3RT2A

Crystal structure of apo-pyl10
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
ESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQCNLNSLADVTERLQAESME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL10
publication title The Molecular Basis of ABA-Independent Inhibition of PP2Cs by a Subclass of PYL Proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase inhibitor
total genus 50
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3rt2A00
1T17A 2LF2A 4XRTA 3UIDA 4IGYA 4MA6A 1LLTA 1T27A 2QIMA 4PSBA 3RD6A 4DSBA 4B9RA 3E85A 1EM2A 2VQ5A 3FO5A 3IJTA 2K5GA 3NJOA 2MOUA 4A83A 5I8FA 4WVOA 3CNWA 3PUTA 2E3QA 4REIA 4IH0A 3ELIA 3P0LA 3KAZA 1JSSA 4LGBA 2PCSA 4LG5A 2KCZA 4N3EA 5JNNA 4BK7A 4C9IA 2LGHA 2GKDA 1E09A 4IH2A 1LN3A 4MAPA 2E3PA 2EJXA 4JHGA 1LN2A 3P51A 2A1LA 3IE5A 3R6PA 4N0GC 5AMWA 3W9RA 2R55A 2KF2A 3NEFA 2M89A 1ICXA 2FLHA 2E3SA 2VNEA 3KDIA 4IHRA 2LAKA 2N4AA 3JRQB 3PU2A 3C0VA 3RT0C 3H3QA 3QN1A 3NI8A 3UQHA 4RYVA 3KAYA 4OICA 2RESA 2E3MA 4A8GA 4IGXA 2LUZA 1XFSA 4A80A 2E3OA 4A8VA 3KDJA 3KB0A 4R7KA 2L8OA 3TVQA 2I9YA 3OTLA 3QSZA 1XN5A 1XN6A 5I9JA 2KEWA 1XDFA 3H3SA 4REHA 3NJ1A 3OQUA 4BTZA 2LDKA 3NMHA 2FFSA 1H2OA 2LEQA 4FPWA 1TW0A 2LE1A 1LN1A 2LPXA 4A86A 1BV1A 4BKDA 1Z94A 2BK0A 2D4RA 3Q63A 3GGNA 4A8UA 4DS8A 3WG8A 4Z3LA 2RERA 1UW5A 1VJHA 1KCMA 4XRWA 3KLXA 1B6FA 3NJ0A 1X53A 3ZVUA 5E4MA 2KTEA 2Z9ZA 4BK6A 1ZXFA 3OH8A 4BKCA 2L65A 3H3TA 1TXCA 2PSOA 2REZA 3OJIA 5E4DA 3P9VA 3H3RA 2LCGA 4JDAA 1FM4A 3UJLA 3RT2A 4Y31A 4C94A 4C9CA 3KB3A 5JO1A 3NMPA 3TL1A 5JO2A 3KL1A 3Q6AA 4A88A 4Q0KA 4A81A 3TFZA 1FSKA 4JHIA 2Q3QA 2LIOA 4LA7A 4REJA 4GY9A 4A85A 4IGVA 1QMRA 3NMVA 2E3RA 2IL5A 3F08A 3K3KA 2Z9YA 3W9KA 3NMTA 5BRLA 1BTVA 2M47A 1XUVA 5C9YA 3NEGA 1IFVA 3K90A 4JHHA 4M9WA 4QIPA 3NR4A 3JRSA 2K7HA 4A84A 2L9PA 4DSCA 2NN5A 3KDHA 4LGAA 2WQLA 3NS2A 4IGWA 4JDLA 3NMNA 4MNSA 2E3NA 2QPVA 5E46A 5E4BA 3TVRA 2NS9A 3Q64A 4A87A 4M9BA 2N4BA
chains in the Genus database with same CATH superfamily
1T17A 2LF2A 4XRTA 3UIDA 4IGYA 4MA6A 1LLTA 1T27A 2QIMA 4PSBA 3RD6A 4DSBA 4B9RA 3E85A 4QDDA 1EM2A 2VQ5A 3FO5A 3IJTA 2K5GA 3NJOA 2MOUA 4A83A 5I8FA 4WVOA 3NQNA 3CNWA 3PUTA 3DLBA 2E3QA 4REIA 4IH0A 4A87A 3ELIA 3F73A 3P0LA 3KAZA 1JSSA 4LGBA 2PCSA 4LG5A 2KCZA 4N3EA 5JNNA 3GOBA 4BK7A 4C9IA 2LGHA 2GKDA 1E09A 4JHYA 4IH2A 1LN3A 4MAPA 2E3PA 2EJXA 4JHGA 1LN2A 3P51A 2A1LA 3IE5A 3R6PA 4N0GC 5AMWA 4N47A 3W9RA 4E6FA 2R55A 2KF2A 3NEFA 2M89A 1ICXA 2FLHA 2E3SA 2VNEA 3KDIA 4IHRA 2LAKA 2N4AA 3JRQB 3PU2A 3C0VA 3RT0C 3H3QA 3QN1A 3NI8A 3UQHA 4NCAA 4RYVA 3KAYA 3HVRA 4OICA 2RESA 2E3MA 3DLHA 4A8GA 4IGXA 2LUZA 1XFSA 4A80A 2E3OA 4A8VA 3KDJA 3KB0A 3HM9A 4R7KA 2L8OA 3TVQA 2I9YA 3OTLA 3QSZA 1XN5A 1XN6A 5I9JA 2KEWA 1XDFA 3H3SA 4REHA 5EKQC 3NJ1A 3HO1A 3OQUA 3GKEA 4BTZA 4N41A 2LDKA 3NMHA 2FFSA 1H2OA 2LEQA 3HJFA 4FPWA 1TW0A 2LE1A 1LN1A 2LPXA 4A86A 1BV1A 4BKDA 1Z94A 2BK0A 2D4RA 3Q63A 3GGNA 4A8UA 4DS8A 4KPYA 3WG8A 4Z3LA 2RERA 3GTSA 1UW5A 1VJHA 1KCMA 3GL2A 4QDCA 4XRWA 3KLXA 1B6FA 4NCBA 3NJ0A 1X53A 4QCKA 3ZVUA 5E4MA 2ZYLA 2KTEA 2Z9ZA 4BK6A 1ZXFA 4QDFB 3OH8A 4BKCA 2L65A 3H3TA 1TXCA 2PSOA 2REZA 3OJIA 5E4DA 3P9VA 3H3RA 2LCGA 4JDAA 1FM4A 3UJLA 3RT2A 4Y31A 4C94A 4C9CA 3KB3A 5JO1A 3NMPA 3TL1A 5JO2A 3KL1A 3Q6AA 4A88A 4Q0KA 4A81A 4N76A 3TFZA 1FSKA 4JHIA 2Q3QA 2LIOA 4LA7A 4REJA 4GY9A 4A85A 4IGVA 1QMRA 3GL0A 3NMVA 2E3RA 2IL5A 3F08A 3K3KA 2Z9YA 3W9KA 3NMTA 5BRLA 1BTVA 2M47A 1XUVA 5C9YA 3NEGA 1IFVA 3K90A 4JHHA 4M9WA 4QIPA 3NR4A 3JRSA 2K7HA 4A84A 2L9PA 4DSCA 3HK2A 2NN5A 3KDHA 3GB4A 2WQLA 3NS2A 4LGAA 4IGWA 4JDLA 4QDFA 3NMNA 4MNSA 2E3NA 2QPVA 3GTEA 5E46A 5E4BA 2YH6A 3TVRA 3HXMA 2NS9A 3TGOC 3Q64A 2LAFA 4M9BA 2N4BA
chains in the Genus database with same CATH topology
1T17A 2LF2A 4XRTA 3UIDA 4IGYA 4MA6A 1LLTA 1T27A 2QIMA 4PSBA 3RD6A 4DSBA 4B9RA 3E85A 4QDDA 1EM2A 2VQ5A 3FO5A 3IJTA 2K5GA 3NJOA 2MOUA 4A83A 5I8FA 4WVOA 3NQNA 3CNWA 3PUTA 3DLBA 2E3QA 4REIA 4IH0A 4A87A 3ELIA 3F73A 3P0LA 3KAZA 1JSSA 4LGBA 2PCSA 4LG5A 2KCZA 4N3EA 5JNNA 3GOBA 4BK7A 4C9IA 2LGHA 2GKDA 1E09A 4JHYA 4IH2A 1LN3A 4MAPA 2E3PA 2EJXA 4JHGA 1LN2A 3P51A 2A1LA 3IE5A 3R6PA 4N0GC 5AMWA 4N47A 3W9RA 4E6FA 2R55A 2KF2A 3NEFA 2M89A 1ICXA 2FLHA 2E3SA 2VNEA 3KDIA 4IHRA 2LAKA 2N4AA 3JRQB 3PU2A 3C0VA 3RT0C 3H3QA 3QN1A 3NI8A 3UQHA 4NCAA 4RYVA 3KAYA 3HVRA 4OICA 2RESA 2E3MA 3DLHA 4A8GA 4IGXA 2LUZA 1XFSA 4A80A 2E3OA 4A8VA 3KDJA 3KB0A 3HM9A 4R7KA 2L8OA 3TVQA 2I9YA 3OTLA 3QSZA 1XN5A 1XN6A 5I9JA 2KEWA 1XDFA 3H3SA 4REHA 5EKQC 3NJ1A 3HO1A 3OQUA 3GKEA 4BTZA 4N41A 2LDKA 3NMHA 2FFSA 1H2OA 2LEQA 3HJFA 4FPWA 1TW0A 2LE1A 1LN1A 2LPXA 4A86A 1BV1A 4BKDA 1Z94A 2BK0A 2D4RA 3Q63A 3GGNA 4A8UA 4DS8A 4KPYA 3WG8A 4Z3LA 2RERA 3GTSA 1UW5A 1VJHA 1KCMA 3GL2A 4QDCA 4XRWA 3KLXA 1B6FA 4NCBA 3NJ0A 1X53A 4QCKA 3ZVUA 5E4MA 2ZYLA 2KTEA 2Z9ZA 4BK6A 1ZXFA 4QDFB 3OH8A 4BKCA 2L65A 3H3TA 1TXCA 2PSOA 2REZA 3OJIA 5E4DA 3P9VA 3H3RA 2LCGA 4JDAA 1FM4A 3UJLA 3RT2A 4Y31A 4C94A 4C9CA 3KB3A 5JO1A 3NMPA 3TL1A 5JO2A 3KL1A 3Q6AA 4A88A 4Q0KA 4A81A 4N76A 3TFZA 1FSKA 4JHIA 2Q3QA 2LIOA 4LA7A 4REJA 4GY9A 4A85A 4IGVA 1QMRA 3GL0A 3NMVA 2E3RA 2IL5A 3F08A 3K3KA 2Z9YA 3W9KA 3NMTA 5BRLA 1BTVA 2M47A 1XUVA 5C9YA 3NEGA 1IFVA 3K90A 4JHHA 4M9WA 4QIPA 3NR4A 3JRSA 2K7HA 4A84A 2L9PA 4DSCA 3HK2A 2NN5A 3KDHA 3GB4A 2WQLA 3NS2A 4LGAA 4IGWA 4JDLA 4QDFA 3NMNA 4MNSA 2E3NA 2QPVA 3GTEA 5E46A 5E4BA 2YH6A 3TVRA 3HXMA 2NS9A 3TGOC 3Q64A 2LAFA 4M9BA 2N4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T17 A;  2LF2 A;  4XRT A;  3UID A;  4IGY A;  4MA6 A;  1LLT A;  1T27 A;  2QIM A;  4PSB A;  3RD6 A;  4DSB A;  4B9R A;  3E85 A;  1EM2 A;  2VQ5 A;  3FO5 A;  3IJT A;  2K5G A;  3NJO A;  2MOU A;  4A83 A;  5I8F A;  4WVO A;  3CNW A;  3PUT A;  2E3Q A;  4REI A;  4IH0 A;  3ELI A;  3P0L A;  3KAZ A;  1JSS A;  4LGB A;  2PCS A;  4LG5 A;  2KCZ A;  4N3E A;  5JNN A;  4BK7 A;  4C9I A;  2LGH A;  2GKD A;  1E09 A;  4IH2 A;  1LN3 A;  4MAP A;  2E3P A;  2EJX A;  4JHG A;  1LN2 A;  3P51 A;  2A1L A;  3IE5 A;  3R6P A;  4N0G C;  5AMW A;  3W9R A;  2R55 A;  2KF2 A;  3NEF A;  2M89 A;  1ICX A;  2FLH A;  2E3S A;  2VNE A;  3KDI A;  4IHR A;  2LAK A;  2N4A A;  3JRQ B;  3PU2 A;  3C0V A;  3RT0 C;  3H3Q A;  3QN1 A;  3NI8 A;  3UQH A;  4RYV A;  3KAY A;  4OIC A;  2RES A;  2E3M A;  4A8G A;  4IGX A;  2LUZ A;  1XFS A;  4A80 A;  2E3O A;  4A8V A;  3KDJ A;  3KB0 A;  4R7K A;  2L8O A;  3TVQ A;  2I9Y A;  3OTL A;  3QSZ A;  1XN5 A;  1XN6 A;  5I9J A;  2KEW A;  1XDF A;  3H3S A;  4REH A;  3NJ1 A;  3OQU A;  4BTZ A;  2LDK A;  3NMH A;  2FFS A;  1H2O A;  2LEQ A;  4FPW A;  1TW0 A;  2LE1 A;  1LN1 A;  2LPX A;  4A86 A;  1BV1 A;  4BKD A;  1Z94 A;  2BK0 A;  2D4R A;  3Q63 A;  3GGN A;  4A8U A;  4DS8 A;  3WG8 A;  4Z3L A;  2RER A;  1UW5 A;  1VJH A;  1KCM A;  4XRW A;  3KLX A;  1B6F A;  3NJ0 A;  1X53 A;  3ZVU A;  5E4M A;  2KTE A;  2Z9Z A;  4BK6 A;  1ZXF A;  3OH8 A;  4BKC A;  2L65 A;  3H3T A;  1TXC A;  2PSO A;  2REZ A;  3OJI A;  5E4D A;  3P9V A;  3H3R A;  2LCG A;  4JDA A;  1FM4 A;  3UJL A;  3RT2 A;  4Y31 A;  4C94 A;  4C9C A;  3KB3 A;  5JO1 A;  3NMP A;  3TL1 A;  5JO2 A;  3KL1 A;  3Q6A A;  4A88 A;  4Q0K A;  4A81 A;  3TFZ A;  1FSK A;  4JHI A;  2Q3Q A;  2LIO A;  4LA7 A;  4REJ A;  4GY9 A;  4A85 A;  4IGV A;  1QMR A;  3NMV A;  2E3R A;  2IL5 A;  3F08 A;  3K3K A;  2Z9Y A;  3W9K A;  3NMT A;  5BRL A;  1BTV A;  2M47 A;  1XUV A;  5C9Y A;  3NEG A;  1IFV A;  3K90 A;  4JHH A;  4M9W A;  4QIP A;  3NR4 A;  3JRS A;  2K7H A;  4A84 A;  2L9P A;  4DSC A;  2NN5 A;  3KDH A;  4LGA A;  2WQL A;  3NS2 A;  4IGW A;  4JDL A;  3NMN A;  4MNS A;  2E3N A;  2QPV A;  5E46 A;  5E4B A;  3TVR A;  2NS9 A;  3Q64 A;  4A87 A;  4M9B A;  2N4B A; 
#chains in the Genus database with same CATH topology
 1T17 A;  2LF2 A;  4XRT A;  3UID A;  4IGY A;  4MA6 A;  1LLT A;  1T27 A;  2QIM A;  4PSB A;  3RD6 A;  4DSB A;  4B9R A;  3E85 A;  4QDD A;  1EM2 A;  2VQ5 A;  3FO5 A;  3IJT A;  2K5G A;  3NJO A;  2MOU A;  4A83 A;  5I8F A;  4WVO A;  3NQN A;  3CNW A;  3PUT A;  3DLB A;  2E3Q A;  4REI A;  4IH0 A;  4A87 A;  3ELI A;  3F73 A;  3P0L A;  3KAZ A;  1JSS A;  4LGB A;  2PCS A;  4LG5 A;  2KCZ A;  4N3E A;  5JNN A;  3GOB A;  4BK7 A;  4C9I A;  2LGH A;  2GKD A;  1E09 A;  4JHY A;  4IH2 A;  1LN3 A;  4MAP A;  2E3P A;  2EJX A;  4JHG A;  1LN2 A;  3P51 A;  2A1L A;  3IE5 A;  3R6P A;  4N0G C;  5AMW A;  4N47 A;  3W9R A;  4E6F A;  2R55 A;  2KF2 A;  3NEF A;  2M89 A;  1ICX A;  2FLH A;  2E3S A;  2VNE A;  3KDI A;  4IHR A;  2LAK A;  2N4A A;  3JRQ B;  3PU2 A;  3C0V A;  3RT0 C;  3H3Q A;  3QN1 A;  3NI8 A;  3UQH A;  4NCA A;  4RYV A;  3KAY A;  3HVR A;  4OIC A;  2RES A;  2E3M A;  3DLH A;  4A8G A;  4IGX A;  2LUZ A;  1XFS A;  4A80 A;  2E3O A;  4A8V A;  3KDJ A;  3KB0 A;  3HM9 A;  4R7K A;  2L8O A;  3TVQ A;  2I9Y A;  3OTL A;  3QSZ A;  1XN5 A;  1XN6 A;  5I9J A;  2KEW A;  1XDF A;  3H3S A;  4REH A;  5EKQ C;  3NJ1 A;  3HO1 A;  3OQU A;  3GKE A;  4BTZ A;  4N41 A;  2LDK A;  3NMH A;  2FFS A;  1H2O A;  2LEQ A;  3HJF A;  4FPW A;  1TW0 A;  2LE1 A;  1LN1 A;  2LPX A;  4A86 A;  1BV1 A;  4BKD A;  1Z94 A;  2BK0 A;  2D4R A;  3Q63 A;  3GGN A;  4A8U A;  4DS8 A;  4KPY A;  3WG8 A;  4Z3L A;  2RER A;  3GTS A;  1UW5 A;  1VJH A;  1KCM A;  3GL2 A;  4QDC A;  4XRW A;  3KLX A;  1B6F A;  4NCB A;  3NJ0 A;  1X53 A;  4QCK A;  3ZVU A;  5E4M A;  2ZYL A;  2KTE A;  2Z9Z A;  4BK6 A;  1ZXF A;  4QDF B;  3OH8 A;  4BKC A;  2L65 A;  3H3T A;  1TXC A;  2PSO A;  2REZ A;  3OJI A;  5E4D A;  3P9V A;  3H3R A;  2LCG A;  4JDA A;  1FM4 A;  3UJL A;  3RT2 A;  4Y31 A;  4C94 A;  4C9C A;  3KB3 A;  5JO1 A;  3NMP A;  3TL1 A;  5JO2 A;  3KL1 A;  3Q6A A;  4A88 A;  4Q0K A;  4A81 A;  4N76 A;  3TFZ A;  1FSK A;  4JHI A;  2Q3Q A;  2LIO A;  4LA7 A;  4REJ A;  4GY9 A;  4A85 A;  4IGV A;  1QMR A;  3GL0 A;  3NMV A;  2E3R A;  2IL5 A;  3F08 A;  3K3K A;  2Z9Y A;  3W9K A;  3NMT A;  5BRL A;  1BTV A;  2M47 A;  1XUV A;  5C9Y A;  3NEG A;  1IFV A;  3K90 A;  4JHH A;  4M9W A;  4QIP A;  3NR4 A;  3JRS A;  2K7H A;  4A84 A;  2L9P A;  4DSC A;  3HK2 A;  2NN5 A;  3KDH A;  3GB4 A;  2WQL A;  3NS2 A;  4LGA A;  4IGW A;  4JDL A;  4QDF A;  3NMN A;  4MNS A;  2E3N A;  2QPV A;  3GTE A;  5E46 A;  5E4B A;  2YH6 A;  3TVR A;  3HXM A;  2NS9 A;  3TGO C;  3Q64 A;  2LAF A;  4M9B A;  2N4B A; 
#chains in the Genus database with same CATH homology
 1T17 A;  2LF2 A;  4XRT A;  3UID A;  4IGY A;  4MA6 A;  1LLT A;  1T27 A;  2QIM A;  4PSB A;  3RD6 A;  4DSB A;  4B9R A;  3E85 A;  4QDD A;  1EM2 A;  2VQ5 A;  3FO5 A;  3IJT A;  2K5G A;  3NJO A;  2MOU A;  4A83 A;  5I8F A;  4WVO A;  3NQN A;  3CNW A;  3PUT A;  3DLB A;  2E3Q A;  4REI A;  4IH0 A;  4A87 A;  3ELI A;  3F73 A;  3P0L A;  3KAZ A;  1JSS A;  4LGB A;  2PCS A;  4LG5 A;  2KCZ A;  4N3E A;  5JNN A;  3GOB A;  4BK7 A;  4C9I A;  2LGH A;  2GKD A;  1E09 A;  4JHY A;  4IH2 A;  1LN3 A;  4MAP A;  2E3P A;  2EJX A;  4JHG A;  1LN2 A;  3P51 A;  2A1L A;  3IE5 A;  3R6P A;  4N0G C;  5AMW A;  4N47 A;  3W9R A;  4E6F A;  2R55 A;  2KF2 A;  3NEF A;  2M89 A;  1ICX A;  2FLH A;  2E3S A;  2VNE A;  3KDI A;  4IHR A;  2LAK A;  2N4A A;  3JRQ B;  3PU2 A;  3C0V A;  3RT0 C;  3H3Q A;  3QN1 A;  3NI8 A;  3UQH A;  4NCA A;  4RYV A;  3KAY A;  3HVR A;  4OIC A;  2RES A;  2E3M A;  3DLH A;  4A8G A;  4IGX A;  2LUZ A;  1XFS A;  4A80 A;  2E3O A;  4A8V A;  3KDJ A;  3KB0 A;  3HM9 A;  4R7K A;  2L8O A;  3TVQ A;  2I9Y A;  3OTL A;  3QSZ A;  1XN5 A;  1XN6 A;  5I9J A;  2KEW A;  1XDF A;  3H3S A;  4REH A;  5EKQ C;  3NJ1 A;  3HO1 A;  3OQU A;  3GKE A;  4BTZ A;  4N41 A;  2LDK A;  3NMH A;  2FFS A;  1H2O A;  2LEQ A;  3HJF A;  4FPW A;  1TW0 A;  2LE1 A;  1LN1 A;  2LPX A;  4A86 A;  1BV1 A;  4BKD A;  1Z94 A;  2BK0 A;  2D4R A;  3Q63 A;  3GGN A;  4A8U A;  4DS8 A;  4KPY A;  3WG8 A;  4Z3L A;  2RER A;  3GTS A;  1UW5 A;  1VJH A;  1KCM A;  3GL2 A;  4QDC A;  4XRW A;  3KLX A;  1B6F A;  4NCB A;  3NJ0 A;  1X53 A;  4QCK A;  3ZVU A;  5E4M A;  2ZYL A;  2KTE A;  2Z9Z A;  4BK6 A;  1ZXF A;  4QDF B;  3OH8 A;  4BKC A;  2L65 A;  3H3T A;  1TXC A;  2PSO A;  2REZ A;  3OJI A;  5E4D A;  3P9V A;  3H3R A;  2LCG A;  4JDA A;  1FM4 A;  3UJL A;  3RT2 A;  4Y31 A;  4C94 A;  4C9C A;  3KB3 A;  5JO1 A;  3NMP A;  3TL1 A;  5JO2 A;  3KL1 A;  3Q6A A;  4A88 A;  4Q0K A;  4A81 A;  4N76 A;  3TFZ A;  1FSK A;  4JHI A;  2Q3Q A;  2LIO A;  4LA7 A;  4REJ A;  4GY9 A;  4A85 A;  4IGV A;  1QMR A;  3GL0 A;  3NMV A;  2E3R A;  2IL5 A;  3F08 A;  3K3K A;  2Z9Y A;  3W9K A;  3NMT A;  5BRL A;  1BTV A;  2M47 A;  1XUV A;  5C9Y A;  3NEG A;  1IFV A;  3K90 A;  4JHH A;  4M9W A;  4QIP A;  3NR4 A;  3JRS A;  2K7H A;  4A84 A;  2L9P A;  4DSC A;  3HK2 A;  2NN5 A;  3KDH A;  3GB4 A;  2WQL A;  3NS2 A;  4LGA A;  4IGW A;  4JDL A;  4QDF A;  3NMN A;  4MNS A;  2E3N A;  2QPV A;  3GTE A;  5E46 A;  5E4B A;  2YH6 A;  3TVR A;  3HXM A;  2NS9 A;  3TGO C;  3Q64 A;  2LAF A;  4M9B A;  2N4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...