3RSTA

Crystal structure of bacillus subtilis signal peptide peptidase a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
227
Chain Sequence
PSSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKKLEEIKKETKKPIYVSMGSMAASGGYYISTAADKIFATPETLTGSLGVIMESVNYSKLADKLGISFETIKSGAHADIMSPSREMTKEEKNIMQSMVDNSYEGFVDVISKGRGMPKAEVKKIADGRVYDGRQAKKLNLVDELGFYDDTITAMKKDHKDLKNASVISYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus subtilis Signal Peptide Peptidase A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Signal peptide peptidase sppA
total genus 81
structure length 227
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01343 Peptidase_S49 Peptidase family S49
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1750.20 Alpha Beta 3-Layer(aba) Sandwich peptide peptidase (sppa) fold peptide peptidase (sppa) fold 3rstA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3rstA01
5DU6A 4ELXA 3H0SA 4JFCA 3TZ3A 3SWXA 3LKEA 2FW2A 3HINA 3TT6A 3ISAA 1K39A 3LAOA 3GF3A 4KPKA 4U19A 1N6FA 4WZ8B 3MFMA 4FB8A 5MGBA 2BZRA 3G64A 3I47A 5C9GA 3K50A 3P5MA 4U0GH 1FC9A 1FC6A 4B3IA 5DZKH 4JCSA 3MT6A 2QQ3A 4FNBA 2ZL2A 4I42A 4EMMA 3RSTA 5CTCA 3TVWA 3M6NA 4ZU2A 5JBXA 1EF9A 4QIIA 2F9IA 2Q35A 3TT7A 1SG4A 4L8KA 4QFEA 2EJ5A 3T88A 3WG5A 1K32A 5C90A 5DTWA 3Q7HA 4OG1A 4Z0MA 2VSUF 2VX2A 4JSBA 1NZYB 3DORA 1PIXA 3R6HA 3GKBA 4KD6A 5KDRB 5FIFA 4RYFA 1Q51A 2FZSA 3L3SA 4FN7A 2J5GD 4ELWA 3H81A 3BPPA 3GLMA 3QWDA 3QK8A 4JYLA 2GTRA 2PPYA 3RSIA 4DI1A 3P85A 5E0SA 2W3PA 3KQFA 4IZDA 4JOTA 3ZW8A 3HP0A 5KDRA 1JXZA 4Q0GA 4WCZA 3ZW9A 3HLN1 4B3HA 1NZYA 3QXZA 2F9IB 2F6IA 4K2NA 1TYFA 2J5IA 1XNYA 2A7KA 3OT6A 3KTIA 1EY3A 2PG8A 5JBWA 2ZL0A 1W2XA 4FJWD 1YG6A 3VIVA 1XX4A 5G1QA 1WZ8A 3T8AA 2X58A 4MXIA 2VSSE 4ASIA 4U0GA 2UZFA 3MOYA 3GMAA 3DJAA 3ZWCA 5INIA 4JYJA 3R9SA 3TLFA 3QKAA 4U0HA 1UYVA 3IAVA 2DUBA 4JCRA 1XO6A 1DUBA 1YG8A 2CBYA 4NNQA 5E0NX 3QYRA 5DUFA 4K29A 1UYSA 2F9YB 1RJNA 1WDMA 2VSUA 5G1RA 2PBPA 2FBMA 2F9YA 4B3JA 1Y7OA 1OD2A 2VSUC 4ZDFA 3ZWAA 3T8BA 2CE3A 4ZDEA 3T3WA 4GHNA 4JJTA 3FDUA 5DKPA 4EMPA 3HE2A 1WDKA 4F47A 5DTPA 5KJPA 3M6MA 2ZL4A 3PZKA 3JU1A 3R0OA 3BF0A 3H02A 3K8XA 2VREA 3QREA 3KTJA 2DEOA 3U9SB 4ELSA 2VSSF 1FC7A 3QXIA 1UIYA 4ZDDA 1WDLA 1OD4A 4YLHA 1RJMA 2NP9A 3PGQA 4OMRA 1UYTA 3PEAA 4IZBA 5DU8A 2ZL3A 4MOUA 1VRGA 3NJBA 3U9RB 4KWBA 1DCIA 4ZDBA 1MJ3A 3V5IA 5INGA 2J5IB 5DU4A 2A81A 2J5II 3HRXA 2J5SA 3KTGA 1HZDA 3ST9A 3RRVA 3ZWBA 1X0UA 2A7SA 3T89A 2VSSA 3QMJA 4JCTA 3V5EA 4L6WA 1XNWA 3MYBA 4FZWA 4QIJA 4FN8A 3NJDA 1HNOA 1O8UA 3PE8A 3BEZA 3STAA 2VSUE 3OC7A 3OMEA 3P2LA 2J5GA 4LK5A 3N6RB 1UYRA 3IBBA 3TV5A 5DZKA 4ZDCA 3KTHA 4WYOB 1XNVA 4JVTA 4IZCA 1FCFA 5INFA 4JWVA 1ON9A 3TRRA 2HW5A 5IKLB 4Q1IA 1HNUA 4EMLA 2Q34A 4I52A 4FNDA 4K3WA 1J7XA 1TG6A 2X24A 4KNPA 1ON3A 1N6EA 5E0SH 4MI2A 2IEXA 5FUSA 2ZQRA 4FZWC 4I4ZA 2C8TA 4U18A 3TDCA 3H0QA 5DUCA 4HNKA 4U1AA 3FF6A 4RYFH 5DL1A 4JCQA 5CTBA 3Q0GA 3GF7A 3IB9A 1PJHA 4HC8A 4G2RA 2D3TA 4NEKA 3U9TB 2Q2XA 1N6DA 1Q52A 4GM2A 4OLQA 3SLLA 2ZQQA 3R9QA 2F6QA 1EF8A 3H0JA 3R9TA 3Q0JA 4RCNA 3H0UA 3TVUA 1SZOA 3Q1TA 3KTKA 5G1SA 2WTBA
chains in the Genus database with same CATH superfamily
5DU6A 4ELXA 3H0SA 4JFCA 3TZ3A 3SWXA 3BPTA 3LKEA 2FW2A 3HINA 3TT6A 3ISAA 1K39A 3LAOA 3GF3A 4KPKA 4U19A 1N6FA 4WZ8B 3MFMA 4FB8A 5MGBA 2BZRA 3G64A 3I47A 5C9GA 3K50A 3P5MA 4U0GH 1FC9A 1FC6A 4B3IA 5DZKH 4JCSA 3MT6A 2QQ3A 4FNBA 2ZL2A 4I42A 4EMMA 3RSTA 5CTCA 3TVWA 3M6NA 4ZU2A 5JBXA 1EF9A 4QIIA 2F9IA 2Q35A 3TT7A 1SG4A 4L8KA 4QFEA 2EJ5A 3T88A 3WG5A 1K32A 5C90A 5DTWA 3Q7HA 4OG1A 4Z0MA 2VSUF 2VX2A 4JSBA 1NZYB 3DORA 1PIXA 3R6HA 3GKBA 4KD6A 5KDRB 5FIFA 4RYFA 1Q51A 2FZSA 3L3SA 4FN7A 2J5GD 4ELWA 3H81A 3BPPA 3GLMA 5HUQA 3QWDA 3QK8A 4JYLA 2GTRA 2PPYA 3RSIA 4DI1A 3P85A 5E0SA 2W3PA 3KQFA 4IZDA 4JOTA 3ZW8A 3HP0A 5KDRA 1JXZA 4Q0GA 4WCZA 3ZW9A 3HLN1 4B3HA 1NZYA 3QXZA 2F9IB 2F6IA 4K2NA 1TYFA 2J5IA 1XNYA 2A7KA 3OT6A 3KTIA 1EY3A 2PG8A 5JBWA 2ZL0A 1W2XA 4FJWD 1YG6A 3VIVA 1XX4A 5G1QA 1WZ8A 3T8AA 2X58A 4MXIA 2VSSE 4ASIA 4U0GA 2UZFA 3MOYA 3GMAA 3DJAA 3ZWCA 5INIA 4JYJA 3R9SA 3TLFA 3QKAA 4U0HA 1UYVA 3IAVA 2DUBA 4JCRA 2YJGA 1XO6A 1DUBA 1YG8A 2CBYA 4NNQA 5E0NX 3QYRA 5DUFA 4K29A 1UYSA 2F9YB 1RJNA 1WDMA 2VSUA 5G1RA 2PBPA 2FBMA 2F9YA 4B3JA 1Y7OA 1OD2A 2VSUC 4ZDFA 3ZWAA 3T8BA 2CE3A 4ZDEA 3T3WA 4GHNA 4JJTA 3FDUA 5DKPA 4EMPA 3HE2A 1WDKA 4F47A 5DTPA 5KJPA 3M6MA 2ZL4A 3PZKA 3JU1A 3R0OA 3BF0A 3H02A 3K8XA 2VREA 3QREA 3KTJA 2DEOA 3U9SB 4ELSA 2VSSF 1FC7A 3QXIA 1UIYA 4ZDDA 1WDLA 1OD4A 4YLHA 1RJMA 2NP9A 3PGQA 4OMRA 1UYTA 3PEAA 4IZBA 5DU8A 2ZL3A 4MOUA 1VRGA 3NJBA 3U9RB 4KWBA 1DCIA 4ZDBA 1MJ3A 3V5IA 5INGA 2J5IB 5DU4A 2A81A 2J5II 3HRXA 2J5SA 3KTGA 1HZDA 3ST9A 3RRVA 3ZWBA 1X0UA 2A7SA 4NARA 3T89A 2VSSA 3QMJA 4JCTA 3V5EA 4L6WA 1XNWA 3MYBA 4FZWA 4QIJA 4FN8A 3NJDA 1HNOA 1O8UA 3PE8A 3BEZA 3STAA 2VSUE 3OC7A 3OMEA 3P2LA 2J5GA 4LK5A 3N6RB 1UYRA 3IBBA 3TV5A 5DZKA 4ZDCA 3KTHA 4WYOB 1XNVA 4JVTA 4IZCA 1FCFA 5INFA 4JWVA 1ON9A 3TRRA 2HW5A 5IKLB 4Q1IA 1HNUA 4J2UA 4EMLA 2Q34A 4I52A 4FNDA 4K3WA 1J7XA 1TG6A 2X24A 4KNPA 1ON3A 1N6EA 5E0SH 4MI2A 2IEXA 5FUSA 2ZQRA 4FZWC 4I4ZA 2C8TA 4U18A 3TDCA 3H0QA 5DUCA 4HNKA 4U1AA 3FF6A 4RYFH 5DL1A 4JCQA 5CTBA 3Q0GA 3GF7A 3IB9A 1PJHA 4HC8A 4G2RA 2D3TA 4NEKA 3U9TB 2Q2XA 1N6DA 1Q52A 4GM2A 4OLQA 3SLLA 2ZQQA 4HDTA 3R9QA 2F6QA 1EF8A 3H0JA 3R9TA 3Q0JA 4RCNA 3H0UA 3TVUA 1SZOA 3Q1TA 3KTKA 5G1SA 2WTBA
chains in the Genus database with same CATH topology
5DU6A 4ELXA 3H0SA 4JFCA 3TZ3A 3SWXA 3BPTA 3LKEA 2FW2A 3HINA 3TT6A 3ISAA 1K39A 3LAOA 3GF3A 4KPKA 4U19A 1N6FA 4WZ8B 3MFMA 4FB8A 5MGBA 2BZRA 3G64A 3I47A 5C9GA 3K50A 3P5MA 4U0GH 1FC9A 1FC6A 4B3IA 5DZKH 4JCSA 3MT6A 2QQ3A 4FNBA 2ZL2A 4I42A 4EMMA 3RSTA 5CTCA 3TVWA 3M6NA 4ZU2A 5JBXA 1EF9A 4QIIA 2F9IA 2Q35A 3TT7A 1SG4A 4L8KA 4QFEA 2EJ5A 3T88A 3WG5A 1K32A 5C90A 5DTWA 3Q7HA 4OG1A 4Z0MA 2VSUF 2VX2A 4JSBA 1NZYB 3DORA 1PIXA 3R6HA 3GKBA 4KD6A 5KDRB 5FIFA 4RYFA 1Q51A 2FZSA 3L3SA 4FN7A 2J5GD 4ELWA 3H81A 3BPPA 3GLMA 5HUQA 3QWDA 3QK8A 4JYLA 2GTRA 2PPYA 3RSIA 4DI1A 3P85A 5E0SA 2W3PA 3KQFA 4IZDA 4JOTA 3ZW8A 3HP0A 5KDRA 1JXZA 4Q0GA 4WCZA 3ZW9A 3HLN1 4B3HA 1NZYA 3QXZA 2F9IB 2F6IA 4K2NA 1TYFA 2J5IA 1XNYA 2A7KA 3OT6A 3KTIA 1EY3A 2PG8A 5JBWA 2ZL0A 1W2XA 4FJWD 1YG6A 3VIVA 1XX4A 5G1QA 1WZ8A 3T8AA 2X58A 4MXIA 2VSSE 4ASIA 4U0GA 2UZFA 3MOYA 3GMAA 3DJAA 3ZWCA 5INIA 4JYJA 3R9SA 3TLFA 3QKAA 4U0HA 1UYVA 3IAVA 2DUBA 4JCRA 2YJGA 1XO6A 1DUBA 1YG8A 2CBYA 4NNQA 5E0NX 3QYRA 5DUFA 4K29A 1UYSA 2F9YB 1RJNA 1WDMA 2VSUA 5G1RA 2PBPA 2FBMA 2F9YA 4B3JA 1Y7OA 1OD2A 2VSUC 4ZDFA 3ZWAA 3T8BA 2CE3A 4ZDEA 3T3WA 4GHNA 4JJTA 3FDUA 5DKPA 4EMPA 3HE2A 1WDKA 4F47A 5DTPA 5KJPA 3M6MA 2ZL4A 3PZKA 3JU1A 3R0OA 3BF0A 3H02A 3K8XA 2VREA 3QREA 3KTJA 2DEOA 3U9SB 4ELSA 2VSSF 1FC7A 3QXIA 1UIYA 4ZDDA 1WDLA 1OD4A 4YLHA 1RJMA 2NP9A 3PGQA 4OMRA 1UYTA 3PEAA 4IZBA 5DU8A 2ZL3A 4MOUA 1VRGA 3NJBA 3U9RB 4KWBA 1DCIA 4ZDBA 1MJ3A 3V5IA 5INGA 2J5IB 5DU4A 2A81A 2J5II 3HRXA 2J5SA 3KTGA 1HZDA 3ST9A 3RRVA 3ZWBA 1X0UA 2A7SA 4NARA 3T89A 2VSSA 3QMJA 4JCTA 3V5EA 4L6WA 1XNWA 3MYBA 4FZWA 4QIJA 4FN8A 3NJDA 1HNOA 1O8UA 3PE8A 3BEZA 3STAA 2VSUE 3OC7A 3OMEA 3P2LA 2J5GA 4LK5A 3N6RB 1UYRA 3IBBA 3TV5A 5DZKA 4ZDCA 3KTHA 4WYOB 1XNVA 4JVTA 4IZCA 1FCFA 5INFA 4JWVA 1ON9A 3TRRA 2HW5A 5IKLB 4Q1IA 1HNUA 4J2UA 4EMLA 2Q34A 4I52A 4FNDA 4K3WA 1J7XA 1TG6A 2X24A 4KNPA 1ON3A 1N6EA 5E0SH 4MI2A 2IEXA 5FUSA 2ZQRA 4FZWC 4I4ZA 2C8TA 4U18A 3TDCA 3H0QA 5DUCA 4HNKA 4U1AA 3FF6A 4RYFH 5DL1A 4JCQA 5CTBA 3Q0GA 3GF7A 3IB9A 1PJHA 4HC8A 4G2RA 2D3TA 4NEKA 3U9TB 2Q2XA 1N6DA 1Q52A 4GM2A 4OLQA 3SLLA 2ZQQA 4HDTA 3R9QA 2F6QA 1EF8A 3H0JA 3R9TA 3Q0JA 4RCNA 3H0UA 3TVUA 1SZOA 3Q1TA 3KTKA 5G1SA 2WTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DU6 A;  4ELX A;  3H0S A;  4JFC A;  3TZ3 A;  3SWX A;  3LKE A;  2FW2 A;  3HIN A;  3TT6 A;  3ISA A;  1K39 A;  3LAO A;  3GF3 A;  4KPK A;  4U19 A;  1N6F A;  4WZ8 B;  3MFM A;  4FB8 A;  5MGB A;  2BZR A;  3G64 A;  3I47 A;  5C9G A;  3K50 A;  3P5M A;  4U0G H;  1FC9 A;  1FC6 A;  4B3I A;  5DZK H;  4JCS A;  3MT6 A;  2QQ3 A;  4FNB A;  2ZL2 A;  4I42 A;  4EMM A;  3RST A;  5CTC A;  3TVW A;  3M6N A;  4ZU2 A;  5JBX A;  1EF9 A;  4QII A;  2F9I A;  2Q35 A;  3TT7 A;  1SG4 A;  4L8K A;  4QFE A;  2EJ5 A;  3T88 A;  3WG5 A;  1K32 A;  5C90 A;  5DTW A;  3Q7H A;  4OG1 A;  4Z0M A;  2VSU F;  2VX2 A;  4JSB A;  1NZY B;  3DOR A;  1PIX A;  3R6H A;  3GKB A;  4KD6 A;  5KDR B;  5FIF A;  4RYF A;  1Q51 A;  2FZS A;  3L3S A;  4FN7 A;  2J5G D;  4ELW A;  3H81 A;  3BPP A;  3GLM A;  3QWD A;  3QK8 A;  4JYL A;  2GTR A;  2PPY A;  3RSI A;  4DI1 A;  3P85 A;  5E0S A;  2W3P A;  3KQF A;  4IZD A;  4JOT A;  3ZW8 A;  3HP0 A;  5KDR A;  1JXZ A;  4Q0G A;  4WCZ A;  3ZW9 A;  3HLN 1;  4B3H A;  1NZY A;  3QXZ A;  2F9I B;  2F6I A;  4K2N A;  1TYF A;  2J5I A;  1XNY A;  2A7K A;  3OT6 A;  3KTI A;  1EY3 A;  2PG8 A;  5JBW A;  2ZL0 A;  1W2X A;  4FJW D;  1YG6 A;  3VIV A;  1XX4 A;  5G1Q A;  1WZ8 A;  3T8A A;  2X58 A;  4MXI A;  2VSS E;  4ASI A;  4U0G A;  2UZF A;  3MOY A;  3GMA A;  3DJA A;  3ZWC A;  5INI A;  4JYJ A;  3R9S A;  3TLF A;  3QKA A;  4U0H A;  1UYV A;  3IAV A;  2DUB A;  4JCR A;  1XO6 A;  1DUB A;  1YG8 A;  2CBY A;  4NNQ A;  5E0N X;  3QYR A;  5DUF A;  4K29 A;  1UYS A;  2F9Y B;  1RJN A;  1WDM A;  2VSU A;  5G1R A;  2PBP A;  2FBM A;  2F9Y A;  4B3J A;  1Y7O A;  1OD2 A;  2VSU C;  4ZDF A;  3ZWA A;  3T8B A;  2CE3 A;  4ZDE A;  3T3W A;  4GHN A;  4JJT A;  3FDU A;  5DKP A;  4EMP A;  3HE2 A;  1WDK A;  4F47 A;  5DTP A;  5KJP A;  3M6M A;  2ZL4 A;  3PZK A;  3JU1 A;  3R0O A;  3BF0 A;  3H02 A;  3K8X A;  2VRE A;  3QRE A;  3KTJ A;  2DEO A;  3U9S B;  4ELS A;  2VSS F;  1FC7 A;  3QXI A;  1UIY A;  4ZDD A;  1WDL A;  1OD4 A;  4YLH A;  1RJM A;  2NP9 A;  3PGQ A;  4OMR A;  1UYT A;  3PEA A;  4IZB A;  5DU8 A;  2ZL3 A;  4MOU A;  1VRG A;  3NJB A;  3U9R B;  4KWB A;  1DCI A;  4ZDB A;  1MJ3 A;  3V5I A;  5ING A;  2J5I B;  5DU4 A;  2A81 A;  2J5I I;  3HRX A;  2J5S A;  3KTG A;  1HZD A;  3ST9 A;  3RRV A;  3ZWB A;  1X0U A;  2A7S A;  3T89 A;  2VSS A;  3QMJ A;  4JCT A;  3V5E A;  4L6W A;  1XNW A;  3MYB A;  4FZW A;  4QIJ A;  4FN8 A;  3NJD A;  1HNO A;  1O8U A;  3PE8 A;  3BEZ A;  3STA A;  2VSU E;  3OC7 A;  3OME A;  3P2L A;  2J5G A;  4LK5 A;  3N6R B;  1UYR A;  3IBB A;  3TV5 A;  5DZK A;  4ZDC A;  3KTH A;  4WYO B;  1XNV A;  4JVT A;  4IZC A;  1FCF A;  5INF A;  4JWV A;  1ON9 A;  3TRR A;  2HW5 A;  5IKL B;  4Q1I A;  1HNU A;  4EML A;  2Q34 A;  4I52 A;  4FND A;  4K3W A;  1J7X A;  1TG6 A;  2X24 A;  4KNP A;  1ON3 A;  1N6E A;  5E0S H;  4MI2 A;  2IEX A;  5FUS A;  2ZQR A;  4FZW C;  4I4Z A;  2C8T A;  4U18 A;  3TDC A;  3H0Q A;  5DUC A;  4HNK A;  4U1A A;  3FF6 A;  4RYF H;  5DL1 A;  4JCQ A;  5CTB A;  3Q0G A;  3GF7 A;  3IB9 A;  1PJH A;  4HC8 A;  4G2R A;  2D3T A;  4NEK A;  3U9T B;  2Q2X A;  1N6D A;  1Q52 A;  4GM2 A;  4OLQ A;  3SLL A;  2ZQQ A;  3R9Q A;  2F6Q A;  1EF8 A;  3H0J A;  3R9T A;  3Q0J A;  4RCN A;  3H0U A;  3TVU A;  1SZO A;  3Q1T A;  3KTK A;  5G1S A;  2WTB A; 
#chains in the Genus database with same CATH topology
 5DU6 A;  4ELX A;  3H0S A;  4JFC A;  3TZ3 A;  3SWX A;  3BPT A;  3LKE A;  2FW2 A;  3HIN A;  3TT6 A;  3ISA A;  1K39 A;  3LAO A;  3GF3 A;  4KPK A;  4U19 A;  1N6F A;  4WZ8 B;  3MFM A;  4FB8 A;  5MGB A;  2BZR A;  3G64 A;  3I47 A;  5C9G A;  3K50 A;  3P5M A;  4U0G H;  1FC9 A;  1FC6 A;  4B3I A;  5DZK H;  4JCS A;  3MT6 A;  2QQ3 A;  4FNB A;  2ZL2 A;  4I42 A;  4EMM A;  3RST A;  5CTC A;  3TVW A;  3M6N A;  4ZU2 A;  5JBX A;  1EF9 A;  4QII A;  2F9I A;  2Q35 A;  3TT7 A;  1SG4 A;  4L8K A;  4QFE A;  2EJ5 A;  3T88 A;  3WG5 A;  1K32 A;  5C90 A;  5DTW A;  3Q7H A;  4OG1 A;  4Z0M A;  2VSU F;  2VX2 A;  4JSB A;  1NZY B;  3DOR A;  1PIX A;  3R6H A;  3GKB A;  4KD6 A;  5KDR B;  5FIF A;  4RYF A;  1Q51 A;  2FZS A;  3L3S A;  4FN7 A;  2J5G D;  4ELW A;  3H81 A;  3BPP A;  3GLM A;  5HUQ A;  3QWD A;  3QK8 A;  4JYL A;  2GTR A;  2PPY A;  3RSI A;  4DI1 A;  3P85 A;  5E0S A;  2W3P A;  3KQF A;  4IZD A;  4JOT A;  3ZW8 A;  3HP0 A;  5KDR A;  1JXZ A;  4Q0G A;  4WCZ A;  3ZW9 A;  3HLN 1;  4B3H A;  1NZY A;  3QXZ A;  2F9I B;  2F6I A;  4K2N A;  1TYF A;  2J5I A;  1XNY A;  2A7K A;  3OT6 A;  3KTI A;  1EY3 A;  2PG8 A;  5JBW A;  2ZL0 A;  1W2X A;  4FJW D;  1YG6 A;  3VIV A;  1XX4 A;  5G1Q A;  1WZ8 A;  3T8A A;  2X58 A;  4MXI A;  2VSS E;  4ASI A;  4U0G A;  2UZF A;  3MOY A;  3GMA A;  3DJA A;  3ZWC A;  5INI A;  4JYJ A;  3R9S A;  3TLF A;  3QKA A;  4U0H A;  1UYV A;  3IAV A;  2DUB A;  4JCR A;  2YJG A;  1XO6 A;  1DUB A;  1YG8 A;  2CBY A;  4NNQ A;  5E0N X;  3QYR A;  5DUF A;  4K29 A;  1UYS A;  2F9Y B;  1RJN A;  1WDM A;  2VSU A;  5G1R A;  2PBP A;  2FBM A;  2F9Y A;  4B3J A;  1Y7O A;  1OD2 A;  2VSU C;  4ZDF A;  3ZWA A;  3T8B A;  2CE3 A;  4ZDE A;  3T3W A;  4GHN A;  4JJT A;  3FDU A;  5DKP A;  4EMP A;  3HE2 A;  1WDK A;  4F47 A;  5DTP A;  5KJP A;  3M6M A;  2ZL4 A;  3PZK A;  3JU1 A;  3R0O A;  3BF0 A;  3H02 A;  3K8X A;  2VRE A;  3QRE A;  3KTJ A;  2DEO A;  3U9S B;  4ELS A;  2VSS F;  1FC7 A;  3QXI A;  1UIY A;  4ZDD A;  1WDL A;  1OD4 A;  4YLH A;  1RJM A;  2NP9 A;  3PGQ A;  4OMR A;  1UYT A;  3PEA A;  4IZB A;  5DU8 A;  2ZL3 A;  4MOU A;  1VRG A;  3NJB A;  3U9R B;  4KWB A;  1DCI A;  4ZDB A;  1MJ3 A;  3V5I A;  5ING A;  2J5I B;  5DU4 A;  2A81 A;  2J5I I;  3HRX A;  2J5S A;  3KTG A;  1HZD A;  3ST9 A;  3RRV A;  3ZWB A;  1X0U A;  2A7S A;  4NAR A;  3T89 A;  2VSS A;  3QMJ A;  4JCT A;  3V5E A;  4L6W A;  1XNW A;  3MYB A;  4FZW A;  4QIJ A;  4FN8 A;  3NJD A;  1HNO A;  1O8U A;  3PE8 A;  3BEZ A;  3STA A;  2VSU E;  3OC7 A;  3OME A;  3P2L A;  2J5G A;  4LK5 A;  3N6R B;  1UYR A;  3IBB A;  3TV5 A;  5DZK A;  4ZDC A;  3KTH A;  4WYO B;  1XNV A;  4JVT A;  4IZC A;  1FCF A;  5INF A;  4JWV A;  1ON9 A;  3TRR A;  2HW5 A;  5IKL B;  4Q1I A;  1HNU A;  4J2U A;  4EML A;  2Q34 A;  4I52 A;  4FND A;  4K3W A;  1J7X A;  1TG6 A;  2X24 A;  4KNP A;  1ON3 A;  1N6E A;  5E0S H;  4MI2 A;  2IEX A;  5FUS A;  2ZQR A;  4FZW C;  4I4Z A;  2C8T A;  4U18 A;  3TDC A;  3H0Q A;  5DUC A;  4HNK A;  4U1A A;  3FF6 A;  4RYF H;  5DL1 A;  4JCQ A;  5CTB A;  3Q0G A;  3GF7 A;  3IB9 A;  1PJH A;  4HC8 A;  4G2R A;  2D3T A;  4NEK A;  3U9T B;  2Q2X A;  1N6D A;  1Q52 A;  4GM2 A;  4OLQ A;  3SLL A;  2ZQQ A;  4HDT A;  3R9Q A;  2F6Q A;  1EF8 A;  3H0J A;  3R9T A;  3Q0J A;  4RCN A;  3H0U A;  3TVU A;  1SZO A;  3Q1T A;  3KTK A;  5G1S A;  2WTB A; 
#chains in the Genus database with same CATH homology
 5DU6 A;  4ELX A;  3H0S A;  4JFC A;  3TZ3 A;  3SWX A;  3BPT A;  3LKE A;  2FW2 A;  3HIN A;  3TT6 A;  3ISA A;  1K39 A;  3LAO A;  3GF3 A;  4KPK A;  4U19 A;  1N6F A;  4WZ8 B;  3MFM A;  4FB8 A;  5MGB A;  2BZR A;  3G64 A;  3I47 A;  5C9G A;  3K50 A;  3P5M A;  4U0G H;  1FC9 A;  1FC6 A;  4B3I A;  5DZK H;  4JCS A;  3MT6 A;  2QQ3 A;  4FNB A;  2ZL2 A;  4I42 A;  4EMM A;  3RST A;  5CTC A;  3TVW A;  3M6N A;  4ZU2 A;  5JBX A;  1EF9 A;  4QII A;  2F9I A;  2Q35 A;  3TT7 A;  1SG4 A;  4L8K A;  4QFE A;  2EJ5 A;  3T88 A;  3WG5 A;  1K32 A;  5C90 A;  5DTW A;  3Q7H A;  4OG1 A;  4Z0M A;  2VSU F;  2VX2 A;  4JSB A;  1NZY B;  3DOR A;  1PIX A;  3R6H A;  3GKB A;  4KD6 A;  5KDR B;  5FIF A;  4RYF A;  1Q51 A;  2FZS A;  3L3S A;  4FN7 A;  2J5G D;  4ELW A;  3H81 A;  3BPP A;  3GLM A;  5HUQ A;  3QWD A;  3QK8 A;  4JYL A;  2GTR A;  2PPY A;  3RSI A;  4DI1 A;  3P85 A;  5E0S A;  2W3P A;  3KQF A;  4IZD A;  4JOT A;  3ZW8 A;  3HP0 A;  5KDR A;  1JXZ A;  4Q0G A;  4WCZ A;  3ZW9 A;  3HLN 1;  4B3H A;  1NZY A;  3QXZ A;  2F9I B;  2F6I A;  4K2N A;  1TYF A;  2J5I A;  1XNY A;  2A7K A;  3OT6 A;  3KTI A;  1EY3 A;  2PG8 A;  5JBW A;  2ZL0 A;  1W2X A;  4FJW D;  1YG6 A;  3VIV A;  1XX4 A;  5G1Q A;  1WZ8 A;  3T8A A;  2X58 A;  4MXI A;  2VSS E;  4ASI A;  4U0G A;  2UZF A;  3MOY A;  3GMA A;  3DJA A;  3ZWC A;  5INI A;  4JYJ A;  3R9S A;  3TLF A;  3QKA A;  4U0H A;  1UYV A;  3IAV A;  2DUB A;  4JCR A;  2YJG A;  1XO6 A;  1DUB A;  1YG8 A;  2CBY A;  4NNQ A;  5E0N X;  3QYR A;  5DUF A;  4K29 A;  1UYS A;  2F9Y B;  1RJN A;  1WDM A;  2VSU A;  5G1R A;  2PBP A;  2FBM A;  2F9Y A;  4B3J A;  1Y7O A;  1OD2 A;  2VSU C;  4ZDF A;  3ZWA A;  3T8B A;  2CE3 A;  4ZDE A;  3T3W A;  4GHN A;  4JJT A;  3FDU A;  5DKP A;  4EMP A;  3HE2 A;  1WDK A;  4F47 A;  5DTP A;  5KJP A;  3M6M A;  2ZL4 A;  3PZK A;  3JU1 A;  3R0O A;  3BF0 A;  3H02 A;  3K8X A;  2VRE A;  3QRE A;  3KTJ A;  2DEO A;  3U9S B;  4ELS A;  2VSS F;  1FC7 A;  3QXI A;  1UIY A;  4ZDD A;  1WDL A;  1OD4 A;  4YLH A;  1RJM A;  2NP9 A;  3PGQ A;  4OMR A;  1UYT A;  3PEA A;  4IZB A;  5DU8 A;  2ZL3 A;  4MOU A;  1VRG A;  3NJB A;  3U9R B;  4KWB A;  1DCI A;  4ZDB A;  1MJ3 A;  3V5I A;  5ING A;  2J5I B;  5DU4 A;  2A81 A;  2J5I I;  3HRX A;  2J5S A;  3KTG A;  1HZD A;  3ST9 A;  3RRV A;  3ZWB A;  1X0U A;  2A7S A;  4NAR A;  3T89 A;  2VSS A;  3QMJ A;  4JCT A;  3V5E A;  4L6W A;  1XNW A;  3MYB A;  4FZW A;  4QIJ A;  4FN8 A;  3NJD A;  1HNO A;  1O8U A;  3PE8 A;  3BEZ A;  3STA A;  2VSU E;  3OC7 A;  3OME A;  3P2L A;  2J5G A;  4LK5 A;  3N6R B;  1UYR A;  3IBB A;  3TV5 A;  5DZK A;  4ZDC A;  3KTH A;  4WYO B;  1XNV A;  4JVT A;  4IZC A;  1FCF A;  5INF A;  4JWV A;  1ON9 A;  3TRR A;  2HW5 A;  5IKL B;  4Q1I A;  1HNU A;  4J2U A;  4EML A;  2Q34 A;  4I52 A;  4FND A;  4K3W A;  1J7X A;  1TG6 A;  2X24 A;  4KNP A;  1ON3 A;  1N6E A;  5E0S H;  4MI2 A;  2IEX A;  5FUS A;  2ZQR A;  4FZW C;  4I4Z A;  2C8T A;  4U18 A;  3TDC A;  3H0Q A;  5DUC A;  4HNK A;  4U1A A;  3FF6 A;  4RYF H;  5DL1 A;  4JCQ A;  5CTB A;  3Q0G A;  3GF7 A;  3IB9 A;  1PJH A;  4HC8 A;  4G2R A;  2D3T A;  4NEK A;  3U9T B;  2Q2X A;  1N6D A;  1Q52 A;  4GM2 A;  4OLQ A;  3SLL A;  2ZQQ A;  4HDT A;  3R9Q A;  2F6Q A;  1EF8 A;  3H0J A;  3R9T A;  3Q0J A;  4RCN A;  3H0U A;  3TVU A;  1SZO A;  3Q1T A;  3KTK A;  5G1S A;  2WTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...