIR 1KK1A 2IXEA 3K53A 1ZNZA 3AB3A 1TU4A 4R2IA 4MYTA 4O25A 1KO1A 2XGJA 1YHNA 1KI4A 1ZVQA 4MGKR 5EE0A 1JBKA 3RSLA 1QG4A 4B43A 5B2ZA 2VSXA 4WZ6A 4TMWA 3ZYCA 2IYVA 5AUOB 2QE7A 4M1TA 3WMGA 1M8PA 2ORIA 1UBFA 3PEWA 2XSZD 4LV5B 2XZPA 5FUWA 2QM8A 2VBCA 2CE7A 3QBVA 4B6EA 4BE7B 2PZEA 3K0CA 1E2JA 4V0MA 2P5SA 2GJ9A 4PHFA 1ODFA 4AK9A 3U7GA 1ZUNB 2HLDD 3DKPA 3X1DA 1K5GA 1SXJE 2ZS8A 1NVUQ 1Z83A 2V3CC 4JLVA 2EW1A 1MO5A 2PJRA 1XBTA 3W8RA 5E7MA 4A15A 2XXAB 3LX8A 4QJ3A 3NBXX 2DHRA 2CL0X 1A2BA 4ZDIA 3TVDA 4LJ6A 1ZUIA 5JLJA 2OSBA 1AJEA 4Q1FA 1XMSA 2FGKA 1OXXK 2KSQA 4OQLA 2J59A 4M21A 4TMKA 2PLRA 4R98A 1FX0B 3KUDA 3MCAA 4FMCF 2WV9A 1H65A 4PAQA 4C30A 1XD8A 1X1RA 2CXXA 2FMXA 4HB3A 4O3MA 5HR5A 4BLOA 2ZETA 1SHZA 1P2SA 3AVQA 1NVWQ 5FUVA 2PMKA 3MWKA 2QPAA 2XTMA 4HATA 4M53A 2IF0A 1W36D 2ONJA 3S1AB 3K9HA 5FL7D 1RW4A 5JECA 1IN6A 2WOJA 5CIQA 1JNYA 1L2TA 3MWLA 3CB4A 3X1XA 4P31A 3K9GA 8OHMA 1R4AA 4PSAA 1VCIA 1RRPA 4RD1A 1UBGA 4YXWD 2AXPA 2GTPA 3I5YA 3SJBA 3BWDD 5KDDA 1TMKA 4Q47A 3B85A 4DT1A 4F93B 4DHEA 3GLHA 1CU1A 1M6NA 3QXSA 5FOUA 4A2WA 4TLCA 2NGRA 4DXAA 1W47A 1YZQA 3BH6A 3VNUA 1X8KA 4RSGA 1N2CE 2AL7A 3CPHA 4QRHA 1IAQA 2BKUA 1ZCAA 3AVXA 1JR3A 3TE6A 1VYTA 2VHTA 1JQJC 4Q9KA 3SYKA 1W4AA 1H8ED 2QGZA 3QPUA 1N6HA 1P9WA 121PA 4PR0A 3CRVA 2GRJA 4MKFA 5EE1A 1T0JB 5E7IA 2ODBA 4TN1A 4D82A 3NH9A 2ZRCA 1KAGA 4B3CA 3ADCA 3D6TB 4WZAE 3RS5A 5CYOA 4A8JB 2O8EA 2ZJ2A 1G3RA 2J5XA 1G3MA 4P3YA 3W5JA 4FINA 4DDUA 2O8FA 2ZE8A 1OXUA 4LBYA 1Q3HA 2J7PA 2IYWA 1I4DD 4IDQA 1LFDB 4C0AC 1F2TA 1BOFA 1EX6A 4CEHB 1SULA 3ECCA 1MH1A 3L0OA 3IO3A 4W5WA 3HWSA 3U60B 2QRNA 3OAAA 2OBMA 2WSSA 2JLUA 2IA5A 4NCKA 1G4UR 4PHGA 1TTTA 1KO4A 2D4HA 3GJ0A 3SBDA 2ANBA 1FPMA 2RGCA 2FH5B 5IDVA 5F98A 3K0SA 1KKMA 1E2GA 4UJ3A 1U8ZA 3OIWA 1VPLA 2JASA 4DLWA 2ZRFA 3A1SA 4C9BA 5EP4A 2A5DA 1RE0A 1ZD1A 4BFVA 3GEIA 2WBLC 2QQ0A 1N0WA 4A0HA 1TADA 1KSHA 3R9WA 1A2KC 3VKWA 3M6AA 2ZJ8A 1FL9A 2V6IA 1KGDA 4HB0A 4M9ZA 4QBFA 1E9RA 2EWWA 4PSVA 5L3SA 4YMWA 4IDOA 1BKDR 1OFIA 4LJ4A 3ZZ0A 2R6FA 4ZCLA 4Q66C 1MO6A 1OXSC 2IS2A 4RZUA 2Z0MA 3QKRA 4DEXA 4LRWA 3UMRA 2JLRA 2ZSEA 2VHCA 3SE0A 4A1FA 3QENA 3GLGA 2DPXA 2DWQA 3NHAA 5CIWA 5EXXA 3U5ZB 4E5UA 4M1YA 2NPIA 2W00A 2BIFA 4UNNA 2RKOA 3NEJA 1U9IA 3R20A 3ZQJA 2WWWA 5TMPA 1CF4A 4ACBA 4D0LB 4URXR 4NYIR 4LBWA 1G16A 4FCTA 3QUSA 3A1UA 3C5HA 2BEJA 2EFEB 4CT5A 2NTYC 3BERA 2ZI7A 4KFSA 2ZRNA 4MRRA 1P4SA 4HLUC 5AUQA 3MJRA 3I73A 1NSTA 2BMJA 4V0OA 5TDHA 1TEVA 4BRUA 3NC1C 3SOPA 1M1YE 4QFMA 3Q5EA 4GT1A 5GJWC 3KXKA 2OCPA 4LY6A 5BYKA 2C03A 2WPDD 3U7FB 2QL6A 2VF8A 3A4LA 4CDGA 4I1UA 1Q22A 3RYTC 3ZJYA 1PLJA 4ARZB 1YE8A 2W2TA 5FPSA 2GESA 2V55B 2CEAA 4M1WA 1XXHB 2QA5A 5LB4A 2OAQ1 1E4VA 1T91A 3N5CA 3AGPA 4Q00A 2O8DB 4S2EA 2ZRBA 1FTNA 1Z6GA 3EW9A 5DLQC 4D0NA 3U6KA 3CF6R 4YONB 4QGAA 3B6EA 2P65A 1SHKA 1NMZA 2VEDA 3GJ8A 2NO6A 1P72A 4AIIA 2WOOA 1DADA 1N6IA 2W0MA 3SYLA 4EJSA 2RGXA 2YWGA 2ZYVX 5JCZA 3WYAA 1G6OA 1HEIA 2OFXA 3LO5A 5JRZA 1T8UA 3E2IA 1KKLA 4HDQB 1US8B 2WAXA 3ZD6A 3GJXC 3W8NA 3KB2A 4AI6A 1IM2A 4YMSA 2DFLA 4CW7A 1GUAA 1OV4A 4QBHA 2G9NA 2FPKA 1NN3A 1VIYA 1SXJC 4NPHA 4EPTA 3GLIB 2OT3B 1B0UA 2FU5C 3B1YA 3FGNA 3FFAA 4IVQA 1CXZA 2VP6A 5DYGA 3D3QA 4ZCMA 1RKBA 1F6BA 1FTSA 1KOFA 1XTQA 2WVJA 4DCTA 1T5LA 3KFXA 1Z5ZA 1Z0AA 2ODNA 4DC9A 1FQJA 4HB2A 2CDNA 1TQ6A 1RC8A 3RS0A 2C98A 5L3QA 1E9SA 4XIGS 1R8QA 4LJYA 1AA9A 2QI9C 2BHRA 421PA 1MRNA 2CHVA 4F7WA 1OYWA 3Q9LA 4TZ6A 2DR3A 4EFNA 4FMDB 2NMVA 1YU9A 1W48A 2BBTA 4HUQA 2JJ8A 1W4RA 2JLSA 2OCBA 1JB1A 2IXFA 3BXZA 4LYJA 2JLYA 1D8TA 4A2PA 3T5DA 1SKYB 3B7GA 3WP1B 4ASUA 3WHKA 4MDFA 2IC5A 5CM9C 1T4GA 3GJ6A 3UWKA 3L2OB 1KI3A 5DISB 2OO7A 3CWQA 4Z1MD 2ZSAA 2NG1A 4Q4AA 3R7WB 4B76A 3LW7A 4EPWA 2I1VB 2A5FA 4DKXA 1ZMXA 2OAP1 2QPTA 2H8KA 3SHWA 2F43B 3UK6A 1EESA 3QKSA 4M9QA 5J4LA 3CNNA 3QBTA 3HPQA 2GXQA 3DKVA 4MGZR 2PZFA 2W6JA 2R6CA 2Z83A 2ZYWX 2VP5A 3Q8XB 2FEMA 3AF0A 2QZ4A 3JZAA 5J40A 2P6RA 3W34A 1HUQA 4LSGA 4URWR 2QN6A 4R7ZA 1SVKA 4O0MA 4Q1BA 2BDTA 1RRFA 3PCRB 3CH4B 4B71A 1G20E 2JLXA 1T6NA 3N2EA 2C9YA 2ZUBA 2IYRA 3RS7A 3T5GA 1R5BA 1XDBA 1G3IA 4YDSA 1AN0A 1YKSA 5FR1A 1QRAA 1XD2B 1NKSA 4V0ME 2BCGY 3UATA 2H7VA 2NZJA 4TLBA 5C18A 3WXMA 1SQ5A 1D9ZA 4NKRA 5HZHA 2FSIA 4PZLA 1G8PA 4PAMA 5HE9A 3OEEA 2GA8A 3EA5A 2A30A 2GWHA 4B73A 5C1BA 4DWJA 1E32A 1SVMA 4Q4HB 5FL3A 2QY9A 1WMSA 3U7EB 3MUFA 4PQYA 3W6NA 2JLZA 2HV8A 2IYSA 4DCNA 1ZD9A 2ZJ5A 4G5GA 4XWOA 1CP2A 1NL3A 2DY1A 3PUWA 4IJMA 2QSZA 3EWSA 3KKQA 1CRQA 1UEIA 1II8A 3W9YA 3T12A 1NG1A 3ADKA 1KZGB 2QMHA 2AHOA 5DE3A 2P6UA 3RABA 1ZM2A 4HZIA 2BJVA
chains in the Genus database with same CATH superfamily
3A1WA 5BSFA 2WDPA 4MW4A 1IBCA 1FRZA 3DZ8A 3IQXA 3KD3A 4ML3A 3CVYA 1RT9A 2RGNC 4IUBS 3BQMB 4HYTA 3K32A 1U3DA 3GWGA 4JUAA 3KTAA 4BLQA 4KR3A 3OQIB 3L49A 3GRKA 1UXGA 4FS8A 1QF9A 4D4KA 2J31A 3MT8A 3I6MA 3PEFA 5HF6A 5D51S 4KXNA 4N76A 1R9MA 3B1KA 3G2OA 2XHEA 3RSQA 4DQ0A 1FY2A 1U8CB 1TUEA 1XNHA 1P74A 3ZZNA 4GSLA 1GQOA 3CSSA 4IOMA 4EAQA 1IJKA 3GV0A 4RO0A 1MDBA 1ZITA 4H4EA 2JH8A 2WUDA 3MMNA 3SAJA 2PRIA 1XEFA 2EX1A 3EMDA 4HO1X 2VAMA 4MQ5A 1ZLXA 2YVLA 5HCNA 4DIEA 2ZUFA 4A0SA 3PI6A 1XRRA 4N0EA 1KYWA 4IDNA 1BJKA 4PRZA 4WOJA 2J5BA 4EATA 4ITVA 3PFIA 1H1TA 2XDYA 3W9UA 3PEUA 1C4XA 4OSPA 5A7GA 1ZLYA 2H51A 2QV0A 2Y1LA 4CFYA 1O5IA 2HA7A 4HYQA 1K06A 2AI2A 5IUJC 3QW2A 1YU6A 5I7UA 3WYBA 4DSNA 4NH0A 3DZGA 2AOVA 4QOHA 3DZDA 3HG7A 2I76A 1RWBA 3JQEA 3B1ZA 3MJTA 7YASA 1KEUA 3G2JA 3LLSA 1T2NA 4QX6A 1GAWA 2UYGA 3DFKA 4RQAA 4XQ9A 1KO8A 2H63A 5KI6A 5LZ2A 4CEIB 2NYAA 1ZICA 2C4VA 3JQDA 4HXGA 3TTWA 1EFPA 4Y7DA 3RHTA 4PPFA 2E5WA 3VBEA 4C1BA 1J8DA 2E4XA 1OWLA 3NPAA 3QWIA 3WJ7A 5KHLB 1ZK0A 2VPWA 2REQA 3IAUA 2IBTA 3X2FA 4EI8A 1P39A 3RS9A 1B8PA 1OWNA 1B2LA 3CLHA 3CFYA 4NJOA 2FW8A 4F4CA 1DXHA 3LBFA 5AI4A 1U0NA 1GRRA 3CBQA 4I1RA 1POXA 3UBMA 3WRXA 1SUPA 3T6KA 3M83A 3RYHA 3ZK8A 3KVNA 5IJ0A 4RTPA 3TBFA 2E4VA 4KKVA 4K9PA 4RPCA 4XB1A 1YCHA 3NOVA 5KHAA 4O1MA 3W7AA 1Y7PA 1E3LA 3LC7O 4OIMA 3ZVKA 4KHPB 3NO4A 1LTHR 2G04A 3QU4A 1T5SA 1KTIA 2FPRA 4FFLA 4OFWA 1XQWA 2XCLA 5SZJA 4WXEA 4N41A 2WMOB 1YZLA 5J43A 5EC8A 2Q8NA 4C0SA 5FA8A 1JQDA 3EMVA 3VMFA 4ROSA 3IBSA 2G1UA 3IP9A 4UTVA 1DMSA 3OT1A 1FYDA 1SN7A 4TGLA 4G1FA 5K0ZA 3MJVA 1NUTA 5EL0A 3NIBA 2OPHA 1EXDA 4F72A 1COWD 3GCGA 2VZ8A 1HV8A 1Q21A 1ML4A 4QPZA 2FGJA 3L02A 4A6XA 2WD9A 2DKNA 3FNEA 4RIIA 4J1SA 1PWHA 1I4EB 1CS4C 3EQ7A 3JWHA 4F06A 4ZYWA 5A5DA 3DTVA 3H5LA 1R0ZA 1TYDE 1OT3A 4TLAA 3PGLA 2JKVA 3A27A 4K1XA 4PCAA 4RHXA 5K3OA 3QWFA 1I2CA 2HNKA 1HGXA 1NI4B 3HRIA 3SXJA 4EUKA 4ESOA 2ZJFA 2ID4A 3DDCA 3IR7A 5DGDA 2WTUA 3Q1LA 1AGXA 1IBSA 1MIOA 2IKQA 4E15A 2DUUA 3MTGA 2IP1A 5IBQA 3P9IA 3T7SA 2X4LA 2XA2A 3QF4A 1RBMA 2IZZA 3AKZA 2H92A 3I28A 3I6YA 3N3BC 3S5JA 4ZYZA 3CR3C 5L8VA 1UP4A 1XZHA 3O4HA 4IUCS 2AZ4A 2C92A 2B1JA 3Q41A 4N12A 2R1UA 2BMVA 3AOEC 4IV0A 4AAYA 3HGMA 1CIVA 4MAFA 5DNWA 5EIHA 2P2LA 3C3MA 2FPGA 3OFND 5K99A 2HY7A 2EJBA 3U4IA 4IJUA 2FW1A 3QLTA 3K6JA 2A5JA 4QEZA 3CISA 3QWHA 4OXXA 4Z8XA 2FLKA 1RKXA 4HXEB 4ZOLF 4QTTB 3UB3A 1KK0A 2HA4A 3KYBA 3MWEA 2ZRMA 2BFBA 4R40A 4FM9A 4GWLA 2PU5A 3RQIA 1T0IA 1ABBA 2FZ4A 3UENA 5CD9A 2A84A 4TKZA 5KYTA 4HWSA 1IQ0A 2PUAA 3AR9A 2BKEA 4ENTA 4L8GA 5HQ3B 2ZSDA 2ZITA 3BICA 5FI0B 4A8HA 1V6SA 2VHYA 4A5OA 1A5BB 2RHWA 5C3UA 1RTKA 1SCBA 1SVLA 3IJRA 4DYDA 2WT9A 2YNMD 2YWRA 1NAIA 2FSPA 1ZBQA 1VL1A 2CLHB 2WIFA 4DIKA 3IEVA 1VKJA 3AUUA 4OJTA 1IUNA 1SKBA 1H5UA 2AR7A 5I9TA 4Q37A 4INOA 3FETA 1PD0A 3ZNNA 2PGDA 3U31A 4BN0A 4BV3A 2ZATA 4Q6WA 4B84A 3E3OA 5JQWA 1U8FO 3AYXB 1I0IA 1MB3A 2E4WA 3DO5A 4OO3A 3QJYA 1IY1A 3T3GA 3OKAA 3HJGA 1GKKA 1IY9A 1A04A 2NO9A 1RZ3A 2TMDA 5BT9A 2Q1TA 1XVLA 3DH0A 3M3HA 2WTNA 5JH7F 3EGWA 3MWFA 2R00A 3RTDA 3NWPA 1KZHA 3DYVA 2ZROA 3HI6A 2X9VA 5EE5B 5FXMA 5IAAA 3R4CA 3TOVA 3PDHA 4V0RA 3WDSA 5C4IA 4C07A 1BC5A 1XZCA 2VDRB 4PIMA 5E1BA 1L4UA 1T9AA 2BEWB 3ILSA 1UC4B 5TV2A 5FIUA 4XCVA 5SYAA 1LW7A 2R8PA 5LXTF 6REQB 1IOZA 5H68A 2EG5A 1Y7IA 3AILA 3N70A 3A6KA 1J6UA 1ZI8A 3BWMA 3ZWKA 2LIPA 1FMFA 2K2WA 4W1QA 4MVXA 2ZYAA 2AFRA 3CF4A 3TD9A 1CK4A 4OHVA 1V3UA 4XWAA 1OPXA 1P3DA 4OKNA 5H02A 1PF7E 5I7WA 3TL3A 2NWQA 2UYYA 4AKEA 5JADA 1U2ZA 3OPMA 1U4OA 3MMSA 1OW3B 1DINA 3ZXSA 3WLKX 1H2AS 1LTQA 5IXSA 3AR2A 3R0XA 5LZ4A 3KSMA 5FPPA 4GUDA 2JBAA 1X1AA 3I53A 1W7AA 2RGRA 2FJPA 3E7XA 3R8FA 1IWOA 2RAPA 3PUHA 1E96A 5TQ0A 1KO5A 2OCAA 1LSOA 4R1SA 5J59A 4ZHQB 4P2GA 5TQJA 3UC9A 2O2SA 1PBTA 2NO1A 3B9PA 3D5EA 3EDQA 1DE0A 1LXCA 4XARA 4UM9B 5C3MA 1KU0A 2XPCA 1VSBA 4O0LA 5EZYF 4ZEOA 4P34A 1C9KA 1DXQA 2HSDA 1OMOA 4WNAB 4HDKB 2CNNA 4TMVA 5COBA 4FR0A 3PFKA 4IOKA 5EFZA 3R3UA 2FZEA 1P5FA 2I1LA 4H3VA 4MUYA 4K03A 5GONA 3K71B 4DILA 3R3HA 1YOVB 2G67A 1E79A 4ZARA 4M7RA 3LKZA 4LZLA 3QP9A 4IQ4A 4R1TA 5CA1A 5K8UA 4QAJA 3KR1A 3N2GB 3Q6NA 4BDSA 3U44B 2XQJA 3IV6A 1PSDA 1X42A 2NNLD 1KFBB 3QTTA 5IC6A 3NXKA 1QR2A 2XB4A 2ZFUA 4NLLA 4B4DA 1GZ4A 1S3FA 1YQXA 1C0KA 4GRIA 2J6CA 5HKKA 3K09A 4QU8A 1TC1A 2COKA 1S2NA 2PRSA 3SE7A 4UMVA 3SIRA 2ZANA 1RXYA 2H7YA 4AO8A 5H81A 1FJGB 4O4LB 2PT5A 4DMCA 1IB6A 3BHNA 1ENZA 2PDAA 4MQ6A 3BWEA 2IS1A 3IULA 3TEJA 2QZPA 1TEZA 1D2EA 1I7LA 3A6ZA 4PHTA 2MSDB 4NQRA 1LNQA 3GDWA 1RI4A 2VLIA 3C87A 1X8LA 2W9XA 3EPHA 1PRYA 1R15A 2E85A 2QD3A 2AVNA 1N2IA 4RPIA 5JY6A 3RU3A 2F1OA 4X66B 2DFKB 3AFOA 4KQEA 3TIIA 3EG5A 1QKJA 4YWHA 2ZEJA 3GO4A 3DDZX 4OV6B 5B4UA 5K8VA 2IYLD 1VB5A 4OMDA 4UD6A 4XI9A 1GNRA 2CJPA 3MGAA 3B7WA 4DLAA 1Q5PA 1QVZA 1RKQA 1DAIA 2VXBA 1OTYA 2FMKA 3AVPA 4TTRA 3P20A 2QYSA 3FNFA 4QE3A 3TG8A 4DL9A 4GOND 3D3JA 1ORTA 2H2GA 4UM8B 2FUG6 3L46A 4D80A 1EVEA 4MR8B 2GS9A 2W2OA 5E4YA 2EQBA 1TCCA 3FCAA 4GX5A 2ZS7A 1PVOA 1YE5A 2SKEA 4NBSA 5JS6A 1S1MA 1U0TA 4UCWA 3HY6A 4B6OA 2XZOA 2C97A 2W22A 3BMOB 4RH0A 4S1OA 3NIGB 1DEHA 1IEQA 3ASZA 4P7FA 3RC3A 4RH3A 1XMOB 1H3EA 1D6SA 1UINA 2O2XA 1I5OA 3IE0A 2HHJA 3S40A 5DI9A 1ISGA 3FNQA 4NENA 4AP6A 1M54A 2ZBFA 1WQ1R 3S28A 1C4KA 1KFCB 3JRNA 5BMVB 3LS2A 2YWEA 1U99A 3AG5A 3B5JA 5AJUA 4OXRA 2I9KA 1B3RA 2FWJA 3G82C 2UYQA 1J5EB 2QLLA 4JBGA 3SZOA 4TKVA 5AYVA 3R74A 4QQ8A 4X8LA 1OFUA 1W29A 4RIEA 4A8JA 4XQGA 2WAYA 1BHQ1 3F7MA 2BE7A 3AX6A 2I4OA 3B20A 4EWLA 2Q3DA 3QYJA 5CFLA 4F85A 4YLEA 2DHCA 5BN4B 1YA8A 2ZYSA 2BFEA 4LOLA 5EIBD 3HNRA 4OJMX 2FQYA 3DZHA 5IDWA 1I2BA 2A78A 2C3PA 4KDEA 4C6SA 1ZHOA 3BFVA 4DAEA 3A6JA 1E8NA 1QJCA 1RKUA 1V6AA 4MARA 2WM9B 5BQ5A 5K3FA 2XKKA 2DR2A 5F9HA 2CJWA 3IDOA 2PZJA 4JP2A 1KERA 5D1NA 2C0QA 3NALA 3BFXA 4UVEA 3AJ9A 3BZUA 4J0DA 5K6AA 3F5FA 4FNAA 3GRVA 3KB8A 1CULC 1E69A 3L9WA 4N7MA 3EX7C 3ZK9A 1NVVQ 3OVMA 5H3HA 1HR0B 1QH9A 3UW3A 3HN6A 3QU7A 1J97A 1EQUA 2TMGA 4ZVLA 3OE4A 4Y6OA 3R3JA 4KQIA 2VHQA 5AVWA 2PQ2A 1XK6A 2QZZA 3JQ7B 3LA8A 1Z74A 4GNKA 2F90A 4YNBA 4I66A 4KLCA 5L3RA 3S99A 3IA7A 4TT3A 3MZ0A 5DWDA 5G4KA 2WUGA 1E1CA 4NIMA 4A92A 1FOEB 4RABA 1OHHD 4MS3A 2E6UX 3H84A 2JEYA 4O3FA 4WKOA 5CDYA 1GM5A 2F8TA 2LIVA 1TDJA 2FWNA 3OQBA 4CHTA 4PNHA 3D0KA 2I1WA 3CZAA 4ZJUA 1QKIA 2R47A 1QB8A 2ZIAA 3BEDA 3QHPA 3VYTB 3W9BA 1TZKA 1ULUA 3RJMA 1M67A 2WU1A 3FVRA 3TUJC 2W58A 4EHLA 3DYIA 4HQKA 3EB9A 4YJ2A 1DQZA 1DKOA 3DL7A 4E03A 3BVPA 1YVRA 4I3HA 1OAAA 1D7OA 2D00A 3C3XA 3TQTA 1F9EA 1B8OA 1ONBA 4BMSA 2IUYA 5EA2A 3HKCB 3ZU6A 1T5TA 5GTDA 2VHWA 1S5PA 2FUG1 4JR0A 3LDUA 4JASB 4EKEA 2WYIA 4EJSC 2IHZA 2JCBA 3E70C 4KNVA 3N07A 1XG5A 1DT3A 1S2OA 4E11A 5DNYB 1L5ZA 2NZYA 1NG9A 2Q3HA 2HZ7A 3F7OA 5ALZA 5E6RB 1JHPA 1H22A 1P7YA 4WY8A 1ZWKA 1E6KA 1W1WA 3MCVA 1BMFA 3NVDA 5AP9A 4IQGA 4FFMA 1LJ8A 1S8AA 3M81A 4EFLA 3SJZA 3QVKA 2QPOA 1U5BB 2PUVA 5HTKA 1L4NA 4NQZA 2WQZA 3AFNA 3LGXA 4EI9A 5JAUA 1N9KA 5K0TA 2XBLA 3GFTA 4J07A 1JF8A 5HF8A 2ATXA 1QR6A 1YAJA 3INTA 4IRMA 2OG1A 4PAOA 1KPGA 5C1OA 4U9UA 5FAKA 1KIAA 3STUA 4ESVA 2N75A 4BWVA 5KKNB 2JA2A 2G17A 1F1BA 1NTRA 4EF5A 1RVDA 1HQYE 4OGWA 5TGTA 3N0RA 3HB4X 5BWCA 4K2AA 1SJ9A 4MUNA 3HBNA 4G24A 3SQMA 2I2BA 4NU8X 3HXPA 2FEWB 3RW9A 4KN6A 2QMYA 3PXBA 1V3TA 2HR1A 4BZPA 1TZ2A 3N59A 3V97A 1CQIA 3VV2A 3CWZA 1WD5A 2OCDA 4K0KB 3GRAA 2A0YA 2WTMA 4IIFA 1ZMOA 3JQPA 2OHHA 2EYUA 3LNTA 2FN4A 1U2EA 2VPXA 3IAAA 3QKWA 4HDRA 4EJ6A 1Z0DA 4TXLA 3P0HA 4R2XA 4G84A 1MP0A 2ZRPA 5EWJA 4ME6A 1K6IA 1QCZA 5KYYB 3PTLA 2W2PA 3GR6A 4N6GA 2GGSA 1M2HA 1US8A 2VJDA 3FWYA 3EZLA 5DBIA 1DBRA 1QFJA 1BH6A 4OB7A 3AM3A 1P31A 4YJHA 5EZQA 3SM9A 3TN7A 2HA0A 3T3PB 3Q5GA 2I3ZA 3W1WA 2YCBA 3ZDEA 9MHTA 3UO8B 5EIXA 1ZAKA 3EUWA 3T0IA 2C84A 4LJAA 2VT2A 1E62A 1IQPA 2AF4C 5KWIA 5JLAA 3S2YA 1DIOB 1KP9A 3NEYA 1CUEA 4JYZA 1M1ZA 2JJ1A 4R05A 5LR6A 1PFVA 1JXAA 1P2UA 2Q5CA 1DBVO 4OK3A 3ROEA 1BXRB 3SZ3A 4QHTA 4HDMB 4B3XA 5LQAA 5LMUB 1M7HA 4O02B 5JCXA 4DR3B 5JCOC 3RUAA 2EL7A 3JQRA 1EI9A 5K0NA 4EGJA 2BAGA 3O8OB 2P1ZA 3BXXA 3TK1A 1Y33E 3PGA1 1XF9A 2V5AA 1SQ6A 4JNKA 4AN4A 1UMCA 4DSTA 2MU1A 5LOVB 1MHPA 1UBSB 4WXPA 4BNYA 1ZO8A 4FYHA 1IN5A 3C8DA 5C2JB 5F7JA 3EH1A 1L4HA 3W5UA 1QPZA 3AMVA 2WUVA 1QH8A 3C43A 4TVOA 4HUJA 1XWWA 4ZU6X 4EO7A 3CB2A 4GYYA 1TJYA 4NDZA 4DLSA 5ADHA 1KXZA 2ZXEA 4M3NA 1HDXA 2BUBA 3HEAA 4QHSA 2WB4A 3JYHA 4O2BB 2CNKA 2NU7A 4S1NA 2Q9CA 1Z13A 2OA0A 3V8BA 4B3HA 1KJJA 1L6RA 2ZJOA 5F5LA 4BKQA 3C45A 2PD4A 1Y1RA 1ZRNA 5ELLA 3GRFA 1ADJA 4Q3LA 2NO0A 2ZUDA 2XIJA 4E5VA 5K01A 2PL3A 4Q9HA 1PU2A 1V11B 2FMFA 2JAQA 4O2LA 2X2OA 4YRQA 2JK0A 3EJ6A 4A27A 4J3FA 4MMXB 2GZRA 4MYCA 3RC7A 2VDQB 3D6JA 3A3PA 3C3WA 4OH7A 2SKDA 4W7IA 3OHSX 1IC6A 2HIAA 4NNPA 4AKIA 4U3JB 4ZO6A 1EWYA 5E3JA 1DX9A 1ID1A 2W71A 1WDWB 3MG9A 3T52A 4CMAA 4YRBA 4J2TA 3DOFA 4TKMA 4QJ5A 5EXTA 1FRQA 4YFVA 4FGJA 4G4SO 3SIPA 5EFOA 3JYNA 1XD2A 5JCJD 5JWOA 2A5LA 4ZV7A 1J9EA 3O0DA 4H1TA 1UZLA 2G8LA 4J43A 4Y6PA 5F3DA 2JAUA 3T7RA 1MOQA 2IHUA 3HA7A 3SEQA 2DB3A 4RLFA 1UT8A 1IZ0A 1XTJA 5D3QA 2O8CB 3E9RA 2QP3A 1NT4A 2YMMA 3Q40A 2C7VA 5GAJA 1YL6A 1DEAA 1GZHB 5AM4A 3LQ4A 3UMFA 2P2GA 2O2EA 3WDLA 4D81A 3T3OA 1I3KA 2VP2A 4AZ3B 4F8JA 3OKPA 1AOXA 2X77A 2GN4A 2ZYIA 1JI3A 4QHYA 2WAAA 4WDQA 4YCNA 2AJCA 3PK0A 4LZPA 2EDAA 5NLLA 3PJRA 1QPBA 2VNJA 2VYFA 2ISQA 2YKGA 1XCPA 3PFGA 5KPDA 1JR3D 2FEPA 3M3PA 3TMKA 4MYUA 3OURA 3ZWXA 3CVWA 3KXLA 1WXEA 5B37A 3UT5B 5AWFC 5T8KA 2P4EA 3WL5A 2AMYA 2WYUA 1TJNA 3BGVA 2XNDA 1F9AA 3UCFA 1R6DA 2EQAA 2DJ5A 4L8WB 5DV9A 1PZEA 2XKAA 2IUUA 5KWSA 1Y8QA 2GCNA 4HFNA 1HTBA 3BMXA 4JIMA 4E6PA 4LE2A 3PSHA 5JYDA 2GXAA 1NBMA 3EDMA 3M4JA 4BNWA 4D79A 5CDGA 3COVA 1XA4A 2AD1A 5MN5A 1PQPA 2YWBA 3WNDA 4O1HA 4YK7A 1CDEA 2UZ3A 2OFWA 2W6IA 4W9NC 4HV4A 4XDYA 3NRJA 1VBNA 2WKRA 3UW1A 1UDXA 1LPOA 2WWIA 1FNDA 3JCZA 3OCCA 1IWBB 3PIIA 1HPLA 1Z36A 3NDRA 2WC1A 4NYIQ 5FEUA 3B51X 1U2GA 4OI2A 4B3FX 5GGYA 2O5VA 1E2HA 4KZKA 4ZAGA 4KZPA 5C80A 5GZ3A 2OBYA 3ILYA 2D5IA 3TECE 3WICA 4DFDA 1XEWX 4JR2A 1DFHA 5BSKA 2BI4A 3RVDA 1JJBA 1SAYA 1E89A 2ZT8A 1VJGA 5D2CA 3H4TA 1VLVA 3OAAD 3BMNA 4U63A 2XUHA 5INTA 3AT1A 2HIHA 3DTNA 3O2JA 4OHWA 3CEMA 5JS7A 5LLTA 4OD0A 2UVDA 4UDOA 3V1KA 1VP9A 4PZ0A 1D2RA 5J2UB 3WL6A 1SXJB 2JPDA 4KPUA 4AY2A 2PIAA 1OLXA 4PV7A 3OTHA 2VJLA 1AQ6A 2PUEA 1DBPA 1YXMA 3EVAA 1X0VA 3GLVA 4Z2AA 3PXGA 5DOVA 2B8EA 3UXHA 2W8BB 2BGLA 1JAYA 1Z16A 1LWNA 5BWLA 3K4HA 2JAWA 5AK3A 1YJAA 5AKJA 5BURA 3REFA 3ZIUA 2AG5A 2X5NA 2BW0A 5KJFA 3L0BA 3KRTA 3MPOA 2GEKA 2REBA 3DDWA 4I4NA 1D4ZA 1ULSA 2CUTA 1U94A 5ENZA 2VCYA 4BNLA 4C0XA 5DMHA 4BATA 3BIXA 1M34A 2RHGB 4WBSA 5AH0A 3TINA 1U8YA 1Z2EA 4TRMA 1FVFA 2GYVA 1AU9A 1G6KA 3DOIA 4Z7JA 1DEKA 5JAZA 4OYYA 2XSZA 4HDAA 4I9UA 4NOKA 4I4LA 5HIMA 3V3TA 1Y6JA 4WESB 3FB1A 5JZMA 3CT6A 2CNOA 2XQVA 1RP1A 1EWQA 2OYRA 2LUOA 4IQ8A 4Z1OA 4BGDA 4PX9A 3KOMA 3OPNA 3EQ2A 3JASA 2EZ8A 4Q4JA 3RIGA 1ZJWA 1OROA 1JLLB 1XEXA 1GV1A 2PGNA 2AN9A 4U1RA 4DDKA 1IEWA 5IANA 2HQSA 4F38A 1P9RA 2P9FA 1L7OA 1V7PC 1FX1A 3MJCA 5CUQA 4IM7A 5C34B 5AUPB 1G18A 5J4YA 4O4IA 3ZI7A 4ENUA 3GUYA 1OTXA 1V95A 1Z5OA 1Q1AA 3KT0A 3MMPA 4Q9LA 3FDZA 3JYPA 3RVKA 4JAVC 3B2EA 4NAVA 5DEIA 5KQSA 2XB2A 1Y3BE 2VWPA 3PLAE 1QFXA 4KYTA 1MZVA 5IEJA 5ARCA 2H85A 2N42A 2D5LA 4QWWA 4B6PA 3TH5A 3ZHQA 4MJXA 1VZ2A 1L1RA 3ZHUA 1DQPA 2XDWA 2WV7A 3N8HA 2HHCA 5HGXA 1P62B 3V4RA 1OXBB 4ETMA 5K3EA 3CRMA 4ZCRA 4QFDA 2VI5A 1KZYC 2EL9A 2FKNA 2IVFA 3CF4G 2P1DA 3CLUC 2HMAA 3TTYA 5DBFA 1EE1A 2XXBA 4HQNA 3PEYA 1HLDA 1G7RA 4PZYA 5ERGB 1SHUX 4YMGA 4RTQA 2G6BA 4HNQA 1L7PA 3B89A 1E6EA 2AOUB 4XX0A 3ZIAD 3UGQA 2ARKA 3VMMA 5IT0A 3C85A 2RGNA 3GBVA 3P9PA 1Z3IX 2PO7A 5BN3B 3RFFA 3EAQA 4LNAA 4S0ZA 1JQAA 4X3CA 3TLGA 4UOZA 3IT3A 4TKUA 4GP7A 4LRQA 3S8MA 4B7AA 2BHLA 5G0SA 1R0YA 3FMFA 3CONA 3KVYA 3VUFA 1JHOA 1FVXA 4QUKA 2OD2A 3C2QA 3VAAA 3Q5DA 2CVOA 3FOWA 4FYXA 2I4LA 3A9VA 5TT1A 1RJFA 4X7BA 2EBFX 2FJUA 2Y9PB 3GL9A 1SOAA 2GXSA 3JSXA 5DRTA 1IVNA 1CFJA 4EW6A 1SZDA 2J7KA 2NADA 2JIMA 4LWOA 4Y2QA 1KOGA 5DHFA 1NW3A 2CF6A 3I32A 1FU8A 1Z6YA 4YRLA 5AKKA 5IU6A 3HSKA 4JUCA 4F5YA 3W77A 3AERB 4IIJB 2PT9A 3HMQA 1NVDA 1KBOA 4MRPA 2XYHA 1XU9A 4EABA 4MQ4A 3VYRB 2IOYA 1GUBA 4KIJA 1IXZA 3CZRA 3TVTA 1OXTA 3AHGA 4KKXB 5JDCA 1H2XA 1K5HA 3NDPA 4Z0TA 3TS1A 1T0UA 1ZQ9A 3NM5A 4KXQA 5TGZA 4B3DA 3FJYA 3DEKA 3OTGA 5FJJA 3RIMA 2F7SA 4MUAA 4OLAA 3IODA 1NT2A 5AVXA 2AW5A 1TKBA 2GERA 3KWFA 5LU9A 3CUUA 3EH2A 1KP3A 1OE0A 1A4XA 3L7OA 1N75A 3G79A 4IWYA 1Z26A 3L05A 4IDFA 4HN9A 3D2LA 4PQRA 1KMHA 4ZQFA 3WAJA 3FBGA 5EHQA 2DETA 2CLSA 1ACMA 1CB0A 1GNPA 2EW8A 2I2DA 4XVQA 3VO8A 5I7EA 3KQNA 2GZMA 1OX4A 3PHJA 1KMCA 2F1RA 1L5RA 1A71A 1YQQA 3KPVA 2ZSIA 4DR1B 3PC4A 2Y99A 4N3AA 4A0GA 2AOXA 2FK8A 1CR2A 3L06A 3TG2A 1SZCA 3DMPA 1U0EA 4JS0A 1GHTA 1GT91 5CT9A 1H9BA 4K9MA 5CCDA 2K5UA 4ARCA 3IUPA 1CUAA 1NJ6A 2VLBA 5KQMA 2VTBA 1V9LA 2B7BA 3EQZA 3QF4B 4R2WA 1AGRA 2X1LA 2WIBA 2DF8A 2I2XB 2GBGA 4R3NA 3KKEA 3RWOA 1CP3A 1YQGA 5GPBA 5L6LB 3PC7A 4F8EA 2ZVDA 1D8AA 1CY1A 5D8DA 3D5TA 1G9SA 1SIUA 3KP1A 4IO1A 3WWDA 3BULA 3H83A 3KQUA 4OB8A 4DJJA 5KC9A 4KOAA 1B6TA 3WAKA 2M6SA 4HCJA 3K2EA 1FDWA 3HJRA 4TUYA 4YEDA 3ICEA 2PQ0A 3FZEA 2Q2NA 4NJEB 4QGBA 5EIOA 3FRJA 4CWAA 3MWEB 3M4XA 3AR5A 5BV8A 1E7QA 1S02A 1LBHA 3T5AA 2Y1KA 2HN9A 2V1XA 2FFBA 3FNGA 3DEHA 4JSYA 4ZI7A 1Z2AA 5BNZA 521PA 3GFQA 2C4MA 3DAFA 1NC1A 1SEPA 1II9A 3HCNA 4OK5A 4R9SA 1VCOA 2WWFA 3Q87B 4UQOA 4J3JA 1ENYA 3WKAA 2OK8A 4GI7A 4OHZA 4NOMA 5EJIA 2ORVA 1V1JA 3SSOA 3TXXA 1K5DA 2ICAA 3CCCA 1Q7EA 1E0AA 1GG5A 1NUAA 1J99A 1TTHA 2AMJA 2P0AA 1S2LA 2JI8A 4G81A 4PRKA 4DARA 1P1KA 3WQRA 4IEEA 1ZP6A 1RFGE 1YRLA 2J3MA 2YMQA 5FNVF 4QOFA 4LFCB 3U3OA 3A28A 3IHTA 3KEOA 3DUFA 1Q91A 1UEXC 1NZDA 4BRWA 5ICEA 1NU8A 2Y1GA 3LRXA 2YTZA 4LZJA 3ETGA 3WNZA 3HDYA 9ATCA 3OOWA 2YJNA 4KRXA 3S27A 3HK2A 4ES6A 4E7PA 2X9QA 4XPIB 4ATNA 1KA9H 2EGUA 4MUBA 4RK7A 2YOHA 3RVJA 4BFYA 1VECA 2BEVB 5L45A 4FKMA 1RAIA 3BB4A 4DB2A 1R9NA 2OLKA 3NGLA 1A9XA 1TFRA 2P41A 4JXXA 3TX2A 4D4GA 4NBKA 2P6OA 2ZPTX 2ZR9A 4H1UA 2J9YB 2BZ1A 4HD8A 4DCGA 1FNSA 3EZGA 3LT1A 1O1YA 1LS6A 1TK3A 2GEUA 2BTEA 1YONA 2G3YA 3GEHA 3IUYA 4AWAA 4XEHA 6PFKA 1YDMA 1S2DA 4QGGA 1XHFA 2NTNA 4PGGA 3UUWA 4LHYA 5LD2B 1FC0A 3T3HA 1FTGA 4RD6A 1YL7A 1F3LA 4TLMB 1JBQA 1AY0A 3G0CA 1FXSA 2VXYA 5TARA 5K8CA 3DAYA 1SG9A 1KI7A 2A7QA 2ZAOA 4KJZA 1E3DA 3PJEA 3ZWDA 2GYYA 2O06A 4Q3OA 1S8FA 4BCDA 1NIJA 3AFMA 4GPIB 5FUXA 1CZLA 4C0KA 5TQ0B 4TTJA 3AUXA 4IW3B 1JFFB 4GZLA 3EXFA 3P9XA 1GGVA 1CJVC 2PWAA 3R0JA 4X1KA 3P52A 4CGZA 2LCFA 2FQWA 5AI0A 5FD8A 3DZKA 1E7YA 1T3ZA 2HXYA 3G5LA 3A4NA 1HQKA 4NPAA 5F1YA 3UXEA 3KJHA 4I8XA 3VR5D 3T61A 3LLUA 3V8QA 2EHJA 3OOEA 1BQ4A 2YVUA 3VRHA 4UJ5A 5CK5A 3V1UA 5FR2A 4JC5A 5CB4F 4OQDA 3ZZMA 2DWOA 2UYOA 3HP4A 3OMLA 1CJMA 5EMLA 2C2BA 2PWBA 4B44A 1JSLA 2VXCA 4L9AA 5CA1B 3R1IA 2A14A 5LA6F 4EA8A 5K0JA 4RGQA 1DARA 3I04A 2V7WA 3K1JA 5A06A 1G20B 3HB5X 3IPLA 3AIOA 5ALYA 1G8MA 4K46A 3I05A 3OEYA 4YRPA 5EJ8A 1FDIA 2Q3EA 4JLWA 1L3IA 1FU7A 3QOXA 4KGDA 2FRDA 1P5JA 4EJMA 3K6RA 4X6YA 1LK0A 3I3OA 3EZNA 4ZCTA 5BUQA 4WXMA 1UM8A 3H19A 1GL9B 3FPFA 1T4MA 5C32A 2BFDB 3D6FA 2YYZA 1PUIA 3ZOZA 3AP1A 4ZTUB 1LLFA 3I9NA 4OA8A 2A94A 3PFHA 2W42A 3HVJA 3QEAZ 3BUSA 4HZGA 1JQBA 1XDDA 1KO7A 5B64A 2QDXA 4MPJA 4ZVMA 3HJAA 1R3UA 2H2HA 1F7UA 1MA0A 1XAIA 2F1IA 3UEOA 1TTPB 3QLVC 5T6MA 1ZGCA 4U7DA 3UFXB 2BGWA 2N1BA 2R7NA 1N2JA 4KTTE 4IPTA 4D4LA 2IT1A 5ICCA 3AF1A 1L4LA 3MAJA 1AXGA 4UNPA 1QZZA 5J23A 2I2CA 4OQPA 1A7AA 3HEMA 3QLUA 2NXJA 2E7ZA 1FUIA 2BBSA 4V2UA 4WADA 2L69A 4M0PA 3LPDA 3SBXA 4DDVA 1DJMA 4IEFB 2IODA 3MWDB 4N0PA 3ENKA 1OD6A 4TQ9A 2GJAA 4LYHA 4CUJA 3ES9A 4DPMA 2GAJA 3D0OA 1PSWA 4JDPA 4HGPA 4BO5A 1GKUB 1QWOA 2CFCA 4NYJQ 1IJFA 1DCMA 2ZBEA 4X8HA 4XOIA 4DTIA 4LISA 5F1OA 2A1TR 3PIRA 2CXOA 3JZIA 2R3SA 2WIDA 3LUCA 1JTFA 2LGJA 5MGBA 3AHJA 4M55A 4B83A 1WVMA 3QMWA 4H4CA 1ORIA 1PT5A 1EFCA 2PH3A 2RHOA 3V7NA 5FH9A 1FSZA 3OJEA 1W0KA 2R6JA 3CO0S 1EG2A 2G0NA 5CA0A 1K92A 3OETA 1UXIA 1SPXA 3GNSA 3IBFA 4LCEA 2YUIA 3MLAA 1A7UA 3BJZA 4WH0A 5EKTA 3GFOA 1XFAA 1SVWA 3DV2A 3RTBA 5JNLA 3D1JA 3CQ9A 5IDYA 1C9NA 2QLNA 4B9EA 5KB3A 2DCMA 3AY7A 3QEBZ 5CB0A 2IEAA 1Q0ZA 4DB4A 3AUSA 1S9HA 4P9NA 5CDSA 3PQ5A 3UKDA 3BN3A 3ILXA 1SXIA 1TO6A 4TV8F 2BFEB 2NU9B 4FI3C 4K86A 4M9XA 3IXQA 1Q0HA 4EIWA 1XPOA 4F4IA 2JJQA 3F3MA 2Z4TA 5D6OA 5K3FB 3LKVA 2ECPA 2WHQA 1JDBC 2NZXA 1PEDA 4L5AA 4QLOA 3W5AA 1U6KA 2CJWB 3P0EA 4G1EB 2L17A 2PZ8A 4A3SA 4UVIA 2QU8A 2YFKA 2X0EA 3JQAD 2HXSA 3X1KA 1UOEA 5MF6A 1JJ7A 4QBKA 5JDIA 3WVNA 5FOXA 4AD8A 3IIJA 4M4SA 2AR9A 4NY1A 3L93A 1SOWA 4UHBA 2WILA 3A6LA 3IKJA 4KQFA 5HOQA 1NTOA 1VGQA 2IU6A 4CR6A 4JJIA 3RTCA 3RVRA 4UUNA 1LNZA 3N9IA 3TSOA 5LP6B 1J8YF 2RAFA 2R62A 3AW9A 1J1ZA 5LBUA 3UA4A 3I92A 2HSWA 4UUOA 3OZFA 5FPYA 3QF7A 2IXAA 4RJKA 3RVQA 2PUCA 4UZSA 4U9HS 3F2VA 5G4KB 4X65B 1E1CB 1M3SA 2P8SA 1UL1X 1SUCA 1ABEA 5A9TA 3Q12A 4MS3B 4G4SP 5DNVA 3LF1A 1CJUC 1Q3TA 4I55A 2CC2A 4PZUA 2YDYA 1U0SY 1VBFA 1O96A 4YH1A 2DERA 2R2AA 2KX7A 2W2KA 2YX1A 1BTOA 3TZHA 1D6JA 2OLEA 4G8BA 5MHTA 1A3CA 1I4OA 2P9TA 2VJQA 2W2XA 4G8JA 2M2IA 1MQSA 1K4YA 1L8AA 3CCBA 3OPVA 3P4UA 4YJ2B 2XNSA 1P0FA 1ECGA 2PX3A 3MBIA 2CZCA 3K8YA 4HHEA 2CLKB 4W9MC 2D1YA 1KYZA 3LWDA 2APJA 5E9WA 3IPXA 1KDOA 1E2KA 2OV2A 3LCRA 2P6NA 1L5WA 2VC2B 4FFWA 4GX0A 5JBIA 2ZIWB 4EUSA 1XE3A 3ICQB 3VJKA 5JXGA 3V4FA 4CKWA 3K0BA 1N6LA 4PHCA 5G3YA 1T29A 5K20A 2QN9A 2UV8A 1U3CA 2GTIA 2OEPA 3FCOA 4OATA 9LDBA 4H6WA 1C7ZA 1BVRA 4L2IA 1M33A 3FNHA 5H0IA 4PRLA 3OWOA 3VZBA 4HBZA 1P18A 2G5GX 3OZGA 5JS2A 1QO0D 1UBCA 1CRWG 1O77A 3IKMB 4UUPA 5FTMA 3GLIA 4KN8A 5ES3A 1V3QE 3VSDA 2C7OA 1XRSB 4RKQA 2JIPA 1N4AA 3LV8A 1U7PA 4MB0A 2JAOA 4J76A 2JNWA 3NHZA 5B6JA 3DOCA 2FOIA 1VSUA 1QUFA 3QK7A 1FZTA 1PTKA 4CV2A 4FC7A 4KVFA 3DT6A 1GOTA 2KBFA 2XA1A 2FFAA 1GPJA 3EGOA 3HMKA 5G53C 3UWPA 3WK5A 4KMRA 2C2KA 4TMXA 3F73A 1CJTC 1OJLA 4JQOA 3D4LA 4KV7A 3AVOA 3WGZA 1MNAA 2DHQA 1KS2A 4DEVA 4YPFA 3SEAA 2OFOA 4EL5A 4C3UA 2BEUB 2WJZB 1AK1A 2FLVA 1FW8A 2GEJA 2XECA 3JARA 1CQIB 3P4XA 2VPTA 1TT7A 4F5ZA 3TCKA 4M0UA 3MFQA 3TB4A