3RSNA

Crystal structure of the n-terminal region of human ash2l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
165
structure length
165
Chain Sequence
ENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2
publication title Crystal structure of the N-terminal region of human Ash2L shows a winged-helix motif involved in DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2760 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3rsnA00
3S32A 3RSNA
chains in the Genus database with same CATH superfamily
3EUAA 1XCBA 3JRHA 3QPSA 2JRTA 2GIZA 3WTTC 2HOSA 1MIJA 1HQCA 4WX9A 1K4TA 4ZTJA 1JJ6C 3BTLA 5EG0A 3H3VK 1XGMA 2ZFWA 3DKYA 1W7PA 2EV5A 3RKWA 1ODDA 3BROA 3K4KA 1D1BA 4CCMA 1FYKA 2P7CB 5JLXA 1JJ8C 4HRIA 2P4WA 1KU2A 4KITB 1F9NA 4P5OA 4B48A 3KZIC 4RLFA 2DLLA 1RC9A 3PUBA 5FGMA 2KKOA 1FP2A 3PNVA 1ON1A 2XGDA 2QSFX 2F4OB 2DA7A 2VE9A 3K0LA 4RBOA 4FT8A 4A3IJ 1R71A 2ZJRF 2KP6A 1ZLKA 4BE0A 3RIRA 4XRFA 4J01A 2O6GE 3CMEI 2IS6A 4WF2A 3BR2A 1ZGWA 1FWZA 5B66C 1VQ9I 3FMQA 4S0HB 1SD4A 1MBKA 3F8FA 4IO9F 2OTLI 4U87A 1RESA 1YJNI 4GFBA 4EMSA 4E7IA 3Q9SA 5J1RA 3RZDJ 2GA2A 1B6AA 2R7TA 2OCCH 2H1KA 1VQNI 1PVEA 3LAJA 1W1WE 4HDUA 2R7FA 3FMSA 3ZMVA 1B1BA 3G1LA 4I99C 4FE7A 1JT6A 3L2RA 1U78A 1K6OA 3HOYJ 4NDLA 3TDUC 1D8JA 3ZQHA 2PBIA 3DPLC 4LK1F 2M30A 5F1JA 4F91B 4ON0A 4BS9A 3P5JA 3Q9VA 1T56A 2HQ5A 4L5JA 4H0EA 1HDPA 1MMDA 5CJ9A 4ZYAA 2NVQJ 1W36D 1D8KA 2HS5A 2R3SA 4YFNF 4I0AA 1S7AA 3HUGA 5L3BA 3I59B 3K1MA 2JWTA 3ZQGA 1ZG1A 3ISPA 4CICA 1WJDA 2IS1A 1TWHJ 1LFBA 4JQFA 1VNDA 3DQVC 2EZIA 1DGRM 2JPCA 4XLFA 2YPRA 2R7RA 2CFXA 2DT7B 3JREA 2CH0A 3ZN1A 1U8RA 1T95A 1GXPA 3KP5A 1IRFA 2IGKA 3Q0VA 1K61A 3IHUA 1WI3A 3RKYA 2LBFA 5AONA 1BW6A 2X6XA 1SEUA 3BG9A 1N77A 1MSEC 2JT1A 2ME0A 5J6XA 4HF0A 3FM3A 4DQ2A 5HNHA 1U3EM 3FKIJ 2V1XA 3MMYB 1VTNC 2NOJB 1XC5A 1IO2A 2ZXWH 3BQYA 2KRHA 3H1CA 4C30A 3ZGKA 1PP8F 2EIJH 1U6GA 3VYRB 2ESHA 4OOIA 3SZPA 4LK0F 4I98B 1SFXA 2DI3A 3B6CA 4ESJA 2VBXA 1B9NA 5L3DA 2L7MP 3QP6A 1FZPB 2F2EA 2FA5A 4RGRA 3V8KA 1I3QJ 3ABUA 3HXLA 1K79A 5JR3A 4PJLA 3ABKH 4XKBA 2ZC2A 3TKYA 1KQ8A 4XK4A 3ONQA 1FC3A 2GIVA 4XL9A 3IRQA 2DU9A 2HWVA 4LITA 3IAM2 3LSGA 2WA0A 3LMMA 5K1YA 1WJFA 4AYBN 3QODA 2M2EA 2K9LA 3F6OA 3RCOA 2FOWA 1WSUA 1OCTC 4ANJA 5CYVA 2NNNA 2NS7A 1OISA 5GPAA 3VYTB 2R7UA 2Q1ZB 2LG4A 5EGOB 4FQGA 3HKZN 4EM2A 1JKRC 5ICFA 3F0CA 3CLQA 4MHGA 4I09A 5KHDA 2JA8J 2ZSIB 5K7HA 5LLQA 1X1AA 3W6VA 1ACIA 5DCMA 4PJJA 4PGGA 5IP7J 3CJNA 2RN7A 1X3ZB 5LD2C 3QYEA 3E1SA 3VWBA 1XMAA 2FBIA 2RV8A 2DT5A 2R92J 4KIBA 4U7BA 4CXFA 2VPLA 1W7PB 5TISC 2R7XA 3LQQA 2PI0A 1Y6IA 1JUSA 1T2KA 4L5EA 3HYIA 2IGMA 2KZGA 2IPQX 2P5KA 3CF2A 2JA2A 1X2NA 4WXHA 2K4BA 2ECBA 1HW2A 2VI6A 1H9GA 1IXRC 1HW1A 2Y0SA 3MKYB 4PZJA 3E3VA 2HDWA 3D1NI 3OYGA 1FX7A 2VBWA 3WTXC 1SANA 4M71A 1TT5B 3PQJA 1Z91A 2M45A 4OMYA 3QWLA 2QZ8A 4HV6A 2BXYA 1QNTA 4HQMA 5J40A 1SVMA 2QA4I 1XGNA 4KIFA 3K2AA 5L3FA 3K1PA 4S05A 1G59A 1R36A 1DQUA 3A03A 3GLLA 2STWA 2KRFA 4LG0A 3HL2A 5E79C 1LFPA 4Y52J 3IV5A 4HW0A 4GGGA 4AM3A 3IAS2 3DXJF 4RAZA 1IXSB 3TGNA 1OFCX 3IKVA 2AO9A 5TGTA 2WB1N 2ZSHB 3S1NJ 2HOEA 2I5UA 3X2QH 2XSDC 4QPQA 3ZMUA 4HZFA 4I7HA 4Y4RA 1LFUP 2X1DA 4JBAA 4RAGA 4MEXF 1ZK8A 3OSGA 1MW7A 4HF2A 2ACJA 2QF7A 3CUQC 2RKHA 2GQQA 1FLIA 5ERIA 2E1MB 1MNEA 1MMAA 2ZCWA 1T33A 4GRIA 2A69F 4F93B 1R1UA 2FD5A 3E6MA 3HUGB 3CP8A 1WVRA 3ECOA 3HDDA 1SAUA 4IKFA 1ZRFA 4E4HA 2NOGA 1FIAA 1YG2A 4EATA 1WRJA 2K86A 4UVCA 2IJLA 3W2VA 5EEAA 3WTWC 4N4NB 3CC7I 2XB5A 2EZHA 2UWMA 4ESFA 2NXNB 2XIGA 1O7LA 2HR3A 4CUGA 1JHHA 2LBFB 2NVYJ 3BWGA 1T39A 2XC7A 2QYOA 2H09A 2EQRA 3RPUA 2G7HA 1YX5A 4HPQA 1YJWI 2CQNA 4AU7A 3F21A 2DJNA 2BZTA 1TLHB 4M9ZA 4E7ZA 3S1MJ 2DMTA 3HGGA 3WGGA 3WGHA 3JRDA 1R7JA 3TBIA 1LQ1A 1APLC 4JYKA 1J9IA 2O03A 4AWXB 1XG1A 5D5XB 3OS0A 1ZYRF 5AIPA 1V3FA 4OAZA 3R0AA 1QA6A 5B3SH 3PFYA 1U5TA 1HSJA 3ZMZA 4L9JA 3CTAA 1HDDC 4BHPA 3MQ0A 1OR7C 1YOVB 3FXOA 5E3NA 3UNGC 3OYNA 1U2WA 1Z7UA 2NRAC 1EH6A 3HIFA 1MBGA 2PG4A 2JMWA 3H5RA 3BZCA 4Q48A 4YIRX 1FBQA 1GV2A 3IWFA 4W1UA 2CJJA 2VQLA 1CF7A 2PFBA 1W5SA 3WTZA 3FWEA 3KP6A 1IRXA 1S7EA 2HNHA 4CYCA 1RUOA 4JX6A 3LSTA 2CO5A 1LDKB 2DO7A 1MGTA 2FUG2 4BQOA 2H27A 1IV6A 2V6CA 1QHGA 3GXOA 3KYLA 1O3RA 3TOAA 4JOMA 4MFDA 1ZHFA 3PIPF 4IXAA 3RQIA 1Y1VJ 4F55A 3HGYA 1OYWA 1UJ8A 1XCVA 2W7NA 3C1DA 3DPTA 4IHTA 4IEJA 4P9UA 1VQMI 3J7AO 2R7VA 2QUFA 4PFPA 1WH5A 5IP9J 1ZRDA 2XPUA 3TP0A 3QP5A 2OAZA 2CUEA 4U7DA 2MYSA 1AHDP 2E2HJ 2BVLA 5DCMB 4CYDA 2E71A 3R6SA 1YHQI 2FXAA 1RETA 2LY1A 4XOPA 1FOWA 1BJZA 3BC8A 2P0WA 3A4CA 1J5YA 3OS2A 1XB4A 3M7GA 3O3KA 2KIFA 1BIAA 4ZDPA 3K2ZA 3L2WA 2A05A 3C7JA 2HTJA 2K85A 1VQOI 3JRIA 1PP7U 1X19A 2KZVA 2R7DA 1ZTRA 3Q5FA 2WV0A 1BW5A 3OR1C 5F04A 1XSDA 3SXYA 2LDUA 4G7OF 5M3FJ 2XF7A 3AG2H 1Z0XA 5ICCA 1X1CA 1O3QA 3J7YJ 3S8PA 3BPVA 2XRLA 3MD2A 4NC7A 3I54A 1XTAA 1G8XA 1VQ4I 4XNFA 2HZTA 3H36A 4UUVA 2VL8A 4AIJA 3QOEA 5EEGA 1SAXA 2M0CA 4UUSA 2JJ7A 2XKOA 3BJ6A 3M1EA 1H88C 3BT9A 4IRGA 4OIOF 4Z2YA 1SFOJ 2MD0A 2V1DA 1JGSA 4LG0B 4BHCA 2BW3A 1DPRA 2CS3A 2DYSH 2L0KA 3TO9A 3VDXA 5IT9Z 3C2GA 3JW4A 2A6EF 3RYRA 5C4XJ 2M7BA 2LMDA 3S2DJ 1LJ9A 5HNFA 4CCLA 4G6QA 2JUCA 1MNMC 1XGOA 3HSRA 3LSJA 4P9FA 1ZREA 3FXKA 3AL0B 2O3FA 2EFOA 2B63J 3ELKA 1BR2A 3GW2A 3A01A 2HGCA 5FB2A 3ZP5A 9ANTA 4PJ0C 2E7XA 4YG2F 3QOPA 1EA3A 2OCEA 4YEJA 3JR9A 2H8RA 1BOBA 2YU9J 2NYXA 5B5EC 1JKOC 4NHJA 1UHWA 1A31A 2JN6A 1W0TA 1UZCA 2ZB9A 4YFKF 5LRSA 5H6QA 5DCFA 3VB2A 3ZRGA 3G6EI 4IQJA 5F0CA 3H3UA 3NWTA 4P1WA 1P6RA 2EK5A 5J1YA 1NG6A 1IN4A 1Z21A 4FE4A 4BGDA 1WCMJ 4E6KG 3SJMA 2X85A 3FXJA 2CV0A 2PLYA 4BNCA 3N4MA 1QO0D 2ID3A 1ZAOA 1W5TA 2F48A 1LVKA 2NVTJ 2P8TA 1JUPA 5BS6A 1X4OA 3LNQA 4IOAF 3CO7C 5D6EA 5J3LA 4ZYDA 5CVRA 2Y0MA 5E1ZB 1WPKA 3OYDA 2EA2A 3MFKA 2RDPA 2G7UA 4A3EJ 2E1OA 2WAQN 2K3FA 3F72A 4A0ZA 1U9NA 4UV9A 4Z6YA 5GTIC 3JRCA 1OCRH 1U5TB 3GO5A 2JVGA 4XBFA 2XASA 5ICEA 2P7VB 4AVZA 1QPIA 4M72A 2R0QC 1J59A 1S5LC 2H6CA 3BTJA 1P2FA 4BJTA 4M9SA 2HPIA 3G3ZA 2XAHA 3FK7A 4KMUX 3BOQA 2LVSA 2OJED 3ZMSA 4M6XA 2RQQA 3SHFA 3BCAA 4HDVA 1CF7B 1FYLA 3KZZA 1CQTA 1H8AC 2BV6A 4ZTFA 1GT0C 3EUHC 5E3OA 3SDBA 4KISA 4CYCB 2VJ5A 4RAFA 3A2KA 1SD6A 2BOLA 1B72A 1A6IA 3GTPJ 3LA7A 3GUDA 2X48A 5IYCJ 2KIMA 2LKXA 1V5EA 1IUFA 2JZYA 4IL6C 2PJRA 5HVQC 3I55I 2DMQA 3V7CA 3G73A 5J4YA 1Q1HA 5CLSA 1H0MA 4DGWB 1K78A 2ICWG 4G7HF 3ROUA 2L7KA 1IF1A 1VQ6I 1E3PA 4QPOA 2WAFA 1IRGA 2XV4S 1ENHA 1B4AA 2XAJA 4PCQA 2M4GA 3NQOA 2I8DA 5L3GA 1YIJI 2VKEA 3N97A 3DEWA 3FK6A 1TC3C 2DT6A 4CZZA 1UCRA 4UVBA 1IGNA 2X6WA 3CESA 1G3YA 5ILUA 4XONA 2G0EA 2F5VA 4ZZLA 4ZZDA 4LIVA 4HLXA 2UXNA 5C44J 2E34A 3CCRI 4IHVA 5E1WA 3K4NA 2W25A 2XF5A 1G3WA 3GZ5A 3CDLA 3OYKA 3GTMJ 3CJRB 4ZDOA 2F5CA 1VQKI 3BDDA 3BTIA 3HG9A 1MZBA 4HEA2 1HW5A 1IN5A 2LP0A 4HNTA 2VOOA 1LDJA 1ZN2A 4FTHA 5DM6F 3ERED 2AXLA 1HSTA 2MA3A 5LRRA 4C3JJ 5ICGA 2Y9YA 2MC4A 3CCMI 4AYBA 1Y39A 2R5ZA 3DWLE 1SD5A 2PN6A 2JA6J 2ZMEA 4RB2C 3HTSB 2X6YA 5IT9K 3BJAA 3HB9A 1HF0A 4UUSB 3TDZC 3VYUB 3H5NA 1N78A 4CCKA 3DTKA 1TNSA 2DODA 5ED4A 3HKZA 5HLHA 2L9VA 2KFDA 3D5SC 3GFMA 1T0FC 2BXZA 4G8XA 2X51A 4B8XA 3RDIA 3V7SA 2BW3B 2PEXA 1Y0NA 3K7AJ 4ENJA 2HOTA 1R1VA 2DMNA 1S6LA 1YJ9I 1ZQ3P 1Z67A 2RGVA 2DDAA 2HDCA 2Z1DA 2KJBA 1D3YA 1ZKGA 2JVHA 3T8RA 3LAPA 3S1RJ 5IYBJ 1EH7A 5LFAA 1OCPA 1TWFJ 2JQ7A 4XKWA 1R4MB 1DGWY 2PQ8A 3L09A 3QQAA 2V6EA 3GZNB 3A01B 2EFPA 3MKWB 1ZELA 1MMNA 2ZNZA 3KIOA 1LB2A 4XLEA 1KZHA 4R8HA 3WU0A 3K4JA 4DJAA 4WXDA 4DZJA 1BI2A 4A3JJ 3GTOJ 3GCMA 2KRCA 4CZCA 5FD5A 2EILH 3J80Z 1KA8A 4G6DA 3LSPA 1Z3XA 3S3NA 3HJEA 4OIPF 2C6YA 2HKXA 4Y13A 2ESNA 3S3MA 3KEYA 1UB9A 4G94A 3WTYC 1LE8B 1NTCA 2E7WA 2Y48A 4L0ZB 3J7ZI 3HSFA 4BH9A 4JP0A 2ZNYA 1STZA 4BE2A 4XR6A 2HU9A 4HX7A 3WE2A 3T0YA 4PDKA 3DPUA 1FPQA 3I56I 3E5XA 2BY1A 3HRMA 1I5ZA 4CSWA 1GUUA 2F6CA 1RKTA 5M5WJ 2A07F 2TCTA 1T8IA 1ETWA 2DFEA 1MBEA 2OC6A 3R0JA 1MNDA 4I01A 1Q1VA 2TRTA 2E36A 2FJ1A 1RIOH 2LSOA 4XKVA 4LLLA 4ETSA 5F08A 4A6DA 4ASNA 1LPQA 3QYBA 1BC8C 1P4AA 4M6YA 5D5UB 5FRNA 2QQBA 4MQ9F 2R7QA 2WB1A 4BDZA 4A12A 3OWTA 2UZKA 3JRBA 3OIQA 4JX5A 4GYGA 1QGPA 4OIQF 3M3YJ 1V54H 1QZZA 1WJBA 5D4RA 2R5YA 5LGTA 3CQZJ 2FX0A 2FE3A 2DA6A 4LB6B 4G9YA 1UELB 2AXTC 5JI6A 4X6AJ 4LOCA 4RGSA 5BQTA 2P5VA 3PM1A 4M3GA 4JX4A 3FIWA 5FO5A 4B09A 1B72B 2IA1A 5K5RA 2DPUA 3FISA 4MTDA 5KK1A 3EYIA 1JXSA 2HI3A 2PJRB 2VT2A 4P55A 1YE9A 1B59A 3AKZA 4NNJA 3WTSC 2E35A 3AG4H 1HKSA 1SVLA 3C2BA 1Z9CA 2IA2A 1K78B 2E1MC 4UHTA 4WCGA 3MZHA 2VC0A 1MMGA 3A1YA 3OOUA 2UV1A 3L2VA 1Z1DA 4FHTA 2P6TA 4BEHA 2CGPA 4KFCA 3CMAI 4AD9A 1WQ2A 1QBJA 3ZR8X 1D0XA 2V1UA 2MC3A 4S04A 2CU7A 4AUXA 2IS4A 1BI1A 2V9KA 3EYYA 3L9FA 3L1PA 2MH9A 3BR1A 5ILVA 1GVJA 1WH7A 1WFXA 1USSA 4HG2A 1T38A 4QLCU 3LSRA 5HDNA 2W48A 2V1NA 1P92A 3GTKJ 3JSPA 3H0DA 3VSLA 3IP4B 3ZQLA 2ZJ2A 2CG4A 3IH4A 4EJTA 1BN5A 2HVQA 1W7PD 2WC2A 5GAGJ 5FRMA 1O57A 2ZXJA 4BQQA 3K70C 3L00A 1OYYA 5FROA 3TW6A 5E18F 1BBYA 1YW8A 5D8LB 2GAUA 2HPMA 1MKMA 5HOOA 4PJMA 3LQRA 4E7LA 1R22A 2IVMA 3PL8A 3MVPA 2DA2A 3CD6I 3HEFA 4OU0A 1OCOH 3C18A 3DF8A 4FASD 5FLMJ 2CW0F 2R5ZB 3O6BB 2ZMEB 2GOMA 4Y33A 4QIWN 1J0RA 5F64A 2E1NA 1TZLA 3N05A 1OCZH 1WI9A 3JRFA 4EM0B 2FF4A 3FMRA 2GZWA 3OYAA 5H6RA 5EG0B 1FBSA 5DM7F 2LKSA 3CCUI 2Z9OA 4KDPA 2ID6A 1BR1A 3BTCA 1J75A 3K4CA 2CQKA 3CDIA 3FDYA 1S7OA 1AOYA 3OL4A 3I4MJ 3GTGJ 3I4NJ 4I76A 1KYWA 5FKNA 2EB7A 3RYPA 4MNUA 5J47A 3O8GA 3DKWA 2Q2EA 2XAFA 3GVAA 4YFXF 5K5QA 4D5FA 1D0YA 2CRGA 5L3CA 3FBIB 1XN7A 4CH7A 3NWSA 5LEKA 1E2XA 2H6BA 2Q8KA 2Q0OA 2L4AA 3J80K 2DOFA 3B02A 1FY7A 2ZO4A 4EJUA 2IEKA 1LEBA 2P5LC 1QU3A 4IF4A 2HVRA 2DMPA 1P7IA 5D6FA 3QPLA 3CCEI 3LWFA 1FMVA 2M5WA 5EDNA 4NC8A 4A5NA 2MD5A 4EJOA 2J5OA 4M74A 4IJAA 3OS1A 2OTJI 5E8IA 3J81K 2QKMB 3ABLH 3FX3A 2EIMH 2DFIA 2VJ4A 3A0HC 1USTA 4P96A 1RKWA 4BE1A 5F0FA 2EV0A 2RNGA 2YSRA 2O5RA 2W84A 3G4SI 5FKMA 1J2XA 2ZJQF 3TEDA 1ZG3A 5JHUA 3KCCA 3ESWB 2LD5A 3NARA 5CVUA 2B7EA 5FD6A 1JKPC 3MCZA 1EV7A 3WHCA 4B3AA 5D8KB 2XKPA 2GOXB 5FJ8J 1YLFA 2V4JC 2XSJC 2EZLA 1HLVA 3ZMDA 1VFCA 6PAXA 3TW7A 2LH9A 2NS0A 2VKVA 1WWXA 2XGEA 3H9GA 1Y0UA 3U1DA 3OYMA 3K70D 3QPTA 1FOYA 3DU5A 1YS6A 1U0JA 2H8WA 2LK2A 2LNBA 4LD5A 4OINF 2DAOA 2EV6A 2XRNA 3K6GA 3FHZA 2R5YB 2LC2A 1HXDA 4F3QA 4ZYHA 3D5LA 1IN8A 4MLOA 4F52A 1XDUA 3ASNH 2E60A 2JUGA 2QLZA 4IQ4A 5J1UA 1LKXA 2LYCA 4BJ5C 4ZC3A 2IXSA 2LKPA 3VSKA 3JTHA 1UHMA 4EJVA 2DK8A 3AL0C 1ULYA 1KU3A 3CZ6A 4J00A 5GTHC 1T98A 2RC4A 3OIOA 3MZ8A 1ETVA 3MAJA 1SMYF 1AWCA 1FNNA 2XAUA 3NAUA 2M87A 3RKXA 2IAIA 2MG4A 5J4VA 2DPDA 4GDFA 4BEHB 5DV5A 1F43A 3OYBA 1GVDA 4BL0B 3KLOA 4C2MJ 1TT0A 1XDSA 1LNWA 4OMZA 1LDDA 1XSXA 1D1AA 2WTEA 1WJ5A 2LFBA 2NAZA 4BAYA 5F6FA 3FM5A 4XOTA 5M5XJ 1CGPA 2AQEA 3FXUA 3RKQA 1D1CA 2FNPA 4EQQA 2MH2A 2A6HF 5FKLA 2FBKA 1ZR2A 1OJLA 4BQNA 3M1CA 3HOZJ 1I1GA 3CCYA 4RMNA 3BG5A 3OSFA 4V19K 5TJJA 3H9JA 4ZDLA 2FMYA 2VJJA 1U5TC 1G3TA 3GTQJ 1Z6RA 2B0LA 2IGOA 3H5AA 3TQNA 4HQEA 4IVNA 3ZQFA 1QQIA 2ELKA 4O3MA 2E19A 2FBHA 4EVIA 2WWYA 1HCRA 3ABTA 2GXGA 1R5ID 2X6OA 1YW9A 2BE5F 3GWZA 2PX9A 1JTYA 1ZARA 2NVUB 3HBLA 3H35A 4BY1J 2E2IJ 1GV5A 4CGZA 3U1KA 3VFZA 3GEZA 4DBQA 2HDDA 2X4HA 3I4PA 1YO5C 1EJ9A 1ERDA 1AA7A 3U2RA 1FYMA 2KDOA 3KYDB 3LL7A 1OCCH 2Q2EB 1XS9A 2M7AA 3DEUA 2DOAA 1R5GA 1YFHA 5IOZA 1AU7A 2X1CA 4O5VA 4RB1A 2O9LA 3OV8A 3QRFF 4WXCA 4FETA 1XX5A 2KL4A 1FSEA 1IZ1A 3PNYA 1B8IA 1S3JA 1X58A 3L2UA 4E7JA 2A68F 3M8JA 3F8BA 4Y3OA 4W97A 4EM1A 1H89C 5JVTA 3WE3A 2MLGA 3DP7A 1X3WB 3IL2A 1RR8C 3IRRA 4DBRA 3S32A 3BCBA 4YRVA 2Y2ZA 1E17A 1FEXA 1JE8A 5FLVA 2R7WA 4XRMA 1FMWA 2DTRA 4Y17A 2JSCA 3JAMK 4XRSG 4D0PA 3ZPLA 3V8LA 2OA4A 3SEQA 1ETXA 4D9JA 3BG3A 3DU6A 2H1LA 2CV2A 2JRMA 1Z3YA 2XAGA 1F5TA 2BVMA 1JUMA 2DJIA 1G3SA 3FXQA 2V26A 3C2HA 2IBDA 4TV7A 5E3LA 4YELA 4XICA 1FSHA 1O7FA 5EYRA 5GPCA 2COBA 2DQRA 4XRSA 3PUFA 2M4KA 1GLNA 1VZ0A 5LGNA 2OD5A 4XSZF 2VT3A 3OYLA 2RQPA 4HLYA 3S1QJ 4FISA 4U0WA 1ZR4A 2XVCA 4U0VA 1YTYA 2FOKA 3RTRA 3I9V2 5CPRB 2LTPA 1OMIA 1IDZA 2XROA 1QVUA 2HVSA 1TP4A 2FQ3A 3GBGA 5IT3A 4M3DA 1J7KA 2VJIA 1PUFA 3RPQA 5GP9A 4KJZA 5LHGA 3S17J 3ZQQA 3HRSA 3WU1B 3CCLI 1I6HJ 2XF6A 3KEQA 5FFXA 2QEXI 1OPCA 3CC2I 2DA5A 3OMYA 3R4KA 4II3A 1DDNA 1FP1D 4OAYA 3VOEA 2M1BA 1XGSA 4BU2A 5K7ZA 5BPIA 2LY9A 4A3GJ 3KP3A 5EF6A 4MEYF 2CWEA 3GFIA 1V55H 2BGCA 2W1OA 1HOMA 3V8JA 2K5CA 4JK1X 3E0JB 2CW8A 3OR2C 4I02A 2IT0A 4IRIA 3EUHA 5BNGA 2Y69H 4MTEA 2JSPA 2MBFA 3KLNA 4LLGF 2Z3YA 1KGSA 2YUSA 1EH8A 4LGWA 1DPUA 2WADA 2FMLA 2DQLA 1FBUA 4G12A 3TO6A 2CW7A 1S8NA 1I50J 2K9SA 4B47A 2ECCA 2QQAA 2L9NA 1RUNA 3S3OA 2G9WA 2D45A 1MSFC 4UY8I 3REOA 2K7LA 4UVAA 2PMUA 1ONVA 3DEEA 4ENNA 4D7MA 1HKQA 2MGQA 1OYIA 2FQ4A 5M5YJ 2PJPA 1NH3A 5KAFC 2QBYA 3KP7A 2Z33A 2ZXIA 2QQ9A 2K9MA 4ESBA 2CYYA 4AC0A 4F7ZA 1MJAA 2VN2A 3FZVA 4XLAA 2QENA 4UNOA 4RDUA 1VQ8I 1WGXA 4IPAA 3FHNA 5GADJ 3OIPA 3KP4A 3BLYA 3PFIA 1BA5A 1VQLI 1HA8A 4GYIA 3F22A 3Q3SA 1XD7A 2M0MA 2MW8A 1Z05A 2DDBA 3WTVC 1OLTA 2BY2A 2QGUA 5DUKA 5DYMA 2HQAA 3HHHA 3KZYA 1L0OC 4E70A 3PSIA 1E3OC 4HSRA 3MWMA 2WBMA 2LR8A 3Q0WA 2L7ZA 2O0YA 5EZGA 2K9NA 4HBLA 1JHFA 1NHAA 2HQNA 3PJRA 3WTUC 2QSGX 4EJWA 3CO6C 2OBPA 3W3CA 2V9PA 2LY2A 2OQRA 1PJRA 3QPHA 4IHWA 1MJBA 1I3AA 4NB5A 3ZXSA 4AVPA 1UAAA 3IH3A 1EF4A 3HOTA 1ZRCA 1SC7A 2VUMJ 5IY5H 1JT0A 2HOAA 5DS9A 4FX4A 3DV8A 1SFKA 1B8IB 3HC7A 4RM2A 4CA0A 4N9HA 3F8CA 3KEOA 1PYVA 3CP2A 3NRVA 3TOBA 3KYCB 1WKMA 2DBBA 2HFHA 3L2CA 3ECHA 3OYEA 2JPBA 2OUMA 5GAHJ 2EINH 2I10A 3HHGA 1DUXC 3PO2J 1O3SA 3LSMA 2A3SA 2MSYA 2B9SA 4D7NA 1IXCA 1GHCA 2KHMA 2IW5A 3K4BA 4KUMA 4RGUA 3AFHA 1KU7A 3IC7A 1XMXA 2XGCA 4ZJZA 4CCNA 1VQ7I 4M3FA 3HOUJ 4V2GA 4G6TB 4PJNA 2VQHA 3P9KA 2W00A 1YRNA 5C4JJ 2IS2A 4ZH4F 2M34A 1RZ4A 2NS8A 2VXDA 4UXNA 2DN0A 2STTA 2BHYA 2D1VA 3E6BA 4Q4ZF 1QVTA 3K9TA 3DLLF 3BQZA 3ZMTA 4HOBA 1L3LA 2KIQA 2ZMEC 2EA4A 2IP2A 1TQMA 2DTZA 2K4JA 2A6TA 1TBXA 4DW6A 1QPMA 1G6NA 3CCSI 3OYFA 2PMZN 1BR4A 2ME6A 3JRAA 4MGRA 3F3XA 1W4MA 4E7SA 1R9TJ 1R23A 4ABZA 4B3XA 4PSXA 5HLTA 2QSHX 1W5CC 1MBJA 5E20A 1SFEA 2A61A 2ZXHA 4D5CA 2V7FA 1PUFB 3GX4X 2XHKA 5K7FA 4NQWA 2TDXA 2GLOA 2O8XA 5JLWA 2JA7J 1KU9A 1BC7C 5M3MJ 3SZTA 3BR6A 1WZ2A 3J81Z 2E5NA 2FRHA 2XGXA 4HF1A 3HTUA 2LLKA 3VEPA 1P9QC 1MD0A 2DOEA 4II2A 3BG6A 3I64A 1GXQA 4E7KA 3GFLA 3ZQIA 2WV1A 3M07A 1FTZA 4LG3A 4H4KC 3MKLA 3UKGA 4CCJA 2F4MB 2KPMA 2M3AA 3BZKA 1ZGAA 3DBRB 2KQRA 4N4OB 4CCOA 3COAC 1HKTA 5HS9A 4EEFG 1BI0A 4M9XA 2VXZA 3QYFA 3S16J 2ZKZA 4DYCA 2UUZA 1H9TA 3OY9A 4N0BA 4B4CA 1ZG5A 3SZGA 2HQRA 4Y7NJ 2VE8A 2W82A 1N25A 2KT0A 5CVVA 3MKZA 1BI3A 2X9DA 2KDZA 3QU6A 4A3FJ 1KQ0A 2XUBA 4XMYA 2RNJA 1IJWC 2QBYB 3F9KA 4BXFA 2W24A 2O8KA 1TQPA 2BBYA 5H20A 2IA0A 3T5XA 2XPWA 3V42A 1WJEA 3K4MA 1WJCA 2HKOA 2W4SA 3C3WA 3ERMA 3I3LA 3P9CA 4YIFA 4ZYGA 4BXXJ 4RAYA 1O4XA 3BPXA 3EPZA 5LGUA 2HXIA 1MBFA 2M8EA 2V9VA 2HTSA 3M8EA 4AIDA 2Y31A 1A35A 3E5QA 1E0EA 1FT9A 3RI4A 3FF5A 1Y56A 4KT6A 1FTTA 4XIDA 3CDHA 3M8FA 2L01A 2N8GA 3SEZA 1ETYA 4Q47A 4ZYEA 4BDYA 1RRJA 1D0ZA 2RAEA 2DMUA 1DU0A 2DK5A 4GXOA 4BYYA 3T1BA 4PK4A 1TWGJ 3U9GA 2L5QA 3L2QA 4EGYA 2R7SA 1LEAA 4C2UA 2QQ8A 3EDPA 3OL3A 4A5MA 1QZYA 2BY0A 2WAEA 2CSOA 1K83J 1P7JA 1S72I 3I58A 3GTJJ 5FKOA 2VKDA 2VBYA 3ZOBA 4UB8C 4HAMA 4RLQA 4KA4A 4G7ZF 3BG7A 5F1RA 3RJPA 5GAEJ 5HLIA 3JRGA 2DA3A 2O7OA 4BUPA 3KFWX 4IHXA 2L4MA 5TRDA 2DYRH 1QRYA 4AIHA 4XSXF 3ZQCA 4O6JA 2ZFUA 2XAQA 1KONA 2LF7A 4Q5SF 3WG9A 4EGZA 5BPDA 3F8MA 5LHIA 3BR3A 4F92B 3G71I 1R6RA 1VQPI 3OYHA 2WY8Q 4RA2A 5DD4A 4LFUA 3TMOA 3H3ZA 1FOXA 4GCVA 4BKXA 5J8FA 5K5OA 4M3BA 4IRHA 4KMFA 2F5EA 2A5WA 1IV8A 2EPFA 1VI0A 2FEZA 3ABMH 2CQQA 1M1EB 3E7LA 1YRNB 2FSWA 3GMEA 4QWQA 3ULQB 3EUKL 4GO1A 1V5GA 4HA8A 4ENKA 2E5ZA 3ASOH 2E1CA 2MFZA 2GM4A 3HOWJ 2DFHA 4NUBA 3B6AA 4A3LJ 1OKRA 5HLGA 2DA1A 4DYRA 2LOOA 1I27A 2KLOA 3BP8A 1R00A 2YS9A 2UXXA 3JSOA 3V4GA 1DU6A 2D5VA 3ML6A 2O61A 4B1RA 5EEHA 2IRFG 3CUOA 3ZN0A 1X4PA 1TQIA 4K2EA 1DP3A 3M4OJ 3PIOF 4IOCF 1TL8A 4XORA 2YX7A 3BJOA 2HYJA 2L54A 2M8GX 4NQWB 3PSFA 3BZ6A 3CUQA 4PGHA 2EBIA 3WGIA 5KVRA 3S15J 1UFMA 1ITYA 5CVIA 4C3HJ 1X1BA 2EFWA 1IW7F 4KT5C 5IYDJ 4OWRB 4E7HA 3O8HA 2AHQA 2D1HA 3H0GJ 2JTVA 3JAMZ 5KCMA 2Y30A 2DCEA 3H92A 5B1BH 4BJ6C 2ZJPF 3QU3A 3KETA 2EWNA 3DLAA 3S93A 3W2AA 2ETHA 5DD8A 3W6JB 3PNTA 5DEQA 3HPGA 5KAIC 1J09A 3GF2A 1Z7LA 1T6SA 4R1HA 3NEUA 5HODA 4IZZA 1JTXA 5LBQA 1TWAJ 3J7AY 2QM3A 4M6VA 5LEJA 3BR0A 3HZJA 4M73A 1LUJB 5F0HA 5LHHA 3LFKA 3I0TA 5D5VB 3CCQI 2YX4A 3E6CC 1R58A 4A3KJ 3CMMA 5D4SA 2F5DA 1IDYA 5DTDA 3G1OA 3TP3A 5CQGA 4HX4A 1D5YA 3CCJI 2KISA 4A3MJ 4A6EA 3AG3H 2P6SA 4MIMA 2LF8A 4QTRA 2OU2A 1ON2A 3G1MA 1HBXG 4R79A 1BOAA 2QKLB 3HRUA 2F4IA 1U9OA 3P9IA 5A2QZ 2KIUA 2X1EA 4A3DJ 1OR7A 4XLHA 3DKXA 3PO3J 5DUIA 2IGNA 1YI2I 1T08B 1UHSA 4EV0A 3SYTA 3EETA 2CUZA 4DOZA 5IOYA 1I6XA 1Z77A 1N75A 4DIQA 3GZ6A 3G2BA 1ETOA 3R60A 1JKQC 1IN6A 2X0LA 3GYHX 2J5PA 1W0UA 1IAWA 4ITVA 4BACA 2R93J 2A5YB 3HSEA 2JA5J 1DP7P 3V7RA 4L9NA 5E8GA 2WAQA 1TW3A 1PDNC 4A0YA 1P4XA 1X1DA 1OQYA 5ILSA 3H9QA 4A2UA 3IUOA 2CUJA 4M3EA 1Y1WJ 4KIGA 4UB6C 4KNYA 2OF7A 5AIQA 2XDVA 3F8NA 2FU4A 3WHBA 2AS5F 4PUSA 2VQCA 4A3BJ 3R61A 3OOPA 2CFOA 3K69A 2JK3A 2Z2SB 1Z6TA 2R7OA 2KJCA 1ETQA 2EFNA 3ZCOA 2GBYA 2L7FP 4LLNA 2EIKH 4L18B 2VBZA 2F5FA 2NVXJ 2W85A 2ELJA 3RZOJ 3CF5F 3O2PE 4CDGA 3HOSA 1G2HA 2OQGA 2HEOA 5BMZA 4QSHA 4L9VA 1REPC 3T8TA 3FXRA 3WG7H 4HNVA 5JHFA 4I6ZA 4XLCA 3I71A 5HS8A 1X1PA 2MLKA 2VKHA 1ZH5A 3Q0UA 4WK8F 3A02A 2COMA 1FIPA 4L9TA 1A6QA 2EH3A 1SMTA 4DYQA 3OYJA 1VF9A 2DFFA 1MJ9A 2L9RA 3VODA 2L9SA 3CC4I 3FBNB 4XN0A 2LREA 3DTIA 4A3CJ 3LOCA 3SQNA 2LRDA 3DFGA 4V2FA 2EFQA 2Y0SN 1RI7A 1RPWA 2VC1A 1XSVA 1ORKA 3MN2A 4FCYA 2K9QA 4L5IA 1TWCJ 2GA1A 3IH2A 3K1NA 3HOXJ 3L7WA 2QCOA 3M9AA 2WY7Q 1ETKA 5F27A 1O3TA 2VOPA 1Y8RB 3VPRA 1TNTA 5C3EJ 3D0SA 2CQXA 1R1TA 2L02A 5E17F 4D1QA 1SFUA 1WHUA 2R7ZJ 5JFRA 1IC8A 4PFOA 4J19A 3HRTA 3SDGA 1JGGA 3RSNA 1D5VA 3DBLB 2H94A 2Z16A 4LMYA 3WODF 3D5RC 1YQAA 3DBHB 3B73A 1F4KA 4CO8A 3CUQB 5FLXZ 2YR2A 1MDMA 4UUTA 3LFUA 1AKHA 2Z99A 3CLOA 2W57A 1E3HA 2CQ7A 2R4GA 1RR7A 4KICA 4XQFA 1XPXA 5KNLA 1BM9A 2L2OA 1PUEE 4BBRJ 3S2HJ 2HYGD 2NNYA 1B9MA 3K10A 4IHYA 2VQGA 4HX8A 4LB5A 1A5JA 4DNCA 2BY3A 3RPUD 2DA4A 3FXMA 2VB6A 2DXIA 2K3PA 5CKTA 5CQEA 2AQFA 2EZKA 3GFJA 1XMKA 4A69C 3WU2C 3IWZA 4C3IJ 3IKTA 4I0BA 2M9HA 4CHUA 1QZEA 3F23A 1RNLA 5HS7A 2ISYA 4BXUA 1R49A 3I53A 1YIOA 4IHSA 1A04A 1V5FA 2RVCA 5A2QK 2HYFA 1BL0A 3UR3C 2GXAA 3GLXA 2E2JJ 2GXBA 1SD7A 2Y9ZA 2OPTA 2OZUA 1VQ5I 5J8CA 2ELHA 5HDGA 4DZPA 3AAFA 1C0WA 1BIBA 1NG7A 1S9HA 2PMZA 3KPHA 2CV1A 1NK3P 5L3EA 1Y8QB 3DTEA 2OV7A 3TL4X 1V4RA 1KQ9A 4B43A 2BEOA 1LE8A 1BJAA 3QAHA 1X2MA 1KYZA 4A93J 3AG1H 3GTLJ 3CCVI 1MMSA 4KN4X 4N9IA 4U88A 2OZ6A 1GDTA 4XLNF 1MBHA 3HPHA 3I5UA 2VLAA 1YS7A 4UV8A 4A0XA 2K02A 1FJLA 4BY7J 1YYVA 1IN7A 4BBSJ 3KX2A 1LVAA 3LA2A 2XB0X 4YIIA 5HDKA 3S2WA 4NBQA 2DW4A 2ZBKA 2HXOA 3E5UA 4FX0A 2BHZA 5EJCA 3OYIA 4ENMA 3FXLA 3A0BC 1HC8A 3PQKA 3SFZA 4BHBA 5DDGA 3LSHA 4RB3C 4L0YB 3S14J 3P7NA 5FFZA 1UMQA 1YX3A 4WWCA 1F1ZA 4PSWA 3BR5A 1U8BA 4I2OA 3I59A 4RGXA 1G4DA 3HM5A 1ZGJA 3KP2A 4B44A 1EKEA 1IRZA 2P81A 3EQLF 3CJQB 1SVOA 1NK2P 4XKCA 2XPVA 3MZYA 2FNAA 3SFIA 2VODA 1UG0A 3TO7A 2PMHA 4BQAA 1A36A 1QHHD 1JI8A 4MO7A 1IUYA 2KMUA 5E3MA 1R4NB 3CJTB 3LA3A 2CUFA 4MFEA 4XLPF 1S29A 1K7AA 2GWRA 3ZQ7A 3U21A 4RM3A 3W2WA 5EZHA 3FKJA 1YITI 1I39A 4KYWA 2VIXA 5H2FC 4IX7A 4X1EA 2Z5UA 2K27A 5E1XA 4XM3A 3OYCA 3F6VA 3DCFA 1UG2A 2CMPA 3E6DA 5CVJA 1K6YA 4LIUA 2QWWA 4LJZF 5D5WB 1WJAA 3W6KB 2QVOA 3VYSB 1F36A 3LSKA 4X0GA 2ADUA 4KN7X 4HYEA 4NC6A 4U0YA 3JTGA 1I1SA 2MABA 4RS8A 4MQVA 3K4LA 5FKKA 1T0FA 2YU3A 2L3DA 3LSIA 1R5HA 3HOVJ 5B1AH 1TW2A 2BYVE 3MEXA 2EJRA 1P4WA 4HNUA 3KE2A 2HZDA 1YW7A 3E97A 4AIKA 1TTYA 5FLXK 4HSTA 5IP6A 1W36C 2RREA 3JCUC 5BOXA 1ZLJA 1X3UA 3BY6A 5EGOA 2ISZA 2V79A 2Y75A 1MH3A 4XN3A 1IG7A 5IPAA 1MH4A 2K40A 2VONA 4C2TA 3RQ4A 4OIRF 4RB0A 1FOKA 4Y15A 1POGA 4HV5A 1MDMB 2VPRA 5JVGF 1AKHB 1K4SA 3CMYA 2D2WA 2VASA 4C9YA
chains in the Genus database with same CATH topology
3EUAA 2WAEA 2VKDA 4BEHB 4ZTJA 3ZRGA 4RLQA 4IQJA 3BG7A 3OYBA 3DKYA 4BL0B 3NWTA 4P1WA 3K4KA 1D1BA 4CCMA 1TT0A 4BUPA 1NG6A 4HRIA 1Z21A 2ZFUA 4KITB 1KONA 4BGDA 1D1AA 4P5OA 1WJ5A 2X85A 4B48A 4E6KG 2CV0A 4RLFA 1LVKA 3PUBA 4F92B 1R6RA 4XOTA 1X4OA 3OYHA 2IS1A 2AQEA 2WY8Q 3PNVA 1D1CA 3TMOA 3OYDA 2KP6A 4BE0A 2A5WA 4J01A 4BQNA 3M1CA 2IS6A 4RMNA 3H9JA 3EUKL 4ZDLA 2VJJA 2JVGA 1V5GA 4AVZA 2E5ZA 2MFZA 3H5AA 2IGOA 4U87A 4BJTA 2HPIA 4NUBA 4E7IA 2LOOA 2KLOA 2RQQA 2R7TA 3BCAA 4ZTFA 3EUHC 3SDBA 4KISA 2VJ5A 3A2KA 1X4PA 1DP3A 2BOLA 3L2RA 3H35A 3DPLC 4DBQA 1V5EA 2PJRA 1ERDA 4F91B 5HVQC 1AA7A 4XORA 4BS9A 2KDOA 4NQWB 3LL7A 3PSFA 2Q2EB 2M7AA 2DOAA 4DGWB 1X1BA 2L7KA 2X1CA 1MMDA 4ZYAA 4QPOA 2WAFA 1W36D 4FETA 4OWRB 4E7HA 2KL4A 5KCMA 2DCEA 2M4GA 2I8DA 4BJ6C 3PNYA 3L2UA 1WJDA 2DT6A 3DLAA 3S93A 4E7JA 3W2AA 4JQFA 2X6WA 3DQVC 3M8JA 3CESA 3PNTA 4Y3OA 1DGRM 4XONA 3HPGA 4XLFA 1J09A 2F5VA 1Z7LA 2R7RA 4IZZA 2DT7B 4LIVA 3J7AY 2CH0A 1T95A 4DBRA 2IGKA 3S32A 2LBFA 3BCBA 4YRVA 3CMMA 2X6XA 1N77A 3K4NA 2R7WA 1FMWA 2XF5A 3OYKA 3CJRB 4ZDOA 5CQGA 5HNHA 3SEQA 4D9JA 3MMYB 3DU6A 2NOJB 4C30A 2KRHA 2CV2A 1Z3YA 3HG9A 3ZGKA 4R79A 2BVMA 4HEA2 2QKLB 3VYRB 2DJIA 4HNTA 2F4IA 2V26A 3C2HA 4YELA 2X1EA 2MC4A 4XLHA 3DKXA 4AYBA 2IGNA 2M4KA 1GLNA 1VZ0A 3DWLE 2X6YA 3OYLA 3SYTA 3HXLA 4PJLA 3VYUB 2CUZA 3H5NA 4XKBA 4DOZA 1N78A 4CCKA 3DTKA 3ONQA 4XL9A 3HKZA 1N75A 3D5SC 4LITA 3RTRA 3IAM2 1T0FC 3I9V2 3LSGA 2X51A 2WA0A 3G2BA 3LMMA 5CPRB 1WJFA 2BW3B 2HVSA 3QODA 4ITVA 2K9LA 3GBGA 3RCOA 4BACA 2VJIA 4KJZA 4ANJA 3ZQQA 2Z1DA 2WAQA 2JVHA 2XF6A 1X1DA 3VYTB 2R7UA 2Q1ZB 2LG4A 3H9QA 2CUJA 3IUOA 5LFAA 3OMYA 4XKWA 1DGWY 4II3A 2V6EA 4OAYA 2XDVA 3MKWB 1ZELA 4BU2A 1MMNA 5KHDA 2ZSIB 4XLEA 4PUSA 2VQCA 3K4JA 1X1AA 2W1OA 4DIQA 4DJAA 2CFOA 2K5CA 3E0JB 2Z2SB 2CW8A 4CZCA 2KRCA 2R7OA 3OR2C 4PJJA 3ZCOA 1Z3XA 5LD2C 3QYEA 3E1SA 3S3NA 3VWBA 2JSPA 4U7BA 2VPLA 2ELJA 2R7XA 2WADA 3HOSA 3S3MA 3KEYA 1Y6IA 2CW7A 2IGMA 5JHFA 3CF2A 4B47A 4XLCA 2JA2A 2L9NA 4BE2A 4XR6A 2HU9A 3S3OA 2VKHA 3DPUA 2Y0SA 3MKYB 3OYJA 2HDWA 4CSWA 3DEEA 2F6CA 3OYGA 2L9SA 2OC6A 1MNDA 3FBNB 4XN0A 2LREA 3DTIA 4XKVA 2ZXIA 2K9MA 3QYBA 2LRDA 4XLAA 5FRNA 2R7QA 2WB1A 4BDZA 3OWTA 3FHNA 3OIPA 3OIQA 1G59A 3BLYA 1DQUA 1HA8A 1WJBA 3HL2A 2WY7Q 1LFPA 2M0MA 1OLTA 2HQAA 3IAS2 1UELB 5TGTA 3PSIA 4HSRA 2ZSHB 4D1QA 2WBMA 4PFOA 4QPQA 3RSNA 4Y4RA 3PJRA 2Z16A 2PJRB 2X1DA 3D5RC 1YE9A 1MW7A 3W3CA 3AKZA 2LY2A 4NNJA 1PJRA 3LFUA 2E1MB 1MNEA 3ZXSA 1MMAA 2E1MC 2R4GA 1UAAA 4XQFA 4GRIA 3HOTA 4F93B 5KNLA 1MMGA 3A1YA 2L2OA 3OOUA 2UV1A 3HUGB 3CP8A 3L2VA 4BEHA 1SAUA 3K10A 1SFKA 4IKFA 3HC7A 2VQGA 4RM2A 4CA0A 4E4HA 3RPUD 3ZR8X 1D0XA 2VB6A 4EATA 2DXIA 3W2VA 1PYVA 2K3PA 3CP2A 2AQFA 5CKTA 5CQEA 2IS4A 2V9KA 4N4NB 2UWMA 3OYEA 2OUMA 4HG2A 1WFXA 4CUGA 2LBFB 2XC7A 2V1NA 3H0DA 3VSLA 3IP4B 3LSMA 1YX5A 4HPQA 1V5FA 4AU7A 2HVQA 4E7ZA 2KHMA 3K4BA 3AFHA 3TBIA 3UR3C 5FRMA 4ZJZA 4CCNA 4BQQA 3K70C 4G6TB 4PJNA 2VQHA 5FROA 3OS0A 4OAZA 2W00A 2IS2A 1NG7A 2HPMA 3PFYA 1S9HA 2PMZA 4PJMA 5HOOA 2CV1A 4E7LA 2VXDA 3PL8A 3DTEA 2OV7A 3TL4X 4B43A 1OR7C 3OYNA 3UNGC 4FASD 2GOMA 4Y33A 3H5RA 1TZLA 3N05A 2A6TA 2VQLA 3OYFA 1BR4A 3OYAA 1IRXA 2HNHA 3HPHA 2VLAA 4E7SA 1LDKB 2FUG2 4B3XA 4BQOA 1BR1A 4PSXA 5HLTA 1QHGA 3K4CA 3KYLA 3FDYA 4JOMA 2ZXHA 3KX2A 3OL4A 2V7FA 4F55A 3OYIA 1D0YA 3FBIB 4CH7A 2W7NA 3NWSA 3DPTA 2E5NA 3LSHA 2R7VA 4PFPA 1YX3A 4PSWA 1P9QC 1QU3A 2HVRA 4II2A 3BG6A 4B44A 4E7KA 2MYSA 2BVLA 3CJQB 1FMVA 4NC8A 4LG3A 4H4KC 2LY1A 4XKCA 4XOPA 1UG0A 4CCJA 3BC8A 3OS1A 2P0WA 2KPMA 1QHHD 2M3AA 2QKMB 3A4CA 3OS2A 1JI8A 2KMUA 4ZDPA 3L2WA 2KQRA 4N4OB 4CCOA 2VJ4A 2VXZA 3QYFA 1X19A 2KZVA 3U21A 4BE1A 2RNGA 4RM3A 3W2WA 2UUZA 3FKJA 2O5RA 3OR1C 3OY9A 2VIXA 4IX7A 3SZGA 2XF7A 4XM3A 2W82A 3OYCA 1X1CA 3MKZA 3S8PA 3MD2A 2CMPA 4XMYA 4NC7A 1K6YA 4LIUA 3F9KA 4BXFA 1G8XA 4XNFA 1WJAA 2GOXB 2V4JC 2XSJC 3VYSB 3LSKA 4X0GA 2VL8A 2LH9A 3QOEA 3V42A 3H9GA 1WJEA 2MABA 3K4MA 3OYMA 3K70D 1WJCA 2W4SA 3K4LA 3DU5A 1U0JA 3I3LA 3LSIA 2MD0A 3K6GA 2LC2A 2BW3A 2CS3A 3EPZA 4F3QA 3VDXA 4HNUA 3C2GA 3D5LA 2HZDA 2M7BA 4MLOA 4F52A 1E0EA 5HNFA 4CCLA 4HSTA 1W36C 1Y56A 2E60A 2JUGA 2RREA 4IQ4A 4KT6A 1LKXA 2LYCA 4BJ5C 4ZC3A 2IXSA 3VSKA 3AL0B 3SEZA 3AL0C 4BDYA 4XN3A 1D0ZA 3CZ6A 4J00A 1BR2A 4C2TA 3RQ4A 4PK4A 2R7SA 2L5QA 3L2QA 4YEJA 1EA3A 4C2UA 1BOBA 2VASA 4C9YA 3OL3A 2XAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S32 A;  3RSN A; 
#chains in the Genus database with same CATH topology
 3EUA A;  1XCB A;  3JRH A;  3QPS A;  2JRT A;  2GIZ A;  3WTT C;  2HOS A;  1MIJ A;  1HQC A;  4WX9 A;  1K4T A;  4ZTJ A;  1JJ6 C;  3BTL A;  5EG0 A;  3H3V K;  1XGM A;  2ZFW A;  3DKY A;  1W7P A;  2EV5 A;  3RKW A;  1ODD A;  3BRO A;  3K4K A;  1D1B A;  4CCM A;  1FYK A;  2P7C B;  5JLX A;  1JJ8 C;  4HRI A;  2P4W A;  1KU2 A;  4KIT B;  1F9N A;  4P5O A;  4B48 A;  3KZI C;  4RLF A;  2DLL A;  1RC9 A;  3PUB A;  5FGM A;  2KKO A;  1FP2 A;  3PNV A;  1ON1 A;  2XGD A;  2QSF X;  2F4O B;  2DA7 A;  2VE9 A;  3K0L A;  4RBO A;  4FT8 A;  4A3I J;  1R71 A;  2ZJR F;  2KP6 A;  1ZLK A;  4BE0 A;  3RIR A;  4XRF A;  4J01 A;  2O6G E;  3CME I;  2IS6 A;  4WF2 A;  3BR2 A;  1ZGW A;  1FWZ A;  5B66 C;  1VQ9 I;  3FMQ A;  4S0H B;  1SD4 A;  1MBK A;  3F8F A;  4IO9 F;  2OTL I;  4U87 A;  1RES A;  1YJN I;  4GFB A;  4EMS A;  4E7I A;  3Q9S A;  5J1R A;  3RZD J;  2GA2 A;  1B6A A;  2R7T A;  2OCC H;  2H1K A;  1VQN I;  1PVE A;  3LAJ A;  1W1W E;  4HDU A;  2R7F A;  3FMS A;  3ZMV A;  1B1B A;  3G1L A;  4I99 C;  4FE7 A;  1JT6 A;  3L2R A;  1U78 A;  1K6O A;  3HOY J;  4NDL A;  3TDU C;  1D8J A;  3ZQH A;  2PBI A;  3DPL C;  4LK1 F;  2M30 A;  5F1J A;  4F91 B;  4ON0 A;  4BS9 A;  3P5J A;  3Q9V A;  1T56 A;  2HQ5 A;  4L5J A;  4H0E A;  1HDP A;  1MMD A;  5CJ9 A;  4ZYA A;  2NVQ J;  1W36 D;  1D8K A;  2HS5 A;  2R3S A;  4YFN F;  4I0A A;  1S7A A;  3HUG A;  5L3B A;  3I59 B;  3K1M A;  2JWT A;  3ZQG A;  1ZG1 A;  3ISP A;  4CIC A;  1WJD A;  2IS1 A;  1TWH J;  1LFB A;  4JQF A;  1VND A;  3DQV C;  2EZI A;  1DGR M;  2JPC A;  4XLF A;  2YPR A;  2R7R A;  2CFX A;  2DT7 B;  3JRE A;  2CH0 A;  3ZN1 A;  1U8R A;  1T95 A;  1GXP A;  3KP5 A;  1IRF A;  2IGK A;  3Q0V A;  1K61 A;  3IHU A;  1WI3 A;  3RKY A;  2LBF A;  5AON A;  1BW6 A;  2X6X A;  1SEU A;  3BG9 A;  1N77 A;  1MSE C;  2JT1 A;  2ME0 A;  5J6X A;  4HF0 A;  3FM3 A;  4DQ2 A;  5HNH A;  1U3E M;  3FKI J;  2V1X A;  3MMY B;  1VTN C;  2NOJ B;  1XC5 A;  1IO2 A;  2ZXW H;  3BQY A;  2KRH A;  3H1C A;  4C30 A;  3ZGK A;  1PP8 F;  2EIJ H;  1U6G A;  3VYR B;  2ESH A;  4OOI A;  3SZP A;  4LK0 F;  4I98 B;  1SFX A;  2DI3 A;  3B6C A;  4ESJ A;  2VBX A;  1B9N A;  5L3D A;  2L7M P;  3QP6 A;  1FZP B;  2F2E A;  2FA5 A;  4RGR A;  3V8K A;  1I3Q J;  3ABU A;  3HXL A;  1K79 A;  5JR3 A;  4PJL A;  3ABK H;  4XKB A;  2ZC2 A;  3TKY A;  1KQ8 A;  4XK4 A;  3ONQ A;  1FC3 A;  2GIV A;  4XL9 A;  3IRQ A;  2DU9 A;  2HWV A;  4LIT A;  3IAM 2;  3LSG A;  2WA0 A;  3LMM A;  5K1Y A;  1WJF A;  4AYB N;  3QOD A;  2M2E A;  2K9L A;  3F6O A;  3RCO A;  2FOW A;  1WSU A;  1OCT C;  4ANJ A;  5CYV A;  2NNN A;  2NS7 A;  1OIS A;  5GPA A;  3VYT B;  2R7U A;  2Q1Z B;  2LG4 A;  5EGO B;  4FQG A;  3HKZ N;  4EM2 A;  1JKR C;  5ICF A;  3F0C A;  3CLQ A;  4MHG A;  4I09 A;  5KHD A;  2JA8 J;  2ZSI B;  5K7H A;  5LLQ A;  1X1A A;  3W6V A;  1ACI A;  5DCM A;  4PJJ A;  4PGG A;  5IP7 J;  3CJN A;  2RN7 A;  1X3Z B;  5LD2 C;  3QYE A;  3E1S A;  3VWB A;  1XMA A;  2FBI A;  2RV8 A;  2DT5 A;  2R92 J;  4KIB A;  4U7B A;  4CXF A;  2VPL A;  1W7P B;  5TIS C;  2R7X A;  3LQQ A;  2PI0 A;  1Y6I A;  1JUS A;  1T2K A;  4L5E A;  3HYI A;  2IGM A;  2KZG A;  2IPQ X;  2P5K A;  3CF2 A;  2JA2 A;  1X2N A;  4WXH A;  2K4B A;  2ECB A;  1HW2 A;  2VI6 A;  1H9G A;  1IXR C;  1HW1 A;  2Y0S A;  3MKY B;  4PZJ A;  3E3V A;  2HDW A;  3D1N I;  3OYG A;  1FX7 A;  2VBW A;  3WTX C;  1SAN A;  4M71 A;  1TT5 B;  3PQJ A;  1Z91 A;  2M45 A;  4OMY A;  3QWL A;  2QZ8 A;  4HV6 A;  2BXY A;  1QNT A;  4HQM A;  5J40 A;  1SVM A;  2QA4 I;  1XGN A;  4KIF A;  3K2A A;  5L3F A;  3K1P A;  4S05 A;  1G59 A;  1R36 A;  1DQU A;  3A03 A;  3GLL A;  2STW A;  2KRF A;  4LG0 A;  3HL2 A;  5E79 C;  1LFP A;  4Y52 J;  3IV5 A;  4HW0 A;  4GGG A;  4AM3 A;  3IAS 2;  3DXJ F;  4RAZ A;  1IXS B;  3TGN A;  1OFC X;  3IKV A;  2AO9 A;  5TGT A;  2WB1 N;  2ZSH B;  3S1N J;  2HOE A;  2I5U A;  3X2Q H;  2XSD C;  4QPQ A;  3ZMU A;  4HZF A;  4I7H A;  4Y4R A;  1LFU P;  2X1D A;  4JBA A;  4RAG A;  4MEX F;  1ZK8 A;  3OSG A;  1MW7 A;  4HF2 A;  2ACJ A;  2QF7 A;  3CUQ C;  2RKH A;  2GQQ A;  1FLI A;  5ERI A;  2E1M B;  1MNE A;  1MMA A;  2ZCW A;  1T33 A;  4GRI A;  2A69 F;  4F93 B;  1R1U A;  2FD5 A;  3E6M A;  3HUG B;  3CP8 A;  1WVR A;  3ECO A;  3HDD A;  1SAU A;  4IKF A;  1ZRF A;  4E4H A;  2NOG A;  1FIA A;  1YG2 A;  4EAT A;  1WRJ A;  2K86 A;  4UVC A;  2IJL A;  3W2V A;  5EEA A;  3WTW C;  4N4N B;  3CC7 I;  2XB5 A;  2EZH A;  2UWM A;  4ESF A;  2NXN B;  2XIG A;  1O7L A;  2HR3 A;  4CUG A;  1JHH A;  2LBF B;  2NVY J;  3BWG A;  1T39 A;  2XC7 A;  2QYO A;  2H09 A;  2EQR A;  3RPU A;  2G7H A;  1YX5 A;  4HPQ A;  1YJW I;  2CQN A;  4AU7 A;  3F21 A;  2DJN A;  2BZT A;  1TLH B;  4M9Z A;  4E7Z A;  3S1M J;  2DMT A;  3HGG A;  3WGG A;  3WGH A;  3JRD A;  1R7J A;  3TBI A;  1LQ1 A;  1APL C;  4JYK A;  1J9I A;  2O03 A;  4AWX B;  1XG1 A;  5D5X B;  3OS0 A;  1ZYR F;  5AIP A;  1V3F A;  4OAZ A;  3R0A A;  1QA6 A;  5B3S H;  3PFY A;  1U5T A;  1HSJ A;  3ZMZ A;  4L9J A;  3CTA A;  1HDD C;  4BHP A;  3MQ0 A;  1OR7 C;  1YOV B;  3FXO A;  5E3N A;  3UNG C;  3OYN A;  1U2W A;  1Z7U A;  2NRA C;  1EH6 A;  3HIF A;  1MBG A;  2PG4 A;  2JMW A;  3H5R A;  3BZC A;  4Q48 A;  4YIR X;  1FBQ A;  1GV2 A;  3IWF A;  4W1U A;  2CJJ A;  2VQL A;  1CF7 A;  2PFB A;  1W5S A;  3WTZ A;  3FWE A;  3KP6 A;  1IRX A;  1S7E A;  2HNH A;  4CYC A;  1RUO A;  4JX6 A;  3LST A;  2CO5 A;  1LDK B;  2DO7 A;  1MGT A;  2FUG 2;  4BQO A;  2H27 A;  1IV6 A;  2V6C A;  1QHG A;  3GXO A;  3KYL A;  1O3R A;  3TOA A;  4JOM A;  4MFD A;  1ZHF A;  3PIP F;  4IXA A;  3RQI A;  1Y1V J;  4F55 A;  3HGY A;  1OYW A;  1UJ8 A;  1XCV A;  2W7N A;  3C1D A;  3DPT A;  4IHT A;  4IEJ A;  4P9U A;  1VQM I;  3J7A O;  2R7V A;  2QUF A;  4PFP A;  1WH5 A;  5IP9 J;  1ZRD A;  2XPU A;  3TP0 A;  3QP5 A;  2OAZ A;  2CUE A;  4U7D A;  2MYS A;  1AHD P;  2E2H J;  2BVL A;  5DCM B;  4CYD A;  2E71 A;  3R6S A;  1YHQ I;  2FXA A;  1RET A;  2LY1 A;  4XOP A;  1FOW A;  1BJZ A;  3BC8 A;  2P0W A;  3A4C A;  1J5Y A;  3OS2 A;  1XB4 A;  3M7G A;  3O3K A;  2KIF A;  1BIA A;  4ZDP A;  3K2Z A;  3L2W A;  2A05 A;  3C7J A;  2HTJ A;  2K85 A;  1VQO I;  3JRI A;  1PP7 U;  1X19 A;  2KZV A;  2R7D A;  1ZTR A;  3Q5F A;  2WV0 A;  1BW5 A;  3OR1 C;  5F04 A;  1XSD A;  3SXY A;  2LDU A;  4G7O F;  5M3F J;  2XF7 A;  3AG2 H;  1Z0X A;  5ICC A;  1X1C A;  1O3Q A;  3J7Y J;  3S8P A;  3BPV A;  2XRL A;  3MD2 A;  4NC7 A;  3I54 A;  1XTA A;  1G8X A;  1VQ4 I;  4XNF A;  2HZT A;  3H36 A;  4UUV A;  2VL8 A;  4AIJ A;  3QOE A;  5EEG A;  1SAX A;  2M0C A;  4UUS A;  2JJ7 A;  2XKO A;  3BJ6 A;  3M1E A;  1H88 C;  3BT9 A;  4IRG A;  4OIO F;  4Z2Y A;  1SFO J;  2MD0 A;  2V1D A;  1JGS A;  4LG0 B;  4BHC A;  2BW3 A;  1DPR A;  2CS3 A;  2DYS H;  2L0K A;  3TO9 A;  3VDX A;  5IT9 Z;  3C2G A;  3JW4 A;  2A6E F;  3RYR A;  5C4X J;  2M7B A;  2LMD A;  3S2D J;  1LJ9 A;  5HNF A;  4CCL A;  4G6Q A;  2JUC A;  1MNM C;  1XGO A;  3HSR A;  3LSJ A;  4P9F A;  1ZRE A;  3FXK A;  3AL0 B;  2O3F A;  2EFO A;  2B63 J;  3ELK A;  1BR2 A;  3GW2 A;  3A01 A;  2HGC A;  5FB2 A;  3ZP5 A;  9ANT A;  4PJ0 C;  2E7X A;  4YG2 F;  3QOP A;  1EA3 A;  2OCE A;  4YEJ A;  3JR9 A;  2H8R A;  1BOB A;  2YU9 J;  2NYX A;  5B5E C;  1JKO C;  4NHJ A;  1UHW A;  1A31 A;  2JN6 A;  1W0T A;  1UZC A;  2ZB9 A;  4YFK F;  5LRS A;  5H6Q A;  5DCF A;  3VB2 A;  3ZRG A;  3G6E I;  4IQJ A;  5F0C A;  3H3U A;  3NWT A;  4P1W A;  1P6R A;  2EK5 A;  5J1Y A;  1NG6 A;  1IN4 A;  1Z21 A;  4FE4 A;  4BGD A;  1WCM J;  4E6K G;  3SJM A;  2X85 A;  3FXJ A;  2CV0 A;  2PLY A;  4BNC A;  3N4M A;  1QO0 D;  2ID3 A;  1ZAO A;  1W5T A;  2F48 A;  1LVK A;  2NVT J;  2P8T A;  1JUP A;  5BS6 A;  1X4O A;  3LNQ A;  4IOA F;  3CO7 C;  5D6E A;  5J3L A;  4ZYD A;  5CVR A;  2Y0M A;  5E1Z B;  1WPK A;  3OYD A;  2EA2 A;  3MFK A;  2RDP A;  2G7U A;  4A3E J;  2E1O A;  2WAQ N;  2K3F A;  3F72 A;  4A0Z A;  1U9N A;  4UV9 A;  4Z6Y A;  5GTI C;  3JRC A;  1OCR H;  1U5T B;  3GO5 A;  2JVG A;  4XBF A;  2XAS A;  5ICE A;  2P7V B;  4AVZ A;  1QPI A;  4M72 A;  2R0Q C;  1J59 A;  1S5L C;  2H6C A;  3BTJ A;  1P2F A;  4BJT A;  4M9S A;  2HPI A;  3G3Z A;  2XAH A;  3FK7 A;  4KMU X;  3BOQ A;  2LVS A;  2OJE D;  3ZMS A;  4M6X A;  2RQQ A;  3SHF A;  3BCA A;  4HDV A;  1CF7 B;  1FYL A;  3KZZ A;  1CQT A;  1H8A C;  2BV6 A;  4ZTF A;  1GT0 C;  3EUH C;  5E3O A;  3SDB A;  4KIS A;  4CYC B;  2VJ5 A;  4RAF A;  3A2K A;  1SD6 A;  2BOL A;  1B72 A;  1A6I A;  3GTP J;  3LA7 A;  3GUD A;  2X48 A;  5IYC J;  2KIM A;  2LKX A;  1V5E A;  1IUF A;  2JZY A;  4IL6 C;  2PJR A;  5HVQ C;  3I55 I;  2DMQ A;  3V7C A;  3G73 A;  5J4Y A;  1Q1H A;  5CLS A;  1H0M A;  4DGW B;  1K78 A;  2ICW G;  4G7H F;  3ROU A;  2L7K A;  1IF1 A;  1VQ6 I;  1E3P A;  4QPO A;  2WAF A;  1IRG A;  2XV4 S;  1ENH A;  1B4A A;  2XAJ A;  4PCQ A;  2M4G A;  3NQO A;  2I8D A;  5L3G A;  1YIJ I;  2VKE A;  3N97 A;  3DEW A;  3FK6 A;  1TC3 C;  2DT6 A;  4CZZ A;  1UCR A;  4UVB A;  1IGN A;  2X6W A;  3CES A;  1G3Y A;  5ILU A;  4XON A;  2G0E A;  2F5V A;  4ZZL A;  4ZZD A;  4LIV A;  4HLX A;  2UXN A;  5C44 J;  2E34 A;  3CCR I;  4IHV A;  5E1W A;  3K4N A;  2W25 A;  2XF5 A;  1G3W A;  3GZ5 A;  3CDL A;  3OYK A;  3GTM J;  3CJR B;  4ZDO A;  2F5C A;  1VQK I;  3BDD A;  3BTI A;  3HG9 A;  1MZB A;  4HEA 2;  1HW5 A;  1IN5 A;  2LP0 A;  4HNT A;  2VOO A;  1LDJ A;  1ZN2 A;  4FTH A;  5DM6 F;  3ERE D;  2AXL A;  1HST A;  2MA3 A;  5LRR A;  4C3J J;  5ICG A;  2Y9Y A;  2MC4 A;  3CCM I;  4AYB A;  1Y39 A;  2R5Z A;  3DWL E;  1SD5 A;  2PN6 A;  2JA6 J;  2ZME A;  4RB2 C;  3HTS B;  2X6Y A;  5IT9 K;  3BJA A;  3HB9 A;  1HF0 A;  4UUS B;  3TDZ C;  3VYU B;  3H5N A;  1N78 A;  4CCK A;  3DTK A;  1TNS A;  2DOD A;  5ED4 A;  3HKZ A;  5HLH A;  2L9V A;  2KFD A;  3D5S C;  3GFM A;  1T0F C;  2BXZ A;  4G8X A;  2X51 A;  4B8X A;  3RDI A;  3V7S A;  2BW3 B;  2PEX A;  1Y0N A;  3K7A J;  4ENJ A;  2HOT A;  1R1V A;  2DMN A;  1S6L A;  1YJ9 I;  1ZQ3 P;  1Z67 A;  2RGV A;  2DDA A;  2HDC A;  2Z1D A;  2KJB A;  1D3Y A;  1ZKG A;  2JVH A;  3T8R A;  3LAP A;  3S1R J;  5IYB J;  1EH7 A;  5LFA A;  1OCP A;  1TWF J;  2JQ7 A;  4XKW A;  1R4M B;  1DGW Y;  2PQ8 A;  3L09 A;  3QQA A;  2V6E A;  3GZN B;  3A01 B;  2EFP A;  3MKW B;  1ZEL A;  1MMN A;  2ZNZ A;  3KIO A;  1LB2 A;  4XLE A;  1KZH A;  4R8H A;  3WU0 A;  3K4J A;  4DJA A;  4WXD A;  4DZJ A;  1BI2 A;  4A3J J;  3GTO J;  3GCM A;  2KRC A;  4CZC A;  5FD5 A;  2EIL H;  3J80 Z;  1KA8 A;  4G6D A;  3LSP A;  1Z3X A;  3S3N A;  3HJE A;  4OIP F;  2C6Y A;  2HKX A;  4Y13 A;  2ESN A;  3S3M A;  3KEY A;  1UB9 A;  4G94 A;  3WTY C;  1LE8 B;  1NTC A;  2E7W A;  2Y48 A;  4L0Z B;  3J7Z I;  3HSF A;  4BH9 A;  4JP0 A;  2ZNY A;  1STZ A;  4BE2 A;  4XR6 A;  2HU9 A;  4HX7 A;  3WE2 A;  3T0Y A;  4PDK A;  3DPU A;  1FPQ A;  3I56 I;  3E5X A;  2BY1 A;  3HRM A;  1I5Z A;  4CSW A;  1GUU A;  2F6C A;  1RKT A;  5M5W J;  2A07 F;  2TCT A;  1T8I A;  1ETW A;  2DFE A;  1MBE A;  2OC6 A;  3R0J A;  1MND A;  4I01 A;  1Q1V A;  2TRT A;  2E36 A;  2FJ1 A;  1RIO H;  2LSO A;  4XKV A;  4LLL A;  4ETS A;  5F08 A;  4A6D A;  4ASN A;  1LPQ A;  3QYB A;  1BC8 C;  1P4A A;  4M6Y A;  5D5U B;  5FRN A;  2QQB A;  4MQ9 F;  2R7Q A;  2WB1 A;  4BDZ A;  4A12 A;  3OWT A;  2UZK A;  3JRB A;  3OIQ A;  4JX5 A;  4GYG A;  1QGP A;  4OIQ F;  3M3Y J;  1V54 H;  1QZZ A;  1WJB A;  5D4R A;  2R5Y A;  5LGT A;  3CQZ J;  2FX0 A;  2FE3 A;  2DA6 A;  4LB6 B;  4G9Y A;  1UEL B;  2AXT C;  5JI6 A;  4X6A J;  4LOC A;  4RGS A;  5BQT A;  2P5V A;  3PM1 A;  4M3G A;  4JX4 A;  3FIW A;  5FO5 A;  4B09 A;  1B72 B;  2IA1 A;  5K5R A;  2DPU A;  3FIS A;  4MTD A;  5KK1 A;  3EYI A;  1JXS A;  2HI3 A;  2PJR B;  2VT2 A;  4P55 A;  1YE9 A;  1B59 A;  3AKZ A;  4NNJ A;  3WTS C;  2E35 A;  3AG4 H;  1HKS A;  1SVL A;  3C2B A;  1Z9C A;  2IA2 A;  1K78 B;  2E1M C;  4UHT A;  4WCG A;  3MZH A;  2VC0 A;  1MMG A;  3A1Y A;  3OOU A;  2UV1 A;  3L2V A;  1Z1D A;  4FHT A;  2P6T A;  4BEH A;  2CGP A;  4KFC A;  3CMA I;  4AD9 A;  1WQ2 A;  1QBJ A;  3ZR8 X;  1D0X A;  2V1U A;  2MC3 A;  4S04 A;  2CU7 A;  4AUX A;  2IS4 A;  1BI1 A;  2V9K A;  3EYY A;  3L9F A;  3L1P A;  2MH9 A;  3BR1 A;  5ILV A;  1GVJ A;  1WH7 A;  1WFX A;  1USS A;  4HG2 A;  1T38 A;  4QLC U;  3LSR A;  5HDN A;  2W48 A;  2V1N A;  1P92 A;  3GTK J;  3JSP A;  3H0D A;  3VSL A;  3IP4 B;  3ZQL A;  2ZJ2 A;  2CG4 A;  3IH4 A;  4EJT A;  1BN5 A;  2HVQ A;  1W7P D;  2WC2 A;  5GAG J;  5FRM A;  1O57 A;  2ZXJ A;  4BQQ A;  3K70 C;  3L00 A;  1OYY A;  5FRO A;  3TW6 A;  5E18 F;  1BBY A;  1YW8 A;  5D8L B;  2GAU A;  2HPM A;  1MKM A;  5HOO A;  4PJM A;  3LQR A;  4E7L A;  1R22 A;  2IVM A;  3PL8 A;  3MVP A;  2DA2 A;  3CD6 I;  3HEF A;  4OU0 A;  1OCO H;  3C18 A;  3DF8 A;  4FAS D;  5FLM J;  2CW0 F;  2R5Z B;  3O6B B;  2ZME B;  2GOM A;  4Y33 A;  4QIW N;  1J0R A;  5F64 A;  2E1N A;  1TZL A;  3N05 A;  1OCZ H;  1WI9 A;  3JRF A;  4EM0 B;  2FF4 A;  3FMR A;  2GZW A;  3OYA A;  5H6R A;  5EG0 B;  1FBS A;  5DM7 F;  2LKS A;  3CCU I;  2Z9O A;  4KDP A;  2ID6 A;  1BR1 A;  3BTC A;  1J75 A;  3K4C A;  2CQK A;  3CDI A;  3FDY A;  1S7O A;  1AOY A;  3OL4 A;  3I4M J;  3GTG J;  3I4N J;  4I76 A;  1KYW A;  5FKN A;  2EB7 A;  3RYP A;  4MNU A;  5J47 A;  3O8G A;  3DKW A;  2Q2E A;  2XAF A;  3GVA A;  4YFX F;  5K5Q A;  4D5F A;  1D0Y A;  2CRG A;  5L3C A;  3FBI B;  1XN7 A;  4CH7 A;  3NWS A;  5LEK A;  1E2X A;  2H6B A;  2Q8K A;  2Q0O A;  2L4A A;  3J80 K;  2DOF A;  3B02 A;  1FY7 A;  2ZO4 A;  4EJU A;  2IEK A;  1LEB A;  2P5L C;  1QU3 A;  4IF4 A;  2HVR A;  2DMP A;  1P7I A;  5D6F A;  3QPL A;  3CCE I;  3LWF A;  1FMV A;  2M5W A;  5EDN A;  4NC8 A;  4A5N A;  2MD5 A;  4EJO A;  2J5O A;  4M74 A;  4IJA A;  3OS1 A;  2OTJ I;  5E8I A;  3J81 K;  2QKM B;  3ABL H;  3FX3 A;  2EIM H;  2DFI A;  2VJ4 A;  3A0H C;  1UST A;  4P96 A;  1RKW A;  4BE1 A;  5F0F A;  2EV0 A;  2RNG A;  2YSR A;  2O5R A;  2W84 A;  3G4S I;  5FKM A;  1J2X A;  2ZJQ F;  3TED A;  1ZG3 A;  5JHU A;  3KCC A;  3ESW B;  2LD5 A;  3NAR A;  5CVU A;  2B7E A;  5FD6 A;  1JKP C;  3MCZ A;  1EV7 A;  3WHC A;  4B3A A;  5D8K B;  2XKP A;  2GOX B;  5FJ8 J;  1YLF A;  2V4J C;  2XSJ C;  2EZL A;  1HLV A;  3ZMD A;  1VFC A;  6PAX A;  3TW7 A;  2LH9 A;  2NS0 A;  2VKV A;  1WWX A;  2XGE A;  3H9G A;  1Y0U A;  3U1D A;  3OYM A;  3K70 D;  3QPT A;  1FOY A;  3DU5 A;  1YS6 A;  1U0J A;  2H8W A;  2LK2 A;  2LNB A;  4LD5 A;  4OIN F;  2DAO A;  2EV6 A;  2XRN A;  3K6G A;  3FHZ A;  2R5Y B;  2LC2 A;  1HXD A;  4F3Q A;  4ZYH A;  3D5L A;  1IN8 A;  4MLO A;  4F52 A;  1XDU A;  3ASN H;  2E60 A;  2JUG A;  2QLZ A;  4IQ4 A;  5J1U A;  1LKX A;  2LYC A;  4BJ5 C;  4ZC3 A;  2IXS A;  2LKP A;  3VSK A;  3JTH A;  1UHM A;  4EJV A;  2DK8 A;  3AL0 C;  1ULY A;  1KU3 A;  3CZ6 A;  4J00 A;  5GTH C;  1T98 A;  2RC4 A;  3OIO A;  3MZ8 A;  1ETV A;  3MAJ A;  1SMY F;  1AWC A;  1FNN A;  2XAU A;  3NAU A;  2M87 A;  3RKX A;  2IAI A;  2MG4 A;  5J4V A;  2DPD A;  4GDF A;  4BEH B;  5DV5 A;  1F43 A;  3OYB A;  1GVD A;  4BL0 B;  3KLO A;  4C2M J;  1TT0 A;  1XDS A;  1LNW A;  4OMZ A;  1LDD A;  1XSX A;  1D1A A;  2WTE A;  1WJ5 A;  2LFB A;  2NAZ A;  4BAY A;  5F6F A;  3FM5 A;  4XOT A;  5M5X J;  1CGP A;  2AQE A;  3FXU A;  3RKQ A;  1D1C A;  2FNP A;  4EQQ A;  2MH2 A;  2A6H F;  5FKL A;  2FBK A;  1ZR2 A;  1OJL A;  4BQN A;  3M1C A;  3HOZ J;  1I1G A;  3CCY A;  4RMN A;  3BG5 A;  3OSF A;  4V19 K;  5TJJ A;  3H9J A;  4ZDL A;  2FMY A;  2VJJ A;  1U5T C;  1G3T A;  3GTQ J;  1Z6R A;  2B0L A;  2IGO A;  3H5A A;  3TQN A;  4HQE A;  4IVN A;  3ZQF A;  1QQI A;  2ELK A;  4O3M A;  2E19 A;  2FBH A;  4EVI A;  2WWY A;  1HCR A;  3ABT A;  2GXG A;  1R5I D;  2X6O A;  1YW9 A;  2BE5 F;  3GWZ A;  2PX9 A;  1JTY A;  1ZAR A;  2NVU B;  3HBL A;  3H35 A;  4BY1 J;  2E2I J;  1GV5 A;  4CGZ A;  3U1K A;  3VFZ A;  3GEZ A;  4DBQ A;  2HDD A;  2X4H A;  3I4P A;  1YO5 C;  1EJ9 A;  1ERD A;  1AA7 A;  3U2R A;  1FYM A;  2KDO A;  3KYD B;  3LL7 A;  1OCC H;  2Q2E B;  1XS9 A;  2M7A A;  3DEU A;  2DOA A;  1R5G A;  1YFH A;  5IOZ A;  1AU7 A;  2X1C A;  4O5V A;  4RB1 A;  2O9L A;  3OV8 A;  3QRF F;  4WXC A;  4FET A;  1XX5 A;  2KL4 A;  1FSE A;  1IZ1 A;  3PNY A;  1B8I A;  1S3J A;  1X58 A;  3L2U A;  4E7J A;  2A68 F;  3M8J A;  3F8B A;  4Y3O A;  4W97 A;  4EM1 A;  1H89 C;  5JVT A;  3WE3 A;  2MLG A;  3DP7 A;  1X3W B;  3IL2 A;  1RR8 C;  3IRR A;  4DBR A;  3S32 A;  3BCB A;  4YRV A;  2Y2Z A;  1E17 A;  1FEX A;  1JE8 A;  5FLV A;  2R7W A;  4XRM A;  1FMW A;  2DTR A;  4Y17 A;  2JSC A;  3JAM K;  4XRS G;  4D0P A;  3ZPL A;  3V8L A;  2OA4 A;  3SEQ A;  1ETX A;  4D9J A;  3BG3 A;  3DU6 A;  2H1L A;  2CV2 A;  2JRM A;  1Z3Y A;  2XAG A;  1F5T A;  2BVM A;  1JUM A;  2DJI A;  1G3S A;  3FXQ A;  2V26 A;  3C2H A;  2IBD A;  4TV7 A;  5E3L A;  4YEL A;  4XIC A;  1FSH A;  1O7F A;  5EYR A;  5GPC A;  2COB A;  2DQR A;  4XRS A;  3PUF A;  2M4K A;  1GLN A;  1VZ0 A;  5LGN A;  2OD5 A;  4XSZ F;  2VT3 A;  3OYL A;  2RQP A;  4HLY A;  3S1Q J;  4FIS A;  4U0W A;  1ZR4 A;  2XVC A;  4U0V A;  1YTY A;  2FOK A;  3RTR A;  3I9V 2;  5CPR B;  2LTP A;  1OMI A;  1IDZ A;  2XRO A;  1QVU A;  2HVS A;  1TP4 A;  2FQ3 A;  3GBG A;  5IT3 A;  4M3D A;  1J7K A;  2VJI A;  1PUF A;  3RPQ A;  5GP9 A;  4KJZ A;  5LHG A;  3S17 J;  3ZQQ A;  3HRS A;  3WU1 B;  3CCL I;  1I6H J;  2XF6 A;  3KEQ A;  5FFX A;  2QEX I;  1OPC A;  3CC2 I;  2DA5 A;  3OMY A;  3R4K A;  4II3 A;  1DDN A;  1FP1 D;  4OAY A;  3VOE A;  2M1B A;  1XGS A;  4BU2 A;  5K7Z A;  5BPI A;  2LY9 A;  4A3G J;  3KP3 A;  5EF6 A;  4MEY F;  2CWE A;  3GFI A;  1V55 H;  2BGC A;  2W1O A;  1HOM A;  3V8J A;  2K5C A;  4JK1 X;  3E0J B;  2CW8 A;  3OR2 C;  4I02 A;  2IT0 A;  4IRI A;  3EUH A;  5BNG A;  2Y69 H;  4MTE A;  2JSP A;  2MBF A;  3KLN A;  4LLG F;  2Z3Y A;  1KGS A;  2YUS A;  1EH8 A;  4LGW A;  1DPU A;  2WAD A;  2FML A;  2DQL A;  1FBU A;  4G12 A;  3TO6 A;  2CW7 A;  1S8N A;  1I50 J;  2K9S A;  4B47 A;  2ECC A;  2QQA A;  2L9N A;  1RUN A;  3S3O A;  2G9W A;  2D45 A;  1MSF C;  4UY8 I;  3REO A;  2K7L A;  4UVA A;  2PMU A;  1ONV A;  3DEE A;  4ENN A;  4D7M A;  1HKQ A;  2MGQ A;  1OYI A;  2FQ4 A;  5M5Y J;  2PJP A;  1NH3 A;  5KAF C;  2QBY A;  3KP7 A;  2Z33 A;  2ZXI A;  2QQ9 A;  2K9M A;  4ESB A;  2CYY A;  4AC0 A;  4F7Z A;  1MJA A;  2VN2 A;  3FZV A;  4XLA A;  2QEN A;  4UNO A;  4RDU A;  1VQ8 I;  1WGX A;  4IPA A;  3FHN A;  5GAD J;  3OIP A;  3KP4 A;  3BLY A;  3PFI A;  1BA5 A;  1VQL I;  1HA8 A;  4GYI A;  3F22 A;  3Q3S A;  1XD7 A;  2M0M A;  2MW8 A;  1Z05 A;  2DDB A;  3WTV C;  1OLT A;  2BY2 A;  2QGU A;  5DUK A;  5DYM A;  2HQA A;  3HHH A;  3KZY A;  1L0O C;  4E70 A;  3PSI A;  1E3O C;  4HSR A;  3MWM A;  2WBM A;  2LR8 A;  3Q0W A;  2L7Z A;  2O0Y A;  5EZG A;  2K9N A;  4HBL A;  1JHF A;  1NHA A;  2HQN A;  3PJR A;  3WTU C;  2QSG X;  4EJW A;  3CO6 C;  2OBP A;  3W3C A;  2V9P A;  2LY2 A;  2OQR A;  1PJR A;  3QPH A;  4IHW A;  1MJB A;  1I3A A;  4NB5 A;  3ZXS A;  4AVP A;  1UAA A;  3IH3 A;  1EF4 A;  3HOT A;  1ZRC A;  1SC7 A;  2VUM J;  5IY5 H;  1JT0 A;  2HOA A;  5DS9 A;  4FX4 A;  3DV8 A;  1SFK A;  1B8I B;  3HC7 A;  4RM2 A;  4CA0 A;  4N9H A;  3F8C A;  3KEO A;  1PYV A;  3CP2 A;  3NRV A;  3TOB A;  3KYC B;  1WKM A;  2DBB A;  2HFH A;  3L2C A;  3ECH A;  3OYE A;  2JPB A;  2OUM A;  5GAH J;  2EIN H;  2I10 A;  3HHG A;  1DUX C;  3PO2 J;  1O3S A;  3LSM A;  2A3S A;  2MSY A;  2B9S A;  4D7N A;  1IXC A;  1GHC A;  2KHM A;  2IW5 A;  3K4B A;  4KUM A;  4RGU A;  3AFH A;  1KU7 A;  3IC7 A;  1XMX A;  2XGC A;  4ZJZ A;  4CCN A;  1VQ7 I;  4M3F A;  3HOU J;  4V2G A;  4G6T B;  4PJN A;  2VQH A;  3P9K A;  2W00 A;  1YRN A;  5C4J J;  2IS2 A;  4ZH4 F;  2M34 A;  1RZ4 A;  2NS8 A;  2VXD A;  4UXN A;  2DN0 A;  2STT A;  2BHY A;  2D1V A;  3E6B A;  4Q4Z F;  1QVT A;  3K9T A;  3DLL F;  3BQZ A;  3ZMT A;  4HOB A;  1L3L A;  2KIQ A;  2ZME C;  2EA4 A;  2IP2 A;  1TQM A;  2DTZ A;  2K4J A;  2A6T A;  1TBX A;  4DW6 A;  1QPM A;  1G6N A;  3CCS I;  3OYF A;  2PMZ N;  1BR4 A;  2ME6 A;  3JRA A;  4MGR A;  3F3X A;  1W4M A;  4E7S A;  1R9T J;  1R23 A;  4ABZ A;  4B3X A;  4PSX A;  5HLT A;  2QSH X;  1W5C C;  1MBJ A;  5E20 A;  1SFE A;  2A61 A;  2ZXH A;  4D5C A;  2V7F A;  1PUF B;  3GX4 X;  2XHK A;  5K7F A;  4NQW A;  2TDX A;  2GLO A;  2O8X A;  5JLW A;  2JA7 J;  1KU9 A;  1BC7 C;  5M3M J;  3SZT A;  3BR6 A;  1WZ2 A;  3J81 Z;  2E5N A;  2FRH A;  2XGX A;  4HF1 A;  3HTU A;  2LLK A;  3VEP A;  1P9Q C;  1MD0 A;  2DOE A;  4II2 A;  3BG6 A;  3I64 A;  1GXQ A;  4E7K A;  3GFL A;  3ZQI A;  2WV1 A;  3M07 A;  1FTZ A;  4LG3 A;  4H4K C;  3MKL A;  3UKG A;  4CCJ A;  2F4M B;  2KPM A;  2M3A A;  3BZK A;  1ZGA A;  3DBR B;  2KQR A;  4N4O B;  4CCO A;  3COA C;  1HKT A;  5HS9 A;  4EEF G;  1BI0 A;  4M9X A;  2VXZ A;  3QYF A;  3S16 J;  2ZKZ A;  4DYC A;  2UUZ A;  1H9T A;  3OY9 A;  4N0B A;  4B4C A;  1ZG5 A;  3SZG A;  2HQR A;  4Y7N J;  2VE8 A;  2W82 A;  1N25 A;  2KT0 A;  5CVV A;  3MKZ A;  1BI3 A;  2X9D A;  2KDZ A;  3QU6 A;  4A3F J;  1KQ0 A;  2XUB A;  4XMY A;  2RNJ A;  1IJW C;  2QBY B;  3F9K A;  4BXF A;  2W24 A;  2O8K A;  1TQP A;  2BBY A;  5H20 A;  2IA0 A;  3T5X A;  2XPW A;  3V42 A;  1WJE A;  3K4M A;  1WJC A;  2HKO A;  2W4S A;  3C3W A;  3ERM A;  3I3L A;  3P9C A;  4YIF A;  4ZYG A;  4BXX J;  4RAY A;  1O4X A;  3BPX A;  3EPZ A;  5LGU A;  2HXI A;  1MBF A;  2M8E A;  2V9V A;  2HTS A;  3M8E A;  4AID A;  2Y31 A;  1A35 A;  3E5Q A;  1E0E A;  1FT9 A;  3RI4 A;  3FF5 A;  1Y56 A;  4KT6 A;  1FTT A;  4XID A;  3CDH A;  3M8F A;  2L01 A;  2N8G A;  3SEZ A;  1ETY A;  4Q47 A;  4ZYE A;  4BDY A;  1RRJ A;  1D0Z A;  2RAE A;  2DMU A;  1DU0 A;  2DK5 A;  4GXO A;  4BYY A;  3T1B A;  4PK4 A;  1TWG J;  3U9G A;  2L5Q A;  3L2Q A;  4EGY A;  2R7S A;  1LEA A;  4C2U A;  2QQ8 A;  3EDP A;  3OL3 A;  4A5M A;  1QZY A;  2BY0 A;  2WAE A;  2CSO A;  1K83 J;  1P7J A;  1S72 I;  3I58 A;  3GTJ J;  5FKO A;  2VKD A;  2VBY A;  3ZOB A;  4UB8 C;  4HAM A;  4RLQ A;  4KA4 A;  4G7Z F;  3BG7 A;  5F1R A;  3RJP A;  5GAE J;  5HLI A;  3JRG A;  2DA3 A;  2O7O A;  4BUP A;  3KFW X;  4IHX A;  2L4M A;  5TRD A;  2DYR H;  1QRY A;  4AIH A;  4XSX F;  3ZQC A;  4O6J A;  2ZFU A;  2XAQ A;  1KON A;  2LF7 A;  4Q5S F;  3WG9 A;  4EGZ A;  5BPD A;  3F8M A;  5LHI A;  3BR3 A;  4F92 B;  3G71 I;  1R6R A;  1VQP I;  3OYH A;  2WY8 Q;  4RA2 A;  5DD4 A;  4LFU A;  3TMO A;  3H3Z A;  1FOX A;  4GCV A;  4BKX A;  5J8F A;  5K5O A;  4M3B A;  4IRH A;  4KMF A;  2F5E A;  2A5W A;  1IV8 A;  2EPF A;  1VI0 A;  2FEZ A;  3ABM H;  2CQQ A;  1M1E B;  3E7L A;  1YRN B;  2FSW A;  3GME A;  4QWQ A;  3ULQ B;  3EUK L;  4GO1 A;  1V5G A;  4HA8 A;  4ENK A;  2E5Z A;  3ASO H;  2E1C A;  2MFZ A;  2GM4 A;  3HOW J;  2DFH A;  4NUB A;  3B6A A;  4A3L J;  1OKR A;  5HLG A;  2DA1 A;  4DYR A;  2LOO A;  1I27 A;  2KLO A;  3BP8 A;  1R00 A;  2YS9 A;  2UXX A;  3JSO A;  3V4G A;  1DU6 A;  2D5V A;  3ML6 A;  2O61 A;  4B1R A;  5EEH A;  2IRF G;  3CUO A;  3ZN0 A;  1X4P A;  1TQI A;  4K2E A;  1DP3 A;  3M4O J;  3PIO F;  4IOC F;  1TL8 A;  4XOR A;  2YX7 A;  3BJO A;  2HYJ A;  2L54 A;  2M8G X;  4NQW B;  3PSF A;  3BZ6 A;  3CUQ A;  4PGH A;  2EBI A;  3WGI A;  5KVR A;  3S15 J;  1UFM A;  1ITY A;  5CVI A;  4C3H J;  1X1B A;  2EFW A;  1IW7 F;  4KT5 C;  5IYD J;  4OWR B;  4E7H A;  3O8H A;  2AHQ A;  2D1H A;  3H0G J;  2JTV A;  3JAM Z;  5KCM A;  2Y30 A;  2DCE A;  3H92 A;  5B1B H;  4BJ6 C;  2ZJP F;  3QU3 A;  3KET A;  2EWN A;  3DLA A;  3S93 A;  3W2A A;  2ETH A;  5DD8 A;  3W6J B;  3PNT A;  5DEQ A;  3HPG A;  5KAI C;  1J09 A;  3GF2 A;  1Z7L A;  1T6S A;  4R1H A;  3NEU A;  5HOD A;  4IZZ A;  1JTX A;  5LBQ A;  1TWA J;  3J7A Y;  2QM3 A;  4M6V A;  5LEJ A;  3BR0 A;  3HZJ A;  4M73 A;  1LUJ B;  5F0H A;  5LHH A;  3LFK A;  3I0T A;  5D5V B;  3CCQ I;  2YX4 A;  3E6C C;  1R58 A;  4A3K J;  3CMM A;  5D4S A;  2F5D A;  1IDY A;  5DTD A;  3G1O A;  3TP3 A;  5CQG A;  4HX4 A;  1D5Y A;  3CCJ I;  2KIS A;  4A3M J;  4A6E A;  3AG3 H;  2P6S A;  4MIM A;  2LF8 A;  4QTR A;  2OU2 A;  1ON2 A;  3G1M A;  1HBX G;  4R79 A;  1BOA A;  2QKL B;  3HRU A;  2F4I A;  1U9O A;  3P9I A;  5A2Q Z;  2KIU A;  2X1E A;  4A3D J;  1OR7 A;  4XLH A;  3DKX A;  3PO3 J;  5DUI A;  2IGN A;  1YI2 I;  1T08 B;  1UHS A;  4EV0 A;  3SYT A;  3EET A;  2CUZ A;  4DOZ A;  5IOY A;  1I6X A;  1Z77 A;  1N75 A;  4DIQ A;  3GZ6 A;  3G2B A;  1ETO A;  3R60 A;  1JKQ C;  1IN6 A;  2X0L A;  3GYH X;  2J5P A;  1W0U A;  1IAW A;  4ITV A;  4BAC A;  2R93 J;  2A5Y B;  3HSE A;  2JA5 J;  1DP7 P;  3V7R A;  4L9N A;  5E8G A;  2WAQ A;  1TW3 A;  1PDN C;  4A0Y A;  1P4X A;  1X1D A;  1OQY A;  5ILS A;  3H9Q A;  4A2U A;  3IUO A;  2CUJ A;  4M3E A;  1Y1W J;  4KIG A;  4UB6 C;  4KNY A;  2OF7 A;  5AIQ A;  2XDV A;  3F8N A;  2FU4 A;  3WHB A;  2AS5 F;  4PUS A;  2VQC A;  4A3B J;  3R61 A;  3OOP A;  2CFO A;  3K69 A;  2JK3 A;  2Z2S B;  1Z6T A;  2R7O A;  2KJC A;  1ETQ A;  2EFN A;  3ZCO A;  2GBY A;  2L7F P;  4LLN A;  2EIK H;  4L18 B;  2VBZ A;  2F5F A;  2NVX J;  2W85 A;  2ELJ A;  3RZO J;  3CF5 F;  3O2P E;  4CDG A;  3HOS A;  1G2H A;  2OQG A;  2HEO A;  5BMZ A;  4QSH A;  4L9V A;  1REP C;  3T8T A;  3FXR A;  3WG7 H;  4HNV A;  5JHF A;  4I6Z A;  4XLC A;  3I71 A;  5HS8 A;  1X1P A;  2MLK A;  2VKH A;  1ZH5 A;  3Q0U A;  4WK8 F;  3A02 A;  2COM A;  1FIP A;  4L9T A;  1A6Q A;  2EH3 A;  1SMT A;  4DYQ A;  3OYJ A;  1VF9 A;  2DFF A;  1MJ9 A;  2L9R A;  3VOD A;  2L9S A;  3CC4 I;  3FBN B;  4XN0 A;  2LRE A;  3DTI A;  4A3C J;  3LOC A;  3SQN A;  2LRD A;  3DFG A;  4V2F A;  2EFQ A;  2Y0S N;  1RI7 A;  1RPW A;  2VC1 A;  1XSV A;  1ORK A;  3MN2 A;  4FCY A;  2K9Q A;  4L5I A;  1TWC J;  2GA1 A;  3IH2 A;  3K1N A;  3HOX J;  3L7W A;  2QCO A;  3M9A A;  2WY7 Q;  1ETK A;  5F27 A;  1O3T A;  2VOP A;  1Y8R B;  3VPR A;  1TNT A;  5C3E J;  3D0S A;  2CQX A;  1R1T A;  2L02 A;  5E17 F;  4D1Q A;  1SFU A;  1WHU A;  2R7Z J;  5JFR A;  1IC8 A;  4PFO A;  4J19 A;  3HRT A;  3SDG A;  1JGG A;  3RSN A;  1D5V A;  3DBL B;  2H94 A;  2Z16 A;  4LMY A;  3WOD F;  3D5R C;  1YQA A;  3DBH B;  3B73 A;  1F4K A;  4CO8 A;  3CUQ B;  5FLX Z;  2YR2 A;  1MDM A;  4UUT A;  3LFU A;  1AKH A;  2Z99 A;  3CLO A;  2W57 A;  1E3H A;  2CQ7 A;  2R4G A;  1RR7 A;  4KIC A;  4XQF A;  1XPX A;  5KNL A;  1BM9 A;  2L2O A;  1PUE E;  4BBR J;  3S2H J;  2HYG D;  2NNY A;  1B9M A;  3K10 A;  4IHY A;  2VQG A;  4HX8 A;  4LB5 A;  1A5J A;  4DNC A;  2BY3 A;  3RPU D;  2DA4 A;  3FXM A;  2VB6 A;  2DXI A;  2K3P A;  5CKT A;  5CQE A;  2AQF A;  2EZK A;  3GFJ A;  1XMK A;  4A69 C;  3WU2 C;  3IWZ A;  4C3I J;  3IKT A;  4I0B A;  2M9H A;  4CHU A;  1QZE A;  3F23 A;  1RNL A;  5HS7 A;  2ISY A;  4BXU A;  1R49 A;  3I53 A;  1YIO A;  4IHS A;  1A04 A;  1V5F A;  2RVC A;  5A2Q K;  2HYF A;  1BL0 A;  3UR3 C;  2GXA A;  3GLX A;  2E2J J;  2GXB A;  1SD7 A;  2Y9Z A;  2OPT A;  2OZU A;  1VQ5 I;  5J8C A;  2ELH A;  5HDG A;  4DZP A;  3AAF A;  1C0W A;  1BIB A;  1NG7 A;  1S9H A;  2PMZ A;  3KPH A;  2CV1 A;  1NK3 P;  5L3E A;  1Y8Q B;  3DTE A;  2OV7 A;  3TL4 X;  1V4R A;  1KQ9 A;  4B43 A;  2BEO A;  1LE8 A;  1BJA A;  3QAH A;  1X2M A;  1KYZ A;  4A93 J;  3AG1 H;  3GTL J;  3CCV I;  1MMS A;  4KN4 X;  4N9I A;  4U88 A;  2OZ6 A;  1GDT A;  4XLN F;  1MBH A;  3HPH A;  3I5U A;  2VLA A;  1YS7 A;  4UV8 A;  4A0X A;  2K02 A;  1FJL A;  4BY7 J;  1YYV A;  1IN7 A;  4BBS J;  3KX2 A;  1LVA A;  3LA2 A;  2XB0 X;  4YII A;  5HDK A;  3S2W A;  4NBQ A;  2DW4 A;  2ZBK A;  2HXO A;  3E5U A;  4FX0 A;  2BHZ A;  5EJC A;  3OYI A;  4ENM A;  3FXL A;  3A0B C;  1HC8 A;  3PQK A;  3SFZ A;  4BHB A;  5DDG A;  3LSH A;  4RB3 C;  4L0Y B;  3S14 J;  3P7N A;  5FFZ A;  1UMQ A;  1YX3 A;  4WWC A;  1F1Z A;  4PSW A;  3BR5 A;  1U8B A;  4I2O A;  3I59 A;  4RGX A;  1G4D A;  3HM5 A;  1ZGJ A;  3KP2 A;  4B44 A;  1EKE A;  1IRZ A;  2P81 A;  3EQL F;  3CJQ B;  1SVO A;  1NK2 P;  4XKC A;  2XPV A;  3MZY A;  2FNA A;  3SFI A;  2VOD A;  1UG0 A;  3TO7 A;  2PMH A;  4BQA A;  1A36 A;  1QHH D;  1JI8 A;  4MO7 A;  1IUY A;  2KMU A;  5E3M A;  1R4N B;  3CJT B;  3LA3 A;  2CUF A;  4MFE A;  4XLP F;  1S29 A;  1K7A A;  2GWR A;  3ZQ7 A;  3U21 A;  4RM3 A;  3W2W A;  5EZH A;  3FKJ A;  1YIT I;  1I39 A;  4KYW A;  2VIX A;  5H2F C;  4IX7 A;  4X1E A;  2Z5U A;  2K27 A;  5E1X A;  4XM3 A;  3OYC A;  3F6V A;  3DCF A;  1UG2 A;  2CMP A;  3E6D A;  5CVJ A;  1K6Y A;  4LIU A;  2QWW A;  4LJZ F;  5D5W B;  1WJA A;  3W6K B;  2QVO A;  3VYS B;  1F36 A;  3LSK A;  4X0G A;  2ADU A;  4KN7 X;  4HYE A;  4NC6 A;  4U0Y A;  3JTG A;  1I1S A;  2MAB A;  4RS8 A;  4MQV A;  3K4L A;  5FKK A;  1T0F A;  2YU3 A;  2L3D A;  3LSI A;  1R5H A;  3HOV J;  5B1A H;  1TW2 A;  2BYV E;  3MEX A;  2EJR A;  1P4W A;  4HNU A;  3KE2 A;  2HZD A;  1YW7 A;  3E97 A;  4AIK A;  1TTY A;  5FLX K;  4HST A;  5IP6 A;  1W36 C;  2RRE A;  3JCU C;  5BOX A;  1ZLJ A;  1X3U A;  3BY6 A;  5EGO A;  2ISZ A;  2V79 A;  2Y75 A;  1MH3 A;  4XN3 A;  1IG7 A;  5IPA A;  1MH4 A;  2K40 A;  2VON A;  4C2T A;  3RQ4 A;  4OIR F;  4RB0 A;  1FOK A;  4Y15 A;  1POG A;  4HV5 A;  1MDM B;  2VPR A;  5JVG F;  1AKH B;  1K4S A;  3CMY A;  2D2W A;  2VAS A;  4C9Y A; 
#chains in the Genus database with same CATH homology
 3EUA A;  2WAE A;  2VKD A;  4BEH B;  4ZTJ A;  3ZRG A;  4RLQ A;  4IQJ A;  3BG7 A;  3OYB A;  3DKY A;  4BL0 B;  3NWT A;  4P1W A;  3K4K A;  1D1B A;  4CCM A;  1TT0 A;  4BUP A;  1NG6 A;  4HRI A;  1Z21 A;  2ZFU A;  4KIT B;  1KON A;  4BGD A;  1D1A A;  4P5O A;  1WJ5 A;  2X85 A;  4B48 A;  4E6K G;  2CV0 A;  4RLF A;  1LVK A;  3PUB A;  4F92 B;  1R6R A;  4XOT A;  1X4O A;  3OYH A;  2IS1 A;  2AQE A;  2WY8 Q;  3PNV A;  1D1C A;  3TMO A;  3OYD A;  2KP6 A;  4BE0 A;  2A5W A;  4J01 A;  4BQN A;  3M1C A;  2IS6 A;  4RMN A;  3H9J A;  3EUK L;  4ZDL A;  2VJJ A;  2JVG A;  1V5G A;  4AVZ A;  2E5Z A;  2MFZ A;  3H5A A;  2IGO A;  4U87 A;  4BJT A;  2HPI A;  4NUB A;  4E7I A;  2LOO A;  2KLO A;  2RQQ A;  2R7T A;  3BCA A;  4ZTF A;  3EUH C;  3SDB A;  4KIS A;  2VJ5 A;  3A2K A;  1X4P A;  1DP3 A;  2BOL A;  3L2R A;  3H35 A;  3DPL C;  4DBQ A;  1V5E A;  2PJR A;  1ERD A;  4F91 B;  5HVQ C;  1AA7 A;  4XOR A;  4BS9 A;  2KDO A;  4NQW B;  3LL7 A;  3PSF A;  2Q2E B;  2M7A A;  2DOA A;  4DGW B;  1X1B A;  2L7K A;  2X1C A;  1MMD A;  4ZYA A;  4QPO A;  2WAF A;  1W36 D;  4FET A;  4OWR B;  4E7H A;  2KL4 A;  5KCM A;  2DCE A;  2M4G A;  2I8D A;  4BJ6 C;  3PNY A;  3L2U A;  1WJD A;  2DT6 A;  3DLA A;  3S93 A;  4E7J A;  3W2A A;  4JQF A;  2X6W A;  3DQV C;  3M8J A;  3CES A;  3PNT A;  4Y3O A;  1DGR M;  4XON A;  3HPG A;  4XLF A;  1J09 A;  2F5V A;  1Z7L A;  2R7R A;  4IZZ A;  2DT7 B;  4LIV A;  3J7A Y;  2CH0 A;  1T95 A;  4DBR A;  2IGK A;  3S32 A;  2LBF A;  3BCB A;  4YRV A;  3CMM A;  2X6X A;  1N77 A;  3K4N A;  2R7W A;  1FMW A;  2XF5 A;  3OYK A;  3CJR B;  4ZDO A;  5CQG A;  5HNH A;  3SEQ A;  4D9J A;  3MMY B;  3DU6 A;  2NOJ B;  4C30 A;  2KRH A;  2CV2 A;  1Z3Y A;  3HG9 A;  3ZGK A;  4R79 A;  2BVM A;  4HEA 2;  2QKL B;  3VYR B;  2DJI A;  4HNT A;  2F4I A;  2V26 A;  3C2H A;  4YEL A;  2X1E A;  2MC4 A;  4XLH A;  3DKX A;  4AYB A;  2IGN A;  2M4K A;  1GLN A;  1VZ0 A;  3DWL E;  2X6Y A;  3OYL A;  3SYT A;  3HXL A;  4PJL A;  3VYU B;  2CUZ A;  3H5N A;  4XKB A;  4DOZ A;  1N78 A;  4CCK A;  3DTK A;  3ONQ A;  4XL9 A;  3HKZ A;  1N75 A;  3D5S C;  4LIT A;  3RTR A;  3IAM 2;  1T0F C;  3I9V 2;  3LSG A;  2X51 A;  2WA0 A;  3G2B A;  3LMM A;  5CPR B;  1WJF A;  2BW3 B;  2HVS A;  3QOD A;  4ITV A;  2K9L A;  3GBG A;  3RCO A;  4BAC A;  2VJI A;  4KJZ A;  4ANJ A;  3ZQQ A;  2Z1D A;  2WAQ A;  2JVH A;  2XF6 A;  1X1D A;  3VYT B;  2R7U A;  2Q1Z B;  2LG4 A;  3H9Q A;  2CUJ A;  3IUO A;  5LFA A;  3OMY A;  4XKW A;  1DGW Y;  4II3 A;  2V6E A;  4OAY A;  2XDV A;  3MKW B;  1ZEL A;  4BU2 A;  1MMN A;  5KHD A;  2ZSI B;  4XLE A;  4PUS A;  2VQC A;  3K4J A;  1X1A A;  2W1O A;  4DIQ A;  4DJA A;  2CFO A;  2K5C A;  3E0J B;  2Z2S B;  2CW8 A;  4CZC A;  2KRC A;  2R7O A;  3OR2 C;  4PJJ A;  3ZCO A;  1Z3X A;  5LD2 C;  3QYE A;  3E1S A;  3S3N A;  3VWB A;  2JSP A;  4U7B A;  2VPL A;  2ELJ A;  2R7X A;  2WAD A;  3HOS A;  3S3M A;  3KEY A;  1Y6I A;  2CW7 A;  2IGM A;  5JHF A;  3CF2 A;  4B47 A;  4XLC A;  2JA2 A;  2L9N A;  4BE2 A;  4XR6 A;  2HU9 A;  3S3O A;  2VKH A;  3DPU A;  2Y0S A;  3MKY B;  3OYJ A;  2HDW A;  4CSW A;  3DEE A;  2F6C A;  3OYG A;  2L9S A;  2OC6 A;  1MND A;  3FBN B;  4XN0 A;  2LRE A;  3DTI A;  4XKV A;  2ZXI A;  2K9M A;  3QYB A;  2LRD A;  4XLA A;  5FRN A;  2R7Q A;  2WB1 A;  4BDZ A;  3OWT A;  3FHN A;  3OIP A;  3OIQ A;  1G59 A;  3BLY A;  1DQU A;  1HA8 A;  1WJB A;  3HL2 A;  2WY7 Q;  1LFP A;  2M0M A;  1OLT A;  2HQA A;  3IAS 2;  1UEL B;  5TGT A;  3PSI A;  4HSR A;  2ZSH B;  4D1Q A;  2WBM A;  4PFO A;  4QPQ A;  3RSN A;  4Y4R A;  3PJR A;  2Z16 A;  2PJR B;  2X1D A;  3D5R C;  1YE9 A;  1MW7 A;  3W3C A;  3AKZ A;  2LY2 A;  4NNJ A;  1PJR A;  3LFU A;  2E1M B;  1MNE A;  3ZXS A;  1MMA A;  2E1M C;  2R4G A;  1UAA A;  4XQF A;  4GRI A;  3HOT A;  4F93 B;  5KNL A;  1MMG A;  3A1Y A;  2L2O A;  3OOU A;  2UV1 A;  3HUG B;  3CP8 A;  3L2V A;  4BEH A;  1SAU A;  3K10 A;  1SFK A;  4IKF A;  3HC7 A;  2VQG A;  4RM2 A;  4CA0 A;  4E4H A;  3RPU D;  3ZR8 X;  1D0X A;  2VB6 A;  4EAT A;  2DXI A;  3W2V A;  1PYV A;  2K3P A;  3CP2 A;  2AQF A;  5CKT A;  5CQE A;  2IS4 A;  2V9K A;  4N4N B;  2UWM A;  3OYE A;  2OUM A;  4HG2 A;  1WFX A;  4CUG A;  2LBF B;  2XC7 A;  2V1N A;  3H0D A;  3VSL A;  3IP4 B;  3LSM A;  1YX5 A;  4HPQ A;  1V5F A;  4AU7 A;  2HVQ A;  4E7Z A;  2KHM A;  3K4B A;  3AFH A;  3TBI A;  3UR3 C;  5FRM A;  4ZJZ A;  4CCN A;  4BQQ A;  3K70 C;  4G6T B;  4PJN A;  2VQH A;  5FRO A;  3OS0 A;  4OAZ A;  2W00 A;  2IS2 A;  1NG7 A;  2HPM A;  3PFY A;  1S9H A;  2PMZ A;  4PJM A;  5HOO A;  2CV1 A;  4E7L A;  2VXD A;  3PL8 A;  3DTE A;  2OV7 A;  3TL4 X;  4B43 A;  1OR7 C;  3OYN A;  3UNG C;  4FAS D;  2GOM A;  4Y33 A;  3H5R A;  1TZL A;  3N05 A;  2A6T A;  2VQL A;  3OYF A;  1BR4 A;  3OYA A;  1IRX A;  2HNH A;  3HPH A;  2VLA A;  4E7S A;  1LDK B;  2FUG 2;  4B3X A;  4BQO A;  1BR1 A;  4PSX A;  5HLT A;  1QHG A;  3K4C A;  3KYL A;  3FDY A;  4JOM A;  2ZXH A;  3KX2 A;  3OL4 A;  2V7F A;  4F55 A;  3OYI A;  1D0Y A;  3FBI B;  4CH7 A;  2W7N A;  3NWS A;  3DPT A;  2E5N A;  3LSH A;  2R7V A;  4PFP A;  1YX3 A;  4PSW A;  1P9Q C;  1QU3 A;  2HVR A;  4II2 A;  3BG6 A;  4B44 A;  4E7K A;  2MYS A;  2BVL A;  3CJQ B;  1FMV A;  4NC8 A;  4LG3 A;  4H4K C;  2LY1 A;  4XKC A;  4XOP A;  1UG0 A;  4CCJ A;  3BC8 A;  3OS1 A;  2P0W A;  2KPM A;  1QHH D;  2M3A A;  2QKM B;  3A4C A;  3OS2 A;  1JI8 A;  2KMU A;  4ZDP A;  3L2W A;  2KQR A;  4N4O B;  4CCO A;  2VJ4 A;  2VXZ A;  3QYF A;  1X19 A;  2KZV A;  3U21 A;  4BE1 A;  2RNG A;  4RM3 A;  3W2W A;  2UUZ A;  3FKJ A;  2O5R A;  3OR1 C;  3OY9 A;  2VIX A;  4IX7 A;  3SZG A;  2XF7 A;  4XM3 A;  2W82 A;  3OYC A;  1X1C A;  3MKZ A;  3S8P A;  3MD2 A;  2CMP A;  4XMY A;  4NC7 A;  1K6Y A;  4LIU A;  3F9K A;  4BXF A;  1G8X A;  4XNF A;  1WJA A;  2GOX B;  2V4J C;  2XSJ C;  3VYS B;  3LSK A;  4X0G A;  2VL8 A;  2LH9 A;  3QOE A;  3V42 A;  3H9G A;  1WJE A;  2MAB A;  3K4M A;  3OYM A;  3K70 D;  1WJC A;  2W4S A;  3K4L A;  3DU5 A;  1U0J A;  3I3L A;  3LSI A;  2MD0 A;  3K6G A;  2LC2 A;  2BW3 A;  2CS3 A;  3EPZ A;  4F3Q A;  3VDX A;  4HNU A;  3C2G A;  3D5L A;  2HZD A;  2M7B A;  4MLO A;  4F52 A;  1E0E A;  5HNF A;  4CCL A;  4HST A;  1W36 C;  1Y56 A;  2E60 A;  2JUG A;  2RRE A;  4IQ4 A;  4KT6 A;  1LKX A;  2LYC A;  4BJ5 C;  4ZC3 A;  2IXS A;  3VSK A;  3AL0 B;  3SEZ A;  3AL0 C;  4BDY A;  4XN3 A;  1D0Z A;  3CZ6 A;  4J00 A;  1BR2 A;  4C2T A;  3RQ4 A;  4PK4 A;  2R7S A;  2L5Q A;  3L2Q A;  4YEJ A;  1EA3 A;  4C2U A;  1BOB A;  2VAS A;  4C9Y A;  3OL3 A;  2XAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...