3RT9A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with coenzyme a
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 183
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rt9A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rt9A02
3NBWA 3IBQA 3RSQA 1LIOA 1UA4A 3RQ6A 4C5LA 3H74A 3QA2A 3RRFA 1JZTA 1EKQA 4LBGA 1VI9A 2DG2A 4E8WA 1GQTA 3MBHA 4K8KA 5F11A 3I3YA 3LHXA 2AJRA 4KBEA 3RT7A 2DDWA 3GO6A 3NC2A 1YGJA 3ROXA 3RM5A 3B1PA 3H49A 3RO4A 4B8RA 3K9EA 3CQDA 3ROEA 3NM3A 5TRWA 3HPDA 1RKSA 4JKUA 2JG1A 3ROZA 1L2LA 4UBEA 3RPHA 2NWHA 3EWMA 2HLZA 2C49A 4C5NA 1V1AA 4JJPA 3PL2A 5EY7A 5C3YA 3KZHA 3RREA 1KYHA 4XF6A 4EBUA 3RTGA 2ABQA 3NC9A 3RRBA 1YHJA 2HQQA 4EN4A 3LJSA 4K9CA 4C5MA 3VAQA 5EYNA 2FV7A 2JG5A 3RSSA 4YWRA 2AB8A 4LCAA 2I6AA 4E8YA 3B1QA 2A9ZA 2AFBA 2RBCA 3IKHA 5BYFA 3JULA 1C3QA 1DGMA 3RNOA 3RT9A 1TYYA 2YXTA 3KTNA 2QHPA 1LIJA 3KD6A 3MBJA 3BGKA 2A9YA 2PKMA 1LIIA 3D3JA 4DC3A 3RTAA 1UB0A 3W4SA 4YL5A 5C40A 2PKKA 3B1RA 3RSFA 1YGKA 4EUMA 2R3BA 3RTCA 3RS8A 3RU3A 3RQ8A 1GC5A 1ESQA 4E8ZA 2HW1A 1LIKA 1U2XA 4KAHA 2YXUA 3FHYA 5CM5A 3UBOA 4E3AA 3RTDA 3RPZA 5BYDA 2XTBA 2Q5RA 1ESJA 4S1MA 1RK2A 2AJPA 3N1CA 5F0ZA 1RFTA 2C4EA 1WYEA 3NL6A 3NL3A 3FHXA 2DDMA 2I6BA 3RQHA 3RRJA 4O1LA 4C5JA 1V1SA 4B8SA 5CGEA 2AX3A 3RS9A 3B1OA 1VM7A 4EOHA 4K8PA 2R3EA 3NCAA 3Q1YA 4XCKA 2VARA 1LHPA 1JXIA 5CGAA 3RSGA 3IE7A 4K9IA 5C3ZA 4XF7A 3RTEA 2QCVA 4S1HA 4GM6A 3NL5A 4K8TA 3BF5A 3QAIA 3DRWA 4N08A 4KADA 4PVVA 2JGVA 2PKFA 3UMPA 5B6AA 3RQXA 4U7XA 1TD2A 3GO7A 3LOOA 2F02A 5COJA 3Q92A 3NL2A 3ZS7A 2F7KA 3NM1A 4K93A 3IH0A 2DCNA 3B1NA 1LHRA 3DZVA 3RQ2A 4XDAA 3RTBA 5C41A 1V19A 1V1BA 3UQ9A 3RY7A 3VASA 3RQ5A 3D3KA 1JXHA 4KALA 2AA0A 4C5KA 3K5WA 3HYOA 3UQEA 4E84A 1RFUA 3PZSA 1TZ6A 3ROGA 3HICA 4JKSA 3UMOA 2V78A 3B3LA 4O1GA 3UQ6A 3LKIA 4LC4A 4S1IA 3NBVA 3RU2A 2AWDA 4WJMA 1RKDA 3GBUA 3UQDA 3OTXA 3KEUA 1RFVA 5BYCA 1RKAA 4K8CA 3IN1A 4KANA 4E69A 5BYEA 2DDOA 5TQIA 4LBXA 1BX4A 1EKKA 4X8FA 2O8NA 3RO7A 2ABSA 3IQ0A 3RQQA 4DU5A 2PKNA 4N09A 1VK4A 4S1IB 1TZ3A 2I5BA
chains in the Genus database with same CATH superfamily
5KYXB 3HGMA 4FSDA 1JLHA 2C3YA 13PKA 4F38A 3GD5A 1ITZA 4W9RA 4CN8A 3PS9A 5ALIA 4JASB 2Z6UA 5AKHA 2IOYA 3EGWA 2OM2A 2X2OA 1BJKA 3BCUA 3QVOA 4NI5A 2YOHA 3KBOA 3OY2A 1EDEA 3P9RA 1N78A 1U2DA 3B6EA 1SQ0A 3CH6A 4FX2A 2YJ4A 5IFKA 2RHOA 3L8DA 2AEFA 3NRJA 4KE6A 3F5FA 1FLAA 1Y34E 2AC7A 2YCLA 5ALYA 3NC4A 3R7WB 1GSHA 3D7NA 1UPTA 3IAXA 1L7EA 5HGJA 2NYAA 4JA0A 1YB5A 1OZHA 3WRXA 5DASA 4EUKA 1SQSA 1UIMA 5CVTA 2C5LA 5AI5A 4H15A 2CEKA 4PINA 1G6Q1 1KZ1A 4KRXA 4NYIQ 5JSKA 1MIHA 3SSMA 3PHHA 1XZJA 5K3BA 4J4BA 1O7JA 3DBLA 3Q7QA 5DGDA 1XMOB 2LD4A 2R8YA 3BIWA 4YY3B 3BJMA 1YVRA 2A88A 2I4NA 4ESHA 1PT6A 2RBKA 4U4AA 2RGCA 3NAMA 2V9PA 4BS9A 2DVMA 1P3Y1 2V9ZA 2ID8A 3FSEA 2JLUA 2HI0A 1Z83A 4OAQA 4ND4A 2PTHA 4KFSA 2P27A 3C0KA 1QK3A 2GUWA 4B76A 1GARA 3PYXA 5I6DA 1OH5A 1VA5A 2BZ0A 1Q57A 1MG0A 4HS4A 3BDIA 2GPTA 1VGQA 3DMTC 3I04M 3L7KA 1IDOA 3AINA 4GI5A 2C57A 3Q1KA 4YUVA 1KMHB 3BF7A 1LPAB 5FO1A 1K86A 2GN4A 2ZYHA 1G2QA 3RRYA 5K6AA 4AJHA 3L6EA 4OQ4A 2X9VA 2QENA 3HZHA 4LPKA 1E0KA 2ZB4A 5E6UB 4Y2JA 1Q95A 5LDDC 1QQ5A 5HJEA 1Q16A 4JOCA 1PTJC 1XQ1A 2FAXA 3P27A 1GN9A 1OAOC 1PP4A 3WGZA 3N5CA 4BKMA 5CXSA 1D6MA 3BMCB 4EUEA 3ORHA 4PYRA 1R6TA 2HADA 4NL4H 1DCTA 4AVYA 2AR9A 1UBGA 1WP4A 1U0LA 1Y8RA 2C5BA 2WSIA 3L0DA 4O1HA 4X00A 2L18A 2LV8A 1ADCA 1RQRA 3ENQA 5AJUA 1UDXA 3MMPA 3HBAA 1F6WA 4AYTA 4DWWA 1OFGA 1Y4UA 3GCZA 1C3EA 2ZKIA 4AL4A 2GK4A 3JQ8B 1HH4A 2BFOA 1JHZA 2W6JA 4Y1RA 2FN8A 3JZMA 3LX8A 3WB0A 4GFDA 1P9LA 4P4SB 4CIDA 4C5KA 1C9DB 1VA4A 3PX2A 1AKUA 4DY6A 3IO5A 3MLAA 4M1YA 4JYPA 5EXTA 4RXUA 1V47A 3WQBA 3Q41A 3WRVA 3M83A 1RZVA 2PH3A 5IEBA 4EHJA 2H07A 1JU4A 1M2WA 1CVRA 4EG8A 1FU7A 4K9OA 3HB9A 4M0LA 2PUDA 1YC2A 5D3MA 4TZTA 5C3UA 4D9KA 3EY9A 2H4XA 1L4FA 3ASVA 4M38A 1QTNA 4QU9A 4MK4A 3B9BA 3ZKWA 1Y7LA 3Q3JB 4Q9KA 2C0PA 3V33A 4YWHA 4K87A 4JB0A 5JSYA 2PYIA 1QH9A 2I87A 3GRPA 1G7TA 3L46A 3PWTA 2Z83A 3KX2A 4WW0A 5DP2A 3RUIA 5JAUA 1VP3A 1FP6A 1QIIA 5KB3A 1JIKA 5TSDA 4JLUA 1Y9EA 2IOFA 3HVIA 3F8TA 4DDKA 4DMKA 3IUJA 5JCXA 4MS1A 1AX9A 3TQOA 1QG2A 1A9XA 3ITDA 4TT3A 2G06A 5DU2A 2SNIE 2ETVA 3T7KA 3OIDA 4QFDA 5AJTA 4F3RA 3ZH9B 9LDTA 4IIJB 3MHPA 3ZH2A 4E4YA 3UBMA 3OTGA 4MR7B 4EELA 4C4YA 2EV9A 4YCNA 2B0JA 4GLFA 1RFLA 2SCUA 3EISA 1HNXB 4PSVA 1ZNQO 4JYZA 5JD4A 3PQFA 3V3TA 2FSVC 3B38A 4G9GA 3S4YA 1I4LD 4B34A 1PUJA 2XZPA 1JIUA 2FMXA 4H4DA 3AJ9A 5F1KA 4JJZA 3QM1A 2FY8A 4B47A 4IKEA 1ZN8A 3BHMA 2AZTA 3IYLW 4MRMB 1PX0A 3WYGA 1SQGA 4LOLA 3CLUC 1QX3A 4DNQA 2KHZA 4R2JA 3KWFA 3EUWA 4HN9A 1WCXA 4Z9YA 1EWTA 2I5PO 1QTRA 5JYEA 1LC3A 1T4MA 2Q0XA 1AA6A 4B4WA 2CV0A 1S2IA 1FFWA 2BC9A 2ERCA 4MKHA 3VKWA 3JSAA 4LG1A 1NR1A 3WJ1A 2D0DA 3FF1A 4MWOA 4A16A 5HJ5A 4UBMA 1USKA 5CVCA 3UOAB 3ZTWA 1I1QB 5C7LO 2J48A 5HXAA 1ZC3A 1HBJA 2DGDA 1DINA 2VXCA 1UJCA 4C21A 3T8YA 4Q24A 2KW5A 3N1CA 2ZIFA 2Y9PB 3FNHA 3ICPA 3ITEA 3OE7D 3QFHA 1M2OA 2O1EA 2H2WA 5I7OA 3VZSA 4O1LA 3VX3A 3N2YA 1VG9B 2YYZA 3C5EA 3X1XA 5DW0A 4ARAA 4D79A 4A5OA 1AQ6A 3SPXA 3COJA 2ZR0A 4KVGA 4OSEA 3BF8A 1AKMA 4EX6A 5FLYA 1PK7A 3VISA 2R4UA 1JA1A 4KBYA 4JD5A 4RHFA 1KI6B 1CQIA 5U4QA 4HDMB 1NBOA 4IGKA 4C0WA 3K6RA 3PFFA 1DAMA 5KMGA 2BEWB 3PC2A 3X2EA 4ZMBA 2J5BA 4V0ME 5HM6A 3AKDA 3PQ4A 2IZ1A 4W82A 1DDGA 3E2PA 2J59A 4UEJA 5IAGA 5FFFA 2BDEA 3DM9B 4JI2B 1M54A 5NULA 4PBRA 1JBWA 4MKRA 3VPDA 2ZR8A 4BBJA 2Z5LA 4B79A 3AYZB 3BWMA 4FLMA 4Q4AB 1GAQA 1UINA 3AEQB 1G7CA 1RYHA 4RNCA 3IBYA 5EMJA 4YAKA 1RYBA 3ZL8A 1XYYA 1QHYA 4WXRA 1MLDA 1QOZA 3RKSA 4F5DA 3LA6A 2XPCA 2WYIA 3G0BA 4DIUA 1B76A 5JOQA 3OEWA 1OBCA 3TCKA 4NXMB 1E20A 3K6SB 1USIA 2ZYAA 2QGFA 3FNRA 1YR6A 4XJSA 1G2OA 2HK7A 4IF4A 5TGZA 1MHTA 1L4YA 3A7DA 2R5NA 1WUYA 4ZOCA 2P5SA 4NH0A 4CIBA 1H2FA 1NFFA 5CDFE 1U28C 3R20A 3HJFA 1P5JA 5IZCA 2HR1A 1DJLA 3AETA 2D6FA 1FFHA 2OZPA 2ZRNA 3PIDA 4NVRA 1GT91 3KUCA 1N77A 2PPLA 3JQ9A 1HEIA 4B43A 5GQSA 4GYYA 1D04A 2WJZB 4E21A 5EP4A 4RQUA 1COWD 2Q29A 3GT0A 3I05A 4PZUA 1UC5B 3I6IA 1DCKA 2YWDA 1WXFA 4I4IA 5A4FS 4DHEA 5B4TA 2PXXA 3GG2A 4C5LA 1NBHA 3AJ8A 2QT9A 1W85A 1K8ZB 1FNDA 1MEOA 2L2QA 3GGDA 4OHCA 1A71A 3KV1A 4QTTB 5CYFA 5DX1A 4EAAA 2RHHA 4G84A 4R40A 4U9HS 4DDTA 5CGEA 4NHOA 1LI5A 4TUYF 3WGVA 1K2WA 2J0SA 3IV6A 3G2JA 4OLHA 5D86A 5BYJA 4OTZA 3INRA 4TQ9A 3SZGA 3MBOA 4YMLA 4GU5A 4PAGA 1Q6ZA 1S4QA 2R4TA 3DHNA 1Z5NA 1AH2A 3ASUA 1AURA 4MV3A 4EB6B 2XW6A 5EP1A 1YIOA 5JH7A 2A0FA 5EC8A 2I80A 4C7BA 4LA4A 5B1EA 4BC0A 1M7HA 1MU0A 4UAUA 5JXGA 4C2UA 2HA0A 3CE9A 3CMCO 3K8OE 1Y82A 1P75A 4QGBA 1RU3A 3D8SA 3KE8A 5EJGA 3ZLTA 4YQFA 3EMDA 3HUFA 3VDNB 4IM7A 1J22A 4PPQA 4XEHA 4G0OA 3NIBA 4EKIA 2JLYA 1E96A 1E7QA 4Y2GA 3WL5A 4FS8A 4I99A 3NHKA 1ILEA 1RQLA 1TDJA 1Z28A 2PT6A 1TU4A 1UOEA 2C5SA 2CJXA 2XX3A 2PAAA 1QAMA 3H4IA 3WMEA 2ZI6A 1GRNA 3DBLB 1NBIA 5HRCA 3R3UA 2WD7B 2ZOSA 1NQXA 1U5CA 2FWBA 2OHVA 1MO2A 3JRXA 3KLPX 3KQQA 4IDGA 4RGQA 2FLKA 2O8BB 1GC5A 1TMOA 4GPIB 5DGIA 2ZPUA 1XZLA 5DDIP 2PMKA 1RWPA 1V41E 5JDCA 2XUDA 5EQDA 2O20A 3H2IA 1I5OA 3ADBA 2HPZA 4RPLA 1PK9A 2O4UX 1JT2A 3NM5A 2VPWA 4ITRC 2BISA 4GRAA 1NYQA 1UJ2A 2A5JA 2BN4A 1TA9A 2G9ZA 2F1RA 2P2GA 3NBZC 2WPNA 4PNPA 1YR9A 4F2WA 2D4AA 3S0JA 1JSCA 4P35A 1N25A 5LZ9A 1V1MA 3IPCA 1AM4D 3NG1A 5DVZA 4CCYB 1SVOA 1VGRA 4B3GA 2A78A 5KX5B 1NXSA 2FHPA 1IONA 3KJFA 4KSBA 2IHVA 3WLIA 4BYGA 1QP0A 2DBQA 3AF5A 3K5IA 2XBUA 2PSEA 5CNIA 1DO0A 4R2KA 3R41A 1VMAA 2IYSA 1PR0A 3AONB 3LX5A 4U02A 3VR5A 5CDGA 1Z17A 1KSJA 2WIKA 3D6TB 3UJAA 4ZI2A 3QE9Y 4QUBA 2XYGA 1SXJA 4WY2A 1ZA1A 2AVDA 4MRPA 5KYXA 4I1RA 3P19A 3GZTB 2JGNA 1PAUA 2P9QA 4KHZA 1ISHA 3DQQA 2ZRCA 3HO1A 1TGVA 2PQMA 2C8KA 2G5TA 3OEYA 4KL8S 2GNPA 4DLPA 4INZA 2JJMA 3AG6A 4M89A 3OVMA 2V58A 3ZWBA 5CBPB 2DY1A 1DBRA 1RMTA 2C1ZA 2Q9AA 2YZNA 3GJQA 2WMNB 3C4JA 3MJSA 3MWFA 5CPBA 4AJIA 4JI6B 3EXHC 1PGPA 2B8JA 4OYLA 3ECCA 3WYNA 4E0BA 5BQFA 3PZSA 2PSHA 4MUHA 4LS3A 4F8EA 1QRDA 1SRQA 3NGMA 3BJIC 1VPWA 1PTKA 2PU7A 2WC1A 4LXUA 3DTNA 1SG0A 3TX6A 2VJPA 3UJ9A 2C04A 3T9EA 5BSWA 5JQWA 1WE2A 3UHJA 5B3AA 1A5TA 1QDLB 4CKZA 3EF0A 1I2CA 3DC2A 1DKLA 2QRLA 2X1HA 1L7MA 5KKCA 5FA5A 4B6SA 2AZ4A 2DB3A 3PC6A 1KSHA 1ZGHA 1W1UA 3T4XA 5CM2Z 4EPRA 3NHBA 4RE6A 1J56A 4S04A 1Z7EA 3HWSA 3MWJA 4AI6A 1GA6A 1UBRS 2AYZA 2WFMA 4CI0B 4RIHA 3SQLA 4BN5A 3VC7A 3LUDA 3NYQA 3GO6A 1TF5A 1VRVA 2R25B 1GDTA 1YGJA 3A9VA 3KSDO 2ZS8A 4YRMA 2WM8A 5AJWA 2P30A 4PGFA 1ZL0A 4ZAYA 2CFOA 5EIWA 5TX7A 5EKTA 3UXEA 3OWOA 1JDBB 1OBHA 2XA9A 4MA5A 4BWFB 4C3ZA 4LF9B 4P0QB 4KQFA 1CSEE 1DGQA 3VSBA 3EWMA 4BATA 3DSRA 3E7XA 3HV2A 4Z4HA 3N9IA 2EEPA 3SE7A 1KYZA 1V43A 1XT6A 3R76A 1OAOA 2XAAA 3P26A 4NKRA 4HAOA 5FOVA 2ZWPA 3SIRA 3DF9A 3G6KA 1RHUA 4C04A 1OBFO 1XZPA 1UZUA 2E9SA 4LYAA 4S1OA 5DCYA 4YPFA 2JDIA 2P4HX 2W2TA 4P53A 1C4WA 2EKBA 4RVHA 4Q9HA 4DAEA 3SXUA 3PVCA 3VPSA 4ENPA 3OJ0A 1HOXA 1K88A 3FLAA 5DNWA 3TN7A 3KB2A 2VF8A 2OCBA 1VZ3A 1UDRA 1M2FA 2X5JO 3IDOA 3ME5A 5C1PA 1B15A 3WYDA 4S1WA 5TJ9A 1L5WA 5L7YA 1Q1BA 4MITA 2B3DA 3RG2A 1MPXA 1NQVA 1WSWA 3Q4GA 3T3MB 4DRXB 1EAYA 1QGYA 1VLVA 3L0PA 1DKQA 2BW0A 2GM5A 4D9FA 1RPZA 2CLKB 2ZXUA 3EGDA 1ZCBA 3S2YA 1EXMA 2WEKA 4J4HA 4Y6OA 3KLOA 4M0CA 3D8NA 3U44B 1J2EA 1XRMA 3E4DA 4RMHA 3ZX5A 1VMIA 1FTSA 2BFFB 3LLCA 3L92A 4CEJB 2PRKA 2Q41A 2QUAA 1R9NA 3IDAA 4R8RA 4GI2A 2P41A 4ZAFA 2XZLA 2JGKA 3LVBA 5KTMA 1DP4A 1NVGA 2FQ1A 2UU9B 4A15A 1MO4A 4H4CA 1FDIA 2PO7A 4L27A 2WUGA 3ODPA 5E4YA 2WU4A 5CW2A 4KRFA 4XD7D 1YS6A 4E7OA 2X4LA 4DUGD 1RCTE 2HQ1A 2LZ0A 1S6YA 4BVFA 5DN9A 3LHIA 4C08A 1VSTA 1XUOA 3O3OB 1I4DD 4GSYA 1WQ1R 2ZI7A 3LY5A 4OP3A 2IFTA 3A1NA 3OQHA 4XVHA 1LBIA 1NAHA 2BGJA 3QXGA 1S2MA 4H1TA 4R51A 1WU7A 2R8EA 5IF9A 3Q92A 3E7WA 4KWCA 2NZ8A 4MVJA 1JSZA 2IP1A 2XUAA 4JP1A 3WLHA 4DIMA 1X1CA 3C6KA 1N6PA 3GJ4A 1D6NA 1VJCA 2XZDA 3AG5A 4O5OA 4BQPA 3FSGD 5BP7A 4A36A 3L7NA 1C9MA 1ZGGA 1UFKA 2CMHA 4NMHA 4CT0A 4QT4A 1DWOA 3GPLA 2UYYA 1E1LA 1KEPA 2OO3A 1C1YA 5AYVA 3QW4B 3IPYA 3TTVA 5HDQA 4RF5A 1M2HA 1I0IA 2PBZA 1QFJA 1ISGA 2A9OA 2MIIA 2VK8A 3JPWA 3MEQA 5ALZA 5DRYA 1POWA 1P4JA 1JMYA 1RI4A 1T3HA 2MSEB 5FX2A 2YW9A 1TUIA 2C42A 4TWBA 2PMBA 3UFXA 5TE9A 3AR2A 1JV2B 3DXZA 3EXAA 5HOQA 3HYRA 1OU0A 2A0YA 3NFYA 4KODA 4DS3A 3IUEA 3WA7A 3GJ0A 4I5IA 2I5BA 2O52A 3EUEA 1U3TA 3NUZA 4G0ZA 4FC7A 2RBGA 3PPYA 5H0IA 3JVEA 3LUPA 4CMIB 4CV2A 3IQGX 1S7GA 1W2HA 3MT9A 2XECA 3QUBA 3EDMA 3OURA 4HVCA 1IVYA 1XCGB 4E2FA 1ZK0A 1T5SA 4MVWA 1QU2A 3EQ6A 2XVXA 4L8WB 1U8CB 4ZVRA 4EMBA 7AT1A 2R65A 3UHFA 2EKLA 3VSAA 1YNOA 5IMBA 2P9CA 4UMVA 5ECDA 4XIJA 3T3EA 3MINB 1JT9A 4DIOA 1YT5A 2FP4A 1C9JA 2LDBA 2NVOA 2VUHB 4FYXA 4MSUA 1DKRA 1CQPA 1GUDA 3P2JA 4P3PA 4Y30A 4ZJPA 3TI7A 4NZPA 2ISSD 3BE4A 2GPYA 1QUEA 2NX2A 3K9LA 4BY9E 3WGHA 3LJSA 5I47A 3AY6A 1Q7GA 4O33A 1PVVA 3T5TA 5M04A 1QKIA 1IPHA 2IHTA 2WJGA 1RWMA 2PYDA 2XMQA 4YO8A 5JTUA 4OLAA 1VIYA 2ZAOA 1SCBA 3L0ZA 4JVSB 5CVJA 1HF3A 2W6IA 3V2GA 4FI3C 3R7AA 1W93A 3P96A 3DLIA 4K3VA 1WX1A 5C81A 4PNZA 2JBAA 5ERXA 2Z04A 3H65A 1W5TA 2BOVA 3W4SA 3KLBA 1XJWA 3NM4A 5MHTA 3I32A 2AH5A 4WGFA 4Q00A 3LUKA 3AKCA 4LGMA 1YZHA 3CRVA 1YS1X 1DBVO 1RBQA 5GGYA 3KQHA 2CJPA 4I66A 3VHXA 3ZJTA 1F60A 2FX5A 4A73A 1G6OA 4K6OA 4W5OA 3KJEA 3IV7A 4GP6A 4LF7B 1GG5A 2IYZA 3GUUA 3IODA 2I78A 4P93A 4DQLA 3K6KA 1X7HA 4NOJA 4NG5A 2Q5HA 3BMCA 3EBOA 1UP6A 4MB2A 3T5MA 5JO0A 2BJWA 3ZCSA 1SFRA 4GL4A 3SOZA 5K4HA 3MWKA 1REQA 2EGGA 3BH0A 3G8CA 2ZVJA 2OHFA 1R6BX 1EBUA 2H85A 3LIPA 3LZCA 1H9BA 3P4UA 1DFHA 4MRSA 4HTFB 4YCDA 5TQ2B 1HXHA 2YDXA 5TQVA 1CY2A 2WIBA 1UCFA 3LLVA 3R6TA 3M3PA 5AM0A 1QDUA 1MAAA 1WCV1 2H29A 3OC0A 2OLEA 2RHCA 2WU3A 1Z8DA 1VSVA 3MWEA 3OLZA 4HFMA 4O63O 4YAEA 4ZHSA 3BF5A 3DV0A 3QWBA 5JRZA 1WDMA 3KQLA 2GPBA 1CETA 1HEUA 4AXBA 3QVVA 3OCWA 4W63A 2DCMA 2OGUA 4JLOA 1M75A 2R66A 2X8WA 2P40A 3GRKA 2X19A 5BV0A 1CY6A 1HDYA 3N2EA 4R69A 4OK3A 2G0NA 2YVAA 3MVEA 5D8DA 5ARCA 3AOGA 2J3HA 2HUPA 3OJEA 4M1ZA 2WM9B 3ZDBA 4UOQA 5AHKA 4H6XA 4NTZA 2PT9A 1F2VA 2TMKA 2Y1XA 4EG0A 4QQRA 3OX1A 2HA6A 3SJBA 3ZUGA 4LXIA 2WG1A 2PKYX 2H1RA 3CVOA 5F2OA 4DR6B 2PX6A 3PDIA 3PTLA 4JCCA 1R4AA 5FWYB 4BP3A 2ZCUA 1CX9B 3OEHD 3VZDA 7ADHA 2WU0A 3KAKA 4B31A 4OFWA 3GOHA 4QPJC 4I9UA 1YQXA 4C5AA 4NE2A 2FGJA 4Z49A 1Q0RA 3VH4A 1U7UA 4X60A 1A9XB 4BO5A 1SHLA 1T6XA 3EODA 2E85A 1Z88A 5EVCA 3OJOA 1NXVA 2ZU0C 1JZTA 2B61A 1GTZA 2PBRA 1YQ9A 1IHYA 3H1PA 3OMLA 4J2OA 2H4ZA 3LUAA 4X6YA 1U5AA 3T0GA 1N9ZA 1E6WA 3OM8A 4H0CA 3IJ5A 1SUCA 2ZSIA 4CGYA 4HPXB 5FKJA 2PXCA 3H5LA 3HBJA 5BVHB 4JP8A 4ZOLA 4X64B 4YRPA 1ZVQA 3B70A 4CM4A 4D82A 3K7EA 4B7AA 1BD3A 4O4HF 1SHTX 1T2UA 3DMTA 2QN6A 2ILVA 4YLGA 5E7MA 3TIVA 3AW8A 5P8WA 2OAGA 4DR7B 2YC4C 2C2WA 2QS9A 3C48A 2ID9A 1VL0A 4G0QA 2HHHB 5CLGA 4NU6A 2ZK7A 3CIFA 3CCFA 1YQQA 3RS2A 4PC1A 4EHKA 3HCAA 4KJXA 2ORYA 4KLZA 5CLHA 2JFBA 2P9TA 1UDWA 4KUHA 3ZY5A 1OC2A 4CQMB 1PW7A 2AMJA 3FVTA 4RL4A 2J9YB 4A0HA 1HDRA 2AJCA 3QBDA 5KYUA 3TEJA 2MJLA 4D8XA 1JDVA 1G1AA 3NPAA 4QD3A 4TLCA 5I7VA 2R60A 4DJEC 3DGEC 1CRWG 4P9NA 2XJAA 2D1QA 3QVSA 1NOKA 2OWDA 4H1HA 4K26A 2WD7A 1PF7E 1LIKA 4KAAA 4I1SA 4CM1A 2E2WA 4ZJZA 3OZTA 3H9JA 5BURA 5KYWB 2ZSKA 1G59A 1T1EA 1R6DA 1SURA 1Z5UA 1ZGAA 2V55B 1OT5A 1VLZA 2PWZA 2BFDB 4RADA 1NXOA 4PX9A 3TUJC 5JLAA 4HEQA 2RMKA 3TRIA 1P9NA 4JJFA 1FFGA 1XVVA 1Q91A 4JGIA 1GGFA 3JARA 3ICQB 4G4GA 4OAPA 5KSYA 4KMMA 1F0PA 3GZJA 3U37A 1C2YA 3BBLA 5HK9A 1IQUA 3L6DA 1T0UA 4WY8A 5CGAA 2IYLD 3TTYA 2JAUA 5JYBA 1CERA 3RUEA 3MWEB 3NB0A 1J2TA 1LRKA 4D3YA 5BW5A 4KO3S 4E5UA 3W8DA 3BB4A 1V7PC 3I9JA 3D4IA 3S1AB 1EQ2A 1WKCA 3E7DA 1R0SA 1V35A 5TY0A 3HFGA 5HF6A 1NNUA 2C9YA 4D42A 3Q3CA 3SQWA 3DDNA 1DL5A 4Z0HO 4PLYA 2EBFX 3TAXA 4CMEA 5E2IA 3KOUA 3RTBA 1CK4A 2CNLA 2DT5A 3H9EO 3K2EA 4NYMQ 4C0HA 2VS1A 5JTTA 3S1SA 3KNZA 1MGPA 4MDHA 4MVJG 4YQEA 4RLHA 3U1TA 3HZOA 2HX1A 2NZJA 3OZDA 3W4IA 4C4PA 1RKQA 2D5AA 2IYYA 3FJYA 1KDOA 1P1IA 3I30X 4NICA 4HNHA 3PR2B 1Y42X 1QRTA 1MX3A 3TLCA 2NM0A 2AG0A 3FPHA 3IOYA 1HG0A 4HAVA 3ZD8A 1QVWA 3TMKA 3PXXA 1YVDA 1BU8A 2Q5JA 2X8LA 3UMRA 4R9VA 1RT9A 2QYTA 3Q11A 3TRFA 1FRQA 4HKTA 1IZYA 1YQUA 1GY8A 1NQ5A 4TS1A 2FMIA 2ZRKA 1Q7CA 1ZHOA 1N5MA 3KKKA 4M22A 2I6XA 3WSTA 2ATVA 2G1PA 3OE4A 2VK1A 3PF9A 3Q10A 4WFJA 3TBHA 1X74A 4AKSA 3ZHTA 4IL5A 3NBUA 4URWR 2I9KA 4E30A 1B16A 1DQYA 2HH9A 2FNAA 3L0OA 3OC6A 4HQ0A 4MQFB 4KFCA 2BMJA 3DV9A 1I6MA 3FB4A 2O14A 4JLPA 3K2QA 4FFBB 1G38A 3GP5A 4BMYA 1IPFA 4MWZA 5CVDA 2VPTA 2YC2C 4RTQA 1KOFA 3SX4A 3PJEA 4HDNA 2EJVA 2KM1A 4X95A 5LA6B 4BJ6A 2KPOA 3CPSA 4X93A 2BM0A 3O8RA 3E22A 2VP5A 3F9RA 4RZQA 4CM3A 5HS4A 5J4KA 4PSCA 4FZVA 3HB7A 1UBOS 1F6DA 1YUBA 5EXPA 5FORA 5HG0A 3ROQA 5EY7A 2FTKE 4F4DA 2GN8A 3DPUA 4LZLA 4W1SA 3SYTA 1BKSB 2X8BA 1WB5A 1F4VA 3ETDA 1M1NA 1D1TA 2G4LA 2X1MA 1UADA 4OJQA 4MDYA 3X44A 1JUDA 1P1FA 5FPSA 2OFOA 3EXG2 3EWAA 4FFOA 1KVSA 5EE1A 5KSZA 1KY3A 3PI7A 3H6GA 4GL2A 1O9HA 2PLFA 5D5QA 4RU1A 4BBPA 4WH0A 5DHPA 1N3BA 1T2EA 4ZOLF 1E5VA 3CLKA 3GH3A 1DIBA 3L1IA 2PUAA 4KCGA 7REQA 1KJQA 1EWKA 2GXAA 2NTYC 3LDFA 4PE5B 1W8DA 2PBLA 2WYUA 4MI1A 2ZVPX 1ACLA 4ZN6A 3LFUA 3BZWA 4V0MA 5KCMA 1RPJA 4GPD1 4BLQA 1HFJA 1JQ3A 2BMDA 1UKBA 2N42A 4QRHA 1O96B 2H4WA 4IDBA 1M9NA 3UB3A 1JPUA 3D4NA 2Y68A 4PBSA 3KPWA 3AI7A 3TB6A 3HBLA 1G98A 5LWHA 4IXMA 2Q7XA 4B3JA 4ZPJA 1XSEA 5HIIA 4XB6B 1E9CA 1ZVVA 2WG0A 3L02A 5IDWA 3KOOA 2Q2WA 1FRVA 1R18A 3U39A 1G0OA 1MNAA 2WUVA 3C2QA 3UV6A 5BV7A 2KBFA 1EK1A 3VKVA 1QFMA 2JFUA 1GU1A 4C1BA 5HW0A 1LW7A 5CTJA 1VIDA 2O57A 2SKCA 3GCDA 1IOWA 2JAXA 4L73A 3G49A 2OK7A 4GMKA 3CRMA 2VHUA 3M34A 3HN6A 3K1AA 2H5EA 2RHTA 3EDRA 1EI9A 3PVZA 3URKA 4E6PA 3L7IA 4EYSA 2JKZA 2R44A 1IEQA 4J49A 4GMHA 3PQEA 4YQZA 1ETHA 1M2JA 1VDZA 3QE4A 3UAVA 2VH2A 1N0WA 2F02A 1WHSA 2WAAA 1NWCA 1GPLA 2YWFA 3AY0A 3NLLA 4FSHA 2ZRPA 4XPIA 3HY3A 3VYSB 4CHTA 1HMPA 3RVMA 1M6YA 2AF4C 5AT1A 2Q45A 2PWBA 2WT8A 5HJ7A 3SZMA 5DBOA 2P6RA 5FXMA 4CV0A 4PYOA 3LOUA 1CJTC 1RPAA 3A6DA 3FWKA 3HNOA 4IIHA 5DEIA 4BC1A 4RTOA 2P4EA 1P5HA 1Y6JA 1SUIA 4MRNA 1NPDA 2HL6A 4O2AF 2EW8A 3X2SA 2O2SA 2G1UA 1BA3A 1L5NA 1O95C 2FE4A 1TUEA 3NBVA 1DTEA 1PLJA 1W581 4YI3A 4YJ3A 2MWMA 2MMGA 1TIPA 1Q12A 3SHTA 2QMOA 1OLSA 1HLGA 4JJGA 4ENUA 3DDUA 2D8MA 1KDZA 1LPMA 2JJ1A 1JHYA 5FNVA 5LQDA 4PV7A 5SYAA 4X62B 4C4TA 2GC6A 2VSFA 3KTAB 1DQRA 1PJCA 3IBQA 1YQEA 2QJFA 3R7BA 1H1LB 5J9FA 3HNRA 3G82C 1M5UA 1UWCA 2YDYA 4BKOA 2CMDA 3BAZA 3N53A 3RVQA 3ZK9A 2Q3FA 1Y7HA 2D54A 3EG9B 1P2VA 3FZNA 1X8XA 4R9UC 4CLEA 1GPH1 2YNMA 4GXQA 5KZMB 5K0NA 4KIFA 1G5HA 3CY6A 3F67A 4B5LA 1JX6A 1VJ0A 3H8VA 1Y33E 2BM8A 3TTXA 2QGZA 3K09C 1J4AA 1D9ZA 3VO2A 4G0WA 5LU8A 2OAP1 3H8JA 3LT4A 1XNJA 1EFLA 2KS6A 4BEWA 1CUFA 1ZSNA 3G0OA 4A5SA 4HEJA 3W79A 3FHOA 5J2TB 4IY1A 4CMEC 2XXJA 1YXMA 2FP4B 4JJPA 5CAEB 4V39A 3USES 2N47A 5BW4A 1NXXA 3EGCA 3MA0A 4BFVA 4GP7A 3GLIE 3ESQA 3RC2A 4TV9A 4L4YA 5IUKC 4BZWA 4DM3A 3RQIA 4OMUA 3ZUPA 1EESA 5ALTA 1R6AA 1LDEA 3BWCA 1JBVA 3COYA 3IQEA 2VT2A 3HM2A 4U1RA 4ZT7A 4D9IA 3DG9A 4PRZA 3GL9A 4HQRA 5LKRA 4LJRA 1WV1A 1HNWB 3LA8A 1UM9A 4ZA2A 4ZT5A 3C8MA 3RTAA 5T4HA 4EYQA 4MQMA 4U3JA 4MWCA 3W2FA 4BRWA 1IXZA 2Z0MA 5JH7F 1L3BA 2BEVA 1MFPA 2G8NA 2GK3A 5K2OA 3VR5H 2ZZNA 4XWAA 3UFXB 1THMA 4J0JA 4QFCA 4RH0A 1NQWA 2C82A 3R0QA 2IKQA 4GPZA 4HAIA 2HW1A 1ZIYA 3ORYA 3M6WA 3ZE6A 1ECJA 5FBLB 1Y4AE 1ZM4A 3ETGA 1O87A 5JS1A 2QM8A 1BHJA 1ZQ1A 3QVWA 4MVJD 4GXNA 3T7IA 1YZVA 2ZROA 4B8SA 2VQFB 4MVCA 4U63A 1KDYA 1XA3A 4A82A 4QBKA 1IOVA 4I50A 4ILKA 4TWIA 3NHYA 3NW9A 2GM3A 2VDJA 1LF5A 4PIPA 4DT1A 1BE6A 4WASA 3U3XA 1M0EA 4O2BA 4EW6A 1TCCA 5JXWA 2ZZMA 4L08A 3ORFA 3RVSA 2ZUWA 3HR8A 3CX3A 2VR1A 4QDXA 1U7WA 1Z2PX 4PEVA 2RBEA 5LP6B 5DWVA 2IW3A 4BFSA 4UBJA 1EX9A 3PHLA 1I4EB 1DPFA 3OKPA 1QGOA 2JH9A 2PX5A 2AD5A 4R7GA 2WJHA 3A6GA 4BMVA 3TGWA 1S2OA 3DCJA 4ID9A 1JKFA 3FDZA 3PGA1 3LL7A 3EVDA 4RQBA 1LLDA 2C3MA 3U56A 5BN5B 3W7BA 1THTA 3UQEA 3B8HA 1EFRA 4PZDA 4V3CA 5BVHA 3H5AA 3GLFA 2VQDA 4K8OA 4D8TA 2WWHA 3AILA 3W8NA 3QU4A 3TNFA 4AWAA 1A4IA 1EEHA 3DWGA 1I8TA 3GNQA 4DVGA 3GLGE 3M4JA 2A0XA 5BPHA 1T5TA 3ISTA 4WSOA 4BWVA 2QQ0A 3LBNA 5BVGA 4OHKA 2EG5A 5LXTA 2HFJA 1MN6A 1GFWA 2O8NA 4KH0A 3RUFA 4MEAA 3EVEA 4HMQA 1LFDB 2FZ4A 1E2NA 5AKEA 3NC9A 5IJ9B 2VATA 4FEAA 4B3MB 3NV7A 2X0RA 3HHEA 2XNKA 4M55A 4M1TA 2VF2A 1KJJA 1EJ0A 1F3LA 4TL8A 3LPCA 4NV3A 1FW6A 3SZ3A 3AESB 1ZCFA 3GJ7A 4IS3A 1UBUS 3IP1A 3DWIA 3GG9A 3VVBA 3WIDA 3ZIAD 3IEMA 1T15A 4J3FA 1Z4QA 1QPBA 1XEXB 3F2VA 4UUNA 1R12A 1WDWB 1YCFA 1W75A 1O94C 2WOJA 3IAFA 3AUKA 3LF2A 4DMFA 4DMRA 5BT8A 1R00A 2BMWA 1Q6YA 2A33A 3CG4A 2BMEA 2HMYB 3FPLA 5EQJB 3WFIA 1YK0A 4HF7A 3K09A 2CL7X 2I3AA 2QMEA 5G0SA 2HRRA 4BQRA 4X3CA 1WPRA 2Z9BA 4D4MA 4I4LA 4AUKA 4WZAA 4JB3A 4KQKA 5C3YA 4CVKA 1BS1A 1ONBA 1WXQA 2NPFA 3GDGA 5IU6A 2XTAA 4EN4A 2P2NA 1SKAA 4ETWA 2CLMB 3WLPA 5A3RA 4FKMA 2QM0A 5E2BA 4PGHA 4EYGA 1F4PA 2HMTA 2G6BA 1X2EA 2PCJA 3AGPA 3B8EA 5EXXA 1O95A 2J4CA 3NBFA 4EF6A 3EXIA 3QEBZ 3BE6A 3CSSA 1U2TA 1H8ED 2GEVA 3B1YA 3T7DA 3TMYA 2OGTA 3ZW7A 4MVJF 5AUPB 1XQYA 1H4SA 1TMGE 3WFZA 1MH1A 1RIIA 3CLTD 3T15A 3X2FA 1GKIA 2XOEA 2G77B 3NJ4A 2OZLA 5D3QA 3AIKA 4ENQA 3OTIA 4PG4A 4Q6BA 1YAJA 2Q28A 3K9BA 2YXNA 4QVGA 4DA8A 4RENA 4KMRA 4RZHA 4P54A 3GEMA 2OR3A 3B3AA 1TZ2A 1K7FB 1IM2A 1Z73A 1ZYUA 2A5DA 5IP5A 3SHVA 5BUZA 1JG4A 1UBCA 3O2NA 1Z2CA 2YQZA 3HLYA 4Y2YA 4AS3A 3G9TA 1GPDG 2OCDA 4BV8A 2FG6C 2QMQA 2NOAA 3TWOA 1D9XA 3HDTA 1G5FA 1QVVA 4LSGA 1T5LA 1DHRA 3DE6X 5LC1A 5LIRA 3L0SA 2Q5FA 2AJLI 5BR7A 2OTCA 2AEMA 1KEVA 5UKDA 2C94A 3OPYI 1SJ9A 2GO1A 4P7GA 1HY3A 4NBUA 4MKIA 2ZSDA 4RORA 2G07A 3SXPA 3R6LA 5EHIA 4A26A 4B4VA 1TIBA 4C0LA 3C41J 2P5UA 2ZUEA 4IJMA 1XFAA 2VZ8A 2R79A 4KRYA 1I2DA 2F17A 2VK2A 5IDYA 4MAMA 4LRWA 4A1FA 4RSGA 2B1JA 1FNSA 2YMQA 3LK6A 4QYXA 5A3SA 4BVBA 3OZWA 1GNPA 3DKIA 4IWYA 2DTEA 3BKWA 4RDIA 4LQCA 4NU0A 3RY7A 1ICIA 3I2GA 2YMPA 1CTQA 4F9GA 4BNJA 4EY7A 2JZNA 1RRPA 2DKNA 1RWBA 2HF9A 2R00C 4KSCA 1XXHA 3AFMA 3LSYA 2F3RA 3AEUB 3CM0A 3DBHB 4XB1A 3UH1A 5A4KA 3RYFB 3BWXA 2H5IA 4OHWA 2O1XA 1RC8A 1XWWA 4RAQA 3D4PA 3UUGA 5HE9A 1ZEMA 4K9DA 4KW7A 1JW9B 2ZIXB 5SZIA 5HCIA 3AF4A 4QBTA 3I9MA 2HLHA 2ZSAA 4WLOA 2EW1A 2J8ZA 2R8RA 1OD6A 3C85A 3HJBA 3L6BA 3PFNA 3RO7A 3ZHYA 2QTWB 5U4XA 1GFZA 1B6RA 4PW0A 2HKIA 2FUNB 2FPIB 5HQJA 1DE0A 3VDQA 4D0RA 1M1XB 1VYTA 2IYPA 4ND6A 5TV2A 2CZCA 3BIFA 3PC8A 4CG3A 5IJ0B 4ZHQF 4KQJA 4LDJA 4XQ0A 1MO3A 5GJBA 4J07A 2P7HA 2CXTA 4RCVA 3LDGA 2GZ1A 4K9SA 3ZN2A 1ACMA 2VQ3A 4KGDA 2AJRA 4DDUA 3DMHA 3DJYA 1IQ0A 4D97A 1A8PA 4G4JA 2R7NA 4GNRA 1JG6A 3PUWA 2BZ1A 4N0MA 3FCCA 3ROEA 3U3DA 3V4OA 1H2AS 1EFVA 1NFRA 2ZYVX 4CQMD 1F2TB 3P9QA 5A2QA 2NWHA 4KBGA 5C5CA 1FS4A 1KAEA 4YMIA 2YQ4A 1CNMA 3IR5A 1E2EA 3N5KA 5FLEX 1UMDA 3MOGA 4BKQA 1YNSA 4M53A 4PNHA 3KFVA 4PONA 4XA8A 3E82A 1YFLA 4WXHA 1KDRA 5BSGA 3NORA 3M1AA 1CR0A 3U7EB 1XDWA 3KXIA 3BK1A 4A0SA 2YY7A 3B7GA 3DKPA 1T8SA 3KK0A 3UIEA 1JHMA 2YINC 4FGKA 1L7DA 4LISA 3LK7A 2CMFA 4Z8XA 2AHRA 4DUGA 4QGSA 5AK4A 3TM4A 1SBTA 4NJOA 4PWYA 1P91A 4QRDA 5DJ5A 3A3YA 1PYGA 3VZRA 1ZG3A 4REQA 4YYZA 1U9IA 3I5XA 1X8JA 2ZZKA 3MGBA 2C2OA 3I1YA 3Q0EA 3UAYA 1WY5A 2VUUA 4BNVA 1WW3A 4C6HA 3QEAZ 1IPEA 2ZSJA 2C7GA 4O8ZA 2J3JA 2CLSA 3RJMA 3O83A 4B3SB 1IG0A 2EJCA 1C41A 3A0UA 3FPEA 3JWEA 1RJFA 2P9ZA 3O91A 4JBYA 2RK3A 3FFTA 4MW1A 4PPFA 3F1KA 3SJZA 4BFXA 1JHUA 2QTZA 3J80A 3IS3A 3BMQA 2WYOA 5AM2A 1T3TA 3RUPA 2ASEA 3AUUA 3N05A 3NHZA 4AX8A 1K6XA 4L85A 5LP6A 3G2MA 1LPSA 4MV0A 3GUYA 2R7LA 1M66A 2IPLA 4IEFB 1EVKA 1RMQA 1PQPA 3P2KA 1GDDA 4MW4A 5E4JA 5EJ8A 2OCYC 3DTTA 3GPDG 5ER6A 2UAGA 1ATZA 3WYFA 2C4KA 1P2UA 3MMNA 5AW8A 2CFCA 1GPAA 4JP2A 5BR4A 2WA2A 3MLEA 1VPEA 2Q4BA 4OAOA 3VNRA 3X0DA 1MA0A 2HIGA 3CZ4A 2MYNA 1IHUA 2QX8A 1KAGA 2BEWA 4KQ1A 5F9MA 2YWRA 2J5KA 1NYLA 3PBKA 2F7SA 3PGMA 1EA5A 1GLGA 4NECA 3HP7A 2CKMA 4WZBE 1ISRA 3QHQA 4R16A 5AJYA 4BMDA 4HDCA 4OHPA 3U61B 2AA0A 3HCNA 4N3NA 1T26A 5CJJA 3GMSA 1E2KA 4KFTA 5BWLA 3U19A 2X1LA 4B2IA 2B1RA 2Y05A 4G25A 3H8SA 5IULC 1CR1A 4B8YA 2YVUA 4E11A 1JQEA 1F2UA 3FGOA 5K09A 1XMSA 2F1JA 2P9BA 2G25A 1VIAA 2H63A 2X0FA 1TOAA 2MT9A 2G08A 4K8CA 4YROA 3UBTA 4Q19A 4FJ0A 4BV9A 5G53C 2VTKA 4HZUB 4RQTA 3EC1A 1JEJA 2GEFA 5MDHA 4JIGA 1XEXA 2CUNA 5FYDA 1DDIA 1WY7A 5FWXB 3HADA 3DWFA 1J7JA 3DZHA 5C8ZA 1LJUA 1DC5A 1T1JA 3DOIA 1ICEA 2TRSB 4LF6B 1VI9A 1Q1NA 1VTKA 2R3SA 2R48A 2REQB 4QXRA 4G6ZA 3WA6A 3FRHA 3L40A 5J3JA 4HWOA 3KEGA 3O6VA 1EBBA 3NTUA 3G5TA 1R5JA 4PYJA 1N92A 3IBCA 2XD4A 1X7YB 1AK2A 3FOBA 2QUZA 2BGNA 2CNOA 4UTPA 1E32A 5KYNA 1O1YA 1SA0A 2KLBA 2OV2A 5EP3A 1HYQA 1XRNA 1YA6A 2XDYA 2ZE7A 3OIYA 2FSFA 5EKSA 1SCNE 5LYJA 1Z0FA 2ATCA 3CS3A 4B84A 1PO7A 4TWAA 1GR1A 3HPRA 4OATA 1ZVMA 2J3LA 2Y9MB 4V1CA 4TS3A 1V9CA 3NWJA 1LV8A 1G8SA 4G5HA 1BQ3A 1G8MA 4JLNA 3S1LA 3U4QA 3PZBA 4J94A 1ADFA 1MXFA 1PI3A 4CQMA 4BKRA 3REQA 3FPAA 2CMGA 1D6JA 1O54A 4NPCA 5EFZA 1N2ZA 2VP9A 4KDEA 4BFWA 3E5NA 1VI5A 4ZI3A 1C30A 1KZ6A 3DD1A 1HDOA 1S3GA 1T5BA 2PVPA 3D43A 3M4YA 4IJUA 4WX2B 3SYNA 4N18A 2FVYA 3JZDA 3VO9A 1DRUA 3Q8MA 3V2UA 4D4JA 2WTZA 2YHIB 1DQNA 2ODWA 5ALDA 5E7QA 1EFCA 5TJHA 2NUTA 3TKAA 1OBOA 2PMFA 4OJNA 3VI3B 1G64A 4ZT2A 3OZSA 4F71A 1L5YA 4K03A 4L15A 2ZRIA 3RWBA 4E3AA 1J0DA 5I7RA 5K8IA 2XTBA 4LJKA 3MTDA 3U7GA 2FW8A 4US0R 4AZ3A 5AVSA 5KX5A 3LC7O 4HP8A 2JLWA 2RHJA 4O0MA 2EF0A 3GAAA 3RS9A 5BSEA 1NBME 3GZNB 3RUAA 3B82A 5HRAA 4P82A 1VLJA 2HQBA 4OLBA 4OGLA 1SZPA 2AFIA 3HH8A 2FX3A 3V7UA 5HOEA 3OQNA 4O2BB 5JSFA 1KU6A 3FGNA 4ZWNA 2EJWA 1ZN9A 3KEFA 1LQTA 3RSZA 1IUNA 5L7WA 1YS4A 3TRJA 2RAVA 1JE0A 1SCIA 4FGSA 4A27A 1G63A 1KRHA 4AUEA 3FMOB 2PUVA 5BOVA 1GCIA 3TDMA 2Q4OA 1N2XA 3DDZX 4PZAA 3X1ZA 1TPYA 4RTLA 2R8OA 5FWXA 5FUQA 3OZUA 4PFQA 2Z2ZA 5AKGA 1JE1A 1PG5A 4S1TA 4YONB 4DZRA 4GC5A 4ZZ1A 3L5OA 2OP0A 4XVQA 5BSTA 2QY6A 3WB9A 4E84A 5I9MA 3SR3A 3HCCA 2B78A 3ZDZB 3PHIA 5F7ZA 4PHCA 5I3ZA 2H9AA 1QKKA 3Q6NA 4DMUB 4BNHA 5FPPA 3W34A 2W8BB 3WL8A 3ZTTA 1LSUA 1O89A 1WW8A 2IYFA 5CB4F 1LZLA 2WF7A 1R8YA 1DQPA 4YJ2A 3O2QB 5A5EA 3HA2A 2LCIA 3TF5A 1HKHA 4L95C 4QDIA 3E27A 1EVZA 3HTXA 4DR4B 3I76A 4YRAA 2HMSA 4J0EA 4LJSA 3TIGA 3W6UA 4LSWA 4Z54A 3DMNA 1W85B 2PWYA 4PYKA 5A5GA 5LDGA 5J2TA 1W78A 4IRUB 4X8LA 4UVHA 1Z13A 3BC1A 4N41A 4QASA 2VAWA 3AO0B 3GP3A 1Q11A 3HG7A 2ZI3A 3FKSD 2Z3WA 1TUGA 4BX2A 4EUFA 1KYYA 5COAA 3EYAA 4KJZA 2OYSA 4R1TA 3CT6A 4RLQA 3ZBTA 1PJBA 3HFJA 4MHOA 4JLKA 5KSWB 2B5WA 1CRPA 4F45A 4IXWA 3WDLA 1XX6A 1KI3A 3A9SA 1ZN2A 1PR4A 2XODA 3NVDA 4UFNA 3ZWYA 3LBHA 1RR6A 4UUBA 1AB5A 4LFCB 5JI2E 2ZDHA 3X1DA 5ED4A 4D4KA 2H1HA 3TJZA 5A4AA 4AF6A 3H1GA 3OZ7A 2MSNA 1BZYA 2FLWA 3K0FB 1BCSB 2QDKA 4U0KA 1P18A 3IAHA 3PE4A 4UULA 5KX5F 4EGAA 3P0EA 3OFKA 1Y3IA 4DEYA 1G4AE 3EEIA 1C3LA 3RJ5A 1R64A 3OLQA 5KVVA 3BRQA 3Q9NA 4ZVPA 1N0HA 2Y1DA 1ZHFA 3E9NA 1KSGA 2PUCA 1V6SA 1QGUB 1J8DA 1SBCA 2C7BA 4O02B 3OF3A 3SS8A 1QUFA 4IJ6A 4MICA 5IYZF 1QPZA 4M54A 4M0KA 1RAFA 1FTWA 1T25A 2I7VA 3D1VA 3LVRE 5ALKA 1QRUA 2FN4A 4Q3OA 2LP4Y 3UQZA 4UE6A 4XGNA 2W2OA 1I4TD 3QELA 1FJHA 3THRA 5HBGA 2JB9A 3UK1A 1HE4A 3O92A 4LX8A 3OEED 4C4SA 2WV9A 5AFSA 1P2FA 4WTOA 2OZVA 5LMUB 2JD1A 2HOQA 2GFHA 4Z2AA 3NWPA 4AQYB 3NCAA 1NG1A 4IP0A 4WUVA 5I48A 1LHPA 3QLTA 3R8CA 4H3KB 3VGJA 3LCJA 4RHCA 2W4QA 3WNDA 1DCMA 4MULA 4BLOA 2ZUTA 1ZR4A 2PKXA 2CJYA 4U7HA 1PBTA 1F3OA 4V02A 4FZ5A 3WOHA 2QX9A 5F12A 2DRIA 2HO4A 1RVDA 2REOA 2YY6A 3AM3A 1X1TA 1TLFA 2GJ9A 3K15A 3YASA 3HU2A 5KPDA 1EZ4A 4F72A 1AK1A 4ZTZB 2C78A 3KB6A 2VJMB 4DQXA 2XRMA 3TVYA 3W77A 4N0PA 1ECPA 4N12A 4RVOA 4D4HA 4IFIA 1E2GA 1HNNA 2H18A 4ZXFA 3GVPA 4YPOA 1GCUA 2WKQA 1IBRA 5IJAA 2IEGA 3B6MA 3REGA 4DV4B 2AVNA 1WXGA 3O8LA 2IC5A 3FPJA 4H7EA 5HFJA 5IM5A 4LDQA 2VTBA 1POXA 1W44A 5D00A 4HDAA 3HICA 1G20E 1NV8A 4A03A 1YZNA 2J87A 1PZNA 1A9QA 1KVQA 3AEUA 4K6CA 5TQ2A 3T3DA 1FLNA 1X7XB 3GW8A 2AWDA 2F64A 2JIZD 4YAFA 4OI2A 2GRUA 3TGPA 2L17A 3ZBUA 5A6SB 2X9GA 1JDTA 1CJVC 3AKZA 1A72A 4IIJA 3FFWA 4ZVMA 1VK4A 1UL1X 2VYCA 3AFIA 3CLRD 5T64A 2VCYA 3WX0A 3PNLA 2FEPA 1X1BA 2IPXA 3FNBA 1QQTA 4OBWA 1ZX1A 3G9UA 4CUZA 4N4AA 1JMVA 2QMZA 3SVZA 1QGAA 3OCVA 4M9SA 1ODCA 1RWKA 1YS9A 3EMVA 2IZ7A 4L4UA 4RETA 3ZQUA 4IHJB 1M67A 1PQYA 2GZAA 4RYLA 1TAUA 2WTXA 1SBNE 1XTIA 2H0QA 4IFBA 4YJ3F 4ZOQI 3AT1A 3KYBA 3B2EA 5IC4A 3QOWA 2CC2A 4DJDC 2W00A 2DWCA 2QN3A 4FN5A 5E6SB 3KKMA 2SECE 1DJPA 3GLIB 3M70A 4I08A 1T0BA 1U9YA 1TJPB 2I2XB 4H0NA 5CLFA 4WZ6A 1HT3A 1USGA 4MX8A 1B7GO 1Q14A 3AF3A 3L7BA 3I8XA 3OFNA 3OOHA 4QICA 3DDCA 4H3VA 4YV2A 3QSYA 5DYWA 3MIZA 1MTOA 1KYQA 5AHRA 1YHJA 1ISMA 1CNEA 4FNOA 4REOA 1P3DA 5HWSA 3BS4A 2IH4A 3IB6A 1NUHA 1TLLA 4M8NE 4S0ZA 3VA7A 2I29A 2W0MA 4G81A 6ABPA 1Z4JA 3U3MA 5AJHA 1ODFA 1YB1A 1NU8A 1J25A 1NN1A 1PG2A 2XHEA 1PVOA 1VL2A 3H1TA 4XASA 4DC3A 3WMGA 3G7SA 4P0TA 3PX7A 2VHTA 2AFHE 4DLBA 1UWLA 4R6WA 5KNBH 5M7EA 3UJ3X 2C77A 1C9EA 3OUUA 3JALA 2ZRFA 3FNQA 3T0IA 1LKZA 3EXIB 2E4XA 3A9TA 1KL7A 1RKUA 2FZLA 2FF5A 3PSHA 4Q7EA 3T9CA 1WCIA 1YTLA 1J0EA 2FW6A 2F59A 4G1EB 4UMDA 5D85A 3GQVA 4ZKEA 1ZGCA 3B5JA 3RTDA 1TQ4A 3SS9X 5EUBA 4HH1A 2ZBQA 5BSFA 2VKTA 3GNSA 3LLUA 1MQAA 3M6VA 5G2OA 2BZSA 3LI2A 4TN1A 3RVJA 1SULA 3RRJA 2ADOA 3ROTA 6REQB 2GXQA 5THKA 1N2HA 3V1NA 1D8AA 1SZJG 2QZJA 3PIRA 4ETIA 1CY1A 2ZIWB 4MPJA 4ZCLA 1PT8A 1PL7A 3ANXA 4Q1AA 5EAIA 3VPBA 5B57C 5HPYB 2IGBA 2QAJA 2HXSA 3SM3A 4F7DA 2OVBA 5KI6A 4J1QA 4ZAGA 3UOGA 1Y80A 2RFLA 2D2XA 4NNJA 6NULA 4BXOA 1DUIA 1M1YA 2G83A 2VJOA 2VUIB 1JVSA 1ESMA 3A36A 3JQ6A 3O94A 3QHPA 4GR5A 4B6GA 1NW9B 1ZUNA 2VNAA 1BFUA 2VPIA 2XCLA 5I45A 1OOEA 1NQTA 2FKAA 2CXUA 1ZNWA 2ZSEA 2Q07A 5AVRA 2FH5B 5CX4A 1EDZA 5CFPA 4B3IA 4CIYA 4II2A 1M74A 3JSXA 2UKDA 1JB1A 1F0KA 3HVHA 4IHKA 4M76B 1E7RA 2IY9A 4UHBA 1LTKA 1MOZA 3INNA 5HSGA 4Q1FA 3ZHCA 1C8KA 1TM2A 4ZYZA 2WJPA 1VJTA 4XDAA 4HMOA 1R4ZA 3PEYA 2PGNA 1JHPA 4I6JA 4R0NA 3U81A 4Z0TA 3E03A 1Q0LA 1KA9H 4G41A 1E3WA 3EEOA 3ZZMA 4EQZA 4GDMA 1ZRMA 1J09A 2AXNA 1LXCA 2N0SA 2XQJA 2HDOA 4I8DA 1KFJB 1XELA 2BMVA 2V1XA 4IF6A 4ND7A 5EJEA 4AF7A 4ZQIA 1F12A 4M8IA 3M9XA 1RAHA 4FOOA 1UWVA 4FYVA 1BJTA 4P31A 4PGAA 2Q3HA 3IN1A 3KZXA 1ZESA 3ZOKA 1COWA 2FW7A 3RVNA 3ZCVA 2W6CX 1QIKA 3IQ0A 1PS8A 3B2QA 1TA0A 4E5KA 4QOGA 5F5LA 1X1DA 5K0EA 3EVTA 4WZZA 2GDJA 2C8LA 5AHOA 1N2OA 4A6PA 4LOIA 2FZCA 2IP2A 4QA9A 2F1IA 5G4KB 3Q7PA 4N3GA 3IB3A 3WBFA 5DM0A 3SMVA 1AGRA 4GMDA 5IXYA 1KAMA 4FVTA 4HQOA 3K2BA 1CIJA 1QP8A 3Q3EA 2QTVA 2ZE6A 3ZG6A 5EKDA 3V6MA 3L82B 3KQUA 4ESVA 3MWDB 2VAMA 4I4TF 4EG4A 5JDIA 4BO7A 4Y6SA 1AOXA 5TNXA 4PG7A 5J2UB 2OILA 4L5JA 3N2LA 1ESZA 4CM8A 1KYHA 4QLOA 5IBCA 2J7KA 5D2CA 1NUQA 4F5YA 5KNDA 1WD7A 1CJUC 1P1HA 3A1DA 4CM9D 2HSEA 4FCWA 4CQLA 1RM0A 1E59A 4LCAA 4XE5A 2AJBA 3MGGA 2R5WA 1F0YA 4X8MA 1X0XA 4AUNA 5CNKA 4DLXA 4GI1A 4DQKA 3RNOA 5KIAA 2DULA 3DF7A 3OUTA 1H2WA 2EX4A 4K05A 4IWXA 2QNRA 3DO5A 1UR5A 3QV1A 4PSDA 2WIFA 1RM3A 4KKVA 3T9DA 4BX8A 4Z3KA 5MN4A 4Y1FA 4ACAA 4HNGA 4HAWA 3T5BA 5FEMA 521PA 3L6CA 2HF2A 4MUMA 1O5ZA 1VKHA 3DV0B 4MW7A 4EA6A 4Q7QA 1RJ9B 2GAOA 2ORVA 1XEFA 4OJKA 5J63A 4HVLA 3K92A 2DQKA 3DT8A 4WXYB 3L0IB 2QU7A 3VDXA 2X3UA 3EOBI 2PNJA 3W5SA 3UK0A 4FZ3A 1OFVA 4NH4A 2B8TA 1QTIA 1AC5A 2XCOA 1WPGA 2F9LA 1OH6A 2GVZC 1IY9A 5CRIA 4PHTA 3ZI0A 4G5GA 1OYVA 2VDOB 1OY1A 4B6PA 2RONA 3JWHA 1EX7A 3HP4A 3PWKA 3VMMA 1R9JA 2C4NA 1EK0A 3BDVA 1H5UA 1UEIA 1JKMA 1LUAA 1NKTA 1EE1A 1TQ6A 2O9JA 4DLVA 1J8FA 1NBAA 2PA3A 3COWA 3QVJA 3AP1A 2ODPA 1JDUA 1H93A 5E6SA 4PZYA 3L1HA 1SAYA 2BIFA 5BYBA 3EA5A 4YCJA 4HTFA 4C0XA 1L4KA 1JHDA 2FV8A 4HJRA 3A1WA 4NE7A 1V1JA 2JIMA 2Z56A 3M5PA 5ITWA 2HO5A 2BKEA 5K2MA 2ZTHA 3VNBA 3QY0A 2OZEA 3HVJA 3DS8A 1RLMA 3KKZA 1JDSA 3FYTA 4Z4QA 2IF0A 3D6AA 2NUPB 1R0KA 1D2NA 1VKJA 3HMKA 5ESWA 2HLDA 2Z4RA 3OZFA 2QR2A 1R3UA 2YH2A 1TO6A 2R97A 3D7LA 4IZIA 1I1NA 2EYQA 3KJGA 4GZ6A 3KPJA 5DO9A 4BJHB 1UFQA 3OWHA 2XVYA 5BPFA 1XRRA 1W36C 2FQXA 2HSDA 1O8BA 2QRHA 4G1CA 3TVDA 2B6HA 5BYKA 2ZE5A 1U5BA 3PUZA 2XXAB 2R85A 1VKNA 1IZZA 2JFHA 1IN6A 2VT7A 3RH0A 3K9CA 3VR4D 4MO9A 2OZLB 2TMYA 3GA0A 3O8OA 4FYKA 1K1EA 4PPNA 3DNMA 3ED1A 4FFPA 1SOUA 1E7WA 4WNAB 1JSLA 2FFQA 1J7KA 2QVLA 2ABSA 4OU5A 4YGXB 2P78A 2BJHA 3KCNA 2RKWA 4UQPA 4TQUS 1ZOSA 1U3GA 2ATIA 1I6WA 1NNSA 3HYNA 4FDMA 1A2QA 1K0UA 2BMFA 5H4HA 3PT9A 2HRQA 4P5PA 4PICA 5EJ7A 2I2AA 1IEVA 5JD6A 1W4RA 1WEKA 2P4UA 3BVPA 3C1TA 4FYWA 4U2CA 4AM8A 3OJLA 3NM6B 4N5LA 1XMQB 5E1BA 3R3VA 5DNYB 1ZINA 3WKBA 4BNXA 5BORA 2AN9A 2CVQA 1ST3A 1GVHA 2HF7A 4MXDA 3GLGA 1ID8A 3ZM6A 4YRZA 3OZBA 2OV3A 5DTJA 1NN5A 4LFAB 1F6BA 4MW6A 3FPSA 1YF3A 4HHEA 2XR1A 3ZU6A 1J9GA 5L6LB 2AG1A 1RQPA 3EWNA 2R2GA 1VHTA 5D5HA 2JS7A 3PNVA 2GBLC 1V3VA 2Y27A 3RRBA 2JIOA 2D5BA 3HCOA 4OF4A 3EHEA 2R1UA 7REQB 2IUTA 5CR9A 2ZJ0A 3ZQ6A 3W1VA 4HNUA 2XBMA 2AWNA 5F1YA 5CFNA 1WOYA 2AB8A 1KO8A 8OHMA 1OUMA 5LDHA 1P8AA 5KAPA 1CF9A 1N1GA 3DZCA 3ZXYA 2B4YA 3RD5A 1QQ6A 3EXEB 5CDHA 3M3DA 5KJ1A 4DV0B 2BFNA 3HEAA 4IKOA 4UXJA 5JD3A 2V98A 4IDAA 5EY5B 3QKRB 1THZA 4FR0A 1U2GA 4G09A 4KGZA 3ZNPA 3VTKA 2IYWA 3K32A 3C16C 3ZEAA 5CA0F 3Q98A 4YRCA 2QM7A 5D3KA 5DNAA 1GTRA 4MR7A 5F2EA 1UJ4A 1EHCA 2Q3DA 2I2FA 5CM5A 1ZK1A 4DCJA 1G3IA 3N2KA 4I9FA 1K8QA 2GASA 3MRVA 4AYWA 4HMPA 4TT8A 4GOKA 1NI3A 4KMSA 3L8HA 2BR3A 3KTOA 3KLMX 2QRVA 2ODAA 4HRXA 4JUIA 4MS1B 1P4AA 1CZLA 3COVA 5IBRA 1JDPA 2GM4A 2EC5A 4HDSA 1II8A 1UK9A 4X8HA 1CIPA 1DC7A 1R6VA 1Y3HA 5D1HA 2B1IA 2OCLA 4YRIA 1C7IA 4UUOA 3Q8KA 3H2BA 5JSZA 1WNTA 4AZVA 1ODIA 1O95D 8GPBA 3I92A 1J2JA 1SPBS 2DU8A 3NANA 1DLIA 1IUOA 5T67A 4CR6A 4EHLA 4V0NA 2X6RA 3E1GA 5I3CA 1HT2E 1N6IA 1UKVY 3JQEA 3KVOA 4PIVA 3GJ6A 2R1TA 1GEGA 5E6RB 3HWWA 5IKXA 2V0CA 2ZSHA 4HNQA 4TRMA 1IB6A 3E0QA 3KBBA 2GPAA 3QWFA 1P0MA 5ENVA 2FUG6 3AHEA 1NJSA 4E31A 3TW8A 3DPSA 2E3JA 2QEQA 3TPFA 3AR6A 1W30A 3A11A 3IQFA 5BSRA 2W70A 3MWYW 4FEGA 1UKAA 6ADHA 1KDPA 5J23A 4Q47A 1SUEA 1EVIA 2JEOA 2PHZA 2QRGA 1S4MA 3UAWA 3WGKA 2C2YA 3QA9A 1M6VA 1D4AA 4BMZA 16PKA 1K6MA 3O4VA 3EPJA 3Q7IA 3PC3A 2VHEA 5BN3A 3TLGB 5B6JA 1V7QA 3WLMA 4CL0A 1Y8QA 4A6DA 1FYEA 1M34A 1QDEA 2P3QA 3HU1A 3AY7A 4MI9A 1R2QA 4NFSA 4YMVA 1KOLA 3EK2A 4GS5A 3ZJYA 4Y6PA 3ZS9A 1X77A 1YE8A 3R3JA 1L3IA 5GZ3A 1KERA 1SXHA 5AI6A 1PLLA 3OOWA 4C20A 1IN5A 4HFNA 2JHAA 3KTDA 4ZMRA 5DIZA 3IHKA 4ZT6A 4KR3A 4F6RB 4L6IA 1PR5A 1X19A 4ISBA 3PNMA 4W5HA 1MJ5A 2CUZA 1GA4A 4FIZA 1ID1A 5EWMA 1RI5A 1ZLYA 2Z2KA 3O8QB 1KQFA 3WGQA 3ZGOA 3BRWA 3BFVA 4BLTA 1M76A 2JD2A 2XDQB 2D3TA 3R0XA 4MCIA 3R74A 2I4OA 3D59A 4MROA 5CG2A 5SICE 4QLBA 4KQ2A 2G1JA 3K70C 3K5PA 3CNBA 4GUDA 5EZSA 3R8XA 3JALB 1Y9AA 3HCFA 1E7MA 1A8UA 3QVGA 4HNAA 4GKBA 3GLHA 3WZ2A 5C8VA 4RO0A 2H48A 2WU8A 1Z4PX 2H1IA 2XGMA 4CR7A 1UPAA 2I6AA 4MWBA 3AEZA 1ZK3A 2HDWA 2PLRA 3J7TA 1TZBA 4HGRA 4OMDA 4V0RA 4B8RA 4N49A 1LIJA 5IVIA 1E5LA 2EQ5A 3TKLA 3WHPA 3FG9A 5B58C 3VKGA 1E1RD 4IXDA 5ES4B 1WRBA 1O9GA 2E18A 3IVRA 5KUTA 3ESRA 1U0SY 3GBVA 3Q8XB 1KY4A 4LE0A 4BE7B 5HZKA 5B1DA 4AO8A 5F76A 4DN6A 4UAVA 4ZARA 4HS9A 3H8WA 1L4BA 4X63A 2PH1A 1CUBA 3RF6A 1O94A 3B3FA 3MM4A 4O4LA 3IMKA 1VFPA 2KI5A 3NONA 5IDQA 3H2GA 3NI2A 3IOEA 2MCFA 1PFQA 4MW2A 1VG0B 5I7EA 5IS2A 1ESJA 2WIDA 3L6UA 1IM8A 3UMGA 1L4LA 1YI8A 2XT0A 5FBVB 1XRJA 1NW5A 1JPNA 3LT1A 3QUTA 4BYMA 1RHMA 2EFCB 3QYPA 5T6BA 3KALA 3P9NA 2VDPB 3EQ2A 4CLXA 1J23A 3O7WA 1YK1A 1EFPB 1T8UA 1WMEA 4HFJA 3AF0A 4BPBA 4WN9A 3O4FA 4NOLA 5CUQA 2QVCA 1XU7A 1LGYA 1Z6QA 3BJRA 3GAMA 3NHRA 2R96A 1HE8B 3UT0A 4YCMA 3H4VA 4L8FA 3C8ZA 5SZHB 4ZALA 4AKIA 2PDAA 1XB2A 3EZGA 3U4MA 2OKGA 3F3KA 3KJNA 4G5OA 5KOJA 4Q4HA 2VH1A 2IKSA 3ON5A 3VR6H 3UMPA 5JT1A 3O75A 4WNCA 2RARA 3ZIDA 1YUMA 4AKTA 2I7TA 2BAGA 2QZ4A 1C7JA 3EFOA 4HDOB 5FWDA 3L0YA 3OSUA 5LXTF 4JL6A 4CWAA 1QTQA 5JE8A 5D6OA 1Z37A 4X8OA 4F4UA 1NMQA 3LQ4A 1PRYA 4YLEA 2FU5C 5CT4A 1DKOA 3V4LA 2PD3A 4TGLA 4CIXA 2D1SA 4DM4A 5A02A 3RNLA 1BDMA 3VX4A 2Q27A 2V6FA 3FM9A 9GPBA 2D2EA 3JQPA 3PR3A 2HHLA 4J75A 4TL6A 4XUCA 1NQAO 5JDCC 4AX4A 4HZUA 4ER3A 4WXEA 2VHYA 2XDAA 4Q0MA 5JNWA 2GTIA 5JHHB 5DYGA 1L0BA 1W96A 4GX0A 1WO8A 3VI4B 4IHAA 3GT3A 2CXRA 2ECKA 2PFGA 5CT8A 4FEEA 1Q74A 4IIGA 4L4XA 2X0IA 1KK3A 3FY4A 2Q5OA 3ACDA 3RKUA 3T9AA 1JAYA 2UV8A 4DJTA 2H52A 4FXPA 1SHUX 3ZI4A 1ZRHA 1BA2A 3QXSA 3RQ6A 3CCCA 2ZCJA 1TMKA 1PR1A 2CV2A 4R41A 4LBGA 3GCXA 3KD3A 3O26A 2ABQA 5JCOA 3UJ7A 4CRWB 1SB8A 2JFGA 2LGJA 3I64A 3PNSA 4GICA 4F7WA 2L19A 2PZGA 3FF4A 3FBGA 3QVXA 3NM3A 4Q4CA 1HC7A 3GLKA 6GPBA 2ZXFA 5SY4A 5TC4A 1FLVA 3BL5A 4GUAA 4REMA 3MWLA 2EYUA 2ECOA 2ENWA 1QG6A 2B69A 2IHUA 3QYFA 2X7XA 4PO9A 4XRRA 2LVBA 5E2AA 4DG8A 1QLHA 3C7KA 3K8YA 4M83A 4ZRDA 3AR5A 3BBPA 2OENG 1W46A 4LOKA 4RELA 3AMVA 3FCSB 1IBSA 1F5NA 3LPAA 2RK6A 3QBJA 4RSMA 1KEWA 1GRVA 1SVMA 4GOJA 4J0DA 3F46A 3EMKA 1E1YA 3UMSA 1XPOA 1E2UA 1DAHA 2OGZA 3K0AB 3KR9A 3N2GA 3QLEA 2OQVA 1WF3A 1PJ8A 3FAZA 4HRAA 1HFEL 9ABPA 3AGQA 2E4AA 5DCLA 3LU1A 4Q7KA 1PN3A 3O4GA 2R6R1 4B3FX 2IYNA 3U6KA 1L8XA 5DX8A 1SKUA 3NOOA 4D3ZA 5B2FA 1E9AA 4HZIA 3A2LA 5K45A 1EXWA 5EJFA 3MJ4A 3WAJA 2GB4A 4WKNA 4E12A 4DNPA 2IEAA 2FF7A 4P81A 4CR8A 1WSBA 4J16C 2XUOA 1T4CB 2B94A 3VVMA 1GZVA 1QWOA 2X6QA 4WUTA 2DPHA 4JYAB 1SGWA 3TQIA 1U0BB 1NUTA 1EFRD 3AR8A 3RAPR 5I4IA 1H66A 1IWBB 4U2FA 5CVEA 3IMFA 5AO9A 3H9GA 3EGOA 3TSAA 4N03A 1PW5A 1T5IA 5IC5A 2RG1A 4ZEXA 1EK5A 4PY2A 4LSZA 3WXBA 2R1ZA 2RCYA 3BE8A 3ETLA 4G0YA 4JUDX 1C2TA 4FUTA 1TQ8A 2J6HA 2VRCD 3K2IA 3KXDA 4LMAA 4V0SA 2ZIZA 3OJWA 4LHSA 1UMDB 5LD2C 1RRCA 5EINA 3LV8A 3DZIA 2DLCX 4OGFA 3SDBA 3L7YA 1IHDA 2UYOA 1U8XX 3CZPA 3MWGA 4ON9A 4P83A 3VR6D 3WWDA 1N2GA 1EIZA 1JR3A 3BB1A 2HV8A 3UG7A 4UC0A 3GLRA 4EABA 1U8TA 2JLBA 2Z4TA 3GEDA 1Z38A 3DLBA 1EBFA 4EDHA 1V26A 2C5FA 2CZGA 3F6CA 1GP2A 5T5QA 4PLGA 4HVAA 4UUQA 5EJ6A 5HQ3B 1QK4A 3MXOA 2A3RA 1C0EA 2B36A 4CDNA 3AESA 1GU7A 5LA6F 5HKBA 1Z2NX 1GD1O 1CUZA 1DHTA 1LI4A 3CONA 2ZI9A 4I5FA 2PX3A 1P0IA 5GZ1A 4MV1A 2BDUA 4EH1A 5FADA 3THYB 1MO6A 2P75A 1X6VA 4EHFA 4X97A 4HK4A 5LB2A 3V8MA 4DCPA 1ZUIA 1URPA 4JEMA 5GWXA 3V8PA 1EP2B 4HX5A 3SG0A 4BV2A 3D6FA 3DYIA 1R0XA 4L5YA 5EWJA 4YRRA 5HKOA 5KNCH 4HXGA 4WBXC 4RF3A 2XLBA 2DDOA 3T7JA 2WKRA 3NCHA 5C4GB 2B8NA 4ZV4A 1R66A 4C87A 1KO5A 1E2HA 2WHQA 3L79A 1H9CA 3ABOB 4L4ZA 1ZAYA 2WWFA 2VTEA 2HT6A 1SVIA 1EFPA 2P5TB 3EN0A 1UBSB 2BEUB 2OKCA 3PFHA 2ZR7A 3GRUA 4QE3A 5ADUS 5ICMA 1EVLA 3N8DA 3NKVA 3ZQ4A 2KQUA 3EUAA 3TD2A 2Q5CA 2IWRA 5F11A 4N5HX 1FE8A 1UBMS 3LGAA 1A97A 1DVRA 3I01A 4FE3A 5C7IO 4LJ5A 3AVTA 3K9EA 2EWVA 4JGGA 2QT0A 3A3NA 2V7GA 3JQAB 4JJ7A 5K8TA 1VPDA 1DI0A 1U2DC 4X90A 3G89A 4RK6A 3R0JA 2CXPA 4UBNA 4DV3B 2VJAA 2ZAYA 2RHMA 4YGYA 4Z1OA 1L2LA 3HCWA 1CS0B 1RM5A 3WL3A 5DM60 2OBFA 3P97A 1RRVA 3JV7A 3OP1A 3RS5A 1X2BA 4A8JB 4E08A 4BGDA 4KTTE 4F85A 5DHRA 4N6OA 2HRDA 2WAYA 4BMPB 2JDID 3EIFA 1KWGA 3Q6IA 4TT3D 4YI5A 1QCZA 1U3FA 1YAHA 4ZD6A 2M98A 3SIWA 5JNVA 3RSOA 4ZQGA 4JR0A 1NZFA 1T6BY 4P08A 5AVTA 3R3ZA 4N3AA 5L4SA 1M5TA 2HWYA 2IZ0A 3DVLA 1VDMA 2OXRA 1L4HA 4TZKA 1J8YF 1Y1LA 4JWKA 1KIMA 4ISCA 3IEPA 2YRWA 1X7GA 4CMBA 4Q3DA 5A7HA 1D7AA 2D1TA 2I3DA 1CUIA 4QFBA 4BQEA 4YT2A 2IYQA 3SWWA 3FFBA 1A7AA 5FHQA 4OQYA 5CYPA 4KXLA 4E8ZA 2G9UA 2GKOA 1PQ4A 2C4UA 1ZWLA 1W4AA 4G8CA 4EHBA 1WXXA 4ND1A 2JH3A 3LRXA 2QVYX 3GVHA 4GWGA 1KJWA 4O2AB 2AJPA 4J6FA 3MN1A 5FLKA 1VBFA 5HIKA 1HGXA 4CEIB 1TM7E 3EIQA 1GG4A 3WK5A 2B9EA 4ZO9A 3CUSA 5HF5A 2EHDA 5EHNA 2F3QA 3UB2A 3QQ5A 3W78A 3ZY4A 1VM7A 2CWDA 1J0AA 2FWRA 5TMPA 4C4ZA 3K0SA 4AU1A 3QFRA 4RTJA 2QTHA 1UC9A 4AP6A 1PL6A 1Z45A 2ZPTX 4GZ3A 3K71B 3TOXA 1CUYA 3ONDA 4I4NA 5JEDA 5BN4B 3N2AA 1RHJA 2IOFK 3H2SA 2CN1A 3RUHA 4HRVA 4BO6A 3F6YA 1WLSA 1PTJA 3N2ZB 4WRRA 1UMCA 4R1PA 2OXCA 4FMCF 4KQGA 4YTEA 3ML1A 3NASA 4MHTA 1R37A 4FILA 1YIAA 4U7XA 3FZQA 3H5WA 1W5BA 1K9SA 3H42B 4GZMA 4RHXA 2ZTUA 1NMXA 3IBGA 1AF7A 2JBHA 1QE3A 1REQB 1U6IA 2ZYWX 4WL0A 4M0DA 1XG5A 4EPWA 2H7CA 3E15A 3H75A 2A67A 3T4UA 5H9WA 1IZ7A 1O3YA 3W5IA 4IZOA 3MG9A 1CS4C 1H1LA 1JAZA 3DAYA 5J5AA 4XVCA 1KYTA 4GKJB 3L4JA 1ZH2A 2B5VA 2ARKA 1Z75A 3PA8A 4IDHA 3ZVKA 3RF7A 5EE9A 1KPIA 2FPUA 2WAMA 5TQ0B 1M8PA 3D4BA 1F8FA 2QRNA 3T9BA 1D5CA 3OTXA 2NZYA 4LRSB 3ZGLA 2IOHA 5AP9A 1AIPA 4RM2A 4I19A 4R84A 1F7VA 2J6IA 2Z8YA 3R0VA 1XK6A 2WSMA 5H02A 3TW8B 5JJCA 2R6JA 3ZCXA 4CU5A 2BFPA 3VU0A 2C2XA 3RAEC 3BJZA 3PGVA 2J09A 2KB0A 1V1MB 3MCUA 5JMWA 3UNXA 3O31A 1T8RA 3R3XA 3VHLB 3RFCA 1DG9A 2JVIA 3I4FA 2OA0A 1OQAA 1QO7A 2VP2A 3PUIA 4D0NA 5A62A 3VPFA 5F23A 2I1QA 3PQCA 4XR9A 3SKVA 4EB0A 4HRYA 1D07A 2GPWA 3JAKB 1T36B 1UWKA 4BLRA 4PN3A 2CV1A 4POAA 1TK2A 3WGUA 3VNQA 1F8YA 2J3KA 3OZRA 5HKLA 4D4LA 4FMDF 1CFJA 1YR7A 2VJDA 2GN0A 3O5AA 3RREA 3HM9A 2A0KA 3TCXB 2OEPA 3HWX1 3MGKA 4JP5A 5T57A 3UO8B 1K5DA 3WL7A 4DA0A 3AHIA 5CDYA 3C1AA 4DLRA 5MGBA 3UUFA 3WIVA 2H57A 1JTEA 2XWSA 1UC8A 1AQYA 2ANCA 4PCLA 3QU7A 3LPDA 3AKEA 1H65A 4AO7A 1H2HA 3CX7A 5C7YA 2JNWA 2V7XA 1IEWA 1QZ3A 1MH9A 2B1QA 2DBVO 2X76A 3CV3A 4FR2A 4Q1BA 3BTSA 4U0JA 4GIBA 2A0UA 2O3JA 2UVPA 3PDWA 1UM9B 4CDMA 4YL5A 2LCQA 1R6UA 5BMOA 5K0CA 1Z4MA 1V2GA 3FTCA 5TVGA 3HA7A 2VKQA 3CZCA 4LFBB 1N6NA 2YNMC 2PMWB 3M1IA 3FOCA 3EXEA 2REQA 3ELYA 4NFHA 3RSHA 2JI9A 1SC6A 2RGEA 5IJWA 4N7BA 2XTNA 1UBEA 3BHJA 2OCGA 2Q5RA 3MPOA 2CE2X 1YL6A 2QB5A 3O3NB 5F5NA 1U8YA 1YE3A 3MOSA 4YACA 1YGPA 1E9EA 1QHIA 4PX5A 1VL8A 3EF1A 4M0FA 3MUEA 4EYKA 3ZNOA 3THXA 2AMYA 2ZE8A 4RVCA 3KB8A 3HRKA 4EB6A 3KJQA 2ZRDA 3S2GA 1JJFA 1LK7A 1NP3A 1OLUB 3GBSA 2XUKA 3FMVA 1RBYA 4IJQA 4TYWA 1AA9A 2CFIA 1JR6A 1PQUA 3JYOA 1JEQA 3ZDFA 1O08A 3ETJA 1XJQA 2GCGA 3GGJA 2LE0A 5JJIA 2VBGA 3U3JA 3QTBA 3TS1A 1TFUA 4NZNA 2QVZX 3ZHQA 1WUIS 4WZBB 1A4RA 2DUNA 4CT5A 5MN5A 5GJVC 3W6OA 2G5CA 3HXPA 4QO7A 1S1MA 2R2AA 1HQKA 2FEAA 1P9RA 1YMUA 3A4IA 4TMWA 2FOLA 3JZIA 1LCIA 2NXWA 4R2LA 1X7DA 3NH9A 3U7IA 4OJMX 3GEGA 3DE2X 2VNIA 2Y4NA 5J4VA 3RHFA 4EFMA 3GFFA 2GF0A 3OIFA 2BV3A 4HEA1 4EEXA 1ZRNA 1GITA 1SZCA 2ZBGA 2X5XA 1H0RA 3WBKA 1Z2AA 2H92A 4DTIA 4RKYA 1RQ7A 2HU7A 4WHMA 2IHYA 1RMYA 4CM9A 2QL7A 1T91A 2G9VA 3IVMA 1JKXA 3IX7A 1E99A 5BW6B 5JS2A 5F2NA 2FPMA 2UZAA 4X1YA 4KHPB 1QF7A 3OQVA 2ONJA 3N8IA 3OOYA 1Y5LA 4KR9A 3HFRA 4D3SA 2AR0A 3HEBA 1A1SA 3OAAA 4H1WA 2QIOA 4YIHA 4Z1MA 3F47A 4CDGA 2BUCA 1H6BA 2HD4A 4JB8A 3G5UA 4P3OA 3H74A 5J5CA 2HJVA 2IU4A 1EVEA 4CKCA 1NVVR 2GTPA 2ZB7A 1F1JA 1MEJA 2DFLA 3TW4A 3LC0A 2O2EA 1E9SA 4UVDA 2WAXA 3PC4A 4ENRA 3EASA 3PQ5A 5ALHA 1XZFA 4RTRA 2MYTA 2DY0A 1AD2A 2YJNA 3OCJA 2BSQA 1A5BB 4RPCA 1TJYA 2J3QA 5SY9A 4NZ9A 3P5SA 4UFOA 4CFYA 4NAVA 4F1JA 3R8FA 4MR9A 4Y0VA 2X8JA 1ZUHA 4XIIA 5DM70 1ZH0A 4MQBA 3LUCA 1NVAA 3ET5A 3ANYB 2V45A 1YZTA 2ZANA 3DT9A 2LCFA 3TR0A 5CA1B 5KVCA 4DCMA 4IIBA 3A8TA 1QK5A 5FTMA 5HX7A 2XWBF 1XTVA 2OHXA 3DC7A 5EYNA 3OCYA 5EERA 3AVXA 2I99A 2YIMA 2I4IA 2EAUA 4X1KA 1T5OA 4PYMA 3CNNA 1TM4E 2OZKA 4QPPA 4D0GA 1ISSA 2QQEA 3LZDA 2YS7A 4BV3A 3CEMA 3G9ZA 1QVZA 1L7BA 1XZ8A 3MCZA 2YOFA 1IOZA 1OV6A 2P8SA 5MGNA 4RH3A 2UVPB 1I2AA 2ZYSA 1EJBA 3C7DB 4I4CA 1NF2A 4WT7A 3UT6A 3C98A 3I2JA 1ZI6A 4GW3A 3RU3A 1SY7A 2FCAA 1E2FA 2NO6A 2FR1A 2ZXEA 3D0KA 4D56A 4KXQA 3IOBA 5AUOB 4OHFA 1PL8A 4AY4A 1T0PA 3P4YA 3DMRA 4BTVA 2VNHA 2B4RO 4PAWA 3WWPA 4RJJA 4B81A 2XOKA 2BKXA 4MMXB 4CLOB 3KDAA 3LP5A 1WXWA 4NDZA 3NBYC 5EUQB 2WW8A 4K9MA 1GPYA 4EO9A 1GAJA 2ZYIA 2IPAB 5KS2A 4AQ7A