3RSTA

Crystal structure of bacillus subtilis signal peptide peptidase a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
227
Chain Sequence
b'PSSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKKLEEIKKETKKPIYVSMGSMAASGGYYISTAADKIFATPETLTGSLGVIMESVNYSKLADKLGISFETIKSGAHADIMSPSREMTKEEKNIMQSMVDNSYEGFVDVISKGRGMPKAEVKKIADGRVYDGRQAKKLNLVDELGFYDDTITAMKKDHKDLKNASVISYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal peptide peptidase sppA
publication title Crystal Structure of Bacillus subtilis Signal Peptide Peptidase A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 81
structure length 227
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01343 Peptidase_S49 Peptidase family S49
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1750.20 Alpha Beta 3-Layer(aba) Sandwich peptide peptidase (sppa) fold peptide peptidase (sppa) fold 3rstA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3rstA01
4FN7A 2VREA 5FUSA 3K8XA 4DI1A 2PBPA 3TRRA 5DUCA 4G2RA 4U1AA 2W3PA 3R0OA 4Q0GA 2J5GD 4JCQA 2F9IB 1EY3A 4ELWA 3IAVA 2CE3A 3ZWCA 2Q2XA 2ZL3A 5DZKH 4FNBA 4IZCA 2VSSA 3BF0A 4RCNA 3I47A 2F6QA 3R6HA 4U19A 3K50A 5E0SH 3RRVA 1WZ8A 3KTIA 2J5GA 4L8KA 3PZKA 2PG8A 2FZSA 2J5II 3R9QA 4JCSA 5INFA 4KWBA 3SWXA 1O8UA 1PIXA 2F9YA 5E0NX 2PPYA 3QXIA 1K32A 1XNWA 2F9YB 1WDKA 2VSUF 4I52A 1TYFA 1OD2A 4GHNA 1FCFA 3Q1TA 2A81A 4WZ8B 4Q1IA 3TDCA 3T88A 3TZ3A 4F47A 4WCZA 3OMEA 5DTPA 4YLHA 3KTJA 3JU1A 2VSUE 4Z0MA 1WDMA 1HZDA 2HW5A 3H0UA 3H0SA 3GF3A 2IEXA 3STAA 4U18A 4JYJA 4ZDBA 4QIIA 4ELSA 4IZDA 5MGBA 5DZKA 3H81A 5G1QA 4QFEA 1J7XA 3VIVA 1JXZA 2DUBA 2ZL4A 2F9IA 5DUFA 1W2XA 3GMAA 3HINA 4B3IA 2C8TA 5E0SA 4JVTA 4ASIA 3P5MA 1EF9A 2X24A 1Q51A 3HE2A 4JCTA 5DKPA 4K2NA 3P85A 4WYOB 3ISAA 2J5IA 1NZYB 3TVUA 4RYFH 3QXZA 3T8BA 3Q0GA 4K29A 4HC8A 1N6DA 3R9SA 5KDRB 3SLLA 4GM2A 3GKBA 2J5IB 3KQFA 3DORA 4JYLA 4KNPA 3T3WA 4JOTA 2FW2A 5C9GA 2VSSF 5DU8A 1UYTA 4EMLA 1YG8A 3HRXA 4U0GH 3DJAA 4U0HA 4EMPA 3Q0JA 3V5IA 5CTCA 1RJMA 1OD4A 3TLFA 1Q52A 1HNOA 4MOUA 3U9SB 3NJBA 4OG1A 4MXIA 2J5SA 2VSSE 3QMJA 3IBBA 3H0JA 2Q35A 3MT6A 3QYRA 3WG5A 3LAOA 1FC9A 1Y7OA 3FF6A 4FB8A 2QQ3A 1UYVA 2ZQQA 1K39A 3BPPA 1N6EA 5FIFA 3U9TB 2ZL2A 4ZDCA 3TV5A 5DL1A 2WTBA 4I4ZA 5KJPA 3H02A 4LK5A 2UZFA 1FC6A 1VRGA 1XNYA 2CBYA 1UYRA 2F6IA 2D3TA 3V5EA 1XNVA 4B3JA 4RYFA 5C90A 4MI2A 2DEOA 1HNUA 4JWVA 1UIYA 1DUBA 2FBMA 2ZL0A 5DTWA 4NNQA 4K3WA 1SZOA 1NZYA 3FDUA 3G64A 3PEAA 3T8AA 4HNKA 5DU4A 3M6MA 3KTGA 1EF8A 4U0GA 3HLN1 5KDRA 1ON9A 3ZWBA 1MJ3A 3LKEA 3PGQA 5JBXA 4ZDFA 5INGA 4NEKA 2VSUC 4OMRA 3IB9A 5DU6A 4EMMA 1X0UA 3L3SA 3QREA 3U9RB 3H0QA 3RSTA 3KTHA 3Q7HA 4I42A 3MFMA 3GLMA 3QWDA 1XO6A 1PJHA 3MYBA 4OLQA 2X58A 3MOYA 4ELXA 3KTKA 3NJDA 4JSBA 3ST9A 3P2LA 4FNDA 5JBWA 3TT6A 5CTBA 4KD6A 5G1SA 4FJWD 2VSUA 4FZWC 5IKLB 1XX4A 5G1RA 3BEZA 3TVWA 3TT7A 3N6RB 2Q34A 3M6NA 2A7KA 3R9TA 4KPKA 3QKAA 1YG6A 3GF7A 2EJ5A 4FN8A 3ZW8A 2GTRA 3RSIA 4QIJA 1WDLA 2ZQRA 3ZW9A 4JCRA 5INIA 4FZWA 4IZBA 2NP9A 1SG4A 3HP0A 2A7SA 3QK8A 4JJTA 4ZU2A 3OC7A 1UYSA 1ON3A 4B3HA 3ZWAA 4ZDDA 1DCIA 1FC7A 3T89A 3OT6A 2BZRA 4ZDEA 1RJNA 1TG6A 3PE8A 1N6FA 4JFCA 4L6WA 2VX2A
chains in the Genus database with same CATH superfamily
4FN7A 2VREA 5FUSA 3K8XA 4DI1A 2PBPA 3TRRA 5DUCA 4G2RA 4U1AA 2W3PA 3R0OA 4Q0GA 2J5GD 4JCQA 2F9IB 1EY3A 4ELWA 3IAVA 2CE3A 3ZWCA 2Q2XA 2ZL3A 5DZKH 4FNBA 5HUQA 4IZCA 2VSSA 3BF0A 4RCNA 3I47A 2F6QA 3R6HA 4U19A 3K50A 5E0SH 3RRVA 1WZ8A 3KTIA 2J5GA 4L8KA 3PZKA 2PG8A 2FZSA 2J5II 3R9QA 4JCSA 5INFA 4KWBA 3SWXA 1O8UA 1PIXA 2F9YA 5E0NX 2PPYA 3QXIA 1K32A 1XNWA 2F9YB 1WDKA 2VSUF 4I52A 1TYFA 1OD2A 4GHNA 1FCFA 3Q1TA 2A81A 4WZ8B 4Q1IA 3TDCA 3T88A 3TZ3A 4F47A 4WCZA 3OMEA 5DTPA 4YLHA 3KTJA 3JU1A 2VSUE 4Z0MA 1WDMA 1HZDA 2HW5A 3H0UA 3H0SA 3BPTA 3GF3A 2IEXA 3STAA 4U18A 2YJGA 4JYJA 4ZDBA 4QIIA 4ELSA 4IZDA 5MGBA 5DZKA 3H81A 5G1QA 4QFEA 1J7XA 3VIVA 1JXZA 2DUBA 2ZL4A 2F9IA 5DUFA 1W2XA 3GMAA 3HINA 4B3IA 2C8TA 5E0SA 4JVTA 4ASIA 3P5MA 1EF9A 2X24A 1Q51A 3HE2A 4JCTA 5DKPA 4K2NA 3P85A 4WYOB 3ISAA 2J5IA 1NZYB 3TVUA 4RYFH 3QXZA 3T8BA 3Q0GA 4K29A 4HC8A 1N6DA 3R9SA 5KDRB 3SLLA 4GM2A 3GKBA 2J5IB 3KQFA 3DORA 4JYLA 4KNPA 3T3WA 4JOTA 2FW2A 5C9GA 2VSSF 5DU8A 1UYTA 4EMLA 1YG8A 3HRXA 4U0GH 3DJAA 4U0HA 4EMPA 3Q0JA 3V5IA 5CTCA 1RJMA 1OD4A 3TLFA 4NARA 1Q52A 1HNOA 4MOUA 3U9SB 3NJBA 4OG1A 4MXIA 2J5SA 2VSSE 3QMJA 3IBBA 3H0JA 2Q35A 3MT6A 3QYRA 3WG5A 3LAOA 1FC9A 1Y7OA 3FF6A 4FB8A 2QQ3A 1UYVA 2ZQQA 1K39A 4HDTA 3BPPA 1N6EA 5FIFA 3U9TB 2ZL2A 4ZDCA 3TV5A 5DL1A 2WTBA 4I4ZA 5KJPA 3H02A 4LK5A 2UZFA 1FC6A 1VRGA 1XNYA 2CBYA 1UYRA 2F6IA 2D3TA 3V5EA 1XNVA 4B3JA 4RYFA 5C90A 4MI2A 2DEOA 1HNUA 4JWVA 1UIYA 1DUBA 2FBMA 4J2UA 2ZL0A 5DTWA 4NNQA 4K3WA 1SZOA 1NZYA 3FDUA 3G64A 3PEAA 3T8AA 4HNKA 5DU4A 3M6MA 3KTGA 1EF8A 4U0GA 3HLN1 5KDRA 1ON9A 3ZWBA 1MJ3A 3LKEA 3PGQA 5JBXA 4ZDFA 5INGA 4NEKA 2VSUC 4OMRA 3IB9A 5DU6A 4EMMA 1X0UA 3L3SA 3QREA 3U9RB 3H0QA 3RSTA 3KTHA 3Q7HA 4I42A 3MFMA 3GLMA 3QWDA 1XO6A 1PJHA 3MYBA 4OLQA 2X58A 3MOYA 4ELXA 3KTKA 3NJDA 4JSBA 3ST9A 3P2LA 4FNDA 5JBWA 3TT6A 5CTBA 4KD6A 5G1SA 4FJWD 2VSUA 4FZWC 5IKLB 1XX4A 5G1RA 3BEZA 3TVWA 3TT7A 3N6RB 2Q34A 3M6NA 2A7KA 3R9TA 4KPKA 3QKAA 1YG6A 3GF7A 2EJ5A 4FN8A 3ZW8A 2GTRA 3RSIA 4QIJA 1WDLA 2ZQRA 3ZW9A 4JCRA 5INIA 4FZWA 4IZBA 2NP9A 1SG4A 3HP0A 2A7SA 3QK8A 4JJTA 4ZU2A 3OC7A 1UYSA 1ON3A 4B3HA 3ZWAA 4ZDDA 1DCIA 1FC7A 3T89A 3OT6A 2BZRA 4ZDEA 1RJNA 1TG6A 3PE8A 1N6FA 4JFCA 4L6WA 2VX2A
chains in the Genus database with same CATH topology
4FN7A 2VREA 5FUSA 3K8XA 4DI1A 2PBPA 3TRRA 5DUCA 4G2RA 4U1AA 2W3PA 3R0OA 4Q0GA 2J5GD 4JCQA 2F9IB 1EY3A 4ELWA 3IAVA 2CE3A 3ZWCA 2Q2XA 2ZL3A 5DZKH 4FNBA 5HUQA 4IZCA 2VSSA 3BF0A 4RCNA 3I47A 2F6QA 3R6HA 4U19A 3K50A 5E0SH 3RRVA 1WZ8A 3KTIA 2J5GA 4L8KA 3PZKA 2PG8A 2FZSA 2J5II 3R9QA 4JCSA 5INFA 4KWBA 3SWXA 1O8UA 1PIXA 2F9YA 5E0NX 2PPYA 3QXIA 1K32A 1XNWA 2F9YB 1WDKA 2VSUF 4I52A 1TYFA 1OD2A 4GHNA 1FCFA 3Q1TA 2A81A 4WZ8B 4Q1IA 3TDCA 3T88A 3TZ3A 4F47A 4WCZA 3OMEA 5DTPA 4YLHA 3KTJA 3JU1A 2VSUE 4Z0MA 1WDMA 1HZDA 2HW5A 3H0UA 3H0SA 3BPTA 3GF3A 2IEXA 3STAA 4U18A 2YJGA 4JYJA 4ZDBA 4QIIA 4ELSA 4IZDA 5MGBA 5DZKA 3H81A 5G1QA 4QFEA 1J7XA 3VIVA 1JXZA 2DUBA 2ZL4A 2F9IA 5DUFA 1W2XA 3GMAA 3HINA 4B3IA 2C8TA 5E0SA 4JVTA 4ASIA 3P5MA 1EF9A 2X24A 1Q51A 3HE2A 4JCTA 5DKPA 4K2NA 3P85A 4WYOB 3ISAA 2J5IA 1NZYB 3TVUA 4RYFH 3QXZA 3T8BA 3Q0GA 4K29A 4HC8A 1N6DA 3R9SA 5KDRB 3SLLA 4GM2A 3GKBA 2J5IB 3KQFA 3DORA 4JYLA 4KNPA 3T3WA 4JOTA 2FW2A 5C9GA 2VSSF 5DU8A 1UYTA 4EMLA 1YG8A 3HRXA 4U0GH 3DJAA 4U0HA 4EMPA 3Q0JA 3V5IA 5CTCA 1RJMA 1OD4A 3TLFA 4NARA 1Q52A 1HNOA 4MOUA 3U9SB 3NJBA 4OG1A 4MXIA 2J5SA 2VSSE 3QMJA 3IBBA 3H0JA 2Q35A 3MT6A 3QYRA 3WG5A 3LAOA 1FC9A 1Y7OA 3FF6A 4FB8A 2QQ3A 1UYVA 2ZQQA 1K39A 4HDTA 3BPPA 1N6EA 5FIFA 3U9TB 2ZL2A 4ZDCA 3TV5A 5DL1A 2WTBA 4I4ZA 5KJPA 3H02A 4LK5A 2UZFA 1FC6A 1VRGA 1XNYA 2CBYA 1UYRA 2F6IA 2D3TA 3V5EA 1XNVA 4B3JA 4RYFA 5C90A 4MI2A 2DEOA 1HNUA 4JWVA 1UIYA 1DUBA 2FBMA 4J2UA 2ZL0A 5DTWA 4NNQA 4K3WA 1SZOA 1NZYA 3FDUA 3G64A 3PEAA 3T8AA 4HNKA 5DU4A 3M6MA 3KTGA 1EF8A 4U0GA 3HLN1 5KDRA 1ON9A 3ZWBA 1MJ3A 3LKEA 3PGQA 5JBXA 4ZDFA 5INGA 4NEKA 2VSUC 4OMRA 3IB9A 5DU6A 4EMMA 1X0UA 3L3SA 3QREA 3U9RB 3H0QA 3RSTA 3KTHA 3Q7HA 4I42A 3MFMA 3GLMA 3QWDA 1XO6A 1PJHA 3MYBA 4OLQA 2X58A 3MOYA 4ELXA 3KTKA 3NJDA 4JSBA 3ST9A 3P2LA 4FNDA 5JBWA 3TT6A 5CTBA 4KD6A 5G1SA 4FJWD 2VSUA 4FZWC 5IKLB 1XX4A 5G1RA 3BEZA 3TVWA 3TT7A 3N6RB 2Q34A 3M6NA 2A7KA 3R9TA 4KPKA 3QKAA 1YG6A 3GF7A 2EJ5A 4FN8A 3ZW8A 2GTRA 3RSIA 4QIJA 1WDLA 2ZQRA 3ZW9A 4JCRA 5INIA 4FZWA 4IZBA 2NP9A 1SG4A 3HP0A 2A7SA 3QK8A 4JJTA 4ZU2A 3OC7A 1UYSA 1ON3A 4B3HA 3ZWAA 4ZDDA 1DCIA 1FC7A 3T89A 3OT6A 2BZRA 4ZDEA 1RJNA 1TG6A 3PE8A 1N6FA 4JFCA 4L6WA 2VX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN7 A;  2VRE A;  5FUS A;  3K8X A;  4DI1 A;  2PBP A;  3TRR A;  5DUC A;  4G2R A;  4U1A A;  2W3P A;  3R0O A;  4Q0G A;  2J5G D;  4JCQ A;  2F9I B;  1EY3 A;  4ELW A;  3IAV A;  2CE3 A;  3ZWC A;  2Q2X A;  2ZL3 A;  5DZK H;  4FNB A;  4IZC A;  2VSS A;  3BF0 A;  4RCN A;  3I47 A;  2F6Q A;  3R6H A;  4U19 A;  3K50 A;  5E0S H;  3RRV A;  1WZ8 A;  3KTI A;  2J5G A;  4L8K A;  3PZK A;  2PG8 A;  2FZS A;  2J5I I;  3R9Q A;  4JCS A;  5INF A;  4KWB A;  3SWX A;  1O8U A;  1PIX A;  2F9Y A;  5E0N X;  2PPY A;  3QXI A;  1K32 A;  1XNW A;  2F9Y B;  1WDK A;  2VSU F;  4I52 A;  1TYF A;  1OD2 A;  4GHN A;  1FCF A;  3Q1T A;  2A81 A;  4WZ8 B;  4Q1I A;  3TDC A;  3T88 A;  3TZ3 A;  4F47 A;  4WCZ A;  3OME A;  5DTP A;  4YLH A;  3KTJ A;  3JU1 A;  2VSU E;  4Z0M A;  1WDM A;  1HZD A;  2HW5 A;  3H0U A;  3H0S A;  3GF3 A;  2IEX A;  3STA A;  4U18 A;  4JYJ A;  4ZDB A;  4QII A;  4ELS A;  4IZD A;  5MGB A;  5DZK A;  3H81 A;  5G1Q A;  4QFE A;  1J7X A;  3VIV A;  1JXZ A;  2DUB A;  2ZL4 A;  2F9I A;  5DUF A;  1W2X A;  3GMA A;  3HIN A;  4B3I A;  2C8T A;  5E0S A;  4JVT A;  4ASI A;  3P5M A;  1EF9 A;  2X24 A;  1Q51 A;  3HE2 A;  4JCT A;  5DKP A;  4K2N A;  3P85 A;  4WYO B;  3ISA A;  2J5I A;  1NZY B;  3TVU A;  4RYF H;  3QXZ A;  3T8B A;  3Q0G A;  4K29 A;  4HC8 A;  1N6D A;  3R9S A;  5KDR B;  3SLL A;  4GM2 A;  3GKB A;  2J5I B;  3KQF A;  3DOR A;  4JYL A;  4KNP A;  3T3W A;  4JOT A;  2FW2 A;  5C9G A;  2VSS F;  5DU8 A;  1UYT A;  4EML A;  1YG8 A;  3HRX A;  4U0G H;  3DJA A;  4U0H A;  4EMP A;  3Q0J A;  3V5I A;  5CTC A;  1RJM A;  1OD4 A;  3TLF A;  1Q52 A;  1HNO A;  4MOU A;  3U9S B;  3NJB A;  4OG1 A;  4MXI A;  2J5S A;  2VSS E;  3QMJ A;  3IBB A;  3H0J A;  2Q35 A;  3MT6 A;  3QYR A;  3WG5 A;  3LAO A;  1FC9 A;  1Y7O A;  3FF6 A;  4FB8 A;  2QQ3 A;  1UYV A;  2ZQQ A;  1K39 A;  3BPP A;  1N6E A;  5FIF A;  3U9T B;  2ZL2 A;  4ZDC A;  3TV5 A;  5DL1 A;  2WTB A;  4I4Z A;  5KJP A;  3H02 A;  4LK5 A;  2UZF A;  1FC6 A;  1VRG A;  1XNY A;  2CBY A;  1UYR A;  2F6I A;  2D3T A;  3V5E A;  1XNV A;  4B3J A;  4RYF A;  5C90 A;  4MI2 A;  2DEO A;  1HNU A;  4JWV A;  1UIY A;  1DUB A;  2FBM A;  2ZL0 A;  5DTW A;  4NNQ A;  4K3W A;  1SZO A;  1NZY A;  3FDU A;  3G64 A;  3PEA A;  3T8A A;  4HNK A;  5DU4 A;  3M6M A;  3KTG A;  1EF8 A;  4U0G A;  3HLN 1;  5KDR A;  1ON9 A;  3ZWB A;  1MJ3 A;  3LKE A;  3PGQ A;  5JBX A;  4ZDF A;  5ING A;  4NEK A;  2VSU C;  4OMR A;  3IB9 A;  5DU6 A;  4EMM A;  1X0U A;  3L3S A;  3QRE A;  3U9R B;  3H0Q A;  3RST A;  3KTH A;  3Q7H A;  4I42 A;  3MFM A;  3GLM A;  3QWD A;  1XO6 A;  1PJH A;  3MYB A;  4OLQ A;  2X58 A;  3MOY A;  4ELX A;  3KTK A;  3NJD A;  4JSB A;  3ST9 A;  3P2L A;  4FND A;  5JBW A;  3TT6 A;  5CTB A;  4KD6 A;  5G1S A;  4FJW D;  2VSU A;  4FZW C;  5IKL B;  1XX4 A;  5G1R A;  3BEZ A;  3TVW A;  3TT7 A;  3N6R B;  2Q34 A;  3M6N A;  2A7K A;  3R9T A;  4KPK A;  3QKA A;  1YG6 A;  3GF7 A;  2EJ5 A;  4FN8 A;  3ZW8 A;  2GTR A;  3RSI A;  4QIJ A;  1WDL A;  2ZQR A;  3ZW9 A;  4JCR A;  5INI A;  4FZW A;  4IZB A;  2NP9 A;  1SG4 A;  3HP0 A;  2A7S A;  3QK8 A;  4JJT A;  4ZU2 A;  3OC7 A;  1UYS A;  1ON3 A;  4B3H A;  3ZWA A;  4ZDD A;  1DCI A;  1FC7 A;  3T89 A;  3OT6 A;  2BZR A;  4ZDE A;  1RJN A;  1TG6 A;  3PE8 A;  1N6F A;  4JFC A;  4L6W A;  2VX2 A; 
#chains in the Genus database with same CATH topology
 4FN7 A;  2VRE A;  5FUS A;  3K8X A;  4DI1 A;  2PBP A;  3TRR A;  5DUC A;  4G2R A;  4U1A A;  2W3P A;  3R0O A;  4Q0G A;  2J5G D;  4JCQ A;  2F9I B;  1EY3 A;  4ELW A;  3IAV A;  2CE3 A;  3ZWC A;  2Q2X A;  2ZL3 A;  5DZK H;  4FNB A;  5HUQ A;  4IZC A;  2VSS A;  3BF0 A;  4RCN A;  3I47 A;  2F6Q A;  3R6H A;  4U19 A;  3K50 A;  5E0S H;  3RRV A;  1WZ8 A;  3KTI A;  2J5G A;  4L8K A;  3PZK A;  2PG8 A;  2FZS A;  2J5I I;  3R9Q A;  4JCS A;  5INF A;  4KWB A;  3SWX A;  1O8U A;  1PIX A;  2F9Y A;  5E0N X;  2PPY A;  3QXI A;  1K32 A;  1XNW A;  2F9Y B;  1WDK A;  2VSU F;  4I52 A;  1TYF A;  1OD2 A;  4GHN A;  1FCF A;  3Q1T A;  2A81 A;  4WZ8 B;  4Q1I A;  3TDC A;  3T88 A;  3TZ3 A;  4F47 A;  4WCZ A;  3OME A;  5DTP A;  4YLH A;  3KTJ A;  3JU1 A;  2VSU E;  4Z0M A;  1WDM A;  1HZD A;  2HW5 A;  3H0U A;  3H0S A;  3BPT A;  3GF3 A;  2IEX A;  3STA A;  4U18 A;  2YJG A;  4JYJ A;  4ZDB A;  4QII A;  4ELS A;  4IZD A;  5MGB A;  5DZK A;  3H81 A;  5G1Q A;  4QFE A;  1J7X A;  3VIV A;  1JXZ A;  2DUB A;  2ZL4 A;  2F9I A;  5DUF A;  1W2X A;  3GMA A;  3HIN A;  4B3I A;  2C8T A;  5E0S A;  4JVT A;  4ASI A;  3P5M A;  1EF9 A;  2X24 A;  1Q51 A;  3HE2 A;  4JCT A;  5DKP A;  4K2N A;  3P85 A;  4WYO B;  3ISA A;  2J5I A;  1NZY B;  3TVU A;  4RYF H;  3QXZ A;  3T8B A;  3Q0G A;  4K29 A;  4HC8 A;  1N6D A;  3R9S A;  5KDR B;  3SLL A;  4GM2 A;  3GKB A;  2J5I B;  3KQF A;  3DOR A;  4JYL A;  4KNP A;  3T3W A;  4JOT A;  2FW2 A;  5C9G A;  2VSS F;  5DU8 A;  1UYT A;  4EML A;  1YG8 A;  3HRX A;  4U0G H;  3DJA A;  4U0H A;  4EMP A;  3Q0J A;  3V5I A;  5CTC A;  1RJM A;  1OD4 A;  3TLF A;  4NAR A;  1Q52 A;  1HNO A;  4MOU A;  3U9S B;  3NJB A;  4OG1 A;  4MXI A;  2J5S A;  2VSS E;  3QMJ A;  3IBB A;  3H0J A;  2Q35 A;  3MT6 A;  3QYR A;  3WG5 A;  3LAO A;  1FC9 A;  1Y7O A;  3FF6 A;  4FB8 A;  2QQ3 A;  1UYV A;  2ZQQ A;  1K39 A;  4HDT A;  3BPP A;  1N6E A;  5FIF A;  3U9T B;  2ZL2 A;  4ZDC A;  3TV5 A;  5DL1 A;  2WTB A;  4I4Z A;  5KJP A;  3H02 A;  4LK5 A;  2UZF A;  1FC6 A;  1VRG A;  1XNY A;  2CBY A;  1UYR A;  2F6I A;  2D3T A;  3V5E A;  1XNV A;  4B3J A;  4RYF A;  5C90 A;  4MI2 A;  2DEO A;  1HNU A;  4JWV A;  1UIY A;  1DUB A;  2FBM A;  4J2U A;  2ZL0 A;  5DTW A;  4NNQ A;  4K3W A;  1SZO A;  1NZY A;  3FDU A;  3G64 A;  3PEA A;  3T8A A;  4HNK A;  5DU4 A;  3M6M A;  3KTG A;  1EF8 A;  4U0G A;  3HLN 1;  5KDR A;  1ON9 A;  3ZWB A;  1MJ3 A;  3LKE A;  3PGQ A;  5JBX A;  4ZDF A;  5ING A;  4NEK A;  2VSU C;  4OMR A;  3IB9 A;  5DU6 A;  4EMM A;  1X0U A;  3L3S A;  3QRE A;  3U9R B;  3H0Q A;  3RST A;  3KTH A;  3Q7H A;  4I42 A;  3MFM A;  3GLM A;  3QWD A;  1XO6 A;  1PJH A;  3MYB A;  4OLQ A;  2X58 A;  3MOY A;  4ELX A;  3KTK A;  3NJD A;  4JSB A;  3ST9 A;  3P2L A;  4FND A;  5JBW A;  3TT6 A;  5CTB A;  4KD6 A;  5G1S A;  4FJW D;  2VSU A;  4FZW C;  5IKL B;  1XX4 A;  5G1R A;  3BEZ A;  3TVW A;  3TT7 A;  3N6R B;  2Q34 A;  3M6N A;  2A7K A;  3R9T A;  4KPK A;  3QKA A;  1YG6 A;  3GF7 A;  2EJ5 A;  4FN8 A;  3ZW8 A;  2GTR A;  3RSI A;  4QIJ A;  1WDL A;  2ZQR A;  3ZW9 A;  4JCR A;  5INI A;  4FZW A;  4IZB A;  2NP9 A;  1SG4 A;  3HP0 A;  2A7S A;  3QK8 A;  4JJT A;  4ZU2 A;  3OC7 A;  1UYS A;  1ON3 A;  4B3H A;  3ZWA A;  4ZDD A;  1DCI A;  1FC7 A;  3T89 A;  3OT6 A;  2BZR A;  4ZDE A;  1RJN A;  1TG6 A;  3PE8 A;  1N6F A;  4JFC A;  4L6W A;  2VX2 A; 
#chains in the Genus database with same CATH homology
 4FN7 A;  2VRE A;  5FUS A;  3K8X A;  4DI1 A;  2PBP A;  3TRR A;  5DUC A;  4G2R A;  4U1A A;  2W3P A;  3R0O A;  4Q0G A;  2J5G D;  4JCQ A;  2F9I B;  1EY3 A;  4ELW A;  3IAV A;  2CE3 A;  3ZWC A;  2Q2X A;  2ZL3 A;  5DZK H;  4FNB A;  5HUQ A;  4IZC A;  2VSS A;  3BF0 A;  4RCN A;  3I47 A;  2F6Q A;  3R6H A;  4U19 A;  3K50 A;  5E0S H;  3RRV A;  1WZ8 A;  3KTI A;  2J5G A;  4L8K A;  3PZK A;  2PG8 A;  2FZS A;  2J5I I;  3R9Q A;  4JCS A;  5INF A;  4KWB A;  3SWX A;  1O8U A;  1PIX A;  2F9Y A;  5E0N X;  2PPY A;  3QXI A;  1K32 A;  1XNW A;  2F9Y B;  1WDK A;  2VSU F;  4I52 A;  1TYF A;  1OD2 A;  4GHN A;  1FCF A;  3Q1T A;  2A81 A;  4WZ8 B;  4Q1I A;  3TDC A;  3T88 A;  3TZ3 A;  4F47 A;  4WCZ A;  3OME A;  5DTP A;  4YLH A;  3KTJ A;  3JU1 A;  2VSU E;  4Z0M A;  1WDM A;  1HZD A;  2HW5 A;  3H0U A;  3H0S A;  3BPT A;  3GF3 A;  2IEX A;  3STA A;  4U18 A;  2YJG A;  4JYJ A;  4ZDB A;  4QII A;  4ELS A;  4IZD A;  5MGB A;  5DZK A;  3H81 A;  5G1Q A;  4QFE A;  1J7X A;  3VIV A;  1JXZ A;  2DUB A;  2ZL4 A;  2F9I A;  5DUF A;  1W2X A;  3GMA A;  3HIN A;  4B3I A;  2C8T A;  5E0S A;  4JVT A;  4ASI A;  3P5M A;  1EF9 A;  2X24 A;  1Q51 A;  3HE2 A;  4JCT A;  5DKP A;  4K2N A;  3P85 A;  4WYO B;  3ISA A;  2J5I A;  1NZY B;  3TVU A;  4RYF H;  3QXZ A;  3T8B A;  3Q0G A;  4K29 A;  4HC8 A;  1N6D A;  3R9S A;  5KDR B;  3SLL A;  4GM2 A;  3GKB A;  2J5I B;  3KQF A;  3DOR A;  4JYL A;  4KNP A;  3T3W A;  4JOT A;  2FW2 A;  5C9G A;  2VSS F;  5DU8 A;  1UYT A;  4EML A;  1YG8 A;  3HRX A;  4U0G H;  3DJA A;  4U0H A;  4EMP A;  3Q0J A;  3V5I A;  5CTC A;  1RJM A;  1OD4 A;  3TLF A;  4NAR A;  1Q52 A;  1HNO A;  4MOU A;  3U9S B;  3NJB A;  4OG1 A;  4MXI A;  2J5S A;  2VSS E;  3QMJ A;  3IBB A;  3H0J A;  2Q35 A;  3MT6 A;  3QYR A;  3WG5 A;  3LAO A;  1FC9 A;  1Y7O A;  3FF6 A;  4FB8 A;  2QQ3 A;  1UYV A;  2ZQQ A;  1K39 A;  4HDT A;  3BPP A;  1N6E A;  5FIF A;  3U9T B;  2ZL2 A;  4ZDC A;  3TV5 A;  5DL1 A;  2WTB A;  4I4Z A;  5KJP A;  3H02 A;  4LK5 A;  2UZF A;  1FC6 A;  1VRG A;  1XNY A;  2CBY A;  1UYR A;  2F6I A;  2D3T A;  3V5E A;  1XNV A;  4B3J A;  4RYF A;  5C90 A;  4MI2 A;  2DEO A;  1HNU A;  4JWV A;  1UIY A;  1DUB A;  2FBM A;  4J2U A;  2ZL0 A;  5DTW A;  4NNQ A;  4K3W A;  1SZO A;  1NZY A;  3FDU A;  3G64 A;  3PEA A;  3T8A A;  4HNK A;  5DU4 A;  3M6M A;  3KTG A;  1EF8 A;  4U0G A;  3HLN 1;  5KDR A;  1ON9 A;  3ZWB A;  1MJ3 A;  3LKE A;  3PGQ A;  5JBX A;  4ZDF A;  5ING A;  4NEK A;  2VSU C;  4OMR A;  3IB9 A;  5DU6 A;  4EMM A;  1X0U A;  3L3S A;  3QRE A;  3U9R B;  3H0Q A;  3RST A;  3KTH A;  3Q7H A;  4I42 A;  3MFM A;  3GLM A;  3QWD A;  1XO6 A;  1PJH A;  3MYB A;  4OLQ A;  2X58 A;  3MOY A;  4ELX A;  3KTK A;  3NJD A;  4JSB A;  3ST9 A;  3P2L A;  4FND A;  5JBW A;  3TT6 A;  5CTB A;  4KD6 A;  5G1S A;  4FJW D;  2VSU A;  4FZW C;  5IKL B;  1XX4 A;  5G1R A;  3BEZ A;  3TVW A;  3TT7 A;  3N6R B;  2Q34 A;  3M6N A;  2A7K A;  3R9T A;  4KPK A;  3QKA A;  1YG6 A;  3GF7 A;  2EJ5 A;  4FN8 A;  3ZW8 A;  2GTR A;  3RSI A;  4QIJ A;  1WDL A;  2ZQR A;  3ZW9 A;  4JCR A;  5INI A;  4FZW A;  4IZB A;  2NP9 A;  1SG4 A;  3HP0 A;  2A7S A;  3QK8 A;  4JJT A;  4ZU2 A;  3OC7 A;  1UYS A;  1ON3 A;  4B3H A;  3ZWA A;  4ZDD A;  1DCI A;  1FC7 A;  3T89 A;  3OT6 A;  2BZR A;  4ZDE A;  1RJN A;  1TG6 A;  3PE8 A;  1N6F A;  4JFC A;  4L6W A;  2VX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...