3RT9A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with coenzyme a
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 183
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rt9A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rt9A02
3HYOA 4KBEA 3IE7A 4S1IA 5TQIA 1LHRA 2DDMA 3RTGA 2I6AA 4XCKA 3RTEA 2HW1A 3RSQA 3RTCA 4JKSA 3UMPA 4JKUA 3ZS7A 5TRWA 3UQ6A 3RO7A 3VASA 1UB0A 4EN4A 4E8WA 1ESQA 3RPHA 4C5KA 2QHPA 1RKAA 2R3EA 3KD6A 3RSGA 3NL3A 5BYCA 3RTDA 2AJRA 3GBUA 2QCVA 4YWRA 3NC9A 4LCAA 3VAQA 5C3ZA 4C5MA 2I5BA 3K5WA 2A9YA 5EYNA 3NL6A 1LIOA 1RK2A 3RSSA 3Q92A 3RTAA 2JG5A 3OTXA 4S1HA 1RKDA 1RFVA 3RU2A 1V19A 3BGKA 4K8TA 3RRBA 3H74A 4WJMA 4KANA 3RNOA 3I3YA 3PL2A 2F7KA 3D3JA 3GO7A 2JGVA 3RQ6A 4EOHA 3MBJA 3UBOA 4PVVA 5B6AA 1TZ3A 3FHXA 1JXIA 3IN1A 1VK4A 4N09A 3BF5A 3RU3A 2AFBA 3DZVA 2JG1A 3RQ2A 2YXTA 3NBVA 4K8PA 2PKNA 5F11A 1EKQA 4B8SA 1VI9A 4E8ZA 3RSFA 2PKFA 1V1BA 2ABSA 3RM5A 1TZ6A 4KAHA 3CQDA 2AX3A 3N1CA 3MBHA 4DC3A 4LBGA 4XF7A 4C5NA 5BYEA 1GQTA 3HICA 3NCAA 3LOOA 4KALA 2DG2A 3B1RA 2O8NA 3RT7A 3NM3A 4C5LA 5C3YA 1WYEA 2AJPA 4K9CA 3UQEA 4YL5A 4EUMA 3UQ9A 3B1PA 3RTBA 3IBQA 5CM5A 1RKSA 2DDWA 2F02A 1YGJA 3NBWA 3RS9A 3RRJA 4JJPA 1V1SA 2I6BA 3FHYA 3IKHA 1TYYA 1V1AA 3KTNA 3LJSA 3RQXA 4S1IB 4S1MA 4K9IA 2AWDA 4O1LA 1ESJA 3RS8A 2C49A 3H49A 2A9ZA 3Q1YA 3RO4A 4LC4A 1TD2A 3NM1A 3LKIA 4O1GA 4GM6A 5COJA 1BX4A 5C40A 2HQQA 1KYHA 4N08A 4XF6A 3KEUA 3D3KA 5CGAA 3EWMA 3QA2A 3ROGA 3B3LA 4X8FA 5C41A 3B1OA 3K9EA 5EY7A 3KZHA 2NWHA 1YGKA 3ROEA 2HLZA 4K8CA 3GO6A 3NL2A 1VM7A 4KADA 3NL5A 1L2LA 3RQQA 1RFUA 4K93A 5BYFA 4EBUA 3UMOA 2C4EA 1LIKA 3ROXA 3UQDA 1JXHA 1UA4A 1YHJA 4U7XA 3B1NA 4E8YA 3ROZA 4C5JA 4E84A 2PKMA 4E3AA 4K8KA 2RBCA 3RPZA 3B1QA 3IQ0A 5CGEA 3DRWA 3HPDA 2AB8A 2V78A 3RQ8A 4UBEA 2Q5RA 1RFTA 1C3QA 2ABQA 3RREA 3RQ5A 2R3BA 3RQHA 3RY7A 1LHPA 2DCNA 3RT9A 2DDOA 2PKKA 5BYDA 2XTBA 4XDAA 1JZTA 3IH0A 1DGMA 3NC2A 3RRFA 3JULA 4B8RA 1GC5A 2VARA 4DU5A 3W4SA 1LIIA 4LBXA 2FV7A 2YXUA 2AA0A 1LIJA 3QAIA 1U2XA 4E69A 1EKKA 3PZSA 5F0ZA 3LHXA
chains in the Genus database with same CATH superfamily
3AFMA 3AEQB 4XEUA 1XCJA 5IS2A 2F3RA 5JAHA 1KOJA 1J07A 1FXSA 4BQSA 1DO8A 1JKIA 1EM8A 3FCXA 4FW8A 4MV0A 4OFWA 3ZN2A 3Q8XB 5U4QA 3R0XA 3WYNA 1NN5A 1Z0UA 4B5LA 3N8KA 2OO5C 4CT0A 1PZNA 2HLDD 1NQUA 5BWMA 3I23A 4A8JB 3LUFA 4AKTA 4R5HA 1MEEA 5EZYB 5ITSA 3ZWCA 1TO2E 2I2AA 3ONDA 3ZR4B 3JY6A 4RH1A 3C3JA 2NG1A 1TMYA 2R751 5EAIA 2R1TB 3ES9A 1RXVA 5BWNA 5I7EA 1V19A 1T4MA 4WJMA 4C03A 1RMYA 1KWKA 5ALOA 2R3SA 2H16A 2PBLA 3BHMA 2LIPA 4M1ZA 1M8JA 2QI9C 1OI3A 3D0QA 4ID3A 4NESA 2A5JA 2AYXA 1RKUA 1DRVA 2BEWA 2P2DA 4PSKA 4UM8B 2YXTA 3NRJA 4A0FA 1JJVA 3QK7A 3R7NA 4WLNA 5CVTA 2WJWA 3FJ1A 1RQLA 2ODBA 2SCUA 4BTLA 4M7PA 4NBUA 1XUOA 2Q7DA 4BBJA 4YMUA 1Y8ZA 5H7XA 1EHYA 3JU3A 1RLJA 2FKAA 2XADA 5KVAA 1G38A 4X45A 3EX7C 4WE3A 3OJFA 3K70B 1GQTA 1V3TA 2RGUA 3WVNA 4UOZA 4ND1A 4ALIA 5FV4A 2ZRCA 5I9IA 3JQ6A 5JW6A 1X38A 2K87A 1EFDN 1A95A 1DCFA 1JAHA 1UFRA 1UMBA 4YP0A 3E5NA 3G1UA 2NV0A 2GN8A 2QGFA 5ES3A 4TRJA 1BMFD 4TLMB 4BO8A 3W8DA 1APBA 5C34B 3LBNA 4Z1MA 4HGOA 4A2PA 4E5PA 2GESA 1AY0A 3KUCA 4HGQA 1ZUNA 1OZGA 1G64A 1JPVA 1NNLA 2I76A 3KOOA 1NRJB 1Q1NA 1TK2A 3WIUA 2RHDA 4MR7A 4CG2A 1DTWA 1KJQA 3EVFA 4P3YA 5BMOA 3KB1A 4PXYA 2ATVA 2XYHA 2ZS8A 3WDMA 1XQXA 3ZXIA 5K3EA 5D8DA 1D1TA 4QRHA 1KMHA 1WSWA 5T57A 1SC4A 5JPCA 5JJKA 3ZE9A 3C5VA 3ENZA 4EB6B 1WDWB 5I7OA 2IP2A 4EFDA 2XKKA 3HKCA 4E11A 4X8OA 3DA8A 2C98A 3CH5A 3P2JA 3H13A 2P6PA 4TKUA 4TVBA 1RZRA 4UZSA 4X95A 1M6VB 3C3MA 4DL9A 5FHRA 1X7XB 1TOAA 1E3WB 1K89A 3S2SA 3RUFA 4K3UA 4I1PA 2KBEA 3K0AA 3AUUA 1M6EX 4QBTA 2QP3A 3FKJA 5FPTA 2NU8A 2G5PA 3LD9A 3E70C 1PZMA 3IUYA 5KQLA 3RPZA 2J8ZA 1O0BA 2VJQA 2NPOA 3GBVA 2H29A 1LKZA 2RHLA 3K9WA 4MWEA 4MUIA 1E9FA 3HXKA 2XLCA 2Q5RA 1ZW6A 4P58A 2H4WA 1BMQA 2O7VA 2WPDA 4B85A 1OFVA 2POQX 3WGQA 1OTYA 4C2BA 1BS2A 5F7OA 3UV3A 4KQIA 1XNGA 4EQZA 2QN8A 5H9WA 3OE4A 4JJ4A 3AJRA 3C3XA 1U8XX 3IR5A 2P67A 4EI8A 4BRUA 2PR7A 5CTJA 1Y1RA 1OZFA 1ZZEA 4YQFA 2EJBA 4HFMA 4HWKA 2YS7A 3SYKA 4F96A 1QC5A 2CUKA 4GSKA 6YASA 2NYRA 1YZUA 1YDFA 2QXUA 3T5AA 1W52X 2JFVA 5BMVA 3FUCA 2NXEA 3C5EA 2Y1FA 4WXPA 4ZC8A 2COUA 2WFLB 3QBVA 1EB9A 5P8WA 2BSQA 2AI3A 4QPDA 3ULKA 1VDMA 1MB9A 4DQDA 2FPRA 2PQ0A 4GOMD 4LKRA 1RTKA 1P1FA 4Q9NA 2HLPA 1JVNA 3CEHA 4CMIB 2IEIA 4ZYUA 3MTBA 2JVJA 5HILA 3N58A 4KWIA 3JZDA 4DQUA 4Z7NB 4S05A 1JFTA 3IULA 1VG8A 5EYNA 4POAA 1NJ1A 1CUHA 4M8IA 3PNQA 3RTAA 2WRZA 5TQ0B 5FLEX 1JU9A 4UCXA 4DMKA 4I4IA 2GAFA 4I1RA 2H48A 2XB8A 5CHEA 4CKCB 2C94A 1TQDA 5HBRA 2GYUA 4GUAA 4EG8A 2V6BA 4IV8A 3OFND 1NIPA 4RQTA 3FCOA 3BF5A 3K9HA 3TL2A 1I2BA 1RWBA 3OQIB 2G25A 4JKIA 4YC7A 1B6GA 3BRCA 5G1OA 3WB2A 3RCBA 1DIAA 4DF3A 2Y1KA 3DM9B 3PUIA 3D64A 2G4VA 2VYNA 5IJ9B 2J7KA 1IBCA 4MAAA 1EVZA 3A3OA 1T35A 3QMVA 3TRFA 1KWGA 1O0CA 2B7LA 4UARA 2JDIA 2HMUA 3SCZA 4DMHA 3ZY5A 4D44A 1QX4A 3GEHA 3PNSA 4G41A 3IA7A 2BELA 4MGEA 4X00A 4NCAA 2YV5A 1C3OB 1PEDA 5AW9A 3JALB 1KGSA 1UBFA 2I1WA 2YN0A 1RQRA 3L7AA 1TJ4A 3LU1A 4OQYA 4XFKA 1C8KA 3DKKA 4YB8A 3TQRA 3Q2OA 1LV8A 1M8FA 2PUCA 4TV8B 4CRWB 4FS3A 1H9BA 3A4LA 4Z8XA 2C4WA 4UU8A 1KHHA 1NVDA 3S2IA 1FLVA 3OT1A 2DH6A 2Q5LA 1OXMA 4EL0A 1N0UA 1W8IA 3BGWA 2G77B 4J9VA 3WLQA 2HIAA 1H2EA 4FDVA 1WP9A 3FAKA 1T5BA 4G9EA 4PYLA 4YPFA 3L6EA 3QA2A 1D2RA 3ZDCA 1QO0D 2FSSA 5A7FA 2QR3A 3QUAA 3ILSA 3PC2A 3WP1B 5K9ZA 2FW7A 4O4IB 2DERA 1L2LA 1PQWA 1FVXA 1ULSA 1ITZA 1HDOA 3HGTA 1A04A 1WX1A 4PLVA 1Z6XA 2ONJA 2IWHA 3V8EA 3HGQA 4OMCA 5J43A 4M49A 2AJLI 3N7UA 4LHXA 4EMSA 2CFTA 1DC7A 2NMVA 3PEFA 2XMPA 2CL5A 2GZDA 3NI2A 3UJ7A 1KFKB 5DX0A 4QFMA 1CJBA 2GUGA 1P61B 2Q4EA 1P31A 4UU1A 1IBMB 2B61A 2JCYA 4D26A 5GVSA 5FWNA 3EPLA 4FFNA 1F6WA 4GWLA 1KY2A 1KKUA 4B6JA 2AIRA 5GM2A 3LK6A 1TJ3A 4EA9A 4JI8B 2JGIA 3EJ6A 4I4TB 4LGMA 4AWXA 4HPJB 3JWPA 4J7AA 3HCAA 1ZK0A 5EIBD 1KDPA 3LIIA 5HDQA 3OU2A 3EWIA 1UZUA 2BVNA 5TNXA 4U2FA 2WLSA 3G2NA 3THYB 1Z8FA 1M72A 1M66A 5KTKA 4L8VA 4NOMA 1KI1A 3AF0A 4KLAA 5EE1A 1QSGA 2NYAA 3QY9A 2J08A 3IBSA 4R6XA 1ABEA 2FPOA 2PSSA 4N0EA 4K1LA 1JR4A 2EL7A 2WU0A 3TE6A 5IKXA 4PINA 1J4AA 1YI0A 2PGLA 3CG0A 5JU6A 3VSEA 1ECGA 4EB3A 4BAZA 5M29A 4JLBA 6AT1A 2FP4A 1FFXB 3I45A 2IPMA 4HPWA 4XD7D 1R6BX 5B1HA 2ZWPA 4F3YA 3GLIB 3BK1A 3FG9A 3UMFA 2QLLA 4TLLB 1KAEA 4RPLA 3IPLA 5BRJA 1VYUA 3HCDA 3LY7A 1TM2A 4LOKA 5EUBA 3I3SR 4ZTZB 1I6LA 5LZ5A 2QSYA 2IF2A 3IERA 3WLTA 1NHWA 4V02A 5H5JA 4F8JA 4Q03A 1YJ5A 4O2BA 1XO1A 2GASA 3A25A 2GTPA 4Q7KA 1TXGA 4NYMR 4II3A 4PCVA 2Y2UA 3HXLA 4CKWB 8ABPA 2O8DB 1HBJA 5H9VA 3TGWA 1TM7E 2QUAA 2NTEA 2OHOA 2R97A 3BILA 1VE9A 3HV2A 4ZWNA 4QODA 4FGJA 2Q3CA 4ZREA 5TV2A 3RLIA 4LY9A 1E2GA 3BMNB 1DDIA 4OBEA 3SS8A 5LQNA 3KVNA 3LWNA 5EJEA 5K6RA 4Y0VA 5EXXA 1OB5A 4R51A 5JPIA 4H0FA 2ESRA 4PZDA 1NI4B 2FU5C 2H4YA 2BWJA 4QU5A 1AQ6A 1A7UA 3PENA 4YBZA 4UTRA 5AHXA 3S1AA 4CDNA 1AXRA 2AZMA 4R68A 2WJPA 1WSDA 1GDHA 2XD9A 5E7JA 5BNIA 1IVSA 2REBA 1ZD1A 2ACKA 2AG8A 2FMUA 5HTOA 5IMBA 4G5XA 5C8VA 1FS5A 1PGQA 3PG5A 4JJPA 1DO0A 1VSBA 2H3HA 3CNNA 3IIJA 1GCGA 3JV7A 3UMMA 2PNFA 5AHRA 2FOIA 3MAAC 5KQMA 1YR9A 1V9CA 4Z7QB 2XSZA 2WVJA 3AEZA 1LPAB 1R12A 2JGEA 3ITKA 3E9EA 5DWQA 5FP0A 3W5UA 2XB9A 2BEUA 4HDAA 4FOOA 4NZNA 2RGBA 3WIVA 3L8HA 4Q9HA 4LYAA 4QDOA 3QSGA 1JQKA 3UV7A 4E1BA 1OREA 3I2IA 4JLWA 1AQLA 2VSXA 3D43A 4DAEA 4RTMA 3DE1X 1MNQA 1OZ0A 4IDGA 4X90A 2C7RA 2R9VA 1TCBA 3KU1A 3FAZA 5BT9A 4DLNA 2FZVA 1G63A 3A2LA 4BMXA 2IPXA 2N9UA 4GXNA 1X42A 1EEXB 1PT5A 1NWCA 2Z95A 1FPMA 3BXPA 4IOLA 1CVIA 5JARA 2VF8A 5B37A 5JV5A 1Z2DA 4YP5A 2PMEA 3VYVA 1HXHA 3BCSA 3VO1A 4HQFA 1B0PA 1NRIA 1P5FA 3VHQA 4EJFA 5E1BA 2YQZA 1PV4A 4G8CA 2OV8A 3T7AA 3IH5A 3VPCA 2AZDA 3EMBA 2YXUA 1LSOA 4KQWA 1PWEA 2O8VA 4MQ4A 4K9QA 2BFWA 1Z2NX 2HBYA 1OWNA 3SBXA 2HIMA 3R0JA 2QX6A 1TEHA 2AG6A 2I2DA 4GPAA 4XVHA 2HU5A 5E4TA 4M0CA 4Z4HA 4WESB 4XJSA 3RTCA 2H54A 2Y3IA 4US2R 1A76A 3QVOA 3QLUC 3AQIA 4K3VA 4I8DA 4PW0A 2V7BA 5AKKA 5GJWC 3U7EB 2Q3JA 3L9XA 1E1NA 1MO3A 4BZZA 3IL2A 2H1WA 2VHVA 2FAXA 4WOJA 3M6MD 4RAQA 4RS3A 5ESRA 3PJDA 4EECA 2GSDA 3GP8A 3EEBA 1FL9A 4AECA 4ZI7F 3M33A 1DUVG 3SQLA 5K3OA 2O8FB 5KTMA 3ZDXB 2ZJOA 3SD7A 4B7ZA 1L4HA 4KV7A 4I9GA 1P3DA 4RD0A 1NX6A 2WD7B 3AINA 2QG6A 2QM8A 3CR8A 3KKLA 3T1OA 4DCSA 2QVLA 3OPNA 2QRGA 3LBAA 3WSTA 2CKMA 1A7KA 1CNFA 3T7KA 1YR2A 5ED4A 3EIFA 4W8GA 3DOOA 4A0QA 3M6XA 3F67A 3IN1A 2DFVA 2ZVJA 3TEFA 3UNXA 2IDKA 2UXCB 5CM2Z 1CUXA 2GT1A 5JNRA 4MHTA 1RP1A 1Z16A 5EGNA 3KYCA 1JBKA 2ABSA 1AQYA 4BV3A 5LQCA 1RMQA 4KQ9A 3V5NA 3W77A 5BPHA 4BX8A 5T3UA 3CN9A 1BXGA 4QVKA 1Z0DA 1KAOA 4BWGA 2ZM6B 2VK4A 1YQUA 2WMOB 5FQOA 5K6AC 2HF8A 2BYTA 2HN9A 4NH4A 3EIQA 4AMBA 2F67A 2WSBA 3GP5A 4QGAA 4R2KA 5B7NA 1JRLA 4U00A 4AS3A 3R5SA 2H2DA 2R7MA 1KO4A 4ER3A 2YKGA 4ZI7B 2XZDA 1NYQA 5KYUB 4X6LA 4LC1A 3TLXA 3GMSA 3I32A 2FWIA 2IZ5A 3WNZA 1M1YA 4R3NA 3O2NA 1JECA 5ANRB 3HUEA 4GIBA 4TTTS 4Y6QA 4K5QA 1IN8A 2FPPA 5L3QA 1VZ3A 1HE1C 1ODJA 3CJQA 3LL7A 4Q21A 4UNNA 5J5VA 1D03A 1R0ZA 4HBZA 5LOVF 3GJ8A 2OP1A 4K9MA 4F4JA 1N77A 4MLDA 3K2IA 1AUPA 3NEPX 3K8QA 1NFFA 3VYRB 2IX3A 3UHJA 2H1OA 1KVSA 4L5JA 3DC7A 4AWAA 3ZD8A 4IUYA 2EX4A 1UMKA 3MG9A 3PIDA 1UBGA 4E14A 3FBTA 4TGLA 1IBKB 4LHSA 1QRUA 4G4IA 3UWPA 4WN9A 1C9EA 4RADA 4N65A 4OQXA 1JA1A 3W5VA 3GGOA 4JJ7A 4LXTA 5A71A 3HI6A 3PF9A 2RAPA 1E2UA 4EH1A 3GA7A 4GLFA 3D7NA 4Z5XA 3GCDA 4NBTA 4L0MA 1MO4A 3UY4A 1YA4A 2B4QA 4XFDA 3EOZA 3PEUA 1QPZA 2VPXA 1XD2B 1Y42X 5BYJA 2SNIE 3JQCA 1TM4E 3GIWA 2PX6A 3WGNA 3H9JA 2ZRLA 5AVWA 2UKDA 3BCUA 4TT3A 2HIGA 2RGAA 6ADHA 3P9YA 3D1VA 3GPBA 2BE7A 3DWIA 3OZUA 3U56A 4MI9A 4QICA 4TTJA 4OX9Y 3ABSB 1HQDA 1OWLA 1W9HA 3BDVA 2YV4A 2NVUB 1DAKA 1SUCA 2W0SA 3C6MA 3CB4A 3LWZA 3TJRA 3D4LA 3WAKA 3I9OA 4P0PB 4EA7A 3N3AC 4JLUA 1DC8A 4QQFA 1BA2A 1EH5A 2QTCA 4BO2A 5B12A 4DLBA 2KBFA 5HF5A 2C5BA 2VORA 2IE8A 3I4FA 3W0LB 3NGLA 2SHKA 2AW5A 3GEIA 1T9DA 1N2JA 2DUMA 1FUYB 4K87A 1M6NA 4IILA 3OA0A 3QZUA 4KHZA 3V55A 4X62B 4XVQA 1YTLA 721PA 1QFSA 3UMOA 2OORA 4KR9A 1X9GA 2WQ7A 5LMZA 4BY9E 1XTSA 2JCGA 3BJZA 3QOFA 5L3VA 2BI4A 1LDNA 2YR0A 2N1MA 1MB0A 2JJ1A 5BQXA 1JDSA 4QRDA 4OMUA 4UAJA 2QTBA 4Q47A 1DQZA 3OOHA 1W1WA 2AN3A 3R5XA 1ZOPA 4LPSA 1IMJA 2X9LA 4J16C 1MX9A 2YDXA 3A58B 5EWLA 5BSEA 1TTHA 4I50A 4WN3A 3B60A 3OJWA 2XMRA 2NO9A 1UPAA 2YICA 5BSTA 3DDSA 1Z0ZA 3DUFB 4MUGA 1Y37A 4L7VA 4JXXA 3KKQA 5E38A 1OU0A 2HPZA 3KBOA 2CUTA 1F0NA 1NZJA 3LUHA 2QPOA 3MWGA 2Q5OA 3AR6A 1V1MA 1RWNA 2KE5A 1WBBA 1RFLA 2QRJA 4A2QA 2HJRA 3QUBA 1L5HA 3VA7A 2AFBA 1JHRA 2PT6A 2OBMA 3VZCA 3S3TA 1Y34E 2RAVA 4U7HA 3ENWA 1PR4A 4KJZA 1Z0KA 2J3QA 2JJ8A 2YCBA 3ZDEA 1V11A 3Q8MA 4BVHA 1SU4A 4V0OA 4ZVTA 3OZBA 4CM5A 4MWSA 1U1DA 4WKNA 4M0EA 1EYZA 1QIHA 4GX2A 3ZLBA 4Q9IA 4HMPA 3GGCA 4LNAA 1XGKA 1IK6A 2GAAA 3OWXA 3K2EA 2OV4A 5HKBA 4UCFA 5BVHB 4X5OA 2R6FA 4YDSA 3G2LA 1I9GA 4PFKA 5BO5A 1HURA 3GEEA 4MVJA 1I4TD 1MV5A 1N3IA 4JI1B 4LKOA 1ZKDA 5B2FA 1QG6A 1YZHA 1TJ5A 2RGYA 2X5KO 4YMIA 3QFCA 1I13A 4YDHB 3EGDA 3JQ9C 1GTMA 5FR2A 4LBXA 3ID6C 1AG9A 2H85A 3M6AA 2XYQA 4TKVA 1Y48E 4O4JB 2GM9A 3EGIA 3PA8A 4LOIA 1Y1TA 2G0TA 5HRAA 2ID8A 2NU9A 4GR4A 4LJ8A 5A4DA 3AHEA 3TW0A 2VHJA 5FULA 5AQEA 1C0LA 3GV0A 5KYNA 3RSZA 1GZ4A 4UDNA 2JFHA 2ZGVA 2WHPB 2ZVPX 1G2PA 3OZVA 3REQA 2JAWA 2OPBA 5IKOA 2ETXA 1VP9A 3HP7A 5KNDA 1SVWA 1HLDA 5MDHA 4QXQA 3ANLA 2HXSA 2H4XA 1JKJB 5IM4F 1QYDA 4Y2VA 4CGYA 4WJKB 3W5JA 1MQAA 3T9BA 1R4MA 2O3UA 3LQRA 2OAGA 3B1QA 1EP3B 1TQ2A 2Z2IA 1ZVJA 1DQYA 4YCBA 2W00A 1YNOA 4MR8A 3A8TA 5KJCA 4CM1A 5LQRA 1EK5A 3V8QA 1X8LA 2VHEA 4COKA 2BM9A 3VQTA 2X76A 5GJCA 1HV8A 5AKIA 1QGED 1X92A 1EHIA 3ROQA 1FFXA 1GG8A 1MRSA 1XLTA 2EJTA 3GZNA 4YQEA 5SYNA 2VSOA 1N6IA 1Z6YA 2XSZD 1CE8A 1RYHA 3H4IA 4HNSA 3BH7A 2OG2A 3HXMA 2TRSB 3SG0A 5H80A 1HLFA 4ZPXA 3ZZNA 3P9QA 4M1KA 1ETHA 1CF4A 2D1YA 5AJYA 4HWRA 1DWOA 2Q1UA 3NTRA 4GECA 1NU8A 1SVKA 4IH9A 1WW8A 4PC7A 3VHXA 1U7OA 3IUPA 3UOGA 3E2IA 4ARZB 1JHZA 1ZJ4A 4YROA 3E9QA 3U9TA 3S81A 1GDDA 1ZGJA 4EZIA 1GTJ1 3AC0A 1HFJA 4FFVA 4MRRA 3UC5A 2YBDA 3ZWQA 2ISCA 4OH7A 4YAOA 4KQXA 2AFRA 1UWCA 2F2TA 1ZICA 2P4HX 1Z0AA 5EKXA 1YS6A 1US8B 4OUDB 4QZVA 5EJ6A 3LQQA 5A4KA 3Q92A 1IHYA 3HEAA 4RD3A 4ARBA 5JNTA 1G5HA 3KTOA 5HTKA 2VA8A 4GNKA 3B2EA 3RU2A 1EUDB 1MGOA 2JHGA 3W5CA 1OFTA 3HADA 3BMNA 2Z43A 3WGKA 1A9XA 2GM4A 1U6IA 3Q5DA 3UAOA 4BB5A 5M34A 1KJIA 5EFZA 1VMAA 1ZN9A 2JASA 3C1UA 4Q39A 1BMFA 1Z0SA 3VU9B 2C07A 1SMKA 2QM7A 1E6MA 4NC9A 4FBGA 1W7AA 2HU2A 3UKJA 3DLBA 1GPMA 2C4NA 1XEWX 1QGUA 2HJVA 3HO8A 4TKMA 3ZH9B 3QVXA 1VI6A 3BRWA 1W46A 1P9RA 3HB1A 3QEJA 1WM1A 4BVEA 2Q46A 3ONNA 5A9RA 1CJTC 1SUEA 4X8MA 5CVJA 4CI9A 1Q0UA 4NRDA 4OHXA 1N32B 3ML1A 3W05A 3U5ZB 3DKPA 2AQHA 2CVZA 1QOQB 4LSGA 3QMMA 4DMUB 4EUMA 1CY8A 3UOWA 1NLYA 1ECJA 1Q74A 3IBQA 1M2OB 3OIDA 3THRA 4URXR 4NK5A 3KXPA 1GKLA 2C78A 2Y0EA 3ABQB 1R6XA 2G36A 3HR7A 3KAKA 4QEKA 1DQPA 3R76A 2G07A 3U9LA 5HM6A 2OQVA 1UKAA 1SXJA 4E3ZA 3DEFA 1NQWA 1TTTA 1RQPA 4BWYA 3HN2A 1YK1A 1EFVB 3EEQA 3FR8A 5CLIA 4G01B 3RROA 2QN3A 5C80A 4AMUA 4ETMA 1QFMA 1YDWA 1Z13A 1U2GA 3KFXA 1HT3A 3M7IA 4N6GA 3RJ9A 4HDNA 4C4SA 4QUHA 3PGA1 1SU6A 1FXWA 2BLLA 1JNYA 3TZHA 4EG6A 1INLA 3K3PA 4IAOA 1O6BA 1Q95A 4DMLA 4BEBA 4KHPB 4MAMA 2EQAA 3LHKA 3GJ0A 3H9EO 2XKBA 4QL3A 5CB4B 1XZ8A 5I48A 2Q1SA 1TAHA 4A8PA 3OIVA 4ZOQI 2WWVD 5IANA 5C8YF 4B1FA 1GFZA 5F78A 1Y8CA 1A4UA 4JT4A 4OFBA 1H4TA 1UT5A 5HFAA 3M1LA 4JA0A 4H4CA 3TDMA 1USUA 1VRVA 1KMIY 2UZ1B 5JS8A 2N46A 2H06A 4YWHA 4DZZA 2DETA 1B16A 2A0UA 3GZTB 3RREA 5B64A 2NOAA 1OGJA 3LKDA 1X1DA 4Y2QA 4YN3A 2XE4A 2J31A 3D6VA 1BC5A 4IDEA 1TEZA 4UTNA 2CW5A 1R10A 4BQIA 5K8JB 1IUKA 1ZYUA 3JTEA 5E6RB 2IIBA 3QP9A 4FN5A 1ZCBA 2NVUA 5EZYF 3WLIA 5B1YA 3JAKA 3O9MA 2AMJA 1NW5A 3WIBA 2P3QA 4AUNA 4FQ8A 1TF2A 2IIPA 1T3HA 4EO4A 3G23A 3PPIA 3HKBB 2FJPA 3UMPA 3AQ4A 3TK1A 4KUEA 1P73A 4A8TA 1N8KA 2CLHB 3UJCA 1OAOA 1YRBA 1JPJA 1UP4A 3E35A 3JX9A 2OGZA 4ER0A 5J58A 4XB1A 1HG0A 3THXA 4BBAA 3RBAA 1E79A 4LHYA 1RJGA 2J5KA 2EZ9A 4GBMA 4ARCA 3H18A 1KK3A 3HKEB 1FDRA 2V7TA 1NM5A 3ESXA 2IUYA 1BSVA 2C92A 3L02A 4OXIA 2VSFA 3L1KA 3TQHA 3U1VA 5C2JB 3KZCA 4ASUA 4JYPA 3ZG6A 4C1BA 2NAPA 3ANTA 3BAZA 3EPPA 2OGUA 1PZHA 2YXNA 4PYKA 5EERA 3RT1A 2R00A 3IOEA 2C9OA 2HO5A 3LX5A 1PLJA 2CK3A 1XQ1A 2IY9A 2PSFA 3GRYA 4B8ZA 1QC5B 4CIXA 3WLMA 5KYVA 5JYEA 1MXHA 2Z56A 3CUVA 4MQ5A 2YASA 5FTKA 3TG2A 3ZE6A 2C8LA 3CA8A 3PBKA 5L4SA 1XEWY 3X1WA 4UPVA 4JXZA 4MLPA 4C87A 4TMKA 5I4KA 1G21E 2PZ8A 4D6XA 4NU5A 2UYCA 2D0PB 3FYTA 3KOYA 4EY3A 5PGMA 3LO5A 3OZSA 1IY8A 2QZJA 5C8XA 1PR9A 5DM60 3TRKA 2E4VA 2D54A 3O1LA 4YNBA 4L4RA 1OH6A 4MV6A 1HQYE 4HCJA 1LBQA 5KWIA 2WHXA 3NRCA 1THGA 5LYYA 4WESA 2OYSA 4C7MA 3KTAA 1QTIA 3ICWA 3IKHA 1N9KA 1QHNA 3R9KA 1QZ3A 5EOVA 3PFBA 1LBSA 1J8YF 1NE7A 1QFZA 3WLRA 3D7MA 5DNUA 4LA4A 4FEAA 2WFAA 2OFFA 3ZV6A 1DEXA 1YIOA 3NBMA 4KACA 3C3WA 4KW7A 4Y2XA 5H82A 5HMLA 3WL5A 5FUXA 4TL9A 3HJGA 3PYMA 4GLLA 3U44A 1Q0PA 2UVDA 2OCAA 2AK2A 3UMBA 4K86A 3VZPA 4HDRB 1L4EA 4YFYA 3H2BA 3E27A 4EI9A 4GPZA 4XGQA 5AW6A 4TTAA 1ZOLA 3DFIA 5JSZA 3RSLA 4WNYA 3IUBA 3I9KA 1P18A 4N3GA 2FDRA 1REQB 3V1MA 3NZEA 4BNLA 1QZUA 2AR9A 2P9CA 1GPUA 1NI5A 1UDBA 2OHXA 2ZJBA 4K40A 5EJGA 4DCMA 5IDXA 5LXTA 4IH4A 4E2FA 3LH5A 3Q3HA 3LW8A 4YFVA 3ZHTA 4E08A 1ZLXA 3INNA 1Q0LA 2WWWA 5JS6A 1JU4A 4DCTA 5KCMA 4NI5A 1YONA 2I03A 3BBLA 3P2MA 1YR8A 4IM7A 3IMKA 3JR3A 4EO9A 1SCJA 2OBLA 2Q6IA 3NIFB 2XEDA 3VYTB 4EY8A 5EIXA 4DPMA 3RY7A 3ADPA 2QPTA 3VC1A 4XSVA 1LPNA 1PUIA 1NVTA 3M6UA 1PD1A 2BW0A 4N7BA 3G2HA 2ZB3A 5H59A 3S99A 3O9ZA 2PZAA 3EFOB 3N2ZB 3CURA 5EZQA 3U1TA 2NP6A 1NW3A 3QXGA 3FFWA 4RORA 3WY9A 3OP1A 5YASA 1O8CA 1NV9A 1T9BA 4MZDA 5KNCD 5ILOA 1GEEA 4KBEA 3NWJA 2XUDA 3TPZA 4PIVA 1QGDA 1W1IA 1XEXA 1EFPB 2IEBA 1TZBA 4XQCA 1Z88A 1IN1A 3PK0A 1P44A 4QYSA 1DIGA 3OF3A 4RETA 4DYVA 3V2IA 2ECFA 2WICA 5COQA 1GNLA 3AF2A 1IH8A 1YQXA 3UKOA 2LV8A 3C1TA 2IL1A 1GCOA 4UMFA 5KTYA 2GXSA 1S3FA 2GHIA 3KG2A 3O0DA 4JUDX 4R2IA 4Q9JA 4JUAA 2OVBA 1UK9A 1P1IA 1QUFA 2PKXA 5EPEA 4YMHA 3H84A 1U2PA 2QT1A 3FX2A 5JYBA 3G9QA 4D56A 1ONPA 4MX8A 3DZJA 3N28A 1JKFA 1PBTA 1TD1A 3DKRA 1EP1B 4LMAA 1OTXA 1RIIA 4BZQA 2NUTA 2PZFA 1RYZA 4WQMA 3W1VA 3I5YA 4RY0A 4DMRA 5I7FA 5BQ3A 2ECOA 3JQDA 4ZQFA 3ZIUA 4HZUA 1OGYA 2Q3EA 4H27A 4LYGA 1HTTA 4MQ6A 1JX6A 5B4VA 3L8EA 1PWYE 1W5TA 3D1LA 3D9QX 4IZHA 4Y6PA 3LQFA 1EUCB 4HATA 2B34A 4ANFA 4KAHA 2PKEA 3COZA 2B4KA 4AI6A 4TV8F 2FK7A 4LF8B 5BYEA 5DWDA 5G0VA 1MLDA 4ZHQA 5KNBA 1SXQA 3SVZA 4DBVO 4TZ6A 1WVIA 4J0QA 4RA6A 3ZXXA 4ZO4A 2A3NA 2C20A 1AKQA 1HETA 4R8KA 1ICIA 4BVJA 5IT9A 1T6BY 3QU9A 3AK4A 5D00A 2QD3A 1YZ3A 1N7IA 4BFYA 4W5NA 4L75A 2Q5CA 4UJ3A 2P4QA 1YL7A 4LTMA 4ZEWA 3V4FA 4M0UA 4DR6B 1PD0A 4BQRA 1XTPA 2A58A 3GEMA 1KH1A 3B1XA 3L7YA 4GAEA 1F5SA 1XZMA 1CUCA 4GDMA 4A5SA 4I4LA 3A3YA 3ZDQA 3VO2A 3HH8A 1DL5A 1H69A 3CNEA 4IF6A 2FPGA 3KOWA 4MA4A 4ECAA 5J2UF 3TUZC 3P26A 2PZMA 4BFLA 4S0XA 2V7EA 2W4IA 3O2JA 4GQAA 3MJHA 1RCUA 1E8MA 1OFHA 3BE8A 3BH6A 1LPSA 1ZJYA 2EDAA 4I5EA 5BSWA 1VM7A 2FX5A 2GA9A 2ATCA 3OUUA 1SR8A 2AOWA 1RKBA 1E96A 2BBOA 3ETEA 4KIFA 4XQ9A 1Z68A 5DT2A 5E6UA 2VPIA 3IIEA 3FVVA 5A4MS 5F3WB 1JXHA 3FPCA 1CDDA 1WSAA 1IVYA 5B3LA 3PTAA 1E92A 2YCLA 3SKYA 2WKWA 1HE5A 1V1JA 4QUDA 1QKJA 5ESWA 1F2UA 2BMAA 5C53B 1NBMA 3E8XA 3FHJA 4F4CA 4WOBA 3CWCA 1WDTA 2W8BA 2DKOA 2AM1A 1ZOIA 1LI4A 1Q57A 4KSYA 2UUAB 2A5DA 2H00A 4KWEA 4D9EA 5EQDA 5KB3A 1MJGA 2AOXA 3GMTA 5DWVA 3I9JA 4KGDA 5FBQB 4B4KA 3UJNA 2Q5QA 4LE0A 1UWLA 1XTQA 2A0XA 3I5AA 1TAQA 2P77A 4JZKA 3TZKA 3NHSA 3SDZA 3TLBA 1XMQB 1QYRA 1K3FA 1P91A 1E6WA 1SKYB 2I4OA 2PGIA 3C5WP 3IIKA 1L7AA 5ES4B 1OR8A 1H9AA 2NZWA 3NDIA 3GHYA 3GRCA 3T38A 1W7KA 4WKBA 1AS0A 3A1CA 1XVUA 3UQ6A 4BUZA 2CNWA 3KBBA 2UU9B 3VASA 4JBGA 3LA8A 3WTCA 4C6HA 2RB4A 4KQEA 4OLHA 2R86A 3TFQA 4EI7A 1HYHA 1E58A 3ASUA 4TT8A 5M3BA 1ZWKA 2XUPA 4CXMA 4D4LA 2CEAA 2YDYA 3KPJA 3KHUA 2R68A 3AL2A 3NNNA 4J0EA 2CEKA 1VKOA 2CJWA 3GZJA 5B30A 1EXNA 4HDKA 4OJMX 1BQ3A 3EVNA 1XZKA 3BJEA 1E7RA 2RHOA 3JRNA 3TRJA 3FPAA 1WV0A 1KNXA 2A9FA 2G80A 4ZJPA 4K0KB 3NIDB 4L16A 5ALVA 5KSWB 2R00C 5DN6A 4L0DA 4ON9A 2BTOA 2VJYA 1UUFA 5GMOA 5BSMA 4EFLA 1JLHA 3DF7A 2YOHA 3MPUA 4KYUA 4EYSA 4BXOA 3F7NA 5EY5B 4BX3A 3T54A 3WB0A 1QRRA 2NZUG 4R3WA 4MCAA 4HZUB 4CEJA 3V2GA 5T6MA 1EKQA 3DC2A 4D9HA 4J2TA 1LSJA 1C81A 1EDEA 1OXBB 2EEZA 2H1HA 4L27A 2J32A 1UODA 3G7NA 4PQGA 1WWKA 2R7LA 3RS3A 2XBUA 1T2FA 1TCUA 4JYMA 1YZKA 4F9EA 5JVDF 4KXVA 3BIXA 1EFVA 1HEUA 5BNTA 1UFQA 2B35A 1C4OA 5JYCA 4TXHA 4U3JB 3AKCA 3GGSA 4IMPA 5FXMA 4G1EB 3T8YA 1HR0B 1R15A 5G4KB 4FCVA 1CEYA 2JPDA 4FYPA 2CVHA 5JH7F 2O07A 2J6IA 5HXAA 4AIIA 3GFGA 3KSZO 1GNVA 4KTVE 2ANCA 3QVGA 4OEHA 5AKHA 1TPZA 1UBLS 4ZAFA 4C6SA 1LK7A 4IFIA 3F74A 4BE7B 1QE3A 2VWQA 1SOWA 4KR7A 4NR0A 3K0SA 2DTDA 1IIRA 4Y6GB 3DXFA 4OAPA 5KYXB 1N2CA 1SXJC 1YRWA 2YC2C 3QE4A 1KZHA 3SJUA 1KEEB 1KOFA 5TQ0A 2AUTA 3HFRA 1PQUA 4ISBA 4OJTA 1NLFA 3THYA 3K1AA 3NJ8A 1G5TA 1Z33A 2VUIB 4GOKA 4YAKA 1BGVA 1X7WA 5JNVA 4X9XA 1PEAA 2YWDA 3AVPA 3DJYA 2ZRAA 1JSLA 1OV6A 2JLRA 3RU7A 4ALKA 5I7UA 4J4TA 4KK4A 4KMRA 5DMHA 4ZT6A 2NO1A 4ZEOA 2ZRNA 1K0FA 1ESNA 4JIGA 4KIWA 1U0GA 3MIIA 4BFWA 3PXXA 3K70D 3WLAA 3QXJA 2FG6C 4G5YA 2YV3A 4I08A 1GRCA 4AKHA 4WZZA 1YF3A 3H86A 1RT9A 1V43A 5BT8A 1G0NA 3T41A 4R5MA 4S2EA 3UMSA 5LB2A 1IAQA 2D0IA 4Y9TA 1GD1O 3U7HB 1I0IA 4H3SA 5K6TA 3GJ5A 1UC9A 3RJZA 1AGXA 2P4UA 3RSHA 2G5CA 5A5FA 4PHFA 1E18A 3IT1A 2BKVA 1JQAA 3SMQA 1ZOOA 3W9UA 4LPKA 1WCYA 4ZOEA 4XWAA 5F0ZA 5EYPA 3WWDA 3MOSA 3ZCQA 3CKMA 4COOA 4L1KA 4MH0R 3JWHA 4BHTA 5C1OA 2Q5IA 3PIRA 5BN4B 3SN6A 1E0AA 3RBXA 2KQUA 1QVRA 3HB9A 4E0BA 4D3XA 2J5BA 2DFKB 1YK0A 5L3SB 3Q12A 3X1MA 3DL4A 5EEGA 3D8RA 3HFJA 3JAMA 3EUWA 5B7QA 1VHTA 3VNAA 3SXJA 1CDEA 2PVCA 1HMPA 3CLKA 2ECQA 4ABYA 1OPRA 1Z74A 4K6OA 4GL2A 2WDPA 1UJ6A 2AXQA 2Q1WA 1QGAA 3PHBE 3AKEA 2V54A 4B4DA 1O95D 1YOBA 4BO4A 3AEKB 2BDUA 5HKKD 3F9CA 1O4VA 1M2HA 3BFKA 3JQ8A 4L8LA 4FYIA 4C4PA 3ZDAA 4RC9A 3I1FA 2JGKA 2J6CA 3V1YA 3L9WA 3UTDA 4HQNA 3ABRB 4Q4JB 1ZR4A 2JGVA 1PDOA 3GNLA 1KH3A 3QWHA 1CJSA 5LPNA 5KTRA 3I6YA 3RDPA 3WJ7A 4OHUA 4OK6A 4AO8A 2FEXA 1QLHA 3KELA 1XPRA 1OROA 1EBUA 4B3DA 4NZOA 4D25A 1X3SA 2TMKA 2IXGA 3CN7A 1C9MA 1YHZA 2XRYA 1GEGA 2BFFA 2VDOB 3DYIA 1DXOA 4I55B 1SD2A 3DVRX 4MR8B 4YTEA 5DM4A 3HY4A 1EZZA 5LOVB 4Z0NA 1WPXA 3B6IA 3UWOA 3G2OA 3X1ZA 2DH5A 2IZ6A 3CNHA 4RKFA 4DJDC 5C4IA 5JJBA 4PFJA 3H5TA 1BVYF 2TECE 3EBOA 3IPAA 4A36A 1N5IA 4YL5A 3PVCA 4C7OA 1VB3A 3PEWA 1Q15A 2ILVA 3GJYA 3GLHB 3L41A 5HFNA 4TZKA 1KVUA 4UEOA 3T5BA 3TL3A 3Q1YA 1I1NA 4YV7A 4YO7A 1S96A 4JODA 2DPYA 1A7AA 5TF4A 3CVXA 1NF8A 2PMBA 3EWNA 2OHIA 5AKYA 1C3LA 2C9BA 1RYEA 3DW3X 5H16A 1SK8A 2BDEA 1J42A 3C6XA 2ONKA 2NSLA 1NV8A 1JDVA 2AN5A 3FYDA 2FLVA 3KQOA 3N6RA 3O3NB 1X7GA 4KQMA 4WD3A 1TJPB 1UM8A 2A30A 4ZAYA 4EKYA 1QE5A 5A5VA 4K81B 5EWMA 4P33A 4AJ2A 2ZQYA 4IH1A 4RU1A 2HK8A 2JJQA 2C2ZA 2EKPA 3L6RA 1P1RA 3E81A 1VA5A 3HEBA 3SIPA 3UANA 3UZUA 3W5IA 4CQMB 1ES9A 3HU2A 1SRQA 2DBQA 4HDSA 2IZ7A 3NOVA 3TTTA 3IKVA 2RBCA 4Q19A 3C3YA 3VU1A 5HIKA 2N42A 2NU6B 2JKYA 4HPXB 2ZIEA 3AF4A 2BH2A 1GUBA 3HPDA 1ZUWA 5KJFA 3NDRA 2WG2A 3HBFA 3EGDB 3AKZA 4JROA 3K15A 1RLOA 2FSVA 1SOMA 1B8UA 3RAFC 4FJ1A 3UHOA 4BWVA 1J2EA 1CUVA 1Y6RA 3L7OA 3ZE8A 4NIMA 1DGMA 4XVUA 3W4SA 3UGQA 2AA0A 3DAFA 2HWKA 4LRYA 1VLJA 2XF8A 4AW9A 4RNDB 1ELOA 2LXNA 3HYOA 2BKUA 1YB7A 1MO2A 2A1IA 2GEFA 5H81A 4O3FA 4Z4FA 1R27A 1IAVA 2WKQA 1ODTC 2OM2A 1W36C 1T5OA 1Z7BA 3TXYA 1Z29A 1OV4A 3X1KA 3ZS8A 1ZK3A 4KH0A 2CFOA 1NQAO 2HQOA 2QX8A 3CXUA 5JC8A 4QDIA 1WXWA 4B7CA 3W3AA 4PX3A 2GBGA 3RVLA 1QTRA 2G76A 2PS9A 3DOFA 1SQSA 1TK9A 2CBXA 3RYHB 1QB8A 1TL7C 4D42A 3G2KA 2QYTA 5LXTF 1XNQB 3IPYA 2QN2A 4AULA 2VRCA 2A57A 1N8SA 1FP1D 5T4EA 4FZRA 2G04A 2IS6A 2HBRA 3OC0A 2JK0A 4R83A 4KANA 1JQDA 1GO2A 2QPLA 1KI6B 1FP4A 4OJKA 3RQ6A 2VAVA 4Z9AA 4ZT2A 4Y9SA 5CDTA 2GCOA 4H2DA 3BWXA 5B6AA 3N6VA 2I6SA 5ENVA 2CCJA 2CFRA 2R8XA 1OY1A 3M9XA 2RBKA 1EXMA 1P0FA 3UUGA 3VYSB 4DCCA 3NHZA 3R7DA 2V4UA 3L2OB 1SBNE 4Q3BA 4O4HB 1R8QA 4N0DA 2RH8A 1BRMA 1DLJA 1NULA 1F3LA 4HK4A 4KJXA 4YREA 3VM6A 3QX3A 2IA5A 3GRFA 2E37A 1UDRA 2BHSA 4NZ9A 5CBPA 2GBPA 2PV7A 3PNLA 1U8UA 2P2CA 1HDRA 3TSCA 4OGWA 4PRLA 4CM4A 1OVGA 3E1KA 3A1DA 2G8NA 4FLEA 2A0FA 1HYGA 1A9RA 1CFJA 3FYUA 5I45A 1RLIA 1UEXC 5CLFA 4WZBA 4QOGA 1RRCA 3UA3A 1K8ZB 2CMFA 3O3MB 3AP2A 3OZWA 2C5LA 1PSDA 1PN3A 2IYAA 4TTIA 1UEJA 2IWRA 2DFPA 5LLDA 3GLFE 2Q0SA 4MMXB 4E2XA 3ZJYA 3O5AA 1J23A 2GSWA 3UTCA 5K20A 4IDCA 1T5DX 1U65A 2ZTHA 3FMVA 4CVMA 5C40A 1V8PA 2B4RO 2J59A 1KDOA 4BNIA 5JMTA 2D59A 4X71A 5ALNA 1KTVA 3GLVA 3PJFA 4HJXA 4QUAA 1EP2B 5SY9A 4DKXA 3UMJA 2NUPA 1E94E 3C1OA 1FK8A 1E3WA 2JS7A 1A9TA 5EWJA 1IJBA 2QY6A 3Q3IA 4RHYA 5LP6F 3OUZA 8OHMA 1F8UA 3EVDA 4BKUA 2YXEA 1MCZA 4TVKA 1RHQA 4HNVA 5AOVA 2HGSA 4IJUA 3LSYA 4GOOD 2FE1A 1ZY2A 2HD4A 4Q48A 1WZCA 2QAJA 1NM5C 4IYRA 2CLIB 2EL9A 2EJUA 3DMNA 3EZ6A 1Q1GA 3I0NA 4UMVA 5EP3A 5J9FA 5JATA 3N2YA 2XB4A 4G1FA 1VPEA 1QQ7A 1NR7A 2CHUA 2OAP1 3PRKE 3ZTYA 3UH1A 4RTNA 3LXUX 2JLCA 2ZRDA 1MAHA 5I5EA 2YRFA 1I2DA 1NW4A 2BKEA 2P9TA 4M1SA 3UHFA 1WULS 3STUA 4UUMA 1IZZA 4BO1A 2JIMA 3D7KA 2MYNA 4E8ZA 5KYUA 1M0TA 1LB1B 1OIXA 2VQSA 1UPFA 1JR2A 4EIWA 1PUXA 1DKLA 2ARKA 4C1NA 1BN6A 4O2AB 2EP5A 2FSGA 1YNSA 1AS3A 3CJRA 4D0RA 1E6KA 3PD7A 1GRRA 2I33A 1RE0A 5EUMA 1NSTA 2XLBA 4ZU6X 2H0RA 3A11A 1E89A 1VCOA 5JNLA 1YASA 4CMJA 3GUUA 5JI3E 3MBKA 3R0IA 3X2SA 1PHPA 3D31A 2RGGA 3M34A 3NWEA 4KNWA 4NMXB 4KGVA 2BKLA 1ORHA 3KQTA 4BMOB 5JEEA 3A32A 3IR6A 4J0DA 5AKXA 2BEWB 2JDID 4KXYA 3ZWPA 4EVRA 4NU6A 5FKJA 10MHA 8ADHA 3LTEA 3W7VA 4IZ6A 1NW7A 2UUOA 2X3FA 1ISPA 1N5JA 4GBJA 4UE6A 2P79A 3K1ZA 3KT0A 5BQPA 4B6EA 4CIDA 2AOVA 2LR0A 3OUTA 4HVTA 3H1AA 1ZCAA 1BFUA 3P2OA 4NV0A 1LW6E 4ZT3A 4B46A 5CA0F 2QRZA 4FEGA 3H7IA 1PNRA 2G1KA 2WSLA 5EJ7A 5B7PA 1KI8A 4YJ2F 3MCAA 4F2GA 1VK4A 4ITUA 4M1WA 3R7FA 1SCUA 1U9IA 4DSTA 1NR5A 4K9RA 3UV6A 2ZANA 4MQFB 3WLKX 3ZJUA 1DG9A 2XA9A 4MRNA 5JQWA 3AFOA 1M0WA 4QJBA 5DYIA 5K6AA 2H9AA 2RMKA 2E5WA 2R6CA 3RYIA 4DLTA 1HO3A 1TYDE 2R47A 5J4YA 1QDEA 3UGKA 5JD3A 3RT7A 4L9SA 1R6AA 3PFHA 4YLGA 5EJFA 3SGLA 3WBBA 5K4GA 3FFAA 1PS9A 1ISHA 3SVLA 1MO6A 2PCJA 1Z8DA 4FD2A 2D5CA 4LBZA 1P6UA 3AVUA 2CYAA 4C76A 1SM4A 2GCGA 2HRBA 3U3JA 3WLSA 4G23A 2PGAA 5BSKA 2ACEA 4YPOA 4JUIA 5ABPA 2AQKA 1MAWA 1MFPA 1Y3BE 5K09A 4TWIA 4RSHA 1XYYA 2X40A 1U3VA 1GGMA 4BFTA 1DZ3A 3NBFA 4KQFA 2XITA 3FCCA 3VO8A 1FS6A 1M6VA 1VA4A 2CNBA 4BIMA 5COJA 3MILA 2BRUC 2IXEA 3HEMA 3MW8A 3TAXA 1UWVA 3PXBA 1KY5A 4PAOA 2QRVA 3RHTA 2G3YA 2E4UA 3EISA 4J9UE 4UAGA 4X97A 3QEBZ 3FVTA 4LBWA 1W19A 3FMPB 2V0CA 3F2VA 4WSOA 4MW5A 1G3UA 1L4UA 5LFAA 1L4FA 1PGNA 2OKGA 2W11A 5CPFA 5DEOA 2DLCX 4WK0B 2GF0A 2RKBA 4G0XA 5DP1A 1MX3A 3EPJA 3VBEA 4I36A 4DLPA 3CRVA 4J1SA 5DH9A 4BASA 1G21A 1N0IA 2W2MA 4TOIA 2C1XA 2W2QA 4ZDJA 2VWGA 4G5OA 3H1EA 4F1WA 3FLMA 2BTQA 3RHSA 4CF3A 1B42A 1AGPA 1P2DA 3TTUA 2IYWA 1QG0A 1UBOS 4ILKA 5MFPA 2QUJA 4MB2A 1VQ1A 2VDUE 2WHQA 2BY4A 2IQIA 2ZKIA 3DT6A 1H6CA 4I14A 1QCYA 3EXIB 4PHHA 4CTKA 1L5SA 2VL7A 1HI9A 1XZPA 2V96A 4QDKA 5AW5A 4JJKA 4DIKA 3QUSA 4X8LA 2AN1A 4XASA 2BGRA 3T99A 1V5GA 3QIVA 4IJMA 1SKMA 2CDCA 4AG6A 5FPYA 1CX9B 4OAQA 3UATA 1R9NA 3DNFA 2ZXUA 1C7RA 4LSWA 3FTQA 4PXAA 1AMOA 4F9TA 4KAXA 2Y9PB 1I36A 1YS9A 2OZKA 3HL4A 2Z83A 3R7AA 3S1LA 4BNHA 4YT4A 3CF2A 2JNWA 1RADA 3I76A 5LZ8A 3W3AH 7YASA 4TVOA 4KPYA 4ZT5A 5HIIA 2J46A 4LFAB 2CDNA 2E49A 4J49A 4UHJA 3LMKA 3PHCA 5KKNB 1BVRA 1RAGA 5AXCA 2HCBA 2O3TA 2HA4A 3FSEA 2GM5A 2COKA 2IPLA 3HBLA 4K6GA 4LMRA 3VPBA 2MMCA 4EEZA 4U8HA 2NAFA 3OD1A 3AR7A 2B1IA 4I7EA 5TSDA 1G8GA 3IJRA 2YNMC 1QV9A 2OUKA 2VAPA 2CJPA 4UBMA 1T13A 3WDLA 4ZCIA 1G6OA 1NVGA 3OTOB 2QW1A 2Y93A 4JGBA 4CCAA 1F1JA 3A9CA 2ZT8A 1S3GA 3KE9A 4JU8A 4CG3A 2IUSA 1VL5A 2BL4A 2CL7X 3BKXA 3LX8A 3PL2A 2WWFA 2X1LA 2Y66A 1JLLB 1UBCA 3KUDA 3BXEA 4PPGA 4GVPA 4F6CA 3FTNA 3ENNA 4RJ2A 3T7CA 3CWQA 3EOAI 5DT9A 1FX0B 4GMXA 4FWTA 4HI0E 4M9XA 3RVBA 2GH1A 1OBVA 5E7MA 4MRAA 5L3ZA 2Z0MA 4YCLA 1RQ7A 1ISFA 1N2BA 2WM8A 5CFNA 4DC3A 1U0FA 1OZHA 2ZXEA 4PCUA 2CXNA 1LV7A 4U7DA 2V6FA 2WZCA 3BVPA 3U7GA 4OHZA 4D9IA 4Z3KA 1ZBDA 4OKSA 3V8BA 2QSZA 3D3WB 1IB6A 1E3EA 3H1GA 3MB5A 4EG7A 3PQ8A 4XUDA 5E1DA 3O3CA 1CP2A 1OXXK 3EQZA 1YBVA 1C7IA 1GTL1 1YGJA 2RGWA 4BPRA 3U0VA 1U7TA 1ZIYA 2HJ9A 2PGNA 5DISB 4C0BA 1QE0A 4LCEA 1NI3A 3ZGYA 4EOGA 4RSRA 4YR9A 2XUQA 2RHJA 3O4FA 1C0KA 1D0SA 1L5GB 2D2IA 1YVDA 3CR3C 5KAPA 1K63A 2B2CA 5I7WA 4YCNA 1RBMA 3VDMA 3OCJA 1IE3A 4MP6A 4ZK6A 4RX1A 5DSXA 2XQJA 1XJQA 3MVEA 3DR3A 1QG2A 4LQ4A 4Z9YA 4ADSG 3LNCA 3EXG1 2VQFB 4Z4GA 1MQ8B 4FNOA 1N1DA 5B55A 3L4EA 2G17A 4FOLA 4YP1A 4ARVA 2C3OA 4CUKA 3OCXA 4AICA 3COJA 1JHXA 3HJTA 2H5IA 3T9EA 3WFIA 2CXPA 2QZZA 3VPSA 1UBEA 2AG5A 1ADFA 1RWMA 2F1KA 2P7HA 4QPNA 4RHCA 2JAPA 1SCQA 1AQNA 1MNAA 2TMGA 4GT1A 2AG0A 5CFQA 2XZOA 4PYRA 1VCMA 1C3JA 2FPIB 2FZ5A 1H1LB 2WWIA 1RJEA 2HWXA 4K6CA 4JXKA 5J2TB 5T7BA 5HZMA 4JK3A 4HQ0A 2EFYA 4MUKA 2CNWD 2AZ4A 3UHPA 1U04A 3BFPA 4YJ3A 2CBGA 3MWYW 2RH4A 4GW3A 4PR3A 5DYGA 2ERCA 5FTWA 3T7DA 3AM1A 3RIHA 4W5OA 1T43A 16PKA 4KWTA 2C7PA 4RPCA 5HPYB 4Y9UA 4DV5B 2VARA 5BN3B 3FZGA 4DU5A 3CSSA 5KNBH 1OFUX 2QI9F 3WQHA 3AOEA 3FTCA 2B0JA 3RIMA 2JFPA 4L72A 5JTUA 3CC8A 3OPQA 4IO1A 1V4NA 2OMEA 1SU7A 1FZQA 4NBRA 4LX8A 4NEGA 4WXEA 3J81k 3TW8A 1SXJB 3NLLA 5DGTA 3RQIA 1QGYA 2OGWA 5TARA 1X3LA 4GU5A 4FHDA 4D9FA 2GN6A 3GYGA 1ODLA 2XOKD 4N8DA 4C20A 3ZS7A 3MFYA 2Z2YA 3OLWA 4ACBA 1IZ0A 1Q44A 1YJXA 3EQ2A 1B41A 2RH9B 3HBAA 4RDIA 4LV5B 3UK0A 4AUKA 1J2RA 2DQZA 4LK3A 2QG4A 3S7TA 4UPEA 5ICSA 2WJZB 5HZHA 1XLWA 4JZYA 2R6R1 1XVVA 4EUHA 3CVYA 1R88A 3GW8A 4M0PA 5CM8B 1N9GB 4DBLE 5DYYA 1XLTC 3FSGA 5KU7A 1FCJA 3IAS1 4V3BA 4FHEA 2CJXA 5C3UA 3PXAA 3WAGA 3RF7A 3EVTA 3QFTA 4FZVA 5AM0A 3HUTA 1EG2A 5BWOA 5I3ZA 4KFTA 1P4SA 2LWIA 3CPEA 5KHAA 3RASA 4F5EA 4DMFA 1XZEA 4RHEA 4YONB 4WZBB 1RWQA 1J8VA 1L3IA 4YRFA 3ZIAD 4G25A 4DZTA 2CLDX 1FBTA 6LDHA 1FU7A 2Q5JA 3ONEA 4L22A 5CFMA 4P5EA 5HJ7A 4MW2A 2IHJA 4ZO8A 1UBMS 1VI2A 3QKWA 2IUFA 3INGA 2J87A 3TI9A 3LS2A 1FFGA 3P0IA 5CITA 3PC8C 2ZYGA 4J0IA 5CJ2A 4RV9A 5HCNA 2YMLA 2HQBA 2FCRA 3CCCA 2C5GA 5DNEA 2JZNA 2VTVA 3PLNA 3Q1KA 1JPNA 3BL8A 4RULA 5CD1A 3CZAA 3TOZA 5CX4A 4Q3KA 1M1UA 1XU7A 3CR7A 3R74A 1G8FA 3HXTA 3KHSA 4HSEA 3O4RA 3A6HA 1J1IA 1R9GA 4QIHA 3TNDA 1SXPA 3QTBA 1M8KA 1HT2E 1KQ3A 1DRJA 3DB2A 2XYRA 2ZE8A 5AVOA 4B0PA 4FUQA 3WKDA 5C81A 4P31A 3AR4A 3WLLA 2P9JA 3H5AA 3ONFA 3TZCA 1F7UA 2YNMD 5TS3A 1UBJS 3OKAA 5FYDA 3VRHA 3HKDA 3AO0B 1H3EA 4LUCA 1ISSA 4O5OA 3GFOA 2F17A 1MOSA 3FPGA 4PZUA 1K5DA 4X65B 3OFVA 1GPBA 2NNWB 2JJYA 3EVCA 4M9ZA 3HR4A 4R1QA 2QTZA 5LQUA 2OXTA 5BR7A 5LU8A 3M4JA 3C24A 2P30A 1F17A 1JDZA 5EXEA 3T5MA 3GROA 5CAEA 2FPMA 2XVYA 1RVV1 1HYQA 3SHTA 1N6RA 3GWGA 4CM6A 3GJTA 5EMMA 4YRGA 4F93B 4K9LA 4NCIA 3F6BX 1UQUA 4YX9A 3URMA 3MSXA 2BFNA 5SYMA 2WP0A 3FF4A 3FOCA 1M1NA 1KFBB 2FN9A 5F7ZA 3ZHYA 3Q9SA 1IQPA 2XA2A 4J0HA 4LJSA 3V3KA 1V39A 1E2DA 4MEBA 3W5SA 3O4HA 5FBZA 5DX8A 1QHXA 4EYKA 1EVYA 2CC2A 2I6QA 2WKRA 3OSUA 3U19A 1QF6A 1YFZA 4LK2A 3TECE 1XPOA 4BMZA 3DVSX 3KJZA 5E1MA 3CBQA 2R6AA 4GXQA 3QAIA 1QGZA 3QEOA 3SKXA 1R4MB 3T34A 5HKKA 1GNTA 2PKMA 3FZEA 4MAFA 3EGCA 4LY0A 4GBGA 1GFIA 1Z28A 4KFRA 3ERCA 2XRFA 2HW1A 2V9CA 2H52A 3I04A 3MBOA 2DCUA 2K4MA 2K6GA 4I9FA 3SM9A 3WL4A 1PK8A 1Z5OA 3PHHA 5REQB 4MDFA 4AS1A 4BE4A 4F56A 4GRAA 1E3MA 3GLHA 4C08A 3ORSA 1FYWA 3TTSA 4I9NA 2DBYA 4B3BA 4RTKA 1YZYA 5H02A 5LDGA 4OHYA 4XLZA 3KD6A 2W6IA 4ZALA 3NL3A 5BN5B 3JVEA 5IH3A 3RS5A 4AMYA 3IBYA 3WAJA 4V0MA 2ZLBA 1UZMA 1Y7PA 1Y82A 2PBZA 3EF3A 1LQTA 3PD1A 3RJ5A 2XCUA 4F4DA 2ACWA 2Y1WA 4J4BA 5K51A 5B3KA 2X58A 2M6KA 4L0CA 2DPGA 4IXWA 2FZKA 3NUQA 3SLKA 1BCSA 1Z2EA 1E7YA 4NG4A 4PGHA 4ZCMA 5CB4A 2A5GA 3MIZA 3L84A 1UOEA 3OJCA 1CEQA 3D3NA 4FSXA 1KMCA 2J45A 2PYZA 4DCUA 2DKNA 2G9VA 3K94A 2WQZA 1KAQA 4OHCA 5EA2A 3SY8A 5JH7B 2QQEA 5JMPA 3TLGB 3DE7X 4LE2A 1EQ2A 2ZBVA 3IAHA 3M5PA 4RJIA 5KQSA 1K3TA 1BNCA 5IAJA 1XAJA 5A1JA 3TBFA 1QQ5A 4H1VA 4WCFB 3LC0A 4L02A 4LBGA 2C84A 3FKSD 2FX2A 4U9IS 2JLQA 5ISMA 3RD5A 1RNLA 5B1IA 1CQZA 4LECA 3LRPA 4FGKA 4KV9A 4WXMA 2H1LA 2NXJA 3LHIA 2DT5A 3LUJA 1OH8A 1VJRA 1ZRMA 3QF7A 4XD2A 1H22A 2L2QA 3ZM6A 5ALIA 1V2GA 1VHDA 5CXUA 2GZ2A 1IZ9A 3PU6A 1CYDA 4QU9A 1GNSA 4O4JA 1KA9H 4NYIR 2VVTA 4IEEA 4YRJA 3BFVA 1ZUHA 1H5UA 1KXZA 1X1QA 2VQDA 2ZRFA 4I9UA 3VYWA 1C9JA 2QN6A 4DQKA 4PC1A 4AZ0B 1BKSB 1XZHA 3NT4A 3DAYA 1LK5A 3ZU6A 4EVSA 1DIHA 3OI7A 4XUEA 4DW8A 5HP4A 2VK2A 3CRNA 1G2IA 3N2KA 2YMMA 1BKDR 1HPLA 2ATIA 1AF4A 2ZTUA 3H9QA 2BFFB 4Q37A 4HLDA 4ZJYA 3TX2A 1D7AA 1CWUA 4H0CA 5TXGA 4PQYA 4D5GA 1P3Y1 4KAAA 4KLNA 2JZOA 5JZVA 2F64A 3LP5A 4D4IA 4CN9A 3ZDYB 4F3TA 3KQSA 2V03A 4WFJA 2OFOA 4XTRA 4GQBA 1NOIA 5LKAA 4LEIA 1ZGGA 4F5ZA 1MRZA 1NJ2A 4RO0A 4DANA 5FNVB 4GP6A 2GD0A 1N5OX 1RHKA 1TCVA 3A1NA 3EFHA 2OSVA 4QA9A 4DY6A 5A2QA 3G9XA 3E84A 3OZ7A 4PONA 2CJWB 4H7DA 4CLEA 3GXOA 4YJDA 2HJWA 3JPWA 3T52A 2PRKA 3OZIA 3PKZA 2PSHA 4LISA 5DTJA 3V2UA 5KOYA 4JX8A 1DB3A 1XK7A 1PNVA 2HSDA 4AURA 3CHYA 3HDJA 4FYYA 2W6QA 3IVCA 4RKYA 3W6NA 1LIJA 1WTCA 5CBPB 2FUEA 1FQKA 2CVOA 4BAGA 3EUEA 5AKGA 3AUXA 5JJLA 3OF5A 4YI3A 5EQFA 1T0HB 1QOPB 5KWSA 5J59A 2B78A 1H0RA 1PNTA 3BFXA 3TLMA 1IRIA 3GFVA 1AUQA 4X63A 4YRRA 4FEYA 4EHNA 2C2KA 4HFJA 4GRIA 5HCUA 1ZU4A 1DELA 5B4TA 5BW8A 2B69A 1G4HA 1E1DA 2ORED 3DBVO 3IC5A 4AJKA 4PYJA 2ZT5A 4DV7B 3LO8A 2PVPA 3P32A 5E6RA 3PQEA 5SZKB 1SBCA 3QE0A 2HV9A 3L1HA 3MJCA 3MWDA 2HPHA 2DZDA 3M5DA 3P4YA 4Y6SA 4ZYTA 2O5VA 2HXYA 3TMAA 5M2QA 5LKRA 3HSSA 1QGOA 1JI3A 2J9FB 4C78A 3ENVA 1E9VA 3I2HA 3U17A 5EEHA 4QNRA 4CDGA 3OLCX 4H0NA 1SH7A 4V0NA 4ZVSA 3WO0A 1BN7A 5ALYA 2NSYA 4R1NA 3L92A 2ORVA 2JBHA 4DMMA 4M7OA 3NC0C 1OHHA 3QFFA 3G0BA 4IWXA 4MVJM 1XPUA 1ODCA 5IAKA 3GDFA 4JLJA 3AF6A 1KOGA 4HD8A 3MHPA 3N86A 4C5CA 2Z6UA 5PNTA 3MS2A 1DQSA 4RVUA 3ANYB 5FJIA 2QJOA 4IIGA 1RIFA 4IDAA 2C9CA 4B6SA 4BFZA 2KPOA 1AKUA 1PL7A 1L1RA 3O92A 1V5FA 3UG6A 5LD2C 3A70A 3PS9A 1R64A 3H99A 5CG2A 2PQMA 3BGVA 1RWKA 2I7TA 4YQZA 3T12A 1QVZA 1SBYA 3B1RA 2YHAA 4X1KA 2QMUA 5JNWA 3DF9A 3PDJA 5GADl 5BMVF 1BCRA 4KE9A 3UQ9A 4CKEA 4D82A 5AI4A 2YV2A 1SA0B 5A5GA 5J3JA 2GD1O 3OPYB 4RMHA 5IJAA 3REQB 3TSOA 3NEAA 4Y2HA 3JASA 3FCEA 4OLJA 2AUMA 2O0MA 3ZGNA 4CTMA 4IXNA 1HYEA 3TFWA 2R7KA 3C8MA 3A4IA 3TRIA 1ZM4A 1OC2A 1BWRA 5MN4A 3T94A 2TMDA 1KARA 1AS2A 3RVPA 3RAGA 5LBIA 2ZRMA 3L7KA 1SUPA 3UUFA 4E5DA 5FX2A 2J9GA 3OD5A 4IHJA 1IHPA 4XPIA 4Q1DA 3DDCA 3SQNA 4P38A 3TTVA 4QHSA 4K1XA 3IJPA 4KE7A 4KXQA 5IWCA 4BE9A 1G55A 4CJXA 5I8PA 1ULUA 3U37A 4TYQA 4YMSA 5E9WA 1U8ZA 3LUKA 2WE8A 4J7UA 4KYVA 4WFIA 3KJFA 1P1HA 3IO5A 1YB2A 4CEJB 4L08A 3IP6A 2YFKA 4QOEA 3AU8A 5IDWA 1J56A 1JHDA 1K08A 2B4YA 3H1TA 3WIDA 1U7PA 2NUTB 4NE2A 2GLUA 4NABA 3TS1A 1SKBA 1Q1QA 4NFLA 3UO8B 5F9HA 1WXHA 3EIUA 2GWHA 1EBBA 2V98A 2IYYA 3E5MA 4N5IX 3P4XA 5D87A 5EVJA 2BFBA 5IC6A 4N12A 1WUJS 3L4JA 3RQ8A 4BJ6A 3SJCA 4RQAA 2VDKB 5KJ6A 1T5LA 1J2TA 1T9GS 5AK6A 4KREA 2Y8EA 2J6HA 2PNJA 3D3WA 2O8EA 2PLNA 4B45A 5K3BA 3NC2A 1X13A 2QMOA 3GOQA 1LFAA 1YJBA 2OV2A 3HVJA 4UXJA 4CF6A 7AT1A 3GLFA 1W59A 2V0GA 5J4KA 3EFBA 4JSYA 4W9RA 3QRWA 1ZJZA 3TZ6A 3B2NA 2VK1A 2VTBB 3V1LA 2WSSA 4BL5A 2I91A 3SYRA 5BRAA 4HB4A 4Q9AA 1ESDA 1N9GA 1Z17A 3QIAA 3TTXA 4TM8A 4EG3A 1KP9A 2J0QA 2DU8A 3N87A 5BW6B 4FN4A 1H5QA 2ACVA 4RDXA 3IVGA 3DLHA 5LQAA 2V7QD 3A3KA 3T3DA 5K0TA 2ZI4A 2Z9DA 5FOSA 3Q9NA 4EL5A 4DT1A 1QH8B 3O94A 1T1JA 1VCHA 3Q3CA 4QEDA 4PLYA 1RACA 2P75A 2HHJA 3GLRA 4GZLA 1K8QA 2GYYA 1E2EA 2AFIB 4R9NA 4KQ1A 2WF7A 2NZXA 4AJEA 4C7JA 1NUAA 4JL5A 2XOKA 4RPGA 4XE5A 1N4AA 4P81A 4DDHA 4X84A 2VZ0A 2FUNB 1SK9A 2GYVA 1XROA 3MBJA 4O4JF 4QBIA 3BMOA 3WGJA 3OHSX 3SS9X 1DCKA 3P1JA 3LCCA 3NBXX 3DHEA 3L6BA 4ZI2A 2DM6A 4LOLA 3LNTA 4XQ0A 1RPZA 4MUJA 5AHKA 4JSTA 1CULC 1IEQA 1S1CA 3VAAA 1GAEO 3BXFA 1XZJA 5EE9A 3FCYA 3HB0A 3TB4A 3QCZA 5IF3A 4IGIA 2IXAA 1G16A 4LF6B 1A50B 5IVDA 4CMEA 2JLBA 2IDJA 4CUZA 4RVHA 4DNXA 5C1DA 3CEPB 2JIZD 1VYHA 1H1TA 4MIEA 4PSDA 4AB1A 1OBHA 4EITA 3PQ5A 4L07A 4P22A 1IXRC 2F8MA 3STVA 2P6MA 1ZC4A 4WW0A 4EMUA 2E6KA 3Q3JB 2Q4OA 1P81A 4P4GA 3ZY6A 1IOVA 4AYTA 5HUJA 1LBIA 3E0QA 1PFGA 3P96A 2RSLA 5AVJA 4M9RA 4F8EA 4JNKA 5HIJA 3ETGA 2Z5VA 1J0CA 1NMYA 4WI1A 2PDAA 1TZCA 1WUHS 4G0QA 5IPFA 3DQZA 2X0EA 1Q1BA 5B3JA 1P7VA 3UPTA 1O95C 2P4EA 2PJDA 5DTQA 1K8XB 3ISVA 3TBHA 2EF0A 3EXAA 4HEHA 2P6UA 5H83A 3TF5A 1WXXA 3IEIA 4QATA 1Z75A 3ZU5A 5KOHA 3PFGA 2GEBA 3UGJA 4CYMA 2A5LA 2XBLA 5KYYB 2NWHA 4DV3B 1M8GA 1NASA 2HREA 2QIPA 2QVYX 3H5IA 4K6FA 3KM0A 4MP3A 4OJQA 4P82A 1QHHA 2EW8A 2D1RA 4R6WA 1KZ6A 4E33A 2J0EA 1JVBA 4RK0A 3N2KB 2Y76A 2IYEA 3DGEC 3FZYA 4KITB 4UFOA 4NFHA 3IP8A 3U40A 4U7XA 2WTXA 4A6PA 5CA0A 3KKMA 1VLVA 1IUPA 1M2VA 3DTVD 1L3CA 2EFCB 3W8FA 3OX2A 1FRQA 1ZCJA 4WZAB 5B1DA 2JFFA 3CLHA 4G24A 5A9SA 4TWRA 3R6LA 4NMLA 2CV1A 1EGHA 1HE8B 4PTLA 1XL0A 5FLXA 3JARA 1Y4UA 4AZSA 4FWBA 3CF4G 3TCNA 3ZW7A 1DPGA 2JHAA 3FRJA 3MT0A 1RRKA 4PX9A 3UFXA 2OHVA 4FIZA 5A3JA 5GIPE 4A15A 3LZ6A 4XIYA 1T10A 2YQ5A 4WXRA 2COEA 4N41A 4D7AA 3HDQA 1W36D 2IP1A 5DVZA 1AQUA 4FWIB 3BMXA 1SXJE 1YXMA 1D0VA 4UUOA 1DOHA 1DWQA 2ZRJA 5J5CA 4Z4CA 5BY2A 1MJ5A 1QKKA 1ZIOA 3PYXA 5C7OO 7REQA 2PG3A 1GUFA 3V2HA 1NLUA 4S1WA 5EI5A 3A1UA 3VZRA 4FE3A 3BWCA 3WLHA 5TRWA 4OL0A 1AD2A 1CR6A 1QQBA 3KKPA 1XA0A 1WBDA 4DSOA 1YL6A 2QHPA 1BCSB 3AB7A 3UMYA 4DDKA 4KTTE 4Q00A 4EHFA 4HTFA 4PBSA 2ZUBA 1UR5A 2WUFA 1UK7A 1H2ZA 2ZW9A 3B1YA 1DRUA 1C3VA 2E3JA 4KLRA 4M2LA 4WLEA 2F6RA 4UFPA 2B7BA 3B8EA 2O3QA 1U28C 4UM5A 1YKSA 3O1IC 5EHZA 1M8PA 4JEIA 2OBBA 3QMWA 2FXIA 3V4ZA 4DNOA 4Y1GA 2A92A 3GJRA 4WWHA 3O8RA 2CFCA 2G83A 1CZUA 1WV1A 4PZCA 4CV1A 2D8MA 3JQAD 4EKDA 3GVXA 1P4AA 4MVJG 2OCKA 4A2CA 1UAGA 1WD5A 1M7BA 4OBXA 4CV0A 1PI3A 3WK4A 2GN9A 3ZCSA 4ESEA 3VZQA 1X39A 2ZRBA 1RZ3A 4URWR 3GNQA 3LZDA 2PO5A 2Z4RA 1MEOA 2ZM5A 1Q0ZA 2CHQA 1EX7A 2EATA 3H2SA 3CVOA 2XDYA 4QTTB 3W5DA 5K0SA 2Q8PA 3B6JA 3PE6A 3KK0A 1VIVA 2BMWA 4FFBA 1EFTA 5F21A 5FFFA 4E7OA 4I8XA 3SP1A 2QRQA 2M98A 3R7SA 2AF3C 5F9MA 1PE0A 4BGDA 5ALZA 1V5EA 2QD4A 5BOSB 3HS3A 3E9DA 3MM4A 4AS2A 4D41A 1VZ2A 1Z07A 3OU7A 4PNPA 4UTXA 1EDOA 4QG3A 1KRWA 4D3FA 3E3AA 3F90A 4S04A 2G72A 4H60A 3WXMA 3NM4A 1BW9A 3SHOA 4GG1A 5BW5A 3LVBA 3MD9A 3S5UA 5KC8A 4L5AA 4WY5A 3DDZX 5AOCA 4DC0A 1JLLA 1TM5E 1J39A 1DIBA 4TUYA 1ILEA 1DUSA 1YE8A 3OETA 2A84A 2LVBA 3FR7A 3GJZA 2IS1A 4NPCA 1I3MA 2AKYA 2XJ9A 3ZU3A 4XCQA 5HVNA 4P4NA 4DREA 2XQVA 4EARA 1DMSA 1KH2A 2XVMA 2PAFA 3PCXA 5C3MA 5DHPA 2A9RA 1J20A 3NHMA 3V7YA 4IFEA 4FTWA 2IHZA 4HAXA 3HYTA 3E9YA 4ZDWA 1GCIA 1UEIA 1IC6A 4C12A 1V7QA 3KYBA 2JI9A 4JBWA 4E8YA 4GX0A 3FTPA 4RLFA 3UJ8A 4CFSA 4IXTA 3FPJA 3IQFA 1Z6TA 2C2YA 2CB0A 2OUIA 4N6OA 4NV3A 1ML4A 4Q4JA 4UHEA 3U0BA 4D79A 1QP0A 1OXVA 1O8BA 3CLRC 4PFSA 2VP0A 1RWVA 4CI0B 4JC0A 1AIPA 4OQPA 1C1DA 1KU0A 1NL3A 2QTVB 4LSZA 3IKLA 1F0YA 5K1ZA 5A02A 4L2IB 1C3QA 2O4CA 2UVPB 4M9SA 4MOWA 1DJQA 3ZZMA 1P9WA 5CNJA 1V6SA 4FMDF 4GKJB 5ED0A 1QJCA 2A67A 2BHNA 2WT4A 4IKEA 2OYCA 4ARUA 1G7RA 1P74A 4UM9D 5LUAA 3DB1A 4BU1A 2JH8A 4EY6A 2ZBUA 4MJLA 5EKUA 3L18A 5I7SA 4F2WA 3LDUA 2IELA 4AL4A 1EX9A 3K8OE 1WY7A 1PQPA 2DDMA 3KQVA 1T3SA 1AX9A 4XX1A 4EA6A 1PS0A 1GZDA 1M3SA 1YR3A 1G17A 3UFXB 2C1EA 4Z4QA 4F60A 3C8UA 1QO9A 2FVYA 4IDQA 4B3RB 5KNBD 4F2PA 3DYBA 3MOIA 3PGVA 5JNUA 5KYKA 4LHVA 3PL5A 1QYIA 2X5NA 1ZR2A 1RMTA 1VMKA 2H8GA 3BA6A 4HN2A 1JDPA 4OIMA 4WTOA 1N0WA 1V3VA 1QR6A 3KR0A 2FN7A 1KJNA 4MQMA 3CZ5A 3EOBI 3RANA 2O2GA 3M2PA 4H4EA 5FWYB 1HM5A 1X1AA 2C4HA 4Z8YA 1M73E 3EZ2A 4KFCA 1HZJA 2JAXA 2BEKA 1P3JA 1RQNA 3HL0A 3SEFA 2AYYA 5CA1A 3T7TA 4IIUA 3SF8B 3RB8A 5JSHA 2X7XA 2F8LA 5F73A 2GK3A 3MJSA 2V7PA 8GPBA 1NDUA 1PVDA 1YAJA 4OLFA 1V95A 2W9XA 3TOVA 3T7SA 4MHSA 3E5HA 3EDMA 4C88A 2C04A 3H42B 3ETDA 4CMKA 2IOHA 3GFQA 5JMWA 1XN1A 1MPXA 3MBHA 2P6RA 5A3VA 1UDXA 1DUIA 2ZUDA 1XWFA 1FMTA 2OB2A 5I9SA 4H6VA 1PT8A 3LGSA 2JEYA 1X7ZA 2C7QA 3H6GA 3ZWMA 3PB3A 1E9BA 3HHPA 3OBIA 1A9PA 1P1KA 3QY0A 2B37A 2PJZA 3ZQ4A 1OAAA 1NLZA 2GI4A 3QW4B 4RNCA 5FA6A 3RTBA 4XPIB 4G8BA 1R0SA 4IBOA 4ZOLF 1XP5A 3BJRA 3RRJA 1H42A 1ZITA 4FYWA 4A3SA 1U1CA 3AV0B 4I55A 2YYSA 1VOTA 3KKEA 4WASA 4EG0A 1IY2A 2JGFA 4I8IA 1M34E 3JSXA 1W0KA 4IF4A 4DTIA 2H1FA 5B3JC 1DRWA 4N3NA 3UB2A 5JTTA 3EQ9A 3VYUB 3GD5A 1LTHR 1KTIA 3J7AC 5HUQA 2O8FA 1Z56C 1WABA 1FMLA 3HYLA 1L5RA 3M2TA 3FCUB 1N2IA 4BRSA 3WISA 4HAIA 4EX6A 1D7OA 2WSMA 2BFBB 2YH2A 5DGCA 2QF7A 3C5CA 1VYVA 2WU4A 2W2VA 1F6BA 1BG6A 2PZKA 3GJ4A 5IBQA 3WWPA 4C14A 4CM8B 1O94C 3TD9A 5JXWA 3K6SB 3I28A 2EP8A 4B8YA 2OBFA 4OHBA 5CT8A 1NY6A 4YAJA 2IC5A 1WLYA 2VYVD 1PL6A 4RQUA 2VRNA 3I9LA 3VISA 3D2AA 4HS4A 3VO9A 4MKHA 1WW2A 1X9IA 4YAUA 1WEHA 5IULC 4BVKA 3AR3A 5SYAA 3IURA 5IN4A 4XLTA 1E4OA 4NY1A 2WIKA 2IT1A 4NBNA 4D45A 2I7VA 1D2AA 1KJYA 4GE0A 2QTLA 3S8MA 2D1QA 1IL0A 3C74A 2H1SA 5CIWA 5CRIA 5EKTA 1PR0A 2FQQA 2DTEA 4LJLA 4NS1A 2MSNA 3HJ6A 3RRFA 1CJKC 1IZYA 2J3MA 1N3BA 2VAWA 2O23A 1L7VC 3L79A 4P3KA 4HZIA 2V8BA 4JP5A 4BJ3A 3FOEC 3HZRA 4I81A 5LP1A 1G60A 1RHRA 5BW4A 1L2TA 3OPYA 3JCZA 1UZAA 3E1SA 3JD2A 3KSDO 3P9PA 1PF7E 3PSHA 2HF7A 4J3NA 1TQ4A 3QXHA 4HRYA 4WEOA 4G0YA 2YC4C 1CUDA 3RTEA 1P4GA 4OGLA 3BD7A 1J0EA 1LTQA 2YXBA 4HSGA 4ND8A 3P9NA 4ICIA 2FEAA 2VZ8A 4EZBA 2P2ZA 1NBAA 2O3SA 3CWZA 3HP1A 3K0EA 4MVCA 4DXDA 1AHPA 5GM1A 4G89A 1VLHA 3IVMA 4DN6A 2NU6A 4DSUA 2GPNA 4IWNA 1P9LA 1GTSA 5FBWB 1T2CA 1ZH2A 3C4JA 4F3RA 1Y5MA 2YX1A 2ZSEA 4H7FA 5AW0A 1EG7A 2ILTA 1TW2A 2PUTA 4MO2A 1XCMA 2PWPA 3H16A 3OTXA 3QFSA 5JNSA 4LQDA 3K73O 1D5WA 2Q5EA 1G7TA 1XMXA 4FUTA 2XE8A 3FTDA 5HMMA 4NJMA 1X2EA 5LM3A 3CKYA 3PGLA 1JFFB 4QFDA 2FB9A 5D3MA 3NJ4A 1ZUNB 2PK3A 1TIKA 4HOYA 5LOVA 2AV6A 3M1YA 4QVGA 3MWFA 1OASA 2ZBPA 1A5SB 1NWHA 3IKMB 1LI7A 3UK1A 2NX2A 2X8JA 3KOUA 4RVCA 1VE1A 1XI2A 1T4BA 2ZIGA 4NCJA 1EXVA 5IARA 3MINB 3WGOA 4WX2B 3R3UA 4KH1A 2QRLA 1FP4B 3U5TA 3ZWBA 3LOOA 4KALA 3L7CA 4XSHA 4MGHA 2QTNA 2E87A 4BLRA 5CCXA 2FSUA 3RYHA 3NKLA 2C03A 1T2EA 3KVVA 1QHGA 1W35A 4EUKA 4RY8A 2NUBA 4MS3B 1JSCA 3E8MA 1H4VB 4PO3X 1T8WA 5EIOA 1RPNA 1CRLA 4JI2B 3HB4X 1V1SA 2WTBA 3CGGA 5IYZF 1MOPA 3Q3VA 1BMDA 4JYAB 3ILVA 1ZSNA 5E7QA 4G0MA 1NP7A 3TLAA 4HYEA 2IJGX 2HZBA 2WKPA 4JWKA 4DR5B 1P4RA 5JWHA 2FSFA 3R1IA 5GAJA 1EE2A 1LF5A 2BKXA 4NU0A 3RH0A 1IU9A 1JJFA 1ZA2A 2BFMA 4C7XA 3T3EA 5D2CA 1Z18A 1E5DA 4TS9A 1EINA 1A3CA 1P4JA 1M75A 3QJYA 4AF7A 5BYBA 2C2OA 2LDBA 3ABZA 3OEYA 5DNDA 1NATA 1NQVA 2ZJZA 2VJMB 3GDGA 5BUCA 2RHTA 1DBRA 4H4DA 3Q8KA 1RFUA 4ZOCA 4XZ3A 5BYFA 1JL3A 4B3MB 4Z4IA 4M38A 5L6LB 3T3MB 2IHKA 3QSYA 2P68A 4B43A 1UMCB 2NO5A 1D6NA 3A9UA 2NSDA 1QIEA 4L85A 1PG0A 1NXSA 3DMTC 4M87A 4C2TA 3KYJB 4AY2A 1MBZA 1R5BA 1OKKA 1JG3A 4N6NA 1P2BA 1K66A 2GN0A 4EJSB 4QARA 3STWA 3WYBA 1SG0A 2CE2X 1KVTA 4JX9A 4XR9A 3ZNQA 2RHBA 5LZ9A 4HLQB 5JQGA 1SZPA 3OU6A 1F5NA 4BJ5A 2VJNA 4P4LA 4QYMA 4CODB 2EYQA 1GZUA 1H66A 4FZJA 1MD9A 4XIFA 5HRUA 4HYTA 2BLNA 1OT5A 4AQDA 1UMBB 2VRWA 2FHSA 2P9ZA 2X1MA 2Q3DA 3QPUA 2AWDA 4RPKA 4S1IA 3RLFA 5LQDA 1X94A 3KSMA 3I42A 3GFBA 3JQ8B 1O3YA 1JVSA 2WJ4A