3RSTA

Crystal structure of bacillus subtilis signal peptide peptidase a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
227
Chain Sequence
PSSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKKLEEIKKETKKPIYVSMGSMAASGGYYISTAADKIFATPETLTGSLGVIMESVNYSKLADKLGISFETIKSGAHADIMSPSREMTKEEKNIMQSMVDNSYEGFVDVISKGRGMPKAEVKKIADGRVYDGRQAKKLNLVDELGFYDDTITAMKKDHKDLKNASVISYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus subtilis Signal Peptide Peptidase A.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Signal peptide peptidase sppA
total genus 81
structure length 227
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01343 Peptidase_S49 Peptidase family S49
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1750.20 Alpha Beta 3-Layer(aba) Sandwich peptide peptidase (sppa) fold peptide peptidase (sppa) fold 3rstA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3rstA01
3OT6A 5INGA 2F9IB 3PEAA 5MGBA 1FC9A 3TV5A 1W2XA 5CTBA 2VSSE 4G2RA 1YG8A 2FW2A 4FZWC 3Q1TA 3GLMA 2EJ5A 3QKAA 3ZW8A 4GM2A 3RRVA 2HW5A 3QYRA 4I52A 4WCZA 4F47A 4JCRA 4JJTA 1N6DA 2X24A 3KTJA 4KPKA 3PGQA 3OMEA 1FC6A 4ASIA 1WDMA 1ON9A 5FUSA 3R0OA 3QK8A 4K2NA 4U0HA 4ELSA 4DI1A 3ISAA 5C90A 3MOYA 4I4ZA 3MT6A 3L3SA 3N6RB 1RJMA 2Q35A 1WZ8A 1EF8A 2QQ3A 3M6NA 1WDLA 3SLLA 2VREA 4L6WA 3H0QA 3TVWA 1PIXA 4QFEA 4WZ8B 3KQFA 1X0UA 4Q0GA 3T3WA 5FIFA 2WTBA 3KTKA 2DUBA 1SZOA 1HZDA 4K3WA 2VX2A 2W3PA 1PJHA 3GKBA 2VSUE 4GHNA 2ZL3A 2PG8A 3BF0A 4FN7A 4IZCA 3V5IA 2ZL0A 4YLHA 1EY3A 2F6IA 4KD6A 4MOUA 1J7XA 5DUCA 1XNWA 1VRGA 3Q0GA 4B3JA 3P5MA 4ZDBA 3GF3A 5DKPA 4JYLA 2Q34A 2A7KA 2J5GA 2ZL2A 2NP9A 3P2LA 4JYJA 1FC7A 1XO6A 3QXZA 3TT7A 3NJBA 4EMLA 5DTPA 3HLN1 3U9TB 5KJPA 4U19A 4K29A 3H0JA 1NZYB 2ZQQA 4JWVA 5KDRB 4FNDA 5DTWA 3VIVA 3TDCA 2Q2XA 3H0SA 5DL1A 3LKEA 4NEKA 3TZ3A 2X58A 4U0GA 5KDRA 1UYTA 3IB9A 3Q0JA 1ON3A 3DJAA 4HC8A 3HP0A 5DUFA 5INIA 2D3TA 3BPPA 4QIIA 1HNUA 4U0GH 3MFMA 4QIJA 1OD2A 5E0SA 2F9IA 5G1QA 3I47A 3TVUA 2VSSF 3BEZA 1K32A 1Q52A 4FN8A 3MYBA 3STAA 4ELXA 3Q7HA 2F9YB 3P85A 3KTIA 4FB8A 2J5SA 3IAVA 1RJNA 1JXZA 2J5IA 2VSSA 5DU8A 3T88A 5DZKA 3TT6A 4RYFH 3ZWCA 3PE8A 4U18A 5DU6A 3U9RB 2VSUC 4IZBA 4IZDA 3V5EA 3RSTA 5DU4A 2FBMA 2FZSA 4FNBA 3TLFA 4JCTA 3H81A 1UYSA 4FJWD 3R9QA 3KTGA 2DEOA 3SWXA 4HNKA 4U1AA 3GMAA 4Q1IA 4KNPA 4I42A 2GTRA 1UYVA 3QMJA 1SG4A 3HINA 1FCFA 4KWBA 4L8KA 3OC7A 5JBWA 2VSUF 3GF7A 3QXIA 1O8UA 4NNQA 1DCIA 1DUBA 4JSBA 4EMPA 3FF6A 3HRXA 3ZWBA 3G64A 3ZWAA 4OMRA 3WG5A 4RYFA 1N6EA 2IEXA 4ZDFA 4RCNA 2J5IB 4JCQA 3RSIA 2J5II 2PBPA 3U9SB 1HNOA 1K39A 3T8AA 3JU1A 3KTHA 3FDUA 4ZDEA 1MJ3A 3K50A 3K8XA 5C9GA 3QWDA 3M6MA 4ZDCA 2A81A 1N6FA 4MXIA 1XX4A 2A7SA 1XNYA 4B3HA 3T89A 3H02A 2PPYA 4LK5A 4OLQA 1UYRA 4ZDDA 5CTCA 2C8TA 1WDKA 1EF9A 5DZKH 4JFCA 3IBBA 4MI2A 3R9SA 5IKLB 3TRRA 4OG1A 1TYFA 3T8BA 1TG6A 3PZKA 4WYOB 4FZWA 4ELWA 3LAOA 1NZYA 1Y7OA 2UZFA 3QREA 3ST9A 1UIYA 2VSUA 3H0UA 2CE3A 3NJDA 3R9TA 3DORA 4ZU2A 4JOTA 2ZL4A 5JBXA 5G1RA 4B3IA 5E0SH 4JVTA 2J5GD 2ZQRA 1OD4A 1YG6A 5INFA 1Q51A 2F9YA 5E0NX 2BZRA 4EMMA 1XNVA 4Z0MA 3ZW9A 5G1SA 3R6HA 4JCSA 2CBYA 2F6QA 3HE2A
chains in the Genus database with same CATH superfamily
3OT6A 5INGA 2F9IB 3PEAA 5MGBA 1FC9A 3TV5A 1W2XA 5CTBA 2VSSE 4G2RA 1YG8A 2FW2A 4FZWC 3Q1TA 3GLMA 2EJ5A 3QKAA 3ZW8A 4GM2A 3RRVA 2HW5A 3QYRA 4I52A 4WCZA 4F47A 4JCRA 4JJTA 1N6DA 2X24A 3KTJA 4KPKA 3PGQA 3OMEA 1FC6A 4ASIA 1WDMA 1ON9A 5HUQA 5FUSA 3R0OA 3QK8A 4K2NA 4U0HA 4ELSA 4DI1A 3ISAA 5C90A 3MOYA 4I4ZA 3MT6A 3L3SA 3N6RB 1RJMA 2Q35A 1WZ8A 1EF8A 2QQ3A 3M6NA 1WDLA 3SLLA 2VREA 4L6WA 3H0QA 3TVWA 1PIXA 4QFEA 4WZ8B 3KQFA 1X0UA 4Q0GA 3T3WA 5FIFA 2WTBA 3KTKA 2DUBA 1SZOA 1HZDA 4K3WA 2VX2A 2W3PA 1PJHA 3GKBA 2VSUE 4GHNA 2ZL3A 2PG8A 3BF0A 4FN7A 4IZCA 3V5IA 2ZL0A 4YLHA 1EY3A 2F6IA 4KD6A 4MOUA 1J7XA 5DUCA 1XNWA 1VRGA 3Q0GA 4B3JA 3P5MA 4ZDBA 3GF3A 5DKPA 4JYLA 2Q34A 2A7KA 2J5GA 2ZL2A 2NP9A 3P2LA 4JYJA 1FC7A 1XO6A 3QXZA 3TT7A 3NJBA 4EMLA 5DTPA 4NARA 3HLN1 3U9TB 5KJPA 4U19A 4K29A 3H0JA 1NZYB 2ZQQA 4JWVA 5KDRB 4FNDA 5DTWA 3VIVA 3TDCA 2Q2XA 3H0SA 5DL1A 3LKEA 4NEKA 3TZ3A 2X58A 4U0GA 5KDRA 1UYTA 3IB9A 3Q0JA 1ON3A 3DJAA 4HC8A 3HP0A 5DUFA 5INIA 2D3TA 3BPPA 4QIIA 1HNUA 4U0GH 3MFMA 4QIJA 1OD2A 5E0SA 2F9IA 5G1QA 3I47A 3TVUA 2VSSF 3BEZA 4HDTA 1K32A 1Q52A 4FN8A 3MYBA 3STAA 4ELXA 3Q7HA 2F9YB 3P85A 3KTIA 4FB8A 2J5SA 3IAVA 1RJNA 1JXZA 2J5IA 2VSSA 5DU8A 3T88A 5DZKA 3TT6A 4RYFH 3ZWCA 3PE8A 4U18A 5DU6A 3U9RB 2VSUC 4IZBA 4IZDA 3V5EA 3RSTA 5DU4A 2FBMA 2FZSA 4FNBA 3TLFA 4JCTA 3BPTA 3H81A 1UYSA 4FJWD 3R9QA 3KTGA 2DEOA 3SWXA 4HNKA 4U1AA 3GMAA 4Q1IA 4KNPA 4I42A 2GTRA 1UYVA 3QMJA 1SG4A 3HINA 1FCFA 4KWBA 4L8KA 3OC7A 5JBWA 2VSUF 3GF7A 3QXIA 1O8UA 4NNQA 1DCIA 1DUBA 4JSBA 4EMPA 3FF6A 3HRXA 3ZWBA 3G64A 3ZWAA 4OMRA 3WG5A 4RYFA 1N6EA 2IEXA 4ZDFA 4RCNA 2J5IB 4JCQA 3RSIA 2J5II 2PBPA 3U9SB 1HNOA 1K39A 3T8AA 3JU1A 3KTHA 3FDUA 4ZDEA 1MJ3A 3K50A 3K8XA 5C9GA 3QWDA 3M6MA 4ZDCA 2A81A 1N6FA 4MXIA 4J2UA 1XX4A 2A7SA 1XNYA 4B3HA 3T89A 3H02A 2PPYA 4LK5A 4OLQA 1UYRA 4ZDDA 5CTCA 2C8TA 1WDKA 1EF9A 5DZKH 4JFCA 3IBBA 4MI2A 3R9SA 5IKLB 3TRRA 4OG1A 1TYFA 3T8BA 1TG6A 3PZKA 4WYOB 4FZWA 4ELWA 3LAOA 1NZYA 1Y7OA 2UZFA 3QREA 3ST9A 1UIYA 2VSUA 3H0UA 2CE3A 3NJDA 3R9TA 3DORA 4ZU2A 4JOTA 2ZL4A 5JBXA 5G1RA 4B3IA 5E0SH 4JVTA 2J5GD 2ZQRA 1OD4A 1YG6A 5INFA 2YJGA 1Q51A 2F9YA 5E0NX 2BZRA 4EMMA 1XNVA 4Z0MA 3ZW9A 5G1SA 3R6HA 4JCSA 2CBYA 2F6QA 3HE2A
chains in the Genus database with same CATH topology
3OT6A 5INGA 2F9IB 3PEAA 5MGBA 1FC9A 3TV5A 1W2XA 5CTBA 2VSSE 4G2RA 1YG8A 2FW2A 4FZWC 3Q1TA 3GLMA 2EJ5A 3QKAA 3ZW8A 4GM2A 3RRVA 2HW5A 3QYRA 4I52A 4WCZA 4F47A 4JCRA 4JJTA 1N6DA 2X24A 3KTJA 4KPKA 3PGQA 3OMEA 1FC6A 4ASIA 1WDMA 1ON9A 5HUQA 5FUSA 3R0OA 3QK8A 4K2NA 4U0HA 4ELSA 4DI1A 3ISAA 5C90A 3MOYA 4I4ZA 3MT6A 3L3SA 3N6RB 1RJMA 2Q35A 1WZ8A 1EF8A 2QQ3A 3M6NA 1WDLA 3SLLA 2VREA 4L6WA 3H0QA 3TVWA 1PIXA 4QFEA 4WZ8B 3KQFA 1X0UA 4Q0GA 3T3WA 5FIFA 2WTBA 3KTKA 2DUBA 1SZOA 1HZDA 4K3WA 2VX2A 2W3PA 1PJHA 3GKBA 2VSUE 4GHNA 2ZL3A 2PG8A 3BF0A 4FN7A 4IZCA 3V5IA 2ZL0A 4YLHA 1EY3A 2F6IA 4KD6A 4MOUA 1J7XA 5DUCA 1XNWA 1VRGA 3Q0GA 4B3JA 3P5MA 4ZDBA 3GF3A 5DKPA 4JYLA 2Q34A 2A7KA 2J5GA 2ZL2A 2NP9A 3P2LA 4JYJA 1FC7A 1XO6A 3QXZA 3TT7A 3NJBA 4EMLA 5DTPA 4NARA 3HLN1 3U9TB 5KJPA 4U19A 4K29A 3H0JA 1NZYB 2ZQQA 4JWVA 5KDRB 4FNDA 5DTWA 3VIVA 3TDCA 2Q2XA 3H0SA 5DL1A 3LKEA 4NEKA 3TZ3A 2X58A 4U0GA 5KDRA 1UYTA 3IB9A 3Q0JA 1ON3A 3DJAA 4HC8A 3HP0A 5DUFA 5INIA 2D3TA 3BPPA 4QIIA 1HNUA 4U0GH 3MFMA 4QIJA 1OD2A 5E0SA 2F9IA 5G1QA 3I47A 3TVUA 2VSSF 3BEZA 4HDTA 1K32A 1Q52A 4FN8A 3MYBA 3STAA 4ELXA 3Q7HA 2F9YB 3P85A 3KTIA 4FB8A 2J5SA 3IAVA 1RJNA 1JXZA 2J5IA 2VSSA 5DU8A 3T88A 5DZKA 3TT6A 4RYFH 3ZWCA 3PE8A 4U18A 5DU6A 3U9RB 2VSUC 4IZBA 4IZDA 3V5EA 3RSTA 5DU4A 2FBMA 2FZSA 4FNBA 3TLFA 4JCTA 3BPTA 3H81A 1UYSA 4FJWD 3R9QA 3KTGA 2DEOA 3SWXA 4HNKA 4U1AA 3GMAA 4Q1IA 4KNPA 4I42A 2GTRA 1UYVA 3QMJA 1SG4A 3HINA 1FCFA 4KWBA 4L8KA 3OC7A 5JBWA 2VSUF 3GF7A 3QXIA 1O8UA 4NNQA 1DCIA 1DUBA 4JSBA 4EMPA 3FF6A 3HRXA 3ZWBA 3G64A 3ZWAA 4OMRA 3WG5A 4RYFA 1N6EA 2IEXA 4ZDFA 4RCNA 2J5IB 4JCQA 3RSIA 2J5II 2PBPA 3U9SB 1HNOA 1K39A 3T8AA 3JU1A 3KTHA 3FDUA 4ZDEA 1MJ3A 3K50A 3K8XA 5C9GA 3QWDA 3M6MA 4ZDCA 2A81A 1N6FA 4MXIA 4J2UA 1XX4A 2A7SA 1XNYA 4B3HA 3T89A 3H02A 2PPYA 4LK5A 4OLQA 1UYRA 4ZDDA 5CTCA 2C8TA 1WDKA 1EF9A 5DZKH 4JFCA 3IBBA 4MI2A 3R9SA 5IKLB 3TRRA 4OG1A 1TYFA 3T8BA 1TG6A 3PZKA 4WYOB 4FZWA 4ELWA 3LAOA 1NZYA 1Y7OA 2UZFA 3QREA 3ST9A 1UIYA 2VSUA 3H0UA 2CE3A 3NJDA 3R9TA 3DORA 4ZU2A 4JOTA 2ZL4A 5JBXA 5G1RA 4B3IA 5E0SH 4JVTA 2J5GD 2ZQRA 1OD4A 1YG6A 5INFA 2YJGA 1Q51A 2F9YA 5E0NX 2BZRA 4EMMA 1XNVA 4Z0MA 3ZW9A 5G1SA 3R6HA 4JCSA 2CBYA 2F6QA 3HE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT6 A;  5ING A;  2F9I B;  3PEA A;  5MGB A;  1FC9 A;  3TV5 A;  1W2X A;  5CTB A;  2VSS E;  4G2R A;  1YG8 A;  2FW2 A;  4FZW C;  3Q1T A;  3GLM A;  2EJ5 A;  3QKA A;  3ZW8 A;  4GM2 A;  3RRV A;  2HW5 A;  3QYR A;  4I52 A;  4WCZ A;  4F47 A;  4JCR A;  4JJT A;  1N6D A;  2X24 A;  3KTJ A;  4KPK A;  3PGQ A;  3OME A;  1FC6 A;  4ASI A;  1WDM A;  1ON9 A;  5FUS A;  3R0O A;  3QK8 A;  4K2N A;  4U0H A;  4ELS A;  4DI1 A;  3ISA A;  5C90 A;  3MOY A;  4I4Z A;  3MT6 A;  3L3S A;  3N6R B;  1RJM A;  2Q35 A;  1WZ8 A;  1EF8 A;  2QQ3 A;  3M6N A;  1WDL A;  3SLL A;  2VRE A;  4L6W A;  3H0Q A;  3TVW A;  1PIX A;  4QFE A;  4WZ8 B;  3KQF A;  1X0U A;  4Q0G A;  3T3W A;  5FIF A;  2WTB A;  3KTK A;  2DUB A;  1SZO A;  1HZD A;  4K3W A;  2VX2 A;  2W3P A;  1PJH A;  3GKB A;  2VSU E;  4GHN A;  2ZL3 A;  2PG8 A;  3BF0 A;  4FN7 A;  4IZC A;  3V5I A;  2ZL0 A;  4YLH A;  1EY3 A;  2F6I A;  4KD6 A;  4MOU A;  1J7X A;  5DUC A;  1XNW A;  1VRG A;  3Q0G A;  4B3J A;  3P5M A;  4ZDB A;  3GF3 A;  5DKP A;  4JYL A;  2Q34 A;  2A7K A;  2J5G A;  2ZL2 A;  2NP9 A;  3P2L A;  4JYJ A;  1FC7 A;  1XO6 A;  3QXZ A;  3TT7 A;  3NJB A;  4EML A;  5DTP A;  3HLN 1;  3U9T B;  5KJP A;  4U19 A;  4K29 A;  3H0J A;  1NZY B;  2ZQQ A;  4JWV A;  5KDR B;  4FND A;  5DTW A;  3VIV A;  3TDC A;  2Q2X A;  3H0S A;  5DL1 A;  3LKE A;  4NEK A;  3TZ3 A;  2X58 A;  4U0G A;  5KDR A;  1UYT A;  3IB9 A;  3Q0J A;  1ON3 A;  3DJA A;  4HC8 A;  3HP0 A;  5DUF A;  5INI A;  2D3T A;  3BPP A;  4QII A;  1HNU A;  4U0G H;  3MFM A;  4QIJ A;  1OD2 A;  5E0S A;  2F9I A;  5G1Q A;  3I47 A;  3TVU A;  2VSS F;  3BEZ A;  1K32 A;  1Q52 A;  4FN8 A;  3MYB A;  3STA A;  4ELX A;  3Q7H A;  2F9Y B;  3P85 A;  3KTI A;  4FB8 A;  2J5S A;  3IAV A;  1RJN A;  1JXZ A;  2J5I A;  2VSS A;  5DU8 A;  3T88 A;  5DZK A;  3TT6 A;  4RYF H;  3ZWC A;  3PE8 A;  4U18 A;  5DU6 A;  3U9R B;  2VSU C;  4IZB A;  4IZD A;  3V5E A;  3RST A;  5DU4 A;  2FBM A;  2FZS A;  4FNB A;  3TLF A;  4JCT A;  3H81 A;  1UYS A;  4FJW D;  3R9Q A;  3KTG A;  2DEO A;  3SWX A;  4HNK A;  4U1A A;  3GMA A;  4Q1I A;  4KNP A;  4I42 A;  2GTR A;  1UYV A;  3QMJ A;  1SG4 A;  3HIN A;  1FCF A;  4KWB A;  4L8K A;  3OC7 A;  5JBW A;  2VSU F;  3GF7 A;  3QXI A;  1O8U A;  4NNQ A;  1DCI A;  1DUB A;  4JSB A;  4EMP A;  3FF6 A;  3HRX A;  3ZWB A;  3G64 A;  3ZWA A;  4OMR A;  3WG5 A;  4RYF A;  1N6E A;  2IEX A;  4ZDF A;  4RCN A;  2J5I B;  4JCQ A;  3RSI A;  2J5I I;  2PBP A;  3U9S B;  1HNO A;  1K39 A;  3T8A A;  3JU1 A;  3KTH A;  3FDU A;  4ZDE A;  1MJ3 A;  3K50 A;  3K8X A;  5C9G A;  3QWD A;  3M6M A;  4ZDC A;  2A81 A;  1N6F A;  4MXI A;  1XX4 A;  2A7S A;  1XNY A;  4B3H A;  3T89 A;  3H02 A;  2PPY A;  4LK5 A;  4OLQ A;  1UYR A;  4ZDD A;  5CTC A;  2C8T A;  1WDK A;  1EF9 A;  5DZK H;  4JFC A;  3IBB A;  4MI2 A;  3R9S A;  5IKL B;  3TRR A;  4OG1 A;  1TYF A;  3T8B A;  1TG6 A;  3PZK A;  4WYO B;  4FZW A;  4ELW A;  3LAO A;  1NZY A;  1Y7O A;  2UZF A;  3QRE A;  3ST9 A;  1UIY A;  2VSU A;  3H0U A;  2CE3 A;  3NJD A;  3R9T A;  3DOR A;  4ZU2 A;  4JOT A;  2ZL4 A;  5JBX A;  5G1R A;  4B3I A;  5E0S H;  4JVT A;  2J5G D;  2ZQR A;  1OD4 A;  1YG6 A;  5INF A;  1Q51 A;  2F9Y A;  5E0N X;  2BZR A;  4EMM A;  1XNV A;  4Z0M A;  3ZW9 A;  5G1S A;  3R6H A;  4JCS A;  2CBY A;  2F6Q A;  3HE2 A; 
#chains in the Genus database with same CATH topology
 3OT6 A;  5ING A;  2F9I B;  3PEA A;  5MGB A;  1FC9 A;  3TV5 A;  1W2X A;  5CTB A;  2VSS E;  4G2R A;  1YG8 A;  2FW2 A;  4FZW C;  3Q1T A;  3GLM A;  2EJ5 A;  3QKA A;  3ZW8 A;  4GM2 A;  3RRV A;  2HW5 A;  3QYR A;  4I52 A;  4WCZ A;  4F47 A;  4JCR A;  4JJT A;  1N6D A;  2X24 A;  3KTJ A;  4KPK A;  3PGQ A;  3OME A;  1FC6 A;  4ASI A;  1WDM A;  1ON9 A;  5HUQ A;  5FUS A;  3R0O A;  3QK8 A;  4K2N A;  4U0H A;  4ELS A;  4DI1 A;  3ISA A;  5C90 A;  3MOY A;  4I4Z A;  3MT6 A;  3L3S A;  3N6R B;  1RJM A;  2Q35 A;  1WZ8 A;  1EF8 A;  2QQ3 A;  3M6N A;  1WDL A;  3SLL A;  2VRE A;  4L6W A;  3H0Q A;  3TVW A;  1PIX A;  4QFE A;  4WZ8 B;  3KQF A;  1X0U A;  4Q0G A;  3T3W A;  5FIF A;  2WTB A;  3KTK A;  2DUB A;  1SZO A;  1HZD A;  4K3W A;  2VX2 A;  2W3P A;  1PJH A;  3GKB A;  2VSU E;  4GHN A;  2ZL3 A;  2PG8 A;  3BF0 A;  4FN7 A;  4IZC A;  3V5I A;  2ZL0 A;  4YLH A;  1EY3 A;  2F6I A;  4KD6 A;  4MOU A;  1J7X A;  5DUC A;  1XNW A;  1VRG A;  3Q0G A;  4B3J A;  3P5M A;  4ZDB A;  3GF3 A;  5DKP A;  4JYL A;  2Q34 A;  2A7K A;  2J5G A;  2ZL2 A;  2NP9 A;  3P2L A;  4JYJ A;  1FC7 A;  1XO6 A;  3QXZ A;  3TT7 A;  3NJB A;  4EML A;  5DTP A;  4NAR A;  3HLN 1;  3U9T B;  5KJP A;  4U19 A;  4K29 A;  3H0J A;  1NZY B;  2ZQQ A;  4JWV A;  5KDR B;  4FND A;  5DTW A;  3VIV A;  3TDC A;  2Q2X A;  3H0S A;  5DL1 A;  3LKE A;  4NEK A;  3TZ3 A;  2X58 A;  4U0G A;  5KDR A;  1UYT A;  3IB9 A;  3Q0J A;  1ON3 A;  3DJA A;  4HC8 A;  3HP0 A;  5DUF A;  5INI A;  2D3T A;  3BPP A;  4QII A;  1HNU A;  4U0G H;  3MFM A;  4QIJ A;  1OD2 A;  5E0S A;  2F9I A;  5G1Q A;  3I47 A;  3TVU A;  2VSS F;  3BEZ A;  4HDT A;  1K32 A;  1Q52 A;  4FN8 A;  3MYB A;  3STA A;  4ELX A;  3Q7H A;  2F9Y B;  3P85 A;  3KTI A;  4FB8 A;  2J5S A;  3IAV A;  1RJN A;  1JXZ A;  2J5I A;  2VSS A;  5DU8 A;  3T88 A;  5DZK A;  3TT6 A;  4RYF H;  3ZWC A;  3PE8 A;  4U18 A;  5DU6 A;  3U9R B;  2VSU C;  4IZB A;  4IZD A;  3V5E A;  3RST A;  5DU4 A;  2FBM A;  2FZS A;  4FNB A;  3TLF A;  4JCT A;  3BPT A;  3H81 A;  1UYS A;  4FJW D;  3R9Q A;  3KTG A;  2DEO A;  3SWX A;  4HNK A;  4U1A A;  3GMA A;  4Q1I A;  4KNP A;  4I42 A;  2GTR A;  1UYV A;  3QMJ A;  1SG4 A;  3HIN A;  1FCF A;  4KWB A;  4L8K A;  3OC7 A;  5JBW A;  2VSU F;  3GF7 A;  3QXI A;  1O8U A;  4NNQ A;  1DCI A;  1DUB A;  4JSB A;  4EMP A;  3FF6 A;  3HRX A;  3ZWB A;  3G64 A;  3ZWA A;  4OMR A;  3WG5 A;  4RYF A;  1N6E A;  2IEX A;  4ZDF A;  4RCN A;  2J5I B;  4JCQ A;  3RSI A;  2J5I I;  2PBP A;  3U9S B;  1HNO A;  1K39 A;  3T8A A;  3JU1 A;  3KTH A;  3FDU A;  4ZDE A;  1MJ3 A;  3K50 A;  3K8X A;  5C9G A;  3QWD A;  3M6M A;  4ZDC A;  2A81 A;  1N6F A;  4MXI A;  4J2U A;  1XX4 A;  2A7S A;  1XNY A;  4B3H A;  3T89 A;  3H02 A;  2PPY A;  4LK5 A;  4OLQ A;  1UYR A;  4ZDD A;  5CTC A;  2C8T A;  1WDK A;  1EF9 A;  5DZK H;  4JFC A;  3IBB A;  4MI2 A;  3R9S A;  5IKL B;  3TRR A;  4OG1 A;  1TYF A;  3T8B A;  1TG6 A;  3PZK A;  4WYO B;  4FZW A;  4ELW A;  3LAO A;  1NZY A;  1Y7O A;  2UZF A;  3QRE A;  3ST9 A;  1UIY A;  2VSU A;  3H0U A;  2CE3 A;  3NJD A;  3R9T A;  3DOR A;  4ZU2 A;  4JOT A;  2ZL4 A;  5JBX A;  5G1R A;  4B3I A;  5E0S H;  4JVT A;  2J5G D;  2ZQR A;  1OD4 A;  1YG6 A;  5INF A;  2YJG A;  1Q51 A;  2F9Y A;  5E0N X;  2BZR A;  4EMM A;  1XNV A;  4Z0M A;  3ZW9 A;  5G1S A;  3R6H A;  4JCS A;  2CBY A;  2F6Q A;  3HE2 A; 
#chains in the Genus database with same CATH homology
 3OT6 A;  5ING A;  2F9I B;  3PEA A;  5MGB A;  1FC9 A;  3TV5 A;  1W2X A;  5CTB A;  2VSS E;  4G2R A;  1YG8 A;  2FW2 A;  4FZW C;  3Q1T A;  3GLM A;  2EJ5 A;  3QKA A;  3ZW8 A;  4GM2 A;  3RRV A;  2HW5 A;  3QYR A;  4I52 A;  4WCZ A;  4F47 A;  4JCR A;  4JJT A;  1N6D A;  2X24 A;  3KTJ A;  4KPK A;  3PGQ A;  3OME A;  1FC6 A;  4ASI A;  1WDM A;  1ON9 A;  5HUQ A;  5FUS A;  3R0O A;  3QK8 A;  4K2N A;  4U0H A;  4ELS A;  4DI1 A;  3ISA A;  5C90 A;  3MOY A;  4I4Z A;  3MT6 A;  3L3S A;  3N6R B;  1RJM A;  2Q35 A;  1WZ8 A;  1EF8 A;  2QQ3 A;  3M6N A;  1WDL A;  3SLL A;  2VRE A;  4L6W A;  3H0Q A;  3TVW A;  1PIX A;  4QFE A;  4WZ8 B;  3KQF A;  1X0U A;  4Q0G A;  3T3W A;  5FIF A;  2WTB A;  3KTK A;  2DUB A;  1SZO A;  1HZD A;  4K3W A;  2VX2 A;  2W3P A;  1PJH A;  3GKB A;  2VSU E;  4GHN A;  2ZL3 A;  2PG8 A;  3BF0 A;  4FN7 A;  4IZC A;  3V5I A;  2ZL0 A;  4YLH A;  1EY3 A;  2F6I A;  4KD6 A;  4MOU A;  1J7X A;  5DUC A;  1XNW A;  1VRG A;  3Q0G A;  4B3J A;  3P5M A;  4ZDB A;  3GF3 A;  5DKP A;  4JYL A;  2Q34 A;  2A7K A;  2J5G A;  2ZL2 A;  2NP9 A;  3P2L A;  4JYJ A;  1FC7 A;  1XO6 A;  3QXZ A;  3TT7 A;  3NJB A;  4EML A;  5DTP A;  4NAR A;  3HLN 1;  3U9T B;  5KJP A;  4U19 A;  4K29 A;  3H0J A;  1NZY B;  2ZQQ A;  4JWV A;  5KDR B;  4FND A;  5DTW A;  3VIV A;  3TDC A;  2Q2X A;  3H0S A;  5DL1 A;  3LKE A;  4NEK A;  3TZ3 A;  2X58 A;  4U0G A;  5KDR A;  1UYT A;  3IB9 A;  3Q0J A;  1ON3 A;  3DJA A;  4HC8 A;  3HP0 A;  5DUF A;  5INI A;  2D3T A;  3BPP A;  4QII A;  1HNU A;  4U0G H;  3MFM A;  4QIJ A;  1OD2 A;  5E0S A;  2F9I A;  5G1Q A;  3I47 A;  3TVU A;  2VSS F;  3BEZ A;  4HDT A;  1K32 A;  1Q52 A;  4FN8 A;  3MYB A;  3STA A;  4ELX A;  3Q7H A;  2F9Y B;  3P85 A;  3KTI A;  4FB8 A;  2J5S A;  3IAV A;  1RJN A;  1JXZ A;  2J5I A;  2VSS A;  5DU8 A;  3T88 A;  5DZK A;  3TT6 A;  4RYF H;  3ZWC A;  3PE8 A;  4U18 A;  5DU6 A;  3U9R B;  2VSU C;  4IZB A;  4IZD A;  3V5E A;  3RST A;  5DU4 A;  2FBM A;  2FZS A;  4FNB A;  3TLF A;  4JCT A;  3BPT A;  3H81 A;  1UYS A;  4FJW D;  3R9Q A;  3KTG A;  2DEO A;  3SWX A;  4HNK A;  4U1A A;  3GMA A;  4Q1I A;  4KNP A;  4I42 A;  2GTR A;  1UYV A;  3QMJ A;  1SG4 A;  3HIN A;  1FCF A;  4KWB A;  4L8K A;  3OC7 A;  5JBW A;  2VSU F;  3GF7 A;  3QXI A;  1O8U A;  4NNQ A;  1DCI A;  1DUB A;  4JSB A;  4EMP A;  3FF6 A;  3HRX A;  3ZWB A;  3G64 A;  3ZWA A;  4OMR A;  3WG5 A;  4RYF A;  1N6E A;  2IEX A;  4ZDF A;  4RCN A;  2J5I B;  4JCQ A;  3RSI A;  2J5I I;  2PBP A;  3U9S B;  1HNO A;  1K39 A;  3T8A A;  3JU1 A;  3KTH A;  3FDU A;  4ZDE A;  1MJ3 A;  3K50 A;  3K8X A;  5C9G A;  3QWD A;  3M6M A;  4ZDC A;  2A81 A;  1N6F A;  4MXI A;  4J2U A;  1XX4 A;  2A7S A;  1XNY A;  4B3H A;  3T89 A;  3H02 A;  2PPY A;  4LK5 A;  4OLQ A;  1UYR A;  4ZDD A;  5CTC A;  2C8T A;  1WDK A;  1EF9 A;  5DZK H;  4JFC A;  3IBB A;  4MI2 A;  3R9S A;  5IKL B;  3TRR A;  4OG1 A;  1TYF A;  3T8B A;  1TG6 A;  3PZK A;  4WYO B;  4FZW A;  4ELW A;  3LAO A;  1NZY A;  1Y7O A;  2UZF A;  3QRE A;  3ST9 A;  1UIY A;  2VSU A;  3H0U A;  2CE3 A;  3NJD A;  3R9T A;  3DOR A;  4ZU2 A;  4JOT A;  2ZL4 A;  5JBX A;  5G1R A;  4B3I A;  5E0S H;  4JVT A;  2J5G D;  2ZQR A;  1OD4 A;  1YG6 A;  5INF A;  2YJG A;  1Q51 A;  2F9Y A;  5E0N X;  2BZR A;  4EMM A;  1XNV A;  4Z0M A;  3ZW9 A;  5G1S A;  3R6H A;  4JCS A;  2CBY A;  2F6Q A;  3HE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...