3RSNA

Crystal structure of the n-terminal region of human ash2l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
165
structure length
165
Chain Sequence
ENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2
publication title Crystal structure of the N-terminal region of human Ash2L shows a winged-helix motif involved in DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2760 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3rsnA00
3S32A 3RSNA
chains in the Genus database with same CATH superfamily
1PYVA 4ZDPA 1W0UA 3HRSA 2HOSA 2VJIA 3T8TA 2FMLA 2JRTA 2XRNA 2E1MB 2LF8A 5CQEA 3WTVC 4BAYA 4A69C 2O3FA 1J9IA 3CO7C 1O3RA 3PNYA 1N75A 4UNOA 1Q1HA 1N78A 2FJ1A 4G9YA 3BR1A 2X0LA 3JR9A 5IT9Z 1ETVA 2IA2A 2VIXA 3A02A 3LSPA 2NXNB 4NHJA 2HDDA 3RPUD 1G3YA 4JK1X 3WE2A 2HQ5A 1K83J 4HV5A 5LRRA 3TEDA 3BZKA 5LEJA 3BJOA 2P81A 1I6HJ 3PSFA 4L5EA 4AYBA 4ZJZA 3PL8A 4XQFA 1ONVA 4P9FA 2Z5UA 5GPAA 5J8FA 4NDLA 2PJRA 2ZFUA 5FJ8J 1VQ9I 1VQOI 4OOIA 3FHZA 1IUYA 1STZA 1Z7LA 2Z9OA 1RKTA 3RZOJ 2FXAA 3MZHA 3S3MA 3E5XA 1QU3A 4FHTA 4PGGA 3G3ZA 5LHIA 2R7QA 5B5EC 3F6VA 3I3LA 2DAOA 1WRJA 2DFEA 2NVTJ 2IAIA 1X2MA 4U0WA 5E17F 3BR0A 1LNWA 5IOZA 1ITYA 3K69A 1E2XA 3BZCA 2WV0A 2MA3A 2DW4A 3KP2A 5LBQA 1MBGA 4XSZF 2O0YA 2RGVA 3DBRB 3QPTA 1W5TA 3OMYA 4M74A 2NVUB 2LC2A 3ZMUA 1Z67A 1LDKB 4CYCB 3BQZA 3L2VA 1EF4A 3WODF 3V7CA 3F23A 2BGCA 1HQCA 2L9VA 2EIJH 2LRDA 4L9NA 4IZZA 1GV5A 4KITB 5E8GA 1I3AA 3VEPA 1HDDC 4G7HF 4HA8A 2DQRA 1GHCA 2MABA 3BTIA 2ELJA 3M8FA 3BPXA 3CCRI 5GAGJ 3CP8A 1R4NB 1MSEC 1JTXA 5ILVA 4IEJA 1TWAJ 1FX7A 2XROA 4A3MJ 3BR5A 2H8WA 3TKYA 4MQVA 2BXZA 4FASD 1SMYF 2EB7A 2KLOA 2CMPA 2EA2A 3G1OA 5CVVA 3DPTA 1TBXA 4DZPA 4Y52J 1GXQA 1IRFA 4BUPA 4RAYA 2WWYA 4B43A 3ABLH 3L2RA 5BPIA 3E6MA 1KONA 5LRSA 3BTJA 3VSKA 2EFNA 3KZZA 2D2WA 1HXDA 2L7KA 4IVNA 4RGRA 4MQ9F 3S15J 3PM1A 5TISC 2JPBA 2HGCA 4XLFA 4BYYA 4Q5SF 1B9NA 2H1LA 3NQOA 2K9LA 4M72A 5IP7J 2DFIA 2XSDC 2BW3B 4MIMA 1A36A 2DDAA 3HOSA 3WG7H 4B47A 1QBJA 1BC7C 1RUOA 3O8HA 3Q0VA 1S9HA 3RQIA 2BE5F 2E1OA 2E71A 3CUOA 3FK6A 1PUEE 3HKZN 3WU1B 1GXPA 1R6RA 1LJ9A 4ON0A 2E35A 4JBAA 3S8PA 2HYJA 4L9TA 3IRQA 3FZVA 1RKWA 5KHDA 2AO9A 1IDZA 3G2BA 1GT0C 1T39A 5KAIC 2BXYA 1TNSA 4M3FA 2BV6A 2OBPA 3LFKA 2DYSH 2F48A 2OZUA 4XLHA 2JUCA 4A6DA 1W7PA 3R0AA 3HOZJ 3DV8A 5K7ZA 1MDMA 1U9OA 4HZFA 4MTEA 2H94A 4UUVA 2E7WA 4WK8F 4LB6B 5KVRA 2WAQA 4GGGA 4RLFA 1XGSA 3M1EA 1MIJA 4A3FJ 3HEFA 5HLGA 2O8XA 1U3EM 4X0GA 3CCQI 3RDIA 3S32A 2IBDA 2E19A 3WU0A 3BG9A 2QEXI 1MNMC 5JI6A 1IAWA 4LMYA 1QHHD 2IJLA 2DA5A 1ORKA 2PMZN 1LFPA 1WJDA 1KQ9A 2OPTA 3HYIA 2P7CB 1S8NA 4F93B 1C0WA 5CVJA 1ZG3A 3CJQB 1KZHA 3SZGA 1P92A 2VXZA 2DXIA 3FXUA 3HTSB 2CUEA 3L09A 3OR1C 1KYWA 3ZCOA 2MG4A 3VSLA 5DDGA 2Y0SN 4GXOA 1T2KA 4FETA 3WU2C 3AL0B 5H6QA 1MMSA 1JE8A 1MD0A 4II2A 2CG4A 2W82A 3C2HA 3OYAA 1ZRCA 2EA4A 3VYRB 3O2PE 4E7JA 2X4HA 3VOEA 4I0BA 3ZQHA 1TQPA 2Y0MA 3ECHA 4A3LJ 2HVQA 1RPWA 3HSRA 2M4GA 3OIPA 2GM4A 3ERED 4Y13A 3IV5A 3IWZA 4J01A 3SFIA 3OS1A 1TTYA 1TWFJ 2Y48A 5E1ZB 3GO5A 3IH2A 2ICWG 2XIGA 4OAYA 1JJ6C 3H9QA 2X6OA 4CCJA 3D5RC 1BI1A 3FDYA 1YW8A 3RKQA 3FXOA 2CQQA 3PFIA 1W5SA 3IP4B 2IGNA 4U88A 4J00A 1D1CA 3IH3A 5LGNA 1RC9A 1SD5A 3P9IA 3WHCA 1G4DA 3WGHA 1J59A 3BG7A 4BGDA 3GW2A 4RA2A 2M87A 2LVSA 4UV9A 5CVRA 4NC6A 3ZQLA 5EGOB 2V7FA 3OV8A 4CH7A 4BY1J 5J6XA 3GFMA 5FROA 3S3OA 1HW2A 1W36C 4XL9A 1U5TB 2QGUA 3ROUA 2LMDA 2EILH 4RBOA 4NUBA 4PFOA 3E5UA 4I0AA 3MFKA 2BY2A 2L7FP 4QTRA 2LY2A 2ECBA 5F1JA 4RGUA 2P0WA 3ULQB 2XAFA 4BU2A 4XICA 2XUBA 2GXGA 3PUFA 4KIBA 2F4IA 2ELHA 4F55A 1XSXA 1AKHB 2WY8Q 3DTEA 2NS7A 3H0GJ 1JKRC 3F0CA 4PJMA 4KT6A 4ESBA 3SQNA 2XAHA 3FXJA 2EFPA 2PEXA 2VC1A 1S6LA 1A35A 2VOPA 2FRHA 4MHGA 3MKLA 4QIWN 5L3GA 1WHUA 3H36A 4KN4X 4PJNA 1WJCA 1WWXA 1MBJA 4ITVA 4O6JA 4OMYA 2OC6A 5DCMA 1T33A 1MMAA 5J4VA 1OJLA 4AVZA 4CXFA 2JA2A 2KPMA 2EWNA 2FNAA 2JK3A 3H3UA 3CJRB 4ZZLA 4WX9A 1D1AA 1QO0D 1T98A 4XKCA 3TOBA 3I0TA 2W24A 3ABUA 4C2TA 4NBQA 2QKMB 5GTHC 4A93J 3J81K 2WB1A 4AIDA 5D6EA 3BOQA 2O6GE 3GX4X 2C6YA 2XPVA 2Y75A 3KLOA 4FQGA 5D4RA 2OUMA 3BTLA 3HOXJ 4L9JA 4LG0B 4FX0A 4HPQA 1R00A 1BR2A 5HODA 4BE2A 1RIOH 3HOYJ 2XKOA 5FLMJ 2LBFB 2ZJQF 3CQZJ 4ZYEA 3S1RJ 4H0EA 3F22A 4IXAA 1A04A 5H20A 4LD5A 2A5WA 2DPUA 3GMEA 2HXIA 1IN4A 2YU3A 3J81Z 4YIRX 1SVMA 2A61A 2DLLA 4XK4A 4BS9A 3WTXC 2W00A 5DM6F 4XR6A 3HOVJ 5LGUA 1X2NA 3K2ZA 1YFHA 1QZEA 2ZC2A 1OCPA 2ZXIA 1MBKA 1P4AA 4DGWB 2KHMA 2E7XA 2XF7A 2XF5A 1BW6A 2XGXA 2XB5A 1YX3A 1BR1A 1BR4A 1OCTC 1SFEA 2QZ8A 1I1GA 4EVIA 2QENA 4IJAA 1D1BA 1P9QC 3LOCA 4KMUX 3CCLI 2D45A 4CA0A 4ENMA 2KP6A 3BTCA 2P6TA 2XAGA 4RB1A 1X3WB 2UXNA 2P6SA 2EV0A 1Z9CA 1WJEA 1ERDA 1ZR2A 5J1UA 3VDXA 2H6BA 4L0ZB 5HOOA 2JMWA 1BOBA 2Z2SB 3FKIJ 3OR2C 4U0VA 3H0DA 3J7AY 2CGPA 3K70D 3QP6A 2LY9A 2R7VA 5ED4A 1HKTA 1DU0A 3I53A 3BROA 4FCYA 2W48A 1SD6A 1LFBA 2DOEA 2OD5A 4UVAA 4BEHA 3OSFA 2RQQA 5EG0B 5D5VB 4HNVA 2QVOA 1YJNI 2ISZA 1W0TA 2ZXHA 3DEWA 1MJAA 1HCRA 3SJMA 3J80K 2E1MC 4KICA 2GA1A 4OINF 1F36A 1LKXA 1SD7A 3OYGA 2EZHA 4HBLA 4XRFA 3S93A 2HVSA 2R5ZA 2ZCWA 3ZMDA 2X1DA 2VJ4A 5GAHJ 5D5WB 2DA1A 1QVUA 1WQ2A 2BY3A 5EEGA 1XMAA 3BY6A 3H1CA 3I55I 3PNVA 2DMQA 2V9VA 3CDHA 1XX5A 3GFJA 3V8LA 3D5SC 2KISA 1V5FA 5EYRA 4A0ZA 5HDKA 5F0CA 4E70A 4HNUA 4CZCA 3J80Z 5FFZA 1I39A 1ZGAA 4RLQA 4HX8A 2IXSA 1O7FA 5F1RA 1WPKA 4AYBN 4CDGA 1ZG1A 2BW3A 2K4JA 3N4MA 2KFDA 1MBFA 1QPMA 2CFOA 4AVPA 4HNTA 1JUMA 5BS6A 2LYCA 2JVHA 4A3EJ 2K40A 4UB8C 2V6CA 1W7PB 4IRGA 1X3ZB 1TC3C 4IHTA 1MDMB 2DK5A 3DPUA 2A07F 3TP0A 2E2JJ 2CH0A 1EV7A 3P7NA 3M8EA 1XCVA 4M9XA 1D0ZA 2L02A 1TWCJ 1G2HA 5BNGA 1W5CC 3KX2A 3CF2A 4G12A 2DK8A 3TW7A 3KIOA 1B9MA 5K7HA 1MNEA 3ABKH 4F92B 4CCNA 5DUKA 3ZQIA 2AXTC 1DQUA 1ZELA 4XKBA 2QF7A 3KETA 4XOPA 2GBYA 4A3KJ 3H92A 3JRGA 5FRNA 1DPUA 1V5GA 4EJTA 4P96A 5B1AH 3EUAA 2J5OA 1AU7A 3G1MA 2AQFA 1Z7UA 4E7HA 4IQ4A 1NTCA 1P7IA 3BC8A 3JTHA 2TRTA 5IYBJ 1VQMI 1TQIA 4GO1A 3BR3A 3LFUA 2WADA 3OL3A 4KJZA 2R7SA 1BI2A 1S7OA 1OQYA 1ACIA 2VT2A 2KIQA 5FFXA 3HTUA 5JVTA 1ZREA 1ETQA 2YUSA 4CSWA 3WG9A 4OU0A 3GTPJ 1IDYA 4B1RA 3C1DA 1L3LA 2JA8J 1OKRA 3U1KA 3K2AA 4IX7A 2E1NA 2LH9A 3HZJA 1VQ4I 1K4TA 3NRVA 4KIGA 2XKPA 5KCMA 2V4JC 2UXXA 3V42A 3HC7A 4C2MJ 3OS0A 3F9KA 3L00A 1WCMJ 3FK7A 5H2FC 5GPCA 2Y2ZA 2ZXWH 5AIPA 1MMGA 2F6CA 2JQ7A 2L9RA 1XD7A 3ISPA 2EBIA 4HEA2 4N4NB 3KEOA 4LIVA 5F04A 4DQ2A 3OYCA 3E7LA 1K79A 1XPXA 3MEXA 1XDSA 3CJNA 3FXMA 4CCKA 1BIAA 3K7AJ 1IGNA 2VBZA 2JPCA 4GRIA 4IQJA 2XRLA 4MO7A 4BNCA 9ANTA 1LUJB 1POGA 2KT0A 5EEHA 2Q2EA 1R1UA 4MEYF 3L2CA 2CRGA 3QYEA 2O61A 4HYEA 4AIHA 3L2QA 2ECCA 1XGNA 2DFHA 1T08B 3HOUJ 1GVDA 1RESA 3A2KA 2A69F 1I50J 1S3JA 2DDBA 1D5YA 1P2FA 3JAMK 1LB2A 1LDJA 5IYCJ 2WAEA 1YITI 1ZARA 1JHHA 1ZR4A 3FF5A 2BBYA 1YS6A 2R7WA 4AIKA 3CMMA 2NVXJ 4S05A 3GUDA 5ICGA 2CS3A 3RYPA 2R92J 2J5PA 2ZJRF 4AM3A 4KMFA 1EH6A 2GAUA 1IF1A 5AIQA 2WAQN 2HKOA 1MH3A 2Y9YA 2EFQA 5DTDA 2M4KA 1IV6A 3JAMZ 4XORA 3FMQA 2DOAA 2DU9A 4KUMA 1G6NA 4I99C 4EJUA 1J75A 2JZYA 1KA8A 5JHUA 3R6SA 1AKHA 3DFGA 3CD6I 1REPC 4RAFA 4M3BA 1TZLA 4C9YA 4XRSA 2LDUA 3AKZA 4UXNA 5DCMB 1TLHB 4KYWA 2MBFA 3I71A 3OYBA 3RPUA 2JA5J 3KZYA 1UZCA 2NRAC 2HEOA 1J0RA 1FSHA 2NNYA 4GCVA 3DBLB 3ESWB 1X1CA 2LTPA 1Q1VA 3QPHA 5DM7F 2QWWA 5LGTA 3QPSA 3K1NA 5FKNA 2DMUA 3DEEA 2AS5F 2K3FA 3EETA 3I5UA 3GZ6A 3AL0C 2HYGD 5E1WA 3V8KA 2LY1A 4E7KA 1VQNI 5IP9J 3F3XA 3OWTA 4IPAA 3HOTA 2B63J 4AIJA 5GTIC 3RSNA 2BHZA 3E6BA 2FQ3A 5E3MA 3FXQA 3H9GA 1B8IA 2R7XA 3JRCA 4V2GA 1FBQA 4QSHA 4DYCA 3M07A 2LFBA 4LG0A 4D1QA 1BN5A 4AU7A 2IA1A 1IN6A 2YU9J 2LBFA 4XSXF 4CCMA 1ETYA 2I5UA 4ZYDA 2BYVE 1B59A 1YE9A 2XF6A 5GADJ 2YX4A 1RETA 4B3XA 2VLAA 3CCVI 1RR8C 3OY9A 1WGXA 4BL0B 2VASA 3OS2A 3BR2A 3TDZC 5HS8A 1PVEA 1XGOA 3UR3C 1K6OA 2IGKA 3GWZA 4YELA 2D1HA 1V4RA 3RYRA 3BT9A 1USTA 4N9HA 5FKMA 2EFWA 2DCEA 2VN2A 2V1UA 4IKFA 3KP5A 3CJTB 1W1WE 1VI0A 3ASNH 5K5OA 3H5AA 2WTEA 1MBHA 1D0YA 3ZR8X 4JX6A 3TBIA 5JR3A 2B0LA 3IUOA 1VQKI 1FP2A 3TP3A 3I59B 1U5TC 2VODA 5D5XB 4XLNF 3QYFA 4XONA 4M3EA 4XLEA 4C3IJ 2MFZA 1MKMA 3AG1H 4ESJA 3BP8A 5BMZA 4EM1A 2XASA 3DXJF 4I6ZA 3W6JB 1IC8A 3FBIB 1YQAA 1E17A 5FRMA 3T5XA 1SVOA 4OWRB 3H5NA 4BEHB 5C4JJ 4Z2YA 3A1YA 3BQYA 3KP7A 4ZYHA 3RZDJ 1XB4A 3CO6C 2WA0A 4BXUA 5E18F 2K9NA 4TV7A 2R5ZB 3LSRA 2HFHA 3WHBA 1UAAA 4PZJA 3W2VA 2RDPA 2H27A 5CVIA 3M9AA 3H9JA 5FGMA 5D6FA 3H35A 2UUZA 2NOJB 2RV8A 3PFYA 3TO7A 1JTYA 2P7VB 5EG0A 1HC8A 1CQTA 3S1QJ 2R7ZJ 3AFHA 5HDNA 1OYWA 3AG4H 3FBNB 3K4LA 2GQQA 5ICEA 2EPFA 1RUNA 4XBFA 3MKYB 1I5ZA 1Z3XA 5DUIA 2PX9A 2M9HA 3KP4A 3SDGA 1PP8F 4Z6YA 4N9IA 1TQMA 2F5EA 3FISA 2A6TA 3D5LA 2DYRH 1B72A 3K0LA 2B7EA 1WFXA 4Q4ZF 2HI3A 2OAZA 5LLQA 3GF2A 5KNLA 2WB1N 3ZP5A 1DU6A 1FIPA 5HLIA 4F91B 1XSDA 4OIPF 1EKEA 1Z0XA 5FD6A 3OSGA 1R5HA 3DPLC 3M1CA 3VYTB 3QWLA 1KU2A 1NK3P 3QAHA 1ETWA 3FIWA 3HG9A 3WTSC 1D8KA 4V2FA 1O4XA 3EDPA 3C3WA 1DGRM 2HXOA 3X2QH 4PJ0C 3F8CA 5H6RA 2KIFA 2M34A 5J1RA 4KDPA 4WCGA 2L4MA 2HQAA 4HG2A 2QCOA 4YFNF 1X19A 2NAZA 1O3SA 3Q0UA 2EV6A 4M73A 4BJ6C 4BQNA 2F4MB 3LWFA 4QLCU 1R22A 1V54H 2OU2A 4WF2A 3I4NJ 2Z33A 3DEUA 3S14J 4A0XA 2LK2A 2X6WA 1VFCA 4WXCA 3RJPA 5FB2A 3K10A 1P6RA 1ETXA 1P4WA 3HL2A 1IG7A 4U7DA 2D1VA 4L9VA 1QA6A 1R4MB 2IGMA 3GBGA 2KRHA 3IKTA 1ZN2A 3GYHX 2F5VA 2IS4A 2X85A 3ASOH 4RDUA 2X1EA 3I58A 1R9TJ 3SZTA 3CDLA 3E6CC 1JT6A 2Q1ZB 3D0SA 2ZB9A 3QU6A 1WI9A 4L0YB 5M3FJ 1T38A 5K7FA 2DJNA 1IUFA 2FOWA 1UHSA 4U87A 1I6XA 1UCRA 5IYDJ 1U78A 5IPAA 2KZVA 2CW0F 2V1NA 4XLPF 3FXLA 3OIQA 3OYJA 4WXDA 2KJCA 1A6QA 2PG4A 2K9MA 3K4MA 1ETKA 3K4KA 3KP3A 5M5XJ 1ZRDA 4I09A 4EJWA 1WSUA 4IHYA 3B6CA 3ONQA 1FBSA 2DI3A 2VQLA 2MC3A 3KP6A 1FMVA 5A2QK 3ZQGA 2V6EA 5BQTA 3HOWJ 1TWHJ 3I4PA 1R23A 1WJ5A 2IGOA 2K86A 2P5KA 1BIBA 2FSWA 5K1YA 4ZH4F 3S2HJ 3NAUA 4AD9A 3IWFA 2G7UA 1HDPA 1ZLJA 1JGSA 2LOOA 2MLGA 2Q2EB 1IXSB 5A2QZ 1BA5A 3DWLE 3JRBA 2A6HF 3PIPF 4CZZA 2A3SA 2L5QA 2PI0A 1V55H 3Q5FA 5JHFA 2ZSIB 1ZK8A 3FMSA 3CUQB 2L7MP 5LFAA 2HDWA 2R7OA 3V4GA 1FNNA 2ZSHB 3FXRA 3CF5F 4ESFA 4LFUA 4BQOA 1IZ1A 1T0FA 3HSFA 5HS9A 2VKDA 2OZ6A 4ENNA 2HPMA 3D1NI 4PSWA 2E2HJ 1APLC 2L9NA 2O03A 1YW9A 1YX5A 2CW8A 1DPRA 3BLYA 4RAGA 3ZMVA 2JRMA 3BJAA 2PLYA 2HZTA 2DO7A 1SAXA 4BKXA 4G7ZF 4EV0A 1SVLA 4DZJA 4HDUA 2DT7B 4EEFG 3ZOBA 1VQ6I 1Z77A 4II3A 3IAS2 2QQ9A 4PJLA 2ACJA 4OIOF 4V19K 4ZC3A 1ENHA 4YIIA 5L3FA 2CUJA 4BDZA 1MZBA 1H9GA 3K9TA 3JRHA 4BE0A 3F21A 1R5GA 4B3AA 3JSPA 1K7AA 2OQGA 3IAM2 3R60A 4NC8A 2M8EA 2Z3YA 3FMRA 1UFMA 3JCUC 2L9SA 1WH7A 5FKOA 5L3BA 4RAZA 1NH3A 2CV1A 3QP5A 2AQEA 1J09A 4P9UA 2JSPA 1AWCA 1YS7A 3OOUA 1OCCH 3FKJA 1Z05A 3DLAA 1B8IB 1D8JA 2Z16A 2VC0A 3CC7I 4ZZDA 2DMTA 2M2EA 2HPIA 1SFUA 1IW7F 5D8LB 4D9JA 2R5YA 1H88C 2MD0A 2VBXA 4JYKA 4ENKA 4CICA 2RREA 5EZGA 1MMDA 1X3UA 4F7ZA 1MJ9A 1LQ1A 4QPOA 1GDTA 2CU7A 4M6VA 1XC5A 3ML6A 3EUHA 4A3GJ 1P4XA 2MGQA 3KYCB 2DA4A 4HSTA 2DJIA 1OMIA 4ZDOA 2NNNA 1OLTA 3MZ8A 1FP1D 2NVYJ 2HS5A 3U2RA 3HUGB 5EDNA 4OAZA 4O3MA 4G8XA 1L0OC 1IV8A 5B3SH 1Z6RA 1U6GA 1YRNB 2P8TA 3N05A 1T0FC 1VF9A 5BPDA 3AAFA 1OR7A 2PN6A 3K4JA 1EH7A 3J7YJ 1H9TA 2VL8A 5FKKA 3SZPA 2LD5A 4HRIA 2JVGA 2L01A 3MN2A 1VQLI 2CUZA 3LSGA 3OYDA 5ICFA 5CJ9A 4MGRA 1UHWA 1VQ5I 3I64A 1Z91A 4A3JJ 1MSFC 4BBRJ 2PFBA 3I59A 3ZRGA 2CQXA 1Y56A 2R0QC 4BQAA 4N4OB 1LDDA 4ASNA 1RZ4A 3PQJA 4IRIA 4YEJA 4X6AJ 2H8RA 1BC8C 2FNPA 4U0YA 2RVCA 3OIOA 3R4KA 1JJ8C 1ZQ3P 1Y8RB 2L2OA 2IPQX 3AG2H 4RGXA 5HDGA 3QOEA 4NC7A 1QVTA 2E34A 1YTYA 5M5WJ 3ERMA 2R93J 3GCMA 4A0YA 1PUFB 1FC3A 2WV1A 1Z6TA 1WI3A 4ZTJA 3L1PA 2MC4A 1YO5C 2IVMA 1X1DA 2OJED 3ELKA 4HF1A 2VQHA 2BOLA 2HU9A 2IW5A 2ME0A 2HYFA 2YX7A 1JXSA 1LVAA 3QQAA 4DYQA 3C7JA 2FX0A 3A03A 1J5YA 1XGMA 1FIAA 3T8RA 3LSKA 1LFUP 1B72B 3RCOA 3N97A 3G6EI 2GXBA 3PSIA 1QHGA 5E3NA 3ZMSA 3DU6A 2OQRA 1SFXA 4G6QA 4QPQA 1ZRFA 1ZKGA 3FXKA 1O3QA 2HOAA 1I3QJ 2K9SA 2JJ7A 3LL7A 3P9CA 4P5OA 5D8KB 1SAUA 3F72A 5M3MJ 4XN3A 1VTNC 4GFBA 2HOTA 2FU4A 4E7LA 3BG6A 3GXOA 5EEAA 2QSGX 5CLSA 4UUSA 3EUHC 2QYOA 3GEZA 1VQ7I 3EYYA 5JLWA 2F4OB 2LNBA 1E3HA 2VKVA 1LEAA 3AG3H 1GLNA 1S7EA 4HSRA 2NOGA 2CYYA 3PNTA 2JN6A 2VE8A 1FJLA 3CCUI 5TGTA 2XAJA 3HHHA 2XV4S 1NHAA 1OR7C 2L3DA 4FTHA 2ZJ2A 1A5JA 1HSJA 2RC4A 4A2UA 1EJ9A 3U21A 3VB2A 2B9SA 2DA2A 2XGEA 3CCYA 1MH4A 3LAJA 5IT3A 1A6IA 4H4KC 1FZPB 5L3DA 3KPHA 2MD5A 4XN0A 1FBUA 1K61A 2G9WA 3LA2A 1TWGJ 1XCBA 2OV7A 4PGHA 2KQRA 3OYLA 1KQ0A 5ICCA 2MYSA 6PAXA 4XNFA 1OCRH 1YLFA 2YSRA 2Y31A 2BEOA 1O7LA 3A0HC 4C3JJ 4RB3C 2QSFX 3L7WA 1R58A 5B66C 5J47A 1VNDA 4I76A 1O3TA 2R7UA 3K4CA 3SYTA 2ISYA 5IY5H 2CO5A 3LMMA 4MLOA 3A01B 1EA3A 3MAJA 3R61A 4EJVA 4UVCA 1FYMA 1WJFA 2KIMA 1RI7A 1PP7U 3UNGC 3BWGA 4D5CA 3F6OA 5KK1A 2WC2A 3O8GA 3SDBA 4J19A 2LKXA 1GUUA 3GZ5A 1NG6A 3KYLA 2P4WA 1U8RA 1BJAA 4E7SA 2XPWA 3ABMH 1Z21A 1SEUA 3HPHA 3S17J 2E5ZA 2RKHA 4BQQA 2DTRA 5TRDA 3H3ZA 3G73A 3CC2I 3HXLA 1XSVA 4W97A 2XDVA 1X4PA 2CSOA 2LREA 2QBYB 1VQ8I 2RNGA 4HOBA 1N77A 4A12A 5J40A 3S2DJ 3O6BB 5EF6A 5CYVA 2YPRA 1HW1A 5HNHA 2LG4A 4HLYA 2DOFA 1BOAA 3IHUA 2EFOA 2QA4I 4GDFA 4P55A 2TDXA 2PJPA 3PO3J 5C4XJ 3LSTA 2LF7A 2EZKA 3CUQA 2RAEA 5FD5A 2CQNA 4EGZA 1MNDA 4HLXA 2K3PA 2LR8A 2KDOA 2QKLB 4JP0A 1BM9A 5GAEJ 1GVJA 5FO5A 1AA7A 2HOEA 4NQWB 2L54A 4F3QA 1YIJI 2W25A 3SHFA 4I02A 3V7RA 4FISA 1R1TA 2OF7A 1BL0A 2R7TA 3TDUC 3E6DA 2ZFWA 3I9V2 5BOXA 2FBKA 4S0HB 2KJBA 3LSHA 3S2WA 2ESNA 5K5QA 1X1PA 3LSMA 3CMYA 1FPQA 1WKMA 3O3KA 1KGSA 5LEKA 1T56A 1IXRC 3OYHA 1JI8A 5D5UB 5GP9A 1TW3A 2FF4A 1ZLKA 3GTLJ 3DCFA 4E7ZA 2DBBA 1T8IA 3K1MA 4K2EA 1DP7P 3FWEA 4HX7A 5HLHA 2JSCA 5JFRA 5LHHA 1RR7A 3HGGA 5FLVA 4M6YA 1R7JA 5LHGA 3JRAA 4DBQA 4JQFA 3C2GA 1BBYA 3K1PA 4KIFA 4M3DA 3NWTA 2H1KA 2EIKH 1JKQC 2F5CA 4FE4A 3GTKJ 2GWRA 4EM0B 2R5YB 2O5RA 3T0YA 3HRTA 3CZ6A 4EQQA 5DS9A 1T95A 1ZHFA 2XVCA 2XPUA 2CW7A 3CCSI 1J2XA 3F8NA 2VPLA 1ZAOA 1JUPA 3F8FA 1U9NA 4LIUA 1IRGA 3I54A 4ZDLA 4MTDA 3GTOJ 4D7MA 2HTSA 3HRUA 4BBSJ 1R1VA 4R79A 2A5YB 1K6YA 4MNUA 1SANA 1IN8A 5J3LA 4YFKF 2KDZA 4B4CA 1OYIA 2XSJC 3I4MJ 1XMXA 1IN5A 4BHBA 4FX4A 1Y39A 1P7JA 4M71A 3S1NJ 1FOKA 1JKPC 1VQPI 4HF2A 3VPRA 4DBRA 1HW5A 2BZTA 4DIQA 4W1UA 4BDYA 2R3SA 1D3YA 4EM2A 3ABTA 3M7GA 2FUG2 3T1BA 1ON1A 5F64A 1D0XA 1IO2A 3P5JA 4WXHA 5ERIA 2GIVA 3BG3A 1GV2A 1VZ0A 4IOCF 2FQ4A 4LLNA 2XC7A 1U8BA 3CUQC 2HKXA 3HUGA 1G3TA 3KFWX 2BHYA 3KEYA 2XGDA 3JTGA 4MFDA 2MH9A 1Z3YA 3JRFA 3BCAA 4FE7A 1YRNA 2K27A 5IP6A 4LITA 1AHDP 4RB0A 1B6AA 4PCQA 5DD8A 2KZGA 1YYVA 4RGSA 3HB9A 5JVGF 2QQ8A 1FTTA 1ZGJA 4ANJA 1R71A 4R8HA 1OISA 1WJBA 1LE8B 1X4OA 1KU9A 1ZYRF 2VT3A 3RIRA 2IS6A 2DA7A 3IKVA 1JUSA 1WJAA 4UV8A 4M3GA 3G4SI 4BACA 5LD2C 3H3VK 4IF4A 2EQRA 3GLLA 2DA3A 5EJCA 1OFCX 2QQBA 4EMSA 3MWMA 1RRJA 4I2OA 1UMQA 1K4SA 3DP7A 2KRCA 3QODA 1I27A 2XAUA 3Q0WA 3HHGA 2OTLI 2FD5A 2I10A 2HZDA 1DUXC 1R36A 3MVPA 4HV6A 3ZPLA 4LOCA 3ZMTA 2F5DA 2QSHX 3VWBA 1ODDA 3MMYB 3OOPA 1H0MA 4KT5C 1PUFA 2HVRA 2GLOA 1FLIA 4CHUA 2STTA 3WTUC 2FBIA 3E5QA 3U1DA 1Y1VJ 2K4BA 4CCLA 1KU3A 1IRZA 3W3CA 1H8AC 2A68F 3QRFF 3HM5A 3KYDB 2W7NA 3WTTC 3KE2A 2YR2A 3NEUA 1MW7A 3CESA 2LKPA 1Y0NA 1E0EA 1S5LC 1FTZA 2PMUA 5L3EA 3TGNA 3C2BA 3TOAA 4UUSB 5D4SA 4ZYAA 3GTJJ 4O5VA 4AWXB 3WE3A 1FSEA 3HGYA 3TO6A 3FM5A 2HQRA 3Q9SA 5FKLA 3OYNA 3M4OJ 4A3DJ 2BVMA 2H6CA 4Y3OA 3BDDA 2W57A 2TCTA 2A05A 3DU5A 5L3CA 3DF8A 2ADUA 2IP2A 3Q3SA 2M5WA 3HIFA 4ETSA 3DQVC 3LQRA 3WTYC 4HX4A 2HDCA 5DV5A 3E3VA 4B8XA 2IS2A 1MGTA 1TT5B 2V1DA 4IHWA 2VKHA 1FWZA 4LGWA 3LAPA 3KCCA 4Q47A 1IRXA 2ZKZA 4IHSA 4JOMA 2EZIA 4ZYGA 1G59A 1B4AA 3IRRA 2AHQA 4YG2F 1MJBA 1UJ8A 4IHXA 1HLVA 1QGPA 4L5IA 2K9QA 4DNCA 1CF7A 4G7OF 3PUBA 1UB9A 4R1HA 1O57A 1BI3A 2K85A 2G0EA 4BXXJ 2W1OA 2W84A 2ZMEB 4UHTA 2EZLA 3F8BA 5CVUA 1XTAA 2BY1A 2EIMH 1W7PD 1LVKA 2KRFA 1YW7A 3SXYA 3DBHB 1W36D 5J4YA 4M9ZA 3HRMA 2R7RA 3HDDA 4JX5A 2L7ZA 3RQ4A 4IOAF 1RNLA 3OYFA 1B1BA 2QQAA 1FT9A 1QNTA 2WBMA 4XMYA 4ENJA 1YIOA 4Y17A 4RM3A 1G3WA 1R49A 3A01A 4IHVA 2Q8KA 3S1MJ 1W4MA 2JUGA 4UY8I 2E1CA 1I1SA 1BI0A 4BY7J 1IXCA 1H89C 4XRSG 1QZYA 1X58A 1CGPA 4XM3A 1HF0A 2VOOA 5M5YJ 1DP3A 1SMTA 2FMYA 3SEQA 5ILUA 3PQKA 2STWA 2EH3A 5DEQA 3I56I 5J8CA 2DA6A 3L2WA 4DW6A 3ZQFA 2DMPA 5K5RA 3FHNA 2O9LA 2O8KA 3EQLF 3MKZA 4EGYA 1R5ID 2VXDA 2L0KA 3RKYA 1TNTA 2QBYA 1JHFA 5J1YA 2FBHA 3DKYA 4M6XA 3MKWB 2DQLA 5JLXA 1TP4A 1XN7A 3CC4I 1FOWA 2MSYA 4LLLA 1HA8A 3E0JB 3OYIA 3EPZA 2R4GA 3DLLF 4A5MA 2CUFA 4BHCA 2KIUA 3GFIA 3B6AA 3PIOF 3A0BC 4NB5A 2P5VA 1EH8A 2M30A 1F9NA 3JREA 1XS9A 1F43A 2P5LC 4L18B 3C18A 5DYMA 3UKGA 2VB6A 3BPVA 2A6EF 3CTAA 3HSEA 3WGIA 2DPDA 4I98B 4S04A 3HJEA 2X6YA 4RM2A 3V7SA 3ZGKA 3M3YJ 2GOXB 1J7KA 4I01A 4D7NA 5DD4A 2GZWA 2L4AA 3RPQA 2V9PA 4QWQA 2GA2A 2XAQA 2O7OA 4KFCA 1ZG5A 4NQWA 1K78B 2VUMJ 5FLXK 1Y1WJ 4GYIA 2MH2A 2N8GA 3KZIC 4Y7NJ 1TT0A 4Q48A 3L2UA 2DODA 4C3HJ 1OYYA 1WH5A 5HLTA 2FOKA 1HSTA 1S29A 3IH4A 2CV0A 1G3SA 4M9SA 3FX3A 5CPRB 1ZGWA 3OYMA 2BY0A 2IT0A 2M0CA 3ZMZA 2PQ8A 2YS9A 5ILSA 4D0PA 5FLXZ 2F2EA 2KL4A 3BR6A 1G8XA 4C30A 2FE3A 1Y0UA 2LLKA 2WY7Q 4B48A 4DOZA 1NG7A 4XKWA 4CO8A 3REOA 3A4CA 4B44A 1V5EA 2K02A 2FEZA 2OA4A 2X9DA 4C2UA 4A3CJ 3K4BA 1FYLA 3B73A 2LSOA 3GTMJ 2MW8A 3IC7A 1AOYA 2IA0A 1X1AA 4A6EA 2G7HA 3LSIA 4PJJA 3TQNA 2RNJA 4ABZA 4OIRF 4EATA 2NYXA 4NNJA 2EK5A 4Y33A 3V8JA 1ZTRA 3BJ6A 3ECOA 2E5NA 3ZQCA 2CFXA 2Z99A 4XOTA 2X48A 4E6KG 2RQPA 3CLOA 5F0HA 5F27A 2X51A 4XKVA 4CUGA 1DDNA 2PJRB 1FOXA 1MBEA 3IL2A 3CDIA 4XLAA 2CQKA 1F1ZA 3LQQA 4JX4A 1N25A 3P9KA 2EV5A 2PBIA 2Y30A 1E3OC 1D5VA 3HKZA 1OCOH 4Y4RA 3CMAI 2ETHA 3RTRA 2GXAA 2JWTA 2ID3A 2ZNYA 3VYUB 2H09A 2M7BA 1SFKA 3LA3A 2COBA 2E2IJ 4LK1F 3TMOA 3PJRA 1HKQA 5F08A 3CMEI 4HQMA 2VBWA 4L5JA 2QM3A 5E3LA 4CCOA 2HNHA 3LA7A 1QQIA 2UZKA 3HBLA 3OYKA 2QLZA 4DJAA 1A31A 4IRHA 2QUFA 4RS8A 1JKOC 2EJRA 4XRMA 3TO9A 1IJWC 4IL6C 5HS7A 1FYKA 2M45A 1LE8A 4P1WA 2K7LA 2PMZA 2M8GX 2X1CA 2HTJA 1YG2A 4ZTFA 2ZO4A 4N0BA 4KN7X 2XHKA 2UV1A 3NWSA 4PK4A 3WTZA 3KEQA 2DN0A 1YHQI 3E1SA 2GIZA 4CYCA 4U7BA 1DGWY 1QZZA 3S3NA 3CP2A 2I8DA 4YFXF 3G71I 2M3AA 4UUTA 3TW6A 3DTIA 3F8MA 4XIDA 3DTKA 4GYGA 2Y0SA 4G94A 2RN7A 2VJ5A 5HNFA 3LSJA 3L9FA 5IOYA 4UVBA 1Z1DA 1QPIA 1FEXA 4EJOA 1FMWA 2E36A 3ZQQA 3G1LA 2D5VA 4KA4A 1IN7A 2JTVA 1U2WA 1PDNC 3B02A 2HWVA 2NVQJ 4LJZF 5CQGA 1OCZH 3SFZA 1S72I 2CV2A 2W4SA 1M1EB 2HR3A 3TL4X 3GTQJ 2M1BA 2DMNA 2BVLA 1HKSA 1YI2I 4CYDA 5F0FA 2VQGA 4RB2C 4FT8A 3S16J 4E4HA 4A5NA 5CKTA 4UB6C 1S7AA 3JW4A 3ZN0A 1LPQA 3DKXA 1YJ9I 3ZQ7A 5E8IA 4OIQF 3OYEA 5EZHA 1OPCA 4A3IJ 2FA5A 2GOMA 3BG5A 1XDUA 3GFLA 3W2WA 2V79A 2VBYA 1JT0A 3R0JA 3KLNA 2Y69H 4AUXA 4Y15A 2ZBKA 2COMA 1Y6IA 4AC0A 1UG2A 3RI4A 3QYBA 2LKSA 3MQ0A 3JRDA 4E7IA 2WAFA 1KQ8A 2ME6A 3J7ZI 2PMHA 3JRIA 3K70C 5C3EJ 3BZ6A 1CF7B 5TJJA 4LLGF 1F5TA 2ELKA 3GZNB 2AXLA 4HF0A 2VPRA 2KKOA 4G6TB 3DKWA 1SFOJ 4PSXA 3QU3A 3ZXSA 1KYZA 1NK2P 2OTJI 1BJZA 2IEKA 4F52A 4OMZA 1UG0A 2DT6A 1XMKA 1HBXG 2R7FA 2XB0X 3MCZA 2OCCH 1YOVB 3QOPA 3Q9VA 5B1BH 1U0JA 4LB5A 2ZMEA 3FM3A 2CJJA 3PO2J 3EUKL 1SD4A 2V26A 1WVRA 3COAC 1UHMA 3WGGA 3VYSB 1Y8QB 3GVAA 1FOYA 2ZNZA 3CLQA 3JSOA 3NARA 4HAMA 4HDVA 3MD2A 4MFEA 2EINH 4WWCA 1PJRA 3H5RA 3CCEI 4D5FA 2OCEA 1USSA 1ON2A 2ID6A 4BE1A 4MEXF 4A3BJ 2XGCA 1LEBA 4I7HA 2VKEA 3OL4A 3U9GA 2IRFG 3QPLA 3ZN1A 3CCMI 1TW2A 2VI6A 2ESHA 1X1BA 4LK0F 2VQCA 4IO9F 4HQEA 3K4NA 1SC7A 2UWMA 5HVQC 2IS1A 2DTZA 5E1XA 2LP0A 4PUSA 5E3OA 3GTGJ 1E3PA 3RKXA 1ULYA 1JGGA 4DYRA 4RMNA 3SEZA 3VODA 2NS8A 4BHPA 2Z1DA 2M7AA 2X6XA 2KMUA 1YJWI 3E97A 4CGZA 1MMNA 4BH9A 5F6FA 5E79C 3BCBA 4BXFA 2R7DA 4YIFA 4YRVA 3K6GA 4G6DA 2VJJA 2ZJPF 2JA7J 3VFZA 1XG1A 3LNQA 2E60A 2K5CA 2CWEA 3M8JA 4BJ5C 2V9KA 1QRYA 2DFFA 4BJTA 4KISA 3WTWC 2CQ7A 5DCFA 2VE9A 1K78A 2JT1A 4X1EA 2VONA 3J7AO 4PDKA 1ETOA 5EGOA 1T6SA 4KNYA 3HPGA 5KAFC 4PFPA 2JA6J 1U5TA 2HQNA 4XLCA 1UELB 3W6KB 5C44J 3W2AA 2ZXJA 1ZH5A 1KU7A 3MZYA 1BW5A 2Q0OA 1F4KA 1FY7A 1V3FA 2V1XA 3CCJI 3EYIA 2DT5A 2F5FA 2MLKA 2M0MA 1WZ2A 1HOMA 2W85A 3W6VA 3GLXA 2NS0A 2ZMEC 5E20A 4B09A 5IT9K 2Y9ZA 1TL8A 5AONA 4HW0A 4LG3A 3RKWA
chains in the Genus database with same CATH topology
1PYVA 2LYCA 2JVHA 4ZDPA 3IAM2 4NC8A 2VJIA 2L9SA 3DPUA 3DQVC 2E1MB 5CQEA 2IS2A 2CH0A 2VKHA 3PNYA 1N75A 1D0ZA 2CV1A 2AQEA 1J09A 1N78A 2JSPA 1IRXA 4JOMA 3OOUA 3KX2A 3CF2A 3FKJA 3DLAA 1G59A 2Z16A 2VIXA 1MNEA 4F92B 4CCNA 3RPUD 2HPIA 4D9JA 1DQUA 1ZELA 2MD0A 4XKBA 3PUBA 4XOPA 2RREA 3PSFA 4AYBA 1MMDA 4ZJZA 3PL8A 4XQFA 5FRNA 1V5GA 4QPOA 2W1OA 2PJRA 3EUAA 2ZFUA 2AQFA 1LVKA 4E7HA 4IQ4A 1W36D 3BC8A 2R7RA 3RQ4A 4HSTA 1Z7LA 2DJIA 3OYFA 4ZDOA 1OLTA 2WBMA 4XMYA 3S3MA 1QU3A 3HUGB 4OAZA 2R7QA 3LFUA 4RM3A 2WADA 3OL3A 4KJZA 3I3LA 2R7SA 2JUGA 3N05A 1T0FC 3K4JA 4CSWA 4XM3A 2VL8A 4HRIA 1DP3A 2JVGA 3SEQA 4IX7A 2LH9A 2CUZA 3LSGA 3OYDA 3V42A 5KCMA 2V4JC 3L2WA 3HC7A 3OS0A 3F9KA 3OMYA 3FHNA 3MKZA 2LC2A 1LDKB 3ZRGA 1MMGA 2F6CA 2VXDA 1Y56A 3L2VA 4HEA2 4N4OB 3DKYA 2LRDA 4N4NB 4LIVA 3OYCA 4IZZA 3MKWB 4KITB 4YEJA 1HA8A 3E0JB 3OYIA 3EPZA 2R4GA 4CCKA 4GRIA 2L2OA 4IQJA 2MABA 2ELJA 3QOEA 4NC7A 3CP8A 3QYEA 4ZTJA 2VB6A 4FASD 2MC4A 3L2QA 2KLOA 2CMPA 1X1DA 3A2KA 2VQHA 3DPTA 2HU9A 2BOLA 2X6YA 4RM2A 3ZGKA 2GOXB 4BUPA 2WAEA 4B43A 3LSKA 2R7WA 3RCOA 3L2RA 3CMMA 1KONA 3PSIA 1QHGA 3VSKA 2CS3A 3DU6A 1TT0A 2L7KA 4QPQA 3L2UA 5HLTA 3LL7A 4P5OA 1SAUA 2CV0A 4XN3A 4XLFA 2M4KA 4E7LA 2K9LA 3BG6A 5CPRB 4XORA 2BW3B 3OYMA 2DOAA 3EUHC 3HOSA 4B47A 2KL4A 1G8XA 1S9HA 4C30A 1TZLA 4C9YA 3AKZA 3OYBA 2WY7Q 4B48A 4DOZA 1NG7A 1GLNA 1R6RA 4XKWA 3S8PA 4HSRA 3A4CA 3PNTA 4B44A 5KHDA 1V5EA 4C2UA 1X1CA 3G2BA 5TGTA 3K4BA 1OR7C 3DEEA 4XLHA 3U21A 1X1AA 3AL0C 3LSIA 4PJJA 4EATA 4NNJA 4Y33A 2LY1A 4E7KA 2WAQA 3OWTA 3HOTA 4RLFA 4H4KC 2E5NA 3RSNA 4XOTA 4XN0A 4E6KG 4X0GA 3H9GA 3S32A 2OV7A 2X51A 4XKVA 4CUGA 2KQRA 3OYLA 2R7XA 2PJRB 2MYSA 4XNFA 1QHHD 4XLAA 4D1QA 1LFPA 1WJDA 4AU7A 4F93B 2LBFA 3HKZA 3CJQB 4Y4RA 4CCMA 3SZGA 2R7UA 1YE9A 2XF6A 3K4CA 2VXZA 3SYTA 2DXIA 3LMMA 3RTRA 4MLOA 4B3XA 2VLAA 3OR1C 1EA3A 3VYUB 3OY9A 2M7BA 4BL0B 1SFKA 2VASA 1WJFA 3ZCOA 3VSLA 3OS2A 3TMOA 3UNGC 3PJRA 3UR3C 3SDBA 4FETA 3AL0B 2IGKA 1NG6A 3KYLA 4YELA 2DCEA 4E7SA 4CCOA 1Z21A 4II2A 4IKFA 3HPHA 2HNHA 2W82A 2E5ZA 4BQQA 3C2HA 3OYAA 3H5AA 3ZR8X 1D0YA 3OYKA 4E7JA 4DJAA 3TBIA 3HXLA 3IUOA 2XDVA 1X4PA 2HVQA 3QYFA 4XONA 2M4GA 2LREA 3OIPA 4XLEA 2MFZA 4P1WA 2PMZA 2RNGA 4J01A 1N77A 2X1CA 4ZTFA 3FBIB 3OS1A 2UV1A 5FRMA 3NWSA 4PK4A 4OWRB 4OAYA 3H5NA 5HNHA 2LG4A 3E1SA 3H9QA 4BEHB 4U7BA 4CCJA 1DGWY 3A1YA 3D5RC 3S3NA 3CP2A 2I8DA 3FDYA 2M3AA 3DTIA 3DTKA 2WA0A 2Y0SA 3IP4B 2IGNA 4J00A 1D1CA 2VJ5A 5HNFA 1UAAA 3W2VA 1MNDA 2K3PA 1FMWA 3ZQQA 3H9JA 3BG7A 2KDOA 2QKLB 3H35A 4BGDA 2UUZA 2NOJB 3PFYA 1AA7A 4NQWB 2V7FA 4CH7A 3AFHA 4F3QA 3K4LA 3FBNB 5CQGA 5FROA 3S3OA 1W36C 2CV2A 4XL9A 2W4SA 3MKYB 2R7TA 3TL4X 1Z3XA 3I9V2 4NUBA 4PFOA 3LSHA 2BVLA 2A6TA 3D5LA 2VQGA 2LY2A 4E4HA 1WFXA 5CKTA 3LSMA 2P0WA 4BU2A 5KNLA 4F91B 3OYHA 3DKXA 1JI8A 2F4IA 4F55A 2WY8Q 3DTEA 3OYEA 4E7ZA 3VYTB 3DPLC 3M1CA 4PJMA 4KT6A 2GOMA 3HG9A 3W2WA 1DGRM 4DBQA 4JQFA 1Y6IA 3C2GA 2HQAA 4PJNA 4HG2A 1WJCA 3QYBA 3NWTA 4ITVA 1X19A 2OC6A 4E7IA 1MMAA 4BJ6C 2WAFA 4BQNA 4AVZA 2O5RA 2JA2A 2KPMA 3K70C 3CZ6A 3CJRB 1T95A 2CW7A 2VPLA 1D1AA 4XKCA 4LIUA 4C2TA 4G6TB 4ZDLA 2QKMB 2X6WA 4PSXA 3ZXSA 2WB1A 3K10A 4R79A 1K6YA 3HL2A 2OUMA 4F52A 1UG0A 2DT6A 2XSJC 4HPQA 4BE2A 1BR2A 3GBGA 2IGMA 2KRHA 2LBFB 2F5VA 2IS4A 2X85A 4DBRA 2X1EA 4DIQA 4BDYA 1U0JA 2Q1ZB 2FUG2 2A5WA 1D0XA 3EUKL 2V26A 1VZ0A 4BS9A 2W00A 4U87A 3VYSB 2XC7A 4XR6A 2KZVA 2V1NA 3KEYA 3OIQA 3OYJA 2ZXIA 3MD2A 1Z3YA 2KHMA 4DGWB 3BCAA 3K4MA 2K9MA 3K4KA 2XF7A 2XF5A 4LITA 1PJRA 3H5RA 3ONQA 1YX3A 1BR1A 1BR4A 2VQLA 4BE1A 1FMVA 2V6EA 3OL4A 1D1BA 1P9QC 4ANJA 1WJ5A 2IGOA 1WJBA 1X4OA 2IS6A 1WJAA 4CA0A 4BACA 5LD2C 2KP6A 1X1BA 2VQCA 1WJEA 3K4NA 2UWMA 2LOOA 5HVQC 2IS1A 1ERDA 3VDXA 2KRCA 2Q2EB 3QODA 3DWLE 4PUSA 2XAUA 5HOOA 1BOBA 2Z2SB 3OR2C 2L5QA 3H0DA 2HZDA 5JHFA 3J7AY 2ZSIB 3K70D 4RMNA 2R7VA 3SEZA 5LFAA 2HDWA 2R7OA 3VWBA 2Z1DA 2M7AA 2X6XA 2KMUA 2ZSHB 1MMNA 3MMYB 4BQOA 4BEHA 2RQQA 3BCBA 4BXFA 4YRVA 2HVRA 3K6GA 2VJJA 2ZXHA 2VKDA 2HPMA 2E1MC 1LKXA 4PSWA 3OYGA 2E60A 2K5CA 3S93A 2HVSA 3M8JA 2X1DA 2L9NA 4BJ5C 4CCLA 2VJ4A 1YX5A 2CW8A 3W3CA 2V9KA 3BLYA 2W7NA 4BJTA 4KISA 3PNVA 1MW7A 3CESA 1E0EA 4ZYAA 2DT7B 3HPGA 3D5SC 1V5FA 4PFPA 4XLCA 1UELB 4HNUA 4II3A 4CZCA 3IAS2 3W2AA 4PJLA 4RLQA 2IXSA 4ZC3A 3OYNA 2BW3A 2M0MA 2BVMA 2CUJA 4Y3OA 4BDZA 3DU5A 4BE0A 2CFOA 4LG3A 4HNTA 3VYRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S32 A;  3RSN A; 
#chains in the Genus database with same CATH topology
 1PYV A;  4ZDP A;  1W0U A;  3HRS A;  2HOS A;  2VJI A;  3T8T A;  2FML A;  2JRT A;  2XRN A;  2E1M B;  2LF8 A;  5CQE A;  3WTV C;  4BAY A;  4A69 C;  2O3F A;  1J9I A;  3CO7 C;  1O3R A;  3PNY A;  1N75 A;  4UNO A;  1Q1H A;  1N78 A;  2FJ1 A;  4G9Y A;  3BR1 A;  2X0L A;  3JR9 A;  5IT9 Z;  1ETV A;  2IA2 A;  2VIX A;  3A02 A;  3LSP A;  2NXN B;  4NHJ A;  2HDD A;  3RPU D;  1G3Y A;  4JK1 X;  3WE2 A;  2HQ5 A;  1K83 J;  4HV5 A;  5LRR A;  3TED A;  3BZK A;  5LEJ A;  3BJO A;  2P81 A;  1I6H J;  3PSF A;  4L5E A;  4AYB A;  4ZJZ A;  3PL8 A;  4XQF A;  1ONV A;  4P9F A;  2Z5U A;  5GPA A;  5J8F A;  4NDL A;  2PJR A;  2ZFU A;  5FJ8 J;  1VQ9 I;  1VQO I;  4OOI A;  3FHZ A;  1IUY A;  1STZ A;  1Z7L A;  2Z9O A;  1RKT A;  3RZO J;  2FXA A;  3MZH A;  3S3M A;  3E5X A;  1QU3 A;  4FHT A;  4PGG A;  3G3Z A;  5LHI A;  2R7Q A;  5B5E C;  3F6V A;  3I3L A;  2DAO A;  1WRJ A;  2DFE A;  2NVT J;  2IAI A;  1X2M A;  4U0W A;  5E17 F;  3BR0 A;  1LNW A;  5IOZ A;  1ITY A;  3K69 A;  1E2X A;  3BZC A;  2WV0 A;  2MA3 A;  2DW4 A;  3KP2 A;  5LBQ A;  1MBG A;  4XSZ F;  2O0Y A;  2RGV A;  3DBR B;  3QPT A;  1W5T A;  3OMY A;  4M74 A;  2NVU B;  2LC2 A;  3ZMU A;  1Z67 A;  1LDK B;  4CYC B;  3BQZ A;  3L2V A;  1EF4 A;  3WOD F;  3V7C A;  3F23 A;  2BGC A;  1HQC A;  2L9V A;  2EIJ H;  2LRD A;  4L9N A;  4IZZ A;  1GV5 A;  4KIT B;  5E8G A;  1I3A A;  3VEP A;  1HDD C;  4G7H F;  4HA8 A;  2DQR A;  1GHC A;  2MAB A;  3BTI A;  2ELJ A;  3M8F A;  3BPX A;  3CCR I;  5GAG J;  3CP8 A;  1R4N B;  1MSE C;  1JTX A;  5ILV A;  4IEJ A;  1TWA J;  1FX7 A;  2XRO A;  4A3M J;  3BR5 A;  2H8W A;  3TKY A;  4MQV A;  2BXZ A;  4FAS D;  1SMY F;  2EB7 A;  2KLO A;  2CMP A;  2EA2 A;  3G1O A;  5CVV A;  3DPT A;  1TBX A;  4DZP A;  4Y52 J;  1GXQ A;  1IRF A;  4BUP A;  4RAY A;  2WWY A;  4B43 A;  3ABL H;  3L2R A;  5BPI A;  3E6M A;  1KON A;  5LRS A;  3BTJ A;  3VSK A;  2EFN A;  3KZZ A;  2D2W A;  1HXD A;  2L7K A;  4IVN A;  4RGR A;  4MQ9 F;  3S15 J;  3PM1 A;  5TIS C;  2JPB A;  2HGC A;  4XLF A;  4BYY A;  4Q5S F;  1B9N A;  2H1L A;  3NQO A;  2K9L A;  4M72 A;  5IP7 J;  2DFI A;  2XSD C;  2BW3 B;  4MIM A;  1A36 A;  2DDA A;  3HOS A;  3WG7 H;  4B47 A;  1QBJ A;  1BC7 C;  1RUO A;  3O8H A;  3Q0V A;  1S9H A;  3RQI A;  2BE5 F;  2E1O A;  2E71 A;  3CUO A;  3FK6 A;  1PUE E;  3HKZ N;  3WU1 B;  1GXP A;  1R6R A;  1LJ9 A;  4ON0 A;  2E35 A;  4JBA A;  3S8P A;  2HYJ A;  4L9T A;  3IRQ A;  3FZV A;  1RKW A;  5KHD A;  2AO9 A;  1IDZ A;  3G2B A;  1GT0 C;  1T39 A;  5KAI C;  2BXY A;  1TNS A;  4M3F A;  2BV6 A;  2OBP A;  3LFK A;  2DYS H;  2F48 A;  2OZU A;  4XLH A;  2JUC A;  4A6D A;  1W7P A;  3R0A A;  3HOZ J;  3DV8 A;  5K7Z A;  1MDM A;  1U9O A;  4HZF A;  4MTE A;  2H94 A;  4UUV A;  2E7W A;  4WK8 F;  4LB6 B;  5KVR A;  2WAQ A;  4GGG A;  4RLF A;  1XGS A;  3M1E A;  1MIJ A;  4A3F J;  3HEF A;  5HLG A;  2O8X A;  1U3E M;  4X0G A;  3CCQ I;  3RDI A;  3S32 A;  2IBD A;  2E19 A;  3WU0 A;  3BG9 A;  2QEX I;  1MNM C;  5JI6 A;  1IAW A;  4LMY A;  1QHH D;  2IJL A;  2DA5 A;  1ORK A;  2PMZ N;  1LFP A;  1WJD A;  1KQ9 A;  2OPT A;  3HYI A;  2P7C B;  1S8N A;  4F93 B;  1C0W A;  5CVJ A;  1ZG3 A;  3CJQ B;  1KZH A;  3SZG A;  1P92 A;  2VXZ A;  2DXI A;  3FXU A;  3HTS B;  2CUE A;  3L09 A;  3OR1 C;  1KYW A;  3ZCO A;  2MG4 A;  3VSL A;  5DDG A;  2Y0S N;  4GXO A;  1T2K A;  4FET A;  3WU2 C;  3AL0 B;  5H6Q A;  1MMS A;  1JE8 A;  1MD0 A;  4II2 A;  2CG4 A;  2W82 A;  3C2H A;  3OYA A;  1ZRC A;  2EA4 A;  3VYR B;  3O2P E;  4E7J A;  2X4H A;  3VOE A;  4I0B A;  3ZQH A;  1TQP A;  2Y0M A;  3ECH A;  4A3L J;  2HVQ A;  1RPW A;  3HSR A;  2M4G A;  3OIP A;  2GM4 A;  3ERE D;  4Y13 A;  3IV5 A;  3IWZ A;  4J01 A;  3SFI A;  3OS1 A;  1TTY A;  1TWF J;  2Y48 A;  5E1Z B;  3GO5 A;  3IH2 A;  2ICW G;  2XIG A;  4OAY A;  1JJ6 C;  3H9Q A;  2X6O A;  4CCJ A;  3D5R C;  1BI1 A;  3FDY A;  1YW8 A;  3RKQ A;  3FXO A;  2CQQ A;  3PFI A;  1W5S A;  3IP4 B;  2IGN A;  4U88 A;  4J00 A;  1D1C A;  3IH3 A;  5LGN A;  1RC9 A;  1SD5 A;  3P9I A;  3WHC A;  1G4D A;  3WGH A;  1J59 A;  3BG7 A;  4BGD A;  3GW2 A;  4RA2 A;  2M87 A;  2LVS A;  4UV9 A;  5CVR A;  4NC6 A;  3ZQL A;  5EGO B;  2V7F A;  3OV8 A;  4CH7 A;  4BY1 J;  5J6X A;  3GFM A;  5FRO A;  3S3O A;  1HW2 A;  1W36 C;  4XL9 A;  1U5T B;  2QGU A;  3ROU A;  2LMD A;  2EIL H;  4RBO A;  4NUB A;  4PFO A;  3E5U A;  4I0A A;  3MFK A;  2BY2 A;  2L7F P;  4QTR A;  2LY2 A;  2ECB A;  5F1J A;  4RGU A;  2P0W A;  3ULQ B;  2XAF A;  4BU2 A;  4XIC A;  2XUB A;  2GXG A;  3PUF A;  4KIB A;  2F4I A;  2ELH A;  4F55 A;  1XSX A;  1AKH B;  2WY8 Q;  3DTE A;  2NS7 A;  3H0G J;  1JKR C;  3F0C A;  4PJM A;  4KT6 A;  4ESB A;  3SQN A;  2XAH A;  3FXJ A;  2EFP A;  2PEX A;  2VC1 A;  1S6L A;  1A35 A;  2VOP A;  2FRH A;  4MHG A;  3MKL A;  4QIW N;  5L3G A;  1WHU A;  3H36 A;  4KN4 X;  4PJN A;  1WJC A;  1WWX A;  1MBJ A;  4ITV A;  4O6J A;  4OMY A;  2OC6 A;  5DCM A;  1T33 A;  1MMA A;  5J4V A;  1OJL A;  4AVZ A;  4CXF A;  2JA2 A;  2KPM A;  2EWN A;  2FNA A;  2JK3 A;  3H3U A;  3CJR B;  4ZZL A;  4WX9 A;  1D1A A;  1QO0 D;  1T98 A;  4XKC A;  3TOB A;  3I0T A;  2W24 A;  3ABU A;  4C2T A;  4NBQ A;  2QKM B;  5GTH C;  4A93 J;  3J81 K;  2WB1 A;  4AID A;  5D6E A;  3BOQ A;  2O6G E;  3GX4 X;  2C6Y A;  2XPV A;  2Y75 A;  3KLO A;  4FQG A;  5D4R A;  2OUM A;  3BTL A;  3HOX J;  4L9J A;  4LG0 B;  4FX0 A;  4HPQ A;  1R00 A;  1BR2 A;  5HOD A;  4BE2 A;  1RIO H;  3HOY J;  2XKO A;  5FLM J;  2LBF B;  2ZJQ F;  3CQZ J;  4ZYE A;  3S1R J;  4H0E A;  3F22 A;  4IXA A;  1A04 A;  5H20 A;  4LD5 A;  2A5W A;  2DPU A;  3GME A;  2HXI A;  1IN4 A;  2YU3 A;  3J81 Z;  4YIR X;  1SVM A;  2A61 A;  2DLL A;  4XK4 A;  4BS9 A;  3WTX C;  2W00 A;  5DM6 F;  4XR6 A;  3HOV J;  5LGU A;  1X2N A;  3K2Z A;  1YFH A;  1QZE A;  2ZC2 A;  1OCP A;  2ZXI A;  1MBK A;  1P4A A;  4DGW B;  2KHM A;  2E7X A;  2XF7 A;  2XF5 A;  1BW6 A;  2XGX A;  2XB5 A;  1YX3 A;  1BR1 A;  1BR4 A;  1OCT C;  1SFE A;  2QZ8 A;  1I1G A;  4EVI A;  2QEN A;  4IJA A;  1D1B A;  1P9Q C;  3LOC A;  4KMU X;  3CCL I;  2D45 A;  4CA0 A;  4ENM A;  2KP6 A;  3BTC A;  2P6T A;  2XAG A;  4RB1 A;  1X3W B;  2UXN A;  2P6S A;  2EV0 A;  1Z9C A;  1WJE A;  1ERD A;  1ZR2 A;  5J1U A;  3VDX A;  2H6B A;  4L0Z B;  5HOO A;  2JMW A;  1BOB A;  2Z2S B;  3FKI J;  3OR2 C;  4U0V A;  3H0D A;  3J7A Y;  2CGP A;  3K70 D;  3QP6 A;  2LY9 A;  2R7V A;  5ED4 A;  1HKT A;  1DU0 A;  3I53 A;  3BRO A;  4FCY A;  2W48 A;  1SD6 A;  1LFB A;  2DOE A;  2OD5 A;  4UVA A;  4BEH A;  3OSF A;  2RQQ A;  5EG0 B;  5D5V B;  4HNV A;  2QVO A;  1YJN I;  2ISZ A;  1W0T A;  2ZXH A;  3DEW A;  1MJA A;  1HCR A;  3SJM A;  3J80 K;  2E1M C;  4KIC A;  2GA1 A;  4OIN F;  1F36 A;  1LKX A;  1SD7 A;  3OYG A;  2EZH A;  4HBL A;  4XRF A;  3S93 A;  2HVS A;  2R5Z A;  2ZCW A;  3ZMD A;  2X1D A;  2VJ4 A;  5GAH J;  5D5W B;  2DA1 A;  1QVU A;  1WQ2 A;  2BY3 A;  5EEG A;  1XMA A;  3BY6 A;  3H1C A;  3I55 I;  3PNV A;  2DMQ A;  2V9V A;  3CDH A;  1XX5 A;  3GFJ A;  3V8L A;  3D5S C;  2KIS A;  1V5F A;  5EYR A;  4A0Z A;  5HDK A;  5F0C A;  4E70 A;  4HNU A;  4CZC A;  3J80 Z;  5FFZ A;  1I39 A;  1ZGA A;  4RLQ A;  4HX8 A;  2IXS A;  1O7F A;  5F1R A;  1WPK A;  4AYB N;  4CDG A;  1ZG1 A;  2BW3 A;  2K4J A;  3N4M A;  2KFD A;  1MBF A;  1QPM A;  2CFO A;  4AVP A;  4HNT A;  1JUM A;  5BS6 A;  2LYC A;  2JVH A;  4A3E J;  2K40 A;  4UB8 C;  2V6C A;  1W7P B;  4IRG A;  1X3Z B;  1TC3 C;  4IHT A;  1MDM B;  2DK5 A;  3DPU A;  2A07 F;  3TP0 A;  2E2J J;  2CH0 A;  1EV7 A;  3P7N A;  3M8E A;  1XCV A;  4M9X A;  1D0Z A;  2L02 A;  1TWC J;  1G2H A;  5BNG A;  1W5C C;  3KX2 A;  3CF2 A;  4G12 A;  2DK8 A;  3TW7 A;  3KIO A;  1B9M A;  5K7H A;  1MNE A;  3ABK H;  4F92 B;  4CCN A;  5DUK A;  3ZQI A;  2AXT C;  1DQU A;  1ZEL A;  4XKB A;  2QF7 A;  3KET A;  4XOP A;  2GBY A;  4A3K J;  3H92 A;  3JRG A;  5FRN A;  1DPU A;  1V5G A;  4EJT A;  4P96 A;  5B1A H;  3EUA A;  2J5O A;  1AU7 A;  3G1M A;  2AQF A;  1Z7U A;  4E7H A;  4IQ4 A;  1NTC A;  1P7I A;  3BC8 A;  3JTH A;  2TRT A;  5IYB J;  1VQM I;  1TQI A;  4GO1 A;  3BR3 A;  3LFU A;  2WAD A;  3OL3 A;  4KJZ A;  2R7S A;  1BI2 A;  1S7O A;  1OQY A;  1ACI A;  2VT2 A;  2KIQ A;  5FFX A;  3HTU A;  5JVT A;  1ZRE A;  1ETQ A;  2YUS A;  4CSW A;  3WG9 A;  4OU0 A;  3GTP J;  1IDY A;  4B1R A;  3C1D A;  1L3L A;  2JA8 J;  1OKR A;  3U1K A;  3K2A A;  4IX7 A;  2E1N A;  2LH9 A;  3HZJ A;  1VQ4 I;  1K4T A;  3NRV A;  4KIG A;  2XKP A;  5KCM A;  2V4J C;  2UXX A;  3V42 A;  3HC7 A;  4C2M J;  3OS0 A;  3F9K A;  3L00 A;  1WCM J;  3FK7 A;  5H2F C;  5GPC A;  2Y2Z A;  2ZXW H;  5AIP A;  1MMG A;  2F6C A;  2JQ7 A;  2L9R A;  1XD7 A;  3ISP A;  2EBI A;  4HEA 2;  4N4N B;  3KEO A;  4LIV A;  5F04 A;  4DQ2 A;  3OYC A;  3E7L A;  1K79 A;  1XPX A;  3MEX A;  1XDS A;  3CJN A;  3FXM A;  4CCK A;  1BIA A;  3K7A J;  1IGN A;  2VBZ A;  2JPC A;  4GRI A;  4IQJ A;  2XRL A;  4MO7 A;  4BNC A;  9ANT A;  1LUJ B;  1POG A;  2KT0 A;  5EEH A;  2Q2E A;  1R1U A;  4MEY F;  3L2C A;  2CRG A;  3QYE A;  2O61 A;  4HYE A;  4AIH A;  3L2Q A;  2ECC A;  1XGN A;  2DFH A;  1T08 B;  3HOU J;  1GVD A;  1RES A;  3A2K A;  2A69 F;  1I50 J;  1S3J A;  2DDB A;  1D5Y A;  1P2F A;  3JAM K;  1LB2 A;  1LDJ A;  5IYC J;  2WAE A;  1YIT I;  1ZAR A;  1JHH A;  1ZR4 A;  3FF5 A;  2BBY A;  1YS6 A;  2R7W A;  4AIK A;  3CMM A;  2NVX J;  4S05 A;  3GUD A;  5ICG A;  2CS3 A;  3RYP A;  2R92 J;  2J5P A;  2ZJR F;  4AM3 A;  4KMF A;  1EH6 A;  2GAU A;  1IF1 A;  5AIQ A;  2WAQ N;  2HKO A;  1MH3 A;  2Y9Y A;  2EFQ A;  5DTD A;  2M4K A;  1IV6 A;  3JAM Z;  4XOR A;  3FMQ A;  2DOA A;  2DU9 A;  4KUM A;  1G6N A;  4I99 C;  4EJU A;  1J75 A;  2JZY A;  1KA8 A;  5JHU A;  3R6S A;  1AKH A;  3DFG A;  3CD6 I;  1REP C;  4RAF A;  4M3B A;  1TZL A;  4C9Y A;  4XRS A;  2LDU A;  3AKZ A;  4UXN A;  5DCM B;  1TLH B;  4KYW A;  2MBF A;  3I71 A;  3OYB A;  3RPU A;  2JA5 J;  3KZY A;  1UZC A;  2NRA C;  2HEO A;  1J0R A;  1FSH A;  2NNY A;  4GCV A;  3DBL B;  3ESW B;  1X1C A;  2LTP A;  1Q1V A;  3QPH A;  5DM7 F;  2QWW A;  5LGT A;  3QPS A;  3K1N A;  5FKN A;  2DMU A;  3DEE A;  2AS5 F;  2K3F A;  3EET A;  3I5U A;  3GZ6 A;  3AL0 C;  2HYG D;  5E1W A;  3V8K A;  2LY1 A;  4E7K A;  1VQN I;  5IP9 J;  3F3X A;  3OWT A;  4IPA A;  3HOT A;  2B63 J;  4AIJ A;  5GTI C;  3RSN A;  2BHZ A;  3E6B A;  2FQ3 A;  5E3M A;  3FXQ A;  3H9G A;  1B8I A;  2R7X A;  3JRC A;  4V2G A;  1FBQ A;  4QSH A;  4DYC A;  3M07 A;  2LFB A;  4LG0 A;  4D1Q A;  1BN5 A;  4AU7 A;  2IA1 A;  1IN6 A;  2YU9 J;  2LBF A;  4XSX F;  4CCM A;  1ETY A;  2I5U A;  4ZYD A;  2BYV E;  1B59 A;  1YE9 A;  2XF6 A;  5GAD J;  2YX4 A;  1RET A;  4B3X A;  2VLA A;  3CCV I;  1RR8 C;  3OY9 A;  1WGX A;  4BL0 B;  2VAS A;  3OS2 A;  3BR2 A;  3TDZ C;  5HS8 A;  1PVE A;  1XGO A;  3UR3 C;  1K6O A;  2IGK A;  3GWZ A;  4YEL A;  2D1H A;  1V4R A;  3RYR A;  3BT9 A;  1UST A;  4N9H A;  5FKM A;  2EFW A;  2DCE A;  2VN2 A;  2V1U A;  4IKF A;  3KP5 A;  3CJT B;  1W1W E;  1VI0 A;  3ASN H;  5K5O A;  3H5A A;  2WTE A;  1MBH A;  1D0Y A;  3ZR8 X;  4JX6 A;  3TBI A;  5JR3 A;  2B0L A;  3IUO A;  1VQK I;  1FP2 A;  3TP3 A;  3I59 B;  1U5T C;  2VOD A;  5D5X B;  4XLN F;  3QYF A;  4XON A;  4M3E A;  4XLE A;  4C3I J;  2MFZ A;  1MKM A;  3AG1 H;  4ESJ A;  3BP8 A;  5BMZ A;  4EM1 A;  2XAS A;  3DXJ F;  4I6Z A;  3W6J B;  1IC8 A;  3FBI B;  1YQA A;  1E17 A;  5FRM A;  3T5X A;  1SVO A;  4OWR B;  3H5N A;  4BEH B;  5C4J J;  4Z2Y A;  3A1Y A;  3BQY A;  3KP7 A;  4ZYH A;  3RZD J;  1XB4 A;  3CO6 C;  2WA0 A;  4BXU A;  5E18 F;  2K9N A;  4TV7 A;  2R5Z B;  3LSR A;  2HFH A;  3WHB A;  1UAA A;  4PZJ A;  3W2V A;  2RDP A;  2H27 A;  5CVI A;  3M9A A;  3H9J A;  5FGM A;  5D6F A;  3H35 A;  2UUZ A;  2NOJ B;  2RV8 A;  3PFY A;  3TO7 A;  1JTY A;  2P7V B;  5EG0 A;  1HC8 A;  1CQT A;  3S1Q J;  2R7Z J;  3AFH A;  5HDN A;  1OYW A;  3AG4 H;  3FBN B;  3K4L A;  2GQQ A;  5ICE A;  2EPF A;  1RUN A;  4XBF A;  3MKY B;  1I5Z A;  1Z3X A;  5DUI A;  2PX9 A;  2M9H A;  3KP4 A;  3SDG A;  1PP8 F;  4Z6Y A;  4N9I A;  1TQM A;  2F5E A;  3FIS A;  2A6T A;  3D5L A;  2DYR H;  1B72 A;  3K0L A;  2B7E A;  1WFX A;  4Q4Z F;  2HI3 A;  2OAZ A;  5LLQ A;  3GF2 A;  5KNL A;  2WB1 N;  3ZP5 A;  1DU6 A;  1FIP A;  5HLI A;  4F91 B;  1XSD A;  4OIP F;  1EKE A;  1Z0X A;  5FD6 A;  3OSG A;  1R5H A;  3DPL C;  3M1C A;  3VYT B;  3QWL A;  1KU2 A;  1NK3 P;  3QAH A;  1ETW A;  3FIW A;  3HG9 A;  3WTS C;  1D8K A;  4V2F A;  1O4X A;  3EDP A;  3C3W A;  1DGR M;  2HXO A;  3X2Q H;  4PJ0 C;  3F8C A;  5H6R A;  2KIF A;  2M34 A;  5J1R A;  4KDP A;  4WCG A;  2L4M A;  2HQA A;  4HG2 A;  2QCO A;  4YFN F;  1X19 A;  2NAZ A;  1O3S A;  3Q0U A;  2EV6 A;  4M73 A;  4BJ6 C;  4BQN A;  2F4M B;  3LWF A;  4QLC U;  1R22 A;  1V54 H;  2OU2 A;  4WF2 A;  3I4N J;  2Z33 A;  3DEU A;  3S14 J;  4A0X A;  2LK2 A;  2X6W A;  1VFC A;  4WXC A;  3RJP A;  5FB2 A;  3K10 A;  1P6R A;  1ETX A;  1P4W A;  3HL2 A;  1IG7 A;  4U7D A;  2D1V A;  4L9V A;  1QA6 A;  1R4M B;  2IGM A;  3GBG A;  2KRH A;  3IKT A;  1ZN2 A;  3GYH X;  2F5V A;  2IS4 A;  2X85 A;  3ASO H;  4RDU A;  2X1E A;  3I58 A;  1R9T J;  3SZT A;  3CDL A;  3E6C C;  1JT6 A;  2Q1Z B;  3D0S A;  2ZB9 A;  3QU6 A;  1WI9 A;  4L0Y B;  5M3F J;  1T38 A;  5K7F A;  2DJN A;  1IUF A;  2FOW A;  1UHS A;  4U87 A;  1I6X A;  1UCR A;  5IYD J;  1U78 A;  5IPA A;  2KZV A;  2CW0 F;  2V1N A;  4XLP F;  3FXL A;  3OIQ A;  3OYJ A;  4WXD A;  2KJC A;  1A6Q A;  2PG4 A;  2K9M A;  3K4M A;  1ETK A;  3K4K A;  3KP3 A;  5M5X J;  1ZRD A;  4I09 A;  4EJW A;  1WSU A;  4IHY A;  3B6C A;  3ONQ A;  1FBS A;  2DI3 A;  2VQL A;  2MC3 A;  3KP6 A;  1FMV A;  5A2Q K;  3ZQG A;  2V6E A;  5BQT A;  3HOW J;  1TWH J;  3I4P A;  1R23 A;  1WJ5 A;  2IGO A;  2K86 A;  2P5K A;  1BIB A;  2FSW A;  5K1Y A;  4ZH4 F;  3S2H J;  3NAU A;  4AD9 A;  3IWF A;  2G7U A;  1HDP A;  1ZLJ A;  1JGS A;  2LOO A;  2MLG A;  2Q2E B;  1IXS B;  5A2Q Z;  1BA5 A;  3DWL E;  3JRB A;  2A6H F;  3PIP F;  4CZZ A;  2A3S A;  2L5Q A;  2PI0 A;  1V55 H;  3Q5F A;  5JHF A;  2ZSI B;  1ZK8 A;  3FMS A;  3CUQ B;  2L7M P;  5LFA A;  2HDW A;  2R7O A;  3V4G A;  1FNN A;  2ZSH B;  3FXR A;  3CF5 F;  4ESF A;  4LFU A;  4BQO A;  1IZ1 A;  1T0F A;  3HSF A;  5HS9 A;  2VKD A;  2OZ6 A;  4ENN A;  2HPM A;  3D1N I;  4PSW A;  2E2H J;  1APL C;  2L9N A;  2O03 A;  1YW9 A;  1YX5 A;  2CW8 A;  1DPR A;  3BLY A;  4RAG A;  3ZMV A;  2JRM A;  3BJA A;  2PLY A;  2HZT A;  2DO7 A;  1SAX A;  4BKX A;  4G7Z F;  4EV0 A;  1SVL A;  4DZJ A;  4HDU A;  2DT7 B;  4EEF G;  3ZOB A;  1VQ6 I;  1Z77 A;  4II3 A;  3IAS 2;  2QQ9 A;  4PJL A;  2ACJ A;  4OIO F;  4V19 K;  4ZC3 A;  1ENH A;  4YII A;  5L3F A;  2CUJ A;  4BDZ A;  1MZB A;  1H9G A;  3K9T A;  3JRH A;  4BE0 A;  3F21 A;  1R5G A;  4B3A A;  3JSP A;  1K7A A;  2OQG A;  3IAM 2;  3R60 A;  4NC8 A;  2M8E A;  2Z3Y A;  3FMR A;  1UFM A;  3JCU C;  2L9S A;  1WH7 A;  5FKO A;  5L3B A;  4RAZ A;  1NH3 A;  2CV1 A;  3QP5 A;  2AQE A;  1J09 A;  4P9U A;  2JSP A;  1AWC A;  1YS7 A;  3OOU A;  1OCC H;  3FKJ A;  1Z05 A;  3DLA A;  1B8I B;  1D8J A;  2Z16 A;  2VC0 A;  3CC7 I;  4ZZD A;  2DMT A;  2M2E A;  2HPI A;  1SFU A;  1IW7 F;  5D8L B;  4D9J A;  2R5Y A;  1H88 C;  2MD0 A;  2VBX A;  4JYK A;  4ENK A;  4CIC A;  2RRE A;  5EZG A;  1MMD A;  1X3U A;  4F7Z A;  1MJ9 A;  1LQ1 A;  4QPO A;  1GDT A;  2CU7 A;  4M6V A;  1XC5 A;  3ML6 A;  3EUH A;  4A3G J;  1P4X A;  2MGQ A;  3KYC B;  2DA4 A;  4HST A;  2DJI A;  1OMI A;  4ZDO A;  2NNN A;  1OLT A;  3MZ8 A;  1FP1 D;  2NVY J;  2HS5 A;  3U2R A;  3HUG B;  5EDN A;  4OAZ A;  4O3M A;  4G8X A;  1L0O C;  1IV8 A;  5B3S H;  1Z6R A;  1U6G A;  1YRN B;  2P8T A;  3N05 A;  1T0F C;  1VF9 A;  5BPD A;  3AAF A;  1OR7 A;  2PN6 A;  3K4J A;  1EH7 A;  3J7Y J;  1H9T A;  2VL8 A;  5FKK A;  3SZP A;  2LD5 A;  4HRI A;  2JVG A;  2L01 A;  3MN2 A;  1VQL I;  2CUZ A;  3LSG A;  3OYD A;  5ICF A;  5CJ9 A;  4MGR A;  1UHW A;  1VQ5 I;  3I64 A;  1Z91 A;  4A3J J;  1MSF C;  4BBR J;  2PFB A;  3I59 A;  3ZRG A;  2CQX A;  1Y56 A;  2R0Q C;  4BQA A;  4N4O B;  1LDD A;  4ASN A;  1RZ4 A;  3PQJ A;  4IRI A;  4YEJ A;  4X6A J;  2H8R A;  1BC8 C;  2FNP A;  4U0Y A;  2RVC A;  3OIO A;  3R4K A;  1JJ8 C;  1ZQ3 P;  1Y8R B;  2L2O A;  2IPQ X;  3AG2 H;  4RGX A;  5HDG A;  3QOE A;  4NC7 A;  1QVT A;  2E34 A;  1YTY A;  5M5W J;  3ERM A;  2R93 J;  3GCM A;  4A0Y A;  1PUF B;  1FC3 A;  2WV1 A;  1Z6T A;  1WI3 A;  4ZTJ A;  3L1P A;  2MC4 A;  1YO5 C;  2IVM A;  1X1D A;  2OJE D;  3ELK A;  4HF1 A;  2VQH A;  2BOL A;  2HU9 A;  2IW5 A;  2ME0 A;  2HYF A;  2YX7 A;  1JXS A;  1LVA A;  3QQA A;  4DYQ A;  3C7J A;  2FX0 A;  3A03 A;  1J5Y A;  1XGM A;  1FIA A;  3T8R A;  3LSK A;  1LFU P;  1B72 B;  3RCO A;  3N97 A;  3G6E I;  2GXB A;  3PSI A;  1QHG A;  5E3N A;  3ZMS A;  3DU6 A;  2OQR A;  1SFX A;  4G6Q A;  4QPQ A;  1ZRF A;  1ZKG A;  3FXK A;  1O3Q A;  2HOA A;  1I3Q J;  2K9S A;  2JJ7 A;  3LL7 A;  3P9C A;  4P5O A;  5D8K B;  1SAU A;  3F72 A;  5M3M J;  4XN3 A;  1VTN C;  4GFB A;  2HOT A;  2FU4 A;  4E7L A;  3BG6 A;  3GXO A;  5EEA A;  2QSG X;  5CLS A;  4UUS A;  3EUH C;  2QYO A;  3GEZ A;  1VQ7 I;  3EYY A;  5JLW A;  2F4O B;  2LNB A;  1E3H A;  2VKV A;  1LEA A;  3AG3 H;  1GLN A;  1S7E A;  4HSR A;  2NOG A;  2CYY A;  3PNT A;  2JN6 A;  2VE8 A;  1FJL A;  3CCU I;  5TGT A;  2XAJ A;  3HHH A;  2XV4 S;  1NHA A;  1OR7 C;  2L3D A;  4FTH A;  2ZJ2 A;  1A5J A;  1HSJ A;  2RC4 A;  4A2U A;  1EJ9 A;  3U21 A;  3VB2 A;  2B9S A;  2DA2 A;  2XGE A;  3CCY A;  1MH4 A;  3LAJ A;  5IT3 A;  1A6I A;  4H4K C;  1FZP B;  5L3D A;  3KPH A;  2MD5 A;  4XN0 A;  1FBU A;  1K61 A;  2G9W A;  3LA2 A;  1TWG J;  1XCB A;  2OV7 A;  4PGH A;  2KQR A;  3OYL A;  1KQ0 A;  5ICC A;  2MYS A;  6PAX A;  4XNF A;  1OCR H;  1YLF A;  2YSR A;  2Y31 A;  2BEO A;  1O7L A;  3A0H C;  4C3J J;  4RB3 C;  2QSF X;  3L7W A;  1R58 A;  5B66 C;  5J47 A;  1VND A;  4I76 A;  1O3T A;  2R7U A;  3K4C A;  3SYT A;  2ISY A;  5IY5 H;  2CO5 A;  3LMM A;  4MLO A;  3A01 B;  1EA3 A;  3MAJ A;  3R61 A;  4EJV A;  4UVC A;  1FYM A;  1WJF A;  2KIM A;  1RI7 A;  1PP7 U;  3UNG C;  3BWG A;  4D5C A;  3F6O A;  5KK1 A;  2WC2 A;  3O8G A;  3SDB A;  4J19 A;  2LKX A;  1GUU A;  3GZ5 A;  1NG6 A;  3KYL A;  2P4W A;  1U8R A;  1BJA A;  4E7S A;  2XPW A;  3ABM H;  1Z21 A;  1SEU A;  3HPH A;  3S17 J;  2E5Z A;  2RKH A;  4BQQ A;  2DTR A;  5TRD A;  3H3Z A;  3G73 A;  3CC2 I;  3HXL A;  1XSV A;  4W97 A;  2XDV A;  1X4P A;  2CSO A;  2LRE A;  2QBY B;  1VQ8 I;  2RNG A;  4HOB A;  1N77 A;  4A12 A;  5J40 A;  3S2D J;  3O6B B;  5EF6 A;  5CYV A;  2YPR A;  1HW1 A;  5HNH A;  2LG4 A;  4HLY A;  2DOF A;  1BOA A;  3IHU A;  2EFO A;  2QA4 I;  4GDF A;  4P55 A;  2TDX A;  2PJP A;  3PO3 J;  5C4X J;  3LST A;  2LF7 A;  2EZK A;  3CUQ A;  2RAE A;  5FD5 A;  2CQN A;  4EGZ A;  1MND A;  4HLX A;  2K3P A;  2LR8 A;  2KDO A;  2QKL B;  4JP0 A;  1BM9 A;  5GAE J;  1GVJ A;  5FO5 A;  1AA7 A;  2HOE A;  4NQW B;  2L54 A;  4F3Q A;  1YIJ I;  2W25 A;  3SHF A;  4I02 A;  3V7R A;  4FIS A;  1R1T A;  2OF7 A;  1BL0 A;  2R7T A;  3TDU C;  3E6D A;  2ZFW A;  3I9V 2;  5BOX A;  2FBK A;  4S0H B;  2KJB A;  3LSH A;  3S2W A;  2ESN A;  5K5Q A;  1X1P A;  3LSM A;  3CMY A;  1FPQ A;  1WKM A;  3O3K A;  1KGS A;  5LEK A;  1T56 A;  1IXR C;  3OYH A;  1JI8 A;  5D5U B;  5GP9 A;  1TW3 A;  2FF4 A;  1ZLK A;  3GTL J;  3DCF A;  4E7Z A;  2DBB A;  1T8I A;  3K1M A;  4K2E A;  1DP7 P;  3FWE A;  4HX7 A;  5HLH A;  2JSC A;  5JFR A;  5LHH A;  1RR7 A;  3HGG A;  5FLV A;  4M6Y A;  1R7J A;  5LHG A;  3JRA A;  4DBQ A;  4JQF A;  3C2G A;  1BBY A;  3K1P A;  4KIF A;  4M3D A;  3NWT A;  2H1K A;  2EIK H;  1JKQ C;  2F5C A;  4FE4 A;  3GTK J;  2GWR A;  4EM0 B;  2R5Y B;  2O5R A;  3T0Y A;  3HRT A;  3CZ6 A;  4EQQ A;  5DS9 A;  1T95 A;  1ZHF A;  2XVC A;  2XPU A;  2CW7 A;  3CCS I;  1J2X A;  3F8N A;  2VPL A;  1ZAO A;  1JUP A;  3F8F A;  1U9N A;  4LIU A;  1IRG A;  3I54 A;  4ZDL A;  4MTD A;  3GTO J;  4D7M A;  2HTS A;  3HRU A;  4BBS J;  1R1V A;  4R79 A;  2A5Y B;  1K6Y A;  4MNU A;  1SAN A;  1IN8 A;  5J3L A;  4YFK F;  2KDZ A;  4B4C A;  1OYI A;  2XSJ C;  3I4M J;  1XMX A;  1IN5 A;  4BHB A;  4FX4 A;  1Y39 A;  1P7J A;  4M71 A;  3S1N J;  1FOK A;  1JKP C;  1VQP I;  4HF2 A;  3VPR A;  4DBR A;  1HW5 A;  2BZT A;  4DIQ A;  4W1U A;  4BDY A;  2R3S A;  1D3Y A;  4EM2 A;  3ABT A;  3M7G A;  2FUG 2;  3T1B A;  1ON1 A;  5F64 A;  1D0X A;  1IO2 A;  3P5J A;  4WXH A;  5ERI A;  2GIV A;  3BG3 A;  1GV2 A;  1VZ0 A;  4IOC F;  2FQ4 A;  4LLN A;  2XC7 A;  1U8B A;  3CUQ C;  2HKX A;  3HUG A;  1G3T A;  3KFW X;  2BHY A;  3KEY A;  2XGD A;  3JTG A;  4MFD A;  2MH9 A;  1Z3Y A;  3JRF A;  3BCA A;  4FE7 A;  1YRN A;  2K27 A;  5IP6 A;  4LIT A;  1AHD P;  4RB0 A;  1B6A A;  4PCQ A;  5DD8 A;  2KZG A;  1YYV A;  4RGS A;  3HB9 A;  5JVG F;  2QQ8 A;  1FTT A;  1ZGJ A;  4ANJ A;  1R71 A;  4R8H A;  1OIS A;  1WJB A;  1LE8 B;  1X4O A;  1KU9 A;  1ZYR F;  2VT3 A;  3RIR A;  2IS6 A;  2DA7 A;  3IKV A;  1JUS A;  1WJA A;  4UV8 A;  4M3G A;  3G4S I;  4BAC A;  5LD2 C;  3H3V K;  4IF4 A;  2EQR A;  3GLL A;  2DA3 A;  5EJC A;  1OFC X;  2QQB A;  4EMS A;  3MWM A;  1RRJ A;  4I2O A;  1UMQ A;  1K4S A;  3DP7 A;  2KRC A;  3QOD A;  1I27 A;  2XAU A;  3Q0W A;  3HHG A;  2OTL I;  2FD5 A;  2I10 A;  2HZD A;  1DUX C;  1R36 A;  3MVP A;  4HV6 A;  3ZPL A;  4LOC A;  3ZMT A;  2F5D A;  2QSH X;  3VWB A;  1ODD A;  3MMY B;  3OOP A;  1H0M A;  4KT5 C;  1PUF A;  2HVR A;  2GLO A;  1FLI A;  4CHU A;  2STT A;  3WTU C;  2FBI A;  3E5Q A;  3U1D A;  1Y1V J;  2K4B A;  4CCL A;  1KU3 A;  1IRZ A;  3W3C A;  1H8A C;  2A68 F;  3QRF F;  3HM5 A;  3KYD B;  2W7N A;  3WTT C;  3KE2 A;  2YR2 A;  3NEU A;  1MW7 A;  3CES A;  2LKP A;  1Y0N A;  1E0E A;  1S5L C;  1FTZ A;  2PMU A;  5L3E A;  3TGN A;  3C2B A;  3TOA A;  4UUS B;  5D4S A;  4ZYA A;  3GTJ J;  4O5V A;  4AWX B;  3WE3 A;  1FSE A;  3HGY A;  3TO6 A;  3FM5 A;  2HQR A;  3Q9S A;  5FKL A;  3OYN A;  3M4O J;  4A3D J;  2BVM A;  2H6C A;  4Y3O A;  3BDD A;  2W57 A;  2TCT A;  2A05 A;  3DU5 A;  5L3C A;  3DF8 A;  2ADU A;  2IP2 A;  3Q3S A;  2M5W A;  3HIF A;  4ETS A;  3DQV C;  3LQR A;  3WTY C;  4HX4 A;  2HDC A;  5DV5 A;  3E3V A;  4B8X A;  2IS2 A;  1MGT A;  1TT5 B;  2V1D A;  4IHW A;  2VKH A;  1FWZ A;  4LGW A;  3LAP A;  3KCC A;  4Q47 A;  1IRX A;  2ZKZ A;  4IHS A;  4JOM A;  2EZI A;  4ZYG A;  1G59 A;  1B4A A;  3IRR A;  2AHQ A;  4YG2 F;  1MJB A;  1UJ8 A;  4IHX A;  1HLV A;  1QGP A;  4L5I A;  2K9Q A;  4DNC A;  1CF7 A;  4G7O F;  3PUB A;  1UB9 A;  4R1H A;  1O57 A;  1BI3 A;  2K85 A;  2G0E A;  4BXX J;  2W1O A;  2W84 A;  2ZME B;  4UHT A;  2EZL A;  3F8B A;  5CVU A;  1XTA A;  2BY1 A;  2EIM H;  1W7P D;  1LVK A;  2KRF A;  1YW7 A;  3SXY A;  3DBH B;  1W36 D;  5J4Y A;  4M9Z A;  3HRM A;  2R7R A;  3HDD A;  4JX5 A;  2L7Z A;  3RQ4 A;  4IOA F;  1RNL A;  3OYF A;  1B1B A;  2QQA A;  1FT9 A;  1QNT A;  2WBM A;  4XMY A;  4ENJ A;  1YIO A;  4Y17 A;  4RM3 A;  1G3W A;  1R49 A;  3A01 A;  4IHV A;  2Q8K A;  3S1M J;  1W4M A;  2JUG A;  4UY8 I;  2E1C A;  1I1S A;  1BI0 A;  4BY7 J;  1IXC A;  1H89 C;  4XRS G;  1QZY A;  1X58 A;  1CGP A;  4XM3 A;  1HF0 A;  2VOO A;  5M5Y J;  1DP3 A;  1SMT A;  2FMY A;  3SEQ A;  5ILU A;  3PQK A;  2STW A;  2EH3 A;  5DEQ A;  3I56 I;  5J8C A;  2DA6 A;  3L2W A;  4DW6 A;  3ZQF A;  2DMP A;  5K5R A;  3FHN A;  2O9L A;  2O8K A;  3EQL F;  3MKZ A;  4EGY A;  1R5I D;  2VXD A;  2L0K A;  3RKY A;  1TNT A;  2QBY A;  1JHF A;  5J1Y A;  2FBH A;  3DKY A;  4M6X A;  3MKW B;  2DQL A;  5JLX A;  1TP4 A;  1XN7 A;  3CC4 I;  1FOW A;  2MSY A;  4LLL A;  1HA8 A;  3E0J B;  3OYI A;  3EPZ A;  2R4G A;  3DLL F;  4A5M A;  2CUF A;  4BHC A;  2KIU A;  3GFI A;  3B6A A;  3PIO F;  3A0B C;  4NB5 A;  2P5V A;  1EH8 A;  2M30 A;  1F9N A;  3JRE A;  1XS9 A;  1F43 A;  2P5L C;  4L18 B;  3C18 A;  5DYM A;  3UKG A;  2VB6 A;  3BPV A;  2A6E F;  3CTA A;  3HSE A;  3WGI A;  2DPD A;  4I98 B;  4S04 A;  3HJE A;  2X6Y A;  4RM2 A;  3V7S A;  3ZGK A;  3M3Y J;  2GOX B;  1J7K A;  4I01 A;  4D7N A;  5DD4 A;  2GZW A;  2L4A A;  3RPQ A;  2V9P A;  4QWQ A;  2GA2 A;  2XAQ A;  2O7O A;  4KFC A;  1ZG5 A;  4NQW A;  1K78 B;  2VUM J;  5FLX K;  1Y1W J;  4GYI A;  2MH2 A;  2N8G A;  3KZI C;  4Y7N J;  1TT0 A;  4Q48 A;  3L2U A;  2DOD A;  4C3H J;  1OYY A;  1WH5 A;  5HLT A;  2FOK A;  1HST A;  1S29 A;  3IH4 A;  2CV0 A;  1G3S A;  4M9S A;  3FX3 A;  5CPR B;  1ZGW A;  3OYM A;  2BY0 A;  2IT0 A;  2M0C A;  3ZMZ A;  2PQ8 A;  2YS9 A;  5ILS A;  4D0P A;  5FLX Z;  2F2E A;  2KL4 A;  3BR6 A;  1G8X A;  4C30 A;  2FE3 A;  1Y0U A;  2LLK A;  2WY7 Q;  4B48 A;  4DOZ A;  1NG7 A;  4XKW A;  4CO8 A;  3REO A;  3A4C A;  4B44 A;  1V5E A;  2K02 A;  2FEZ A;  2OA4 A;  2X9D A;  4C2U A;  4A3C J;  3K4B A;  1FYL A;  3B73 A;  2LSO A;  3GTM J;  2MW8 A;  3IC7 A;  1AOY A;  2IA0 A;  1X1A A;  4A6E A;  2G7H A;  3LSI A;  4PJJ A;  3TQN A;  2RNJ A;  4ABZ A;  4OIR F;  4EAT A;  2NYX A;  4NNJ A;  2EK5 A;  4Y33 A;  3V8J A;  1ZTR A;  3BJ6 A;  3ECO A;  2E5N A;  3ZQC A;  2CFX A;  2Z99 A;  4XOT A;  2X48 A;  4E6K G;  2RQP A;  3CLO A;  5F0H A;  5F27 A;  2X51 A;  4XKV A;  4CUG A;  1DDN A;  2PJR B;  1FOX A;  1MBE A;  3IL2 A;  3CDI A;  4XLA A;  2CQK A;  1F1Z A;  3LQQ A;  4JX4 A;  1N25 A;  3P9K A;  2EV5 A;  2PBI A;  2Y30 A;  1E3O C;  1D5V A;  3HKZ A;  1OCO H;  4Y4R A;  3CMA I;  2ETH A;  3RTR A;  2GXA A;  2JWT A;  2ID3 A;  2ZNY A;  3VYU B;  2H09 A;  2M7B A;  1SFK A;  3LA3 A;  2COB A;  2E2I J;  4LK1 F;  3TMO A;  3PJR A;  1HKQ A;  5F08 A;  3CME I;  4HQM A;  2VBW A;  4L5J A;  2QM3 A;  5E3L A;  4CCO A;  2HNH A;  3LA7 A;  1QQI A;  2UZK A;  3HBL A;  3OYK A;  2QLZ A;  4DJA A;  1A31 A;  4IRH A;  2QUF A;  4RS8 A;  1JKO C;  2EJR A;  4XRM A;  3TO9 A;  1IJW C;  4IL6 C;  5HS7 A;  1FYK A;  2M45 A;  1LE8 A;  4P1W A;  2K7L A;  2PMZ A;  2M8G X;  2X1C A;  2HTJ A;  1YG2 A;  4ZTF A;  2ZO4 A;  4N0B A;  4KN7 X;  2XHK A;  2UV1 A;  3NWS A;  4PK4 A;  3WTZ A;  3KEQ A;  2DN0 A;  1YHQ I;  3E1S A;  2GIZ A;  4CYC A;  4U7B A;  1DGW Y;  1QZZ A;  3S3N A;  3CP2 A;  2I8D A;  4YFX F;  3G71 I;  2M3A A;  4UUT A;  3TW6 A;  3DTI A;  3F8M A;  4XID A;  3DTK A;  4GYG A;  2Y0S A;  4G94 A;  2RN7 A;  2VJ5 A;  5HNF A;  3LSJ A;  3L9F A;  5IOY A;  4UVB A;  1Z1D A;  1QPI A;  1FEX A;  4EJO A;  1FMW A;  2E36 A;  3ZQQ A;  3G1L A;  2D5V A;  4KA4 A;  1IN7 A;  2JTV A;  1U2W A;  1PDN C;  3B02 A;  2HWV A;  2NVQ J;  4LJZ F;  5CQG A;  1OCZ H;  3SFZ A;  1S72 I;  2CV2 A;  2W4S A;  1M1E B;  2HR3 A;  3TL4 X;  3GTQ J;  2M1B A;  2DMN A;  2BVL A;  1HKS A;  1YI2 I;  4CYD A;  5F0F A;  2VQG A;  4RB2 C;  4FT8 A;  3S16 J;  4E4H A;  4A5N A;  5CKT A;  4UB6 C;  1S7A A;  3JW4 A;  3ZN0 A;  1LPQ A;  3DKX A;  1YJ9 I;  3ZQ7 A;  5E8I A;  4OIQ F;  3OYE A;  5EZH A;  1OPC A;  4A3I J;  2FA5 A;  2GOM A;  3BG5 A;  1XDU A;  3GFL A;  3W2W A;  2V79 A;  2VBY A;  1JT0 A;  3R0J A;  3KLN A;  2Y69 H;  4AUX A;  4Y15 A;  2ZBK A;  2COM A;  1Y6I A;  4AC0 A;  1UG2 A;  3RI4 A;  3QYB A;  2LKS A;  3MQ0 A;  3JRD A;  4E7I A;  2WAF A;  1KQ8 A;  2ME6 A;  3J7Z I;  2PMH A;  3JRI A;  3K70 C;  5C3E J;  3BZ6 A;  1CF7 B;  5TJJ A;  4LLG F;  1F5T A;  2ELK A;  3GZN B;  2AXL A;  4HF0 A;  2VPR A;  2KKO A;  4G6T B;  3DKW A;  1SFO J;  4PSX A;  3QU3 A;  3ZXS A;  1KYZ A;  1NK2 P;  2OTJ I;  1BJZ A;  2IEK A;  4F52 A;  4OMZ A;  1UG0 A;  2DT6 A;  1XMK A;  1HBX G;  2R7F A;  2XB0 X;  3MCZ A;  2OCC H;  1YOV B;  3QOP A;  3Q9V A;  5B1B H;  1U0J A;  4LB5 A;  2ZME A;  3FM3 A;  2CJJ A;  3PO2 J;  3EUK L;  1SD4 A;  2V26 A;  1WVR A;  3COA C;  1UHM A;  3WGG A;  3VYS B;  1Y8Q B;  3GVA A;  1FOY A;  2ZNZ A;  3CLQ A;  3JSO A;  3NAR A;  4HAM A;  4HDV A;  3MD2 A;  4MFE A;  2EIN H;  4WWC A;  1PJR A;  3H5R A;  3CCE I;  4D5F A;  2OCE A;  1USS A;  1ON2 A;  2ID6 A;  4BE1 A;  4MEX F;  4A3B J;  2XGC A;  1LEB A;  4I7H A;  2VKE A;  3OL4 A;  3U9G A;  2IRF G;  3QPL A;  3ZN1 A;  3CCM I;  1TW2 A;  2VI6 A;  2ESH A;  1X1B A;  4LK0 F;  2VQC A;  4IO9 F;  4HQE A;  3K4N A;  1SC7 A;  2UWM A;  5HVQ C;  2IS1 A;  2DTZ A;  5E1X A;  2LP0 A;  4PUS A;  5E3O A;  3GTG J;  1E3P A;  3RKX A;  1ULY A;  1JGG A;  4DYR A;  4RMN A;  3SEZ A;  3VOD A;  2NS8 A;  4BHP A;  2Z1D A;  2M7A A;  2X6X A;  2KMU A;  1YJW I;  3E97 A;  4CGZ A;  1MMN A;  4BH9 A;  5F6F A;  5E79 C;  3BCB A;  4BXF A;  2R7D A;  4YIF A;  4YRV A;  3K6G A;  4G6D A;  2VJJ A;  2ZJP F;  2JA7 J;  3VFZ A;  1XG1 A;  3LNQ A;  2E60 A;  2K5C A;  2CWE A;  3M8J A;  4BJ5 C;  2V9K A;  1QRY A;  2DFF A;  4BJT A;  4KIS A;  3WTW C;  2CQ7 A;  5DCF A;  2VE9 A;  1K78 A;  2JT1 A;  4X1E A;  2VON A;  3J7A O;  4PDK A;  1ETO A;  5EGO A;  1T6S A;  4KNY A;  3HPG A;  5KAF C;  4PFP A;  2JA6 J;  1U5T A;  2HQN A;  4XLC A;  1UEL B;  3W6K B;  5C44 J;  3W2A A;  2ZXJ A;  1ZH5 A;  1KU7 A;  3MZY A;  1BW5 A;  2Q0O A;  1F4K A;  1FY7 A;  1V3F A;  2V1X A;  3CCJ I;  3EYI A;  2DT5 A;  2F5F A;  2MLK A;  2M0M A;  1WZ2 A;  1HOM A;  2W85 A;  3W6V A;  3GLX A;  2NS0 A;  2ZME C;  5E20 A;  4B09 A;  5IT9 K;  2Y9Z A;  1TL8 A;  5AON A;  4HW0 A;  4LG3 A;  3RKW A; 
#chains in the Genus database with same CATH homology
 1PYV A;  2LYC A;  2JVH A;  4ZDP A;  3IAM 2;  4NC8 A;  2VJI A;  2L9S A;  3DPU A;  3DQV C;  2E1M B;  5CQE A;  2IS2 A;  2CH0 A;  2VKH A;  3PNY A;  1N75 A;  1D0Z A;  2CV1 A;  2AQE A;  1J09 A;  1N78 A;  2JSP A;  1IRX A;  4JOM A;  3OOU A;  3KX2 A;  3CF2 A;  3FKJ A;  3DLA A;  1G59 A;  2Z16 A;  2VIX A;  1MNE A;  4F92 B;  4CCN A;  3RPU D;  2HPI A;  4D9J A;  1DQU A;  1ZEL A;  2MD0 A;  4XKB A;  3PUB A;  4XOP A;  2RRE A;  3PSF A;  4AYB A;  1MMD A;  4ZJZ A;  3PL8 A;  4XQF A;  5FRN A;  1V5G A;  4QPO A;  2W1O A;  2PJR A;  3EUA A;  2ZFU A;  2AQF A;  1LVK A;  4E7H A;  4IQ4 A;  1W36 D;  3BC8 A;  2R7R A;  3RQ4 A;  4HST A;  1Z7L A;  2DJI A;  3OYF A;  4ZDO A;  1OLT A;  2WBM A;  4XMY A;  3S3M A;  1QU3 A;  3HUG B;  4OAZ A;  2R7Q A;  3LFU A;  4RM3 A;  2WAD A;  3OL3 A;  4KJZ A;  3I3L A;  2R7S A;  2JUG A;  3N05 A;  1T0F C;  3K4J A;  4CSW A;  4XM3 A;  2VL8 A;  4HRI A;  1DP3 A;  2JVG A;  3SEQ A;  4IX7 A;  2LH9 A;  2CUZ A;  3LSG A;  3OYD A;  3V42 A;  5KCM A;  2V4J C;  3L2W A;  3HC7 A;  3OS0 A;  3F9K A;  3OMY A;  3FHN A;  3MKZ A;  2LC2 A;  1LDK B;  3ZRG A;  1MMG A;  2F6C A;  2VXD A;  1Y56 A;  3L2V A;  4HEA 2;  4N4O B;  3DKY A;  2LRD A;  4N4N B;  4LIV A;  3OYC A;  4IZZ A;  3MKW B;  4KIT B;  4YEJ A;  1HA8 A;  3E0J B;  3OYI A;  3EPZ A;  2R4G A;  4CCK A;  4GRI A;  2L2O A;  4IQJ A;  2MAB A;  2ELJ A;  3QOE A;  4NC7 A;  3CP8 A;  3QYE A;  4ZTJ A;  2VB6 A;  4FAS D;  2MC4 A;  3L2Q A;  2KLO A;  2CMP A;  1X1D A;  3A2K A;  2VQH A;  3DPT A;  2HU9 A;  2BOL A;  2X6Y A;  4RM2 A;  3ZGK A;  2GOX B;  4BUP A;  2WAE A;  4B43 A;  3LSK A;  2R7W A;  3RCO A;  3L2R A;  3CMM A;  1KON A;  3PSI A;  1QHG A;  3VSK A;  2CS3 A;  3DU6 A;  1TT0 A;  2L7K A;  4QPQ A;  3L2U A;  5HLT A;  3LL7 A;  4P5O A;  1SAU A;  2CV0 A;  4XN3 A;  4XLF A;  2M4K A;  4E7L A;  2K9L A;  3BG6 A;  5CPR B;  4XOR A;  2BW3 B;  3OYM A;  2DOA A;  3EUH C;  3HOS A;  4B47 A;  2KL4 A;  1G8X A;  1S9H A;  4C30 A;  1TZL A;  4C9Y A;  3AKZ A;  3OYB A;  2WY7 Q;  4B48 A;  4DOZ A;  1NG7 A;  1GLN A;  1R6R A;  4XKW A;  3S8P A;  4HSR A;  3A4C A;  3PNT A;  4B44 A;  5KHD A;  1V5E A;  4C2U A;  1X1C A;  3G2B A;  5TGT A;  3K4B A;  1OR7 C;  3DEE A;  4XLH A;  3U21 A;  1X1A A;  3AL0 C;  3LSI A;  4PJJ A;  4EAT A;  4NNJ A;  4Y33 A;  2LY1 A;  4E7K A;  2WAQ A;  3OWT A;  3HOT A;  4RLF A;  4H4K C;  2E5N A;  3RSN A;  4XOT A;  4XN0 A;  4E6K G;  4X0G A;  3H9G A;  3S32 A;  2OV7 A;  2X51 A;  4XKV A;  4CUG A;  2KQR A;  3OYL A;  2R7X A;  2PJR B;  2MYS A;  4XNF A;  1QHH D;  4XLA A;  4D1Q A;  1LFP A;  1WJD A;  4AU7 A;  4F93 B;  2LBF A;  3HKZ A;  3CJQ B;  4Y4R A;  4CCM A;  3SZG A;  2R7U A;  1YE9 A;  2XF6 A;  3K4C A;  2VXZ A;  3SYT A;  2DXI A;  3LMM A;  3RTR A;  4MLO A;  4B3X A;  2VLA A;  3OR1 C;  1EA3 A;  3VYU B;  3OY9 A;  2M7B A;  4BL0 B;  1SFK A;  2VAS A;  1WJF A;  3ZCO A;  3VSL A;  3OS2 A;  3TMO A;  3UNG C;  3PJR A;  3UR3 C;  3SDB A;  4FET A;  3AL0 B;  2IGK A;  1NG6 A;  3KYL A;  4YEL A;  2DCE A;  4E7S A;  4CCO A;  1Z21 A;  4II2 A;  4IKF A;  3HPH A;  2HNH A;  2W82 A;  2E5Z A;  4BQQ A;  3C2H A;  3OYA A;  3H5A A;  3ZR8 X;  1D0Y A;  3OYK A;  4E7J A;  4DJA A;  3TBI A;  3HXL A;  3IUO A;  2XDV A;  1X4P A;  2HVQ A;  3QYF A;  4XON A;  2M4G A;  2LRE A;  3OIP A;  4XLE A;  2MFZ A;  4P1W A;  2PMZ A;  2RNG A;  4J01 A;  1N77 A;  2X1C A;  4ZTF A;  3FBI B;  3OS1 A;  2UV1 A;  5FRM A;  3NWS A;  4PK4 A;  4OWR B;  4OAY A;  3H5N A;  5HNH A;  2LG4 A;  3E1S A;  3H9Q A;  4BEH B;  4U7B A;  4CCJ A;  1DGW Y;  3A1Y A;  3D5R C;  3S3N A;  3CP2 A;  2I8D A;  3FDY A;  2M3A A;  3DTI A;  3DTK A;  2WA0 A;  2Y0S A;  3IP4 B;  2IGN A;  4J00 A;  1D1C A;  2VJ5 A;  5HNF A;  1UAA A;  3W2V A;  1MND A;  2K3P A;  1FMW A;  3ZQQ A;  3H9J A;  3BG7 A;  2KDO A;  2QKL B;  3H35 A;  4BGD A;  2UUZ A;  2NOJ B;  3PFY A;  1AA7 A;  4NQW B;  2V7F A;  4CH7 A;  3AFH A;  4F3Q A;  3K4L A;  3FBN B;  5CQG A;  5FRO A;  3S3O A;  1W36 C;  2CV2 A;  4XL9 A;  2W4S A;  3MKY B;  2R7T A;  3TL4 X;  1Z3X A;  3I9V 2;  4NUB A;  4PFO A;  3LSH A;  2BVL A;  2A6T A;  3D5L A;  2VQG A;  2LY2 A;  4E4H A;  1WFX A;  5CKT A;  3LSM A;  2P0W A;  4BU2 A;  5KNL A;  4F91 B;  3OYH A;  3DKX A;  1JI8 A;  2F4I A;  4F55 A;  2WY8 Q;  3DTE A;  3OYE A;  4E7Z A;  3VYT B;  3DPL C;  3M1C A;  4PJM A;  4KT6 A;  2GOM A;  3HG9 A;  3W2W A;  1DGR M;  4DBQ A;  4JQF A;  1Y6I A;  3C2G A;  2HQA A;  4PJN A;  4HG2 A;  1WJC A;  3QYB A;  3NWT A;  4ITV A;  1X19 A;  2OC6 A;  4E7I A;  1MMA A;  4BJ6 C;  2WAF A;  4BQN A;  4AVZ A;  2O5R A;  2JA2 A;  2KPM A;  3K70 C;  3CZ6 A;  3CJR B;  1T95 A;  2CW7 A;  2VPL A;  1D1A A;  4XKC A;  4LIU A;  4C2T A;  4G6T B;  4ZDL A;  2QKM B;  2X6W A;  4PSX A;  3ZXS A;  2WB1 A;  3K10 A;  4R79 A;  1K6Y A;  3HL2 A;  2OUM A;  4F52 A;  1UG0 A;  2DT6 A;  2XSJ C;  4HPQ A;  4BE2 A;  1BR2 A;  3GBG A;  2IGM A;  2KRH A;  2LBF B;  2F5V A;  2IS4 A;  2X85 A;  4DBR A;  2X1E A;  4DIQ A;  4BDY A;  1U0J A;  2Q1Z B;  2FUG 2;  2A5W A;  1D0X A;  3EUK L;  2V26 A;  1VZ0 A;  4BS9 A;  2W00 A;  4U87 A;  3VYS B;  2XC7 A;  4XR6 A;  2KZV A;  2V1N A;  3KEY A;  3OIQ A;  3OYJ A;  2ZXI A;  3MD2 A;  1Z3Y A;  2KHM A;  4DGW B;  3BCA A;  3K4M A;  2K9M A;  3K4K A;  2XF7 A;  2XF5 A;  4LIT A;  1PJR A;  3H5R A;  3ONQ A;  1YX3 A;  1BR1 A;  1BR4 A;  2VQL A;  4BE1 A;  1FMV A;  2V6E A;  3OL4 A;  1D1B A;  1P9Q C;  4ANJ A;  1WJ5 A;  2IGO A;  1WJB A;  1X4O A;  2IS6 A;  1WJA A;  4CA0 A;  4BAC A;  5LD2 C;  2KP6 A;  1X1B A;  2VQC A;  1WJE A;  3K4N A;  2UWM A;  2LOO A;  5HVQ C;  2IS1 A;  1ERD A;  3VDX A;  2KRC A;  2Q2E B;  3QOD A;  3DWL E;  4PUS A;  2XAU A;  5HOO A;  1BOB A;  2Z2S B;  3OR2 C;  2L5Q A;  3H0D A;  2HZD A;  5JHF A;  3J7A Y;  2ZSI B;  3K70 D;  4RMN A;  2R7V A;  3SEZ A;  5LFA A;  2HDW A;  2R7O A;  3VWB A;  2Z1D A;  2M7A A;  2X6X A;  2KMU A;  2ZSH B;  1MMN A;  3MMY B;  4BQO A;  4BEH A;  2RQQ A;  3BCB A;  4BXF A;  4YRV A;  2HVR A;  3K6G A;  2VJJ A;  2ZXH A;  2VKD A;  2HPM A;  2E1M C;  1LKX A;  4PSW A;  3OYG A;  2E60 A;  2K5C A;  3S93 A;  2HVS A;  3M8J A;  2X1D A;  2L9N A;  4BJ5 C;  4CCL A;  2VJ4 A;  1YX5 A;  2CW8 A;  3W3C A;  2V9K A;  3BLY A;  2W7N A;  4BJT A;  4KIS A;  3PNV A;  1MW7 A;  3CES A;  1E0E A;  4ZYA A;  2DT7 B;  3HPG A;  3D5S C;  1V5F A;  4PFP A;  4XLC A;  1UEL B;  4HNU A;  4II3 A;  4CZC A;  3IAS 2;  3W2A A;  4PJL A;  4RLQ A;  2IXS A;  4ZC3 A;  3OYN A;  2BW3 A;  2M0M A;  2BVM A;  2CUJ A;  4Y3O A;  4BDZ A;  3DU5 A;  4BE0 A;  2CFO A;  4LG3 A;  4HNT A;  3VYR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...