3RTCA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nad and atp.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 185
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtcA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtcA02
4E3AA 3RU2A 3W4SA 5F11A 4B8RA 3UQ6A 3RNOA 3ROXA 3DRWA 3UQ9A 1TZ6A 1JXHA 3Q92A 3NC9A 4KALA 1YGKA 3IE7A 3DZVA 3NL2A 2DDOA 1V19A 3ROZA 1VM7A 1V1BA 2PKMA 1U2XA 3CQDA 3QAIA 4XDAA 3NM1A 1GC5A 2YXUA 3GBUA 2YXTA 3RU3A 3IBQA 4K9IA 5CM5A 2JG5A 3BF5A 5BYCA 1LHPA 3JULA 3RQHA 3RT9A 1BX4A 4JKUA 2PKFA 3RQXA 3RQ2A 3ROEA 1YHJA 3LKIA 1LIKA 4K8PA 4KANA 3RTAA 2HQQA 5C41A 5CGAA 5BYEA 4C5JA 3RRBA 3MBHA 3UMPA 4K9CA 4O1LA 4DU5A 1EKKA 2AA0A 4LC4A 3RQQA 3UQDA 1ESQA 2PKNA 4LBXA 3LJSA 4S1HA 5COJA 1VK4A 2ABSA 3NBWA 3GO7A 1RFUA 2FV7A 3IQ0A 4S1MA 1C3QA 3RSSA 1UA4A 3B1NA 3QA2A 4KBEA 4C5MA 4N08A 4YL5A 2I5BA 3IN1A 1TYYA 2AJRA 4K93A 3RQ5A 4EBUA 4EOHA 5BYFA 2QCVA 4GM6A 5B6AA 2A9ZA 3RQ8A 3RO7A 3RSQA 2JG1A 2ABQA 2VARA 3UBOA 2DDMA 2I6BA 1WYEA 4JKSA 4E84A 5C40A 1LIJA 3RRFA 3RY7A 2HLZA 3RPHA 3Q1YA 1TD2A 1RKDA 4S1IB 3UMOA 5F0ZA 3RTGA 3VASA 3I3YA 3NBVA 3NCAA 4XF7A 1ESJA 3IKHA 3UQEA 4PVVA 1YGJA 3HPDA 4DC3A 3LHXA 5CGEA 2DDWA 1VI9A 3B1OA 4KAHA 1JZTA 3NC2A 1UB0A 3NL3A 3NM3A 3FHYA 4C5NA 1GQTA 3ROGA 4LCAA 3ZS7A 4E69A 5BYDA 4K8KA 3D3KA 4JJPA 3RRJA 3B3LA 5C3YA 3RPZA 2HW1A 4K8TA 1RKSA 2QHPA 3RM5A 4YWRA 2AJPA 3N1CA 1RFVA 1TZ3A 2F02A 2AFBA 2F7KA 4E8WA 2PKKA 2V78A 2O8NA 3B1RA 2AWDA 3RSFA 4U7XA 5EY7A 4LBGA 3KZHA 4EN4A 3NL6A 1LIOA 2NWHA 5C3ZA 1V1SA 1V1AA 2JGVA 2AX3A 2R3EA 3EWMA 1L2LA 3H74A 3NL5A 4N09A 3LOOA 4UBEA 3D3JA 2C49A 4X8FA 1LHRA 4C5KA 3RREA 4E8ZA 4EUMA 5TQIA 4K8CA 3IH0A 1DGMA 2R3BA 3K9EA 4O1GA 3RS9A 3RTDA 2DCNA 3FHXA 3PL2A 4XF6A 3K5WA 3RTEA 4XCKA 1JXIA 2C4EA 3B1PA 3RO4A 3RTCA 3KD6A 1EKQA 4C5LA 1RKAA 3OTXA 5EYNA 3RTBA 3KEUA 2AB8A 2RBCA 3BGKA 4KADA 3PZSA 4B8SA 3HYOA 1RK2A 4S1IA 1KYHA 4WJMA 2Q5RA 3VAQA 3GO6A 3RS8A 3MBJA 1RFTA 3B1QA 3RT7A 2DG2A 3KTNA 2XTBA 2A9YA 3RSGA 3RQ6A 2I6AA 3HICA 4E8YA 5TRWA 1LIIA 3H49A
chains in the Genus database with same CATH superfamily
4II3A 1L7EA 4A7PA 1JDPA 3PU6A 5J5VA 3L0YA 1IOWA 1A96A 4MWOA 4ZAGA 1W76A 1EFDN 3NHZA 1H4QA 5K09A 4JJ7A 1AUVA 3P7MA 2YBDA 5B7NA 1VHDA 1EFPA 5KSOA 3I6ZA 3VPCA 4MZDA 5A4DA 2G71A 1YE8A 2KS6A 2RC6A 3OEWA 3QUSA 5JSKA 5AKHA 4HVCA 3C8UA 1A97A 5C7IO 2XNCA 4XEHA 1YS6A 2DRIA 1F0NA 3RBXA 5LMNB 1LIKA 4FYWA 1VLHA 2YVAA 5HRAA 3H19A 1IEWA 1GEEA 1WW3A 2QGNA 3DR5A 4X0EA 3I83A 4C6TA 3TTUA 1E9CA 1YRAA 2X1VA 2JRLA 3FD8A 2YIMA 1Z4KA 4OPMA 1QIKA 4PSAA 4YO8A 5DHSA 1U9CA 2QXYA 4Y1RA 2ABSA 2B5VA 3PE6A 3KZXA 1A5BB 5E3JA 3IVMA 1J7KA 1OLSA 2IKQA 4I1RA 1G4HA 1U5BA 4KAXA 4EQ6B 1QGDA 1GWNA 5EIOA 4ARSA 1N77A 1P1JA 3AFIA 3PJRA 3IDQA 1Z0KA 1HQCA 1M6VB 1JSXA 4G8DA 3CVJA 4L6AA 1ZOIA 1G6OA 2R8OA 1KZYC 3LT4A 3OZSA 3QGMA 4NABA 3D6VA 1A82A 4RFVA 5K2MA 3TLGA 4G0PA 3RY7A 1WHSA 4CM8A 3RPHA 1HBJA 4XPZA 1SVIA 4RPJA 1Z3CA 1CUCA 2P5SA 3AUYA 1Y6FA 2FDCA 1AJEA 2WIGA 4MQUA 3CYFA 1NQAO 3C2QA 4ZZ3A 4U6NA 1NQVA 2G28A 2TMYA 2H11A 5CG1A 1FRNA 2O3UA 2XSZD 3H2SA 5K0EA 2N75A 3A36A 1FDIA 2A4MA 1K88A 1O4VA 2ABWA 4R9VA 1XNRB 4CG1A 1HZZC 1Z6PA 2QVGA 3BMCA 3B3LA 1MGPA 3VU9B 3ZD7A 4NE9A 4RIFA 2WHPA 5KYUA 1C7EA 1HFWA 1SXJB 4NDZA 1CRLA 1IWOA 2AQKA 3REGA 3GNLA 1PT6A 2BR4A 2J7KA 2QTTA 3FZEA 5AI8A 3QCZA 1W7AA 3FNQA 1EUQA 3E9QA 1EJBA 4AJIA 4AJJA 4BO1A 3GLUA 3VBCA 3B6IA 3N1UA 2IIVA 1WM1A 3C5CA 3EK2A 4MDHA 5K3FA 3EUWA 5LZ2A 3U6BA 2WILA 4ZQGA 1E4EA 5DNCA 2H18A 4DQLA 3AW8A 1AUPA 3PR2B 3CUKA 1M7HA 4PVVA 5EE0A 1VB3A 3PDIA 5FFMA 3A3NA 4V39A 3MRVA 3VV3A 1NV9A 4EF5A 3ODGA 2Q1XA 3U1TA 3AWIA 3DLCA 3EEQA 3WLPA 1H0SA 3AUTA 2NP7A 1KYHA 2J9ZB 4LOJA 3USZA 3W5BA 4F9TA 2K7FA 4Q9DA 1PBNA 2C04A 1SOUA 3BTSA 3L04A 5KJEA 2YNMA 3HB5X 3GA5A 1PL6A 3O3MB 2VYVA 5LDGA 3WXBA 3W90A 3OJLA 3RI3A 10MHA 3F8TA 2OP1A 5CT6A 5BYBA 3TIXB 3HICA 3IMCA 2AUTA 3OHSX 4Q9AA 1H5QA 4YGXB 4BNDB 1Q7BA 1QGOA 4GDFA 1AQIA 4LF8B 4P5PA 1NT4A 2OQ2A 3DL4A 1LBSA 5ES3A 2OO5A 1X9IA 2YNMD 2ZREA 4DLUA 4N6OA 1SHUX 4S1OA 2VYVD 4V0SA 4Q37A 1V1BA 2Y76A 3CLVA 3NANA 5FOWA 1VSTA 3FNGA 2YY7A 3OEEA 3WB0A 3WNZA 2GBCA 4DRXA 2Q28A 5CM5A 1TVKB 1VIDA 3SF0A 3TJMA 1KVRA 2FAXA 3ZHCA 1O0CA 1EJ6A 4N39A 5ESWA 4ETWA 2ZJ3A 4INOA 4JOCA 4P58A 5JMOA 1TPYA 1E6KA 2A33A 2NNWB 2OV3A 3HXPA 1LPPA 4K8PA 1R5OA 1AD2A 3JQFC 1WXFA 4FW8A 5G40A 1WZ2A 3NBZC 3LS2A 2GEUA 3M6IA 1QKJA 1ZCZA 2ETVA 1XRPA 4MUHA 4O4IA 1XJ0A 3E15A 4AJNA 4KKXB 1H8HD 4ZHQA 2ZJ0A 2RKBA 1KFKB 1GSIA 1P0PA 2ZVQX 3FWZA 5GONF 5A7FA 5CDFE 1ZR4A 1ZICA 2FV7A 2FPKA 4GPZA 5CYPA 1FNBA 1A9YA 5KUTA 1EBBA 1PZHA 3P0HA 4IY1A 4M8LA 4EB0A 4EGQA 4DEYA 4RKEA 5K1ZA 2AZ4A 3ESCA 3W5IA 2A9ZA 4ZYYA 1P0CA 4HEQA 1A27A 3CT4A 2A9KA 4TTRA 3DKIA 2C4TA 4N01A 2QNBA 4E84A 1CR0A 1YD7A 2OCLA 2GDJA 2Y1CA 1JN0A 2OQIA 2XCIA 4YRFA 4RZUA 2OE2A 3VH2A 1KK2A 1ULZA 3E5HA 2DMRA 4CM1A 1ZFNA 3BRSA 5I7VA 1L5ZA 2GTPA 3MXTA 3OZ7A 1CR6A 2C7QA 4OHYA 3E3NA 3DFUA 4NR0A 3K9BA 4KPYA 1V3VA 4JEUA 1U6KA 5C1DA 4MCIA 2DBVO 4RQUA 1Z8NA 1DC4A 3PKZA 1U7WA 1SKYB 3QU7A 2QOEA 5EIBC 3AP3A 2W8BB 4M83A 4XYMA 1PEDA 1RQ2A 3K2QA 2C2ZA 4QU0A 5FP0A 4G84A 2V9ZA 1KZ1A 3A04A 2QN1A 4MVJE 1GUZA 4QRIA 4TYPA 2ZWPA 4HDKA 3N7UA 4F85A 3UBTA 5FCDA 2Y8EA 1DCTA 5DLQC 1A7KA 4XWYA 2ZTHA 4U2GA 3T3OA 2R96A 4JMPA 1Q84A 1N2SA 2OHGA 3GT7A 4QYMA 2GARA 5AOAA 5FWDA 1GQQA 4RS4A 4H2DA 1IY0A 1G60A 2JL1A 4UE2A 5L4NA 2PBRA 3QVJA 2XODA 1EHIA 3ML1A 1Y8ZA 3I9V6 1EDZA 2NZ8A 4HDMA 3K8QA 2I2AA 3PIRA 4YP0A 4INAA 1RYEA 1WKBA 4BNZA 4TWRA 1QHYA 3S2SA 5KPDA 1Z2PX 3DJFA 4B3GA 4YP9A 2DGDA 2X3FA 3A4YA 4CQLB 4GX2A 3TH5A 4DM4A 4RULA 4GKKB 1B2RA 3EF3A 1UPCA 4CF6A 5LOVA 1VIMA 4LEIA 1Q5PA 2O1XA 1NXOA 4QJIA 4GC9A 3ANSA 4EOGA 2EWMA 4PNHA 2VF7A 4A2QA 5K0JA 1VXRA 4P7BA 4LSMA 1QHFA 2BCJQ 2GF0A 3HS3A 1IM8A 4JC4A 1H4SA 1OT5A 2DUMA 1E18A 5FTNA 4R8SA 5KTMA 5GGXA 2ZSAA 5LQDA 1K0UA 2D0DA 4FIDA 2ZKIA 4KAFA 1Z6QA 2AEMA 1RC1A 3UHPA 1AZTA 1RYZA 4GQBA 1X9HA 4AMYA 5CB6A 3MEQA 2GO1A 4KW7A 2VJPA 4LJ4A 4KXVA 2ZJ6A 5HCUA 2YV2A 2J5BA 4L2IB 4QBGB 3PUHA 4UATA 1ZCAA 5JQWA 3RVQA 3QK7A 3OSZA 5G0SA 4F6LA 3FDZB 4IFTA 1HRDA 3TMKA 3H2KA 4AKHA 4MUEA 2PSEA 1XZ8A 3IPCA 3SSMA 4DCOA 2QLNA 4NZPA 5J4LA 2VF8A 1Z5NA 1QIFA 2PKQP 1H85A 3ZKWB 3DKPA 2DBYA 4LXXA 5JVDF 4FSHA 3DKKA 3GAFA 5BYEA 1UR5A 1PZMA 1TTHA 2RGYA 3UMPA 4XE5A 3LHSA 4DU5A 3R0IA 4HDNA 1QMPA 4X1KB 3THYB 1ZIYA 1Z5UA 1EHYA 1CF2O 3OO1A 5IT0A 3IKMB 5BOVA 4I14A 4DCCA 5KOYA 1NP7A 1Z4OA 4E5PA 3UAGA 4LFCB 1EJ0A 4KE8A 1PUJA 5IYZB 3CW8X 1XEWY 1PR2A 2O3JA 3GFVA 5SYAA 5CDTA 2WJIA 4JBNA 4F2GA 2CDBA 4DG5A 2BEUB 2XOXA 3RF6A 3FDJA 1J5PA 5C8DA 2ADMA 3UJPA 3F5DA 2NO5A 4C88A 4BCBA 5BPHA 1F7UA 2AYYA 5JSYA 2WMYA 1S8AA 1DIBA 3GPLA 4Z9FA 3PDUA 2A88A 4HSEA 5AKLA 1WXXA 1CBUA 3RAJA 4JB2A 2WWTA 3NC0C 2GYYA 4JYMA 3CY6A 4GR9A 1BCSB 2XTZA 5DN9A 1ODSA 1PT9A 2QD4A 4H3KB 3H13A 3K5HA 2JK1A 2JZCA 1IHXA 2Z09A 1B0UA 1MXHA 2J8ZA 4QOIA 4E69A 4JDUA 1LQTA 3Q3VA 2FR1A 3ZY2A 5IJZA 1OD6A 5BXYA 5B37A 1ZVJA 1OI4A 2JS7A 2IHBA 2IUTA 1P0FA 5K0SA 1P2DA 2Q6LA 3PE3A 4H7PA 4KO8A 3REQB 4PHHA 5AQ1A 1T1GA 4DILA 2AWDA 2KI5A 1N6PA 2P4EA 5HILA 4S05A 3W5SA 2YWCA 3BZBA 3IL2A 2R3EA 4ZU1X 4WBSA 4RJJA 2X86A 3EIXA 1E96A 1UMDB 1AGNA 4GZ3A 4A0HA 3IJ5A 2DCNA 2NTEA 1FFHA 5CGQB 3V1NA 5HYVA 3QPWA 1MW8X 1DDGA 3SXPA 3WGZA 1ONNA 2J0VA 1E0JA 2N42A 5FO1A 3UAVA 5JROA 1SUWA 1JQDA 1M2OA 2WFAA 4G0OA 4NULA 2C07A 3UY4A 3E5MA 4M7OA 4MI9A 3ZGZA 2PFSA 3QFCA 3V8QA 2MYTA 2HCFA 1TA4A 2AFVA 3AM5A 2A0WA 3MHPA 1JHDA 3UOAB 5KTNA 4AZSA 4C0SA 3GGSA 4TTTS 3WGOA 2QQGA 1AHHA 1SD1A 5HF6A 2XDWA 3O8OB 3IT0A 1KP2A 4MW7A 3OO0A 1AF7A 4MI6A 1JQEA 1ULAA 3AP1A 2G09A 1XAHA 2AFIA 1EA7A 4MWZA 4NOJA 4X8MA 4U7HA 4QA9A 4G63A 4BN5A 3RS2A 1FYFA 3JYOA 3TRKA 4LV8B 2IEYA 1XXLA 3HR8A 3WGYA 1JS1X 4WBNB 5EUBA 2JD0A 4KBFA 1OXTA 1AN9A 3UHAA 4NU6A 4BB9A 4DLZA 4KPUA 2SICE 3RK0A 4B85A 4D4MA 5K8IA 5K8CA 2OD9A 5F35A 1TEZA 5B7GA 3K7EA 3NT2A 2UZ4A 1GPKA 1ZVMA 4HJRA 3GUZA 5ER9A 4DQDA 4ALIA 1TYAE 4GYKA 5CG2A 8OHMA 3SLRA 4CDNA 4TUYA 3INYA 1JZQA 1BTOA 4YRAA 4S1HA 1GZHB 1YBMA 5AVVA 1J1UA 4J4BA 2F1HA 4PPYA 4PTLA 4W5TA 3KR2A 1LEHA 2FMXA 4F3CA 4RD1A 3OIFA 2ZRCA 1ZUNB 2PS0A 1F2VA 2CVFA 4L3OA 5IXJA 4N08A 1LU9A 1WEHA 3DOIA 3QMWA 1U1CA 5FTKA 2HA0A 5C8YB 5B6AA 1PNRA 1Y7PA 4OP3A 1VLZA 2Q5IA 4WMLA 1WW8A 1S6YA 3IJPA 1BJTA 5JCXA 3L8YA 5C40A 4XB2A 1TUBB 1X92A 2DTEA 2PU7A 2GJ9A 2VF2A 1CSEE 3JZDA 2O2EA 4IVQA 4QXQA 4QD3A 4BS9A 2YIVX 1JTVA 3RJ9A 3FR7A 4D57A 1G5RA 1W1UA 4EUHA 1RLMA 5CGEA 2ADFA 3SFZA 2H65A 4WZ6A 3O8BA 3IKJA 3ZDQA 4YRSA 3NOVA 2NO0A 1SG6A 3CW9A 4IUBS 4OKNA 1G55A 4F93B 4D42A 4ZJYA 3R20A 1ILWA 5ELMA 3NNNA 2ZRDA 3AHEA 4EKYA 3O73A 2QVXX 3GRRA 4BC0A 1WVMA 2F02A 4WIAA 4TKUB 3GLFE 3DV0B 3EXHB 3QE9Y 4CQNA 3JQ9A 4WKOA 3SSNA 3COWA 4FILA 4EITA 1BXKA 3KOMA 3NCTA 1HYHA 5E7QA 1V1RB 5EE1A 1QH1A 1KI9A 5EUCA 3SLGA 5BWBA 1NRWA 3ROMA 4P8RA 1U0RA 4EEZA 5CLLA 2HQOA 3TO5A 4CLHA 1N3LA 2GEFA 2AOVA 1BHO1 1YB5A 4OQQA 3UJ3X 1UQTA 3VSBA 5TV2A 2EOAA 1ADCA 1UOQA 3FMFA 1JDVA 4XUGB 5TEVA 3MGCA 3UKDA 1E2IA 4WOPA 1LB1B 3A2KA 2EKPA 4EHHA 4F9EA 4UBLA 3FRHA 3NIGB 4ZO4A 1JTFA 2ODTX 1WBBA 4OXQA 1IQPA 3UENA 4NZOA 1V35A 1H05A 1Z5ZA 1JHUA 3TDKA 3SPXA 3KL4A 4UD2A 1E1DA 2IYQA 2Q3LA 4GM1A 1SBYA 4C7KA 4DUGD 3JRNA 2EKQA 3L93A 1P7CA 3WB1A 1NNLA 2XJ9A 1K9VF 4WA8A 1SBHA 1YFKA 3PUZA 5DHAA 4ZT7A 3TLJA 4ZHQF 1JKJB 1U31A 1Z2EA 5HG0A 4D56A 3EH2A 1CVIA 1FZQA 3IELA 5DOZA 3WLKX 3HVRA 4WFJA 4N76A 4OQZA 2QG6A 2FSPA 1I3MA 1T0BA 2FPWA 4LF9B 4Y98A 4CQMB 2B1JA 5CCXA 1IK4A 2AYXA 1M8KA 1DTWA 3P9NA 1ESDA 1JHYA 3DNFA 3G3EA 3GGGA 3VYSB 4Z6KA 2Q5HA 3ZK7A 2EJUA 2UUPA 3VPBA 4P3NA 3URKA 1V8DA 2FFJA 3RU3A 5A9SB 5CXQA 3I5YA 2JG5A 1U7OA 3D1JA 1AO0A 2EG9A 2OL4A 1LLCA 3VDRA 3IR6A 2O20A 3HVUA 2V7VA 1BKDR 2VBFA 1NTRA 4Q3OA 4OQEA 2ZJZA 1DC3A 1PZXA 1NLMA 4RJLA 5HBRA 1S89A 3LX6A 1VM6A 3ZLTA 4L5YA 4DLYA 1QRSA 5DEIA 3MIIA 2HQBA 2Z56A 4BIIA 2GHIA 2H2DA 2C97A 2MWMA 1RXIA 3DBHB 3OZCA 1T9BA 1T3TA 1EX6A 2QLMA 3F74A 2NU9B 3VO1A 1EX7A 2J46A 2GBIA 4FGJA 1XALA 4UARA 4L8GA 2EBFX 3W6ZA 2Q1TA 1KJ9A 2BMWA 1ISPA 3C14C 4G5XA 4JLVA 4C5MA 3IPLA 3Q87B 5ENDA 5AW2A 4BO8A 2PS9A 4L0CA 3TS1A 3PPXA 4KDRA 4Z7QB 3T12A 2FMFA 3FB1A 1EXMA 4DM3A 1N7JA 2I4LA 2N3ZA 4GLOA 1FOEB 2SKCA 1J23A 1FYWA 1NP6A 3BREA 1BQEA 2KM1A 2QMHA 2C3MA 4L7VA 5DCUA 5ALMA 3RRXA 2XOEA 2C88A 2BMVA 3OPYA 4HB4A 3KUDA 1RYNA 5CK4A 1Y81A 2QTAA 4FDUA 4PX5A 5DX1A 4ARCA 4QRDA 4C0WA 1G5TA 2PMWB 3ICVA 1T8YA 2QAIA 3FGPA 2VT6A 3IIJA 3DDCA 2BISA 3W2GA 2YY5A 1SC6A 3HXQA 4U2FA 1ZMBA 3G1WA 5FFFA 4LDQA 5LOVF 5KOJA 4BNGA 4JVOA 1CY0A 4J2HA 2Y2VA 4CIDA 3OICA 5CA0F 4K8KA 2CJXA 4FJ2A 4EKGA 1PGJA 3I9KA 3QPUA 4CR8A 1LC3A 4REOA 4CETA 2BFBA 1LBIA 1PUIA 4PNPA 5GZ6A 3K0EA 5E4YA 1NBOA 1XIVA 2O8NA 2HPVA 1K6EA 2P0YA 1CD5A 1IULA 1AKWA 2HHCA 3AOEA 3AXSA 4ON9A 5AVZA 5IAOA 5L3ZA 2XNKA 4CBVA 2OEPA 2QRPA 3I2GA 2GEJA 4CIBA 3DTTA 2CLMB 1AO3A 1RFLA 3D3NA 4MMXB 1OR8A 4FFPA 4KVGA 1ZPDA 3VR4D 1XTBA 1K7SN 3F9IA 3EVBA 2VHXA 3W77A 5HIAA 4KZKA 1M8PA 4NZYA 1AS3A 4QDZA 2OOSA 3FMGA 1MG0A 3DXXA 4G0XA 3DDZX 3BHMA 3ZHVA 1KOJA 4LQ4A 4LIPD 4E70A 5J63A 2OKGA 4NPHA 3BXXA 3FFAA 2HCBA 4HAXA 5EMHA 1XEXB 1MO6A 2H9AA 3OLYA 4NZNA 1NAHA 4QTZA 4PCUA 1C41A 4X7RA 2DWUA 1NY6A 2QJWA 3K05A 5DBEX 3WB2A 4FWTA 1C8LA 1X7GA 5DV9A 4I08A 4FD2A 4PLTA 4XD2A 4D82A 5JQGA 3O8RA 5JS1A 3QVLA 4CTJA 4DUPA 3A7EA 2IOFA 3SICE 3IUPA 3IV9A 4MOWA 1W2GA 5FUMA 3ICPA 4RX1A 3J81A 4KMOA 2WM9B 2C4MA 1T8WA 2GERA 1R15A 1BD3A 1JG7A 3QXJA 4GYWA 4UM9D 1JJAA 4NCKA 5C52B 5F11A 2ZB2A 1QF7A 3F6SA 1R8XA 2LIPA 1XF9A 1GPWB 1KDPA 2ZRBA 1OJLA 3PPIA 3STYA 1W4AA 2HLHA 3O47A 3CW2A 1X19A 1XCGB 4KV7A 3MQ2A 2GT1A 2GAOA 4YJFB 3GMSA 5HDBB 5AOCA 1E2GA 3STWA 5LOVB 4WY2A 5D2CA 3R44A 1RM4A 1TC1A 3B70A 5GIPE 1CY6A 1U0EA 4Q02A 3I01A 1KY5A 3T54A 2DLCX 3PQEA 3B6MA 4KTTE 3K8YA 4PXSA 1XRRA 2GCOA 3GW8A 3JWHA 3EPKA 5KJFA 1KPIA 2O8DA 4MR7A 1Y3HA 1XDBA 2NWQA 2N9UA 5CFMA 1ZMTA 3DV2A 3V55A 2IZZA 3KKNA 1E5XA 2JGEA 4HFMA 4HL6A 4RHUA 1FS4A 3DEZA 1MQ8B 3UQDA 1RMTA 3K92A 4K28A 4RVDA 4IH9A 2VT7A 1IQ0A 3I61A 3HRIA 1RFUA 1IONA 3JW8A 3L92A 2IS2A 1Q3KA 3H8SA 4RLSA 1SXQA 2RAFA 1R74A 1HYBA 4FGLA 5IXYA 2ZBDA 4OHWA 5CLGA 4YJHB 3LF2A 3RYHB 2QCVA 1U7TA 2ZB4A 3PLAE 1DIOB 3KWLA 3S1AA 2JFQA 2QRMA 2WVGA 5ALRA 1KQ3A 2VHQA 3H9EO 5ALLA 1TW2A 4TKZA 5FUXA 3GFGA 2OFOA 4DC9A 5JAIA 1U65A 3LX4A 4BBZA 1ENPA 2Q4DA 3NBQA 3ZE9A 1S2DA 1SELA 2NUPB 3DOFA 2IHTA 2P9TA 4PZDA 1QE5A 2F1IA 2VJCA 4B3XA 4HLDA 2FSSA 2RGEA 5FBZA 5A6SB 2DLDA 4H77A 3JARA 3UHJA 4F4HA 1HH4A 3HKDA 4DMFA 4BFUA 3BJZA 2J1LA 5HK9A 5CX1B 3KKLA 4D92A 1P19A 4UEOA 1PLJA 1K3TA 3L9WA 4YP6A 1CEYA 1IM2A 3ADBA 5KJ6A 3KJGA 1LFAA 2VK8A 2AJPA 1V5EA 3QLVC 2ZYRA 5HR5A 1E7QA 4EGAA 4O2BB 5TNXA 2IY8A 4BCDA 3CG0A 3EUFA 4QQKA 4PYLA 4XPIA 1JXAA 1WVGA 4XR9A 2I7VA 3FFWA 4EECA 2ZI5A 3DBVO 2BUCA 3M5PA 4YAKA 4AJ9A 1P80A 1PK9A 3HFSA 1E69A 1Y98A 2FZ4A 3GJ6A 1G2IA 3JCZA 2G7MC 2JIDA 2N1MA 3N2EA 4YRJA 3EG5A 2BFPA 2GWRA 2W83A 4OM7A 4EDFA 2PQMA 4F4DA 3D2AA 1WO8A 1L8AA 3NHRA 4UJ3A 2GTHA 4HGNA 3PGA1 1D0IA 1KPGA 4PF1A 3CKLA 1ADBA 1KI3A 4KH1A 2RB5A 3A32A 4BU0A 4G1VA 4JKOA 4AECA 1NNEA 1QS0A 2FDXA 4ARAA 2NV6A 3A4MA 3B3AA 1XFAA 2VUIB 2MHCA 2XDQB 1N2CB 4LC0A 1M3SA 1QIEA 1FA9A 2G9VA 3DTNA 3EIQA 2XA2A 4PSDA 4TUYF 4LWPA 2QQFA 1ZIDA 2Z9DA 1QCZA 3JWGA 4NESA 4YV2A 1PN3A 3Q2KA 1JHOA 3CGGA 5KPJA 3T5CA 2AMJA 5KOIA 3W4SA 3DMYA 4TGLA 2I2XB 2PMKA 3HZHA 3LWDA 3JQAA 1SCDA 3LHXA 3SJCA 5K3OA 2P6NA 4OSPA 3GRYA 1CQWA 3IE7A 5DOVA 3A2LA 1A4RA 4CE6A 4MVJA 2GPAA 1MT3A 3G1TA 4JR2A 4IIBA 4UMEA 1IB0A 4HPJB 4MS4A 5FPPA 4DA4A 4BVLA 5BYCA 1BXRB 1ZGJA 2CB0A 4ZPJA 3SEZA 4JA0A 2F62A 3JQAD 4WPGA 5F77A 2EZTA 1ZRSA 3O1LA 1JIUA 3AF2A 1K2VN 3M83A 3QVOA 1E7YA 2RHJA 4MVJD 1JDBC 3EXEB 4MVXA 3DEJA 4FHEA 5FBVB 4UMVA 1RVDA 1TU3A 4DA7A 5B3LA 1MRZA 2C03A 1WV1A 1YGYA 1A9QA 3ICCA 1XHLA 3M6WA 1N6LA 4O02B 4G8BA 4UBJA 4WK2B 1Q0RA 2FPLA 4OHRA 3A27A 3KKKA 3RVNA 3TKYA 4FNAA 4AO8A 3TZ6A 2C9ZA 4HNGA 4PFKA 3K6JA 1DQSA 4FI3C 1CJTC 1TTQB 1MQ9A 4CU5A 2YWXA 5FLXA 1GL6A 5BNZA 1ETHA 2Y1OA 3BRCA 3RYCB 1UXOA 4LF4B 4J3JA 1TZBA 3H8VA 1XPJA 3FUCA 3DL0A 1UK9A 2YMMA 3LD9A 2V96A 4CWAA 3UAZA 2SBTA 4TZKA 2W9XA 3B6JA 1Q77A 2WJJA 2WTZA 3OURA 1HG0A 2VWHA 3WYBA 4YMWA 5C4MA 3UQZA 2O8EA 1CUSA 3GJ7A 2EX1A 1WG8A 2NU6A 4JJ6A 1N3BA 4MQ5A 3CLSC 4V3BA 4YWJA 3M34A 1NBWB 2B25A 1PD1A 5IX8A 1E1CA 2XCUA 3WJAA 4WKGA 2FDRA 3E03A 3VH3A 2ZW9A 4XDHA 2NXJA 5HW0A 5A7GA 1OV4A 4CTOA 3CJTA 4YY3B 3FCOA 1EIWA 2G8NA 2ORED 4ND6A 3HG7A 1SVWA 3K2EA 2NUAB 1SNYA 4R5MA 2X15A 3BD6A 4ZI7B 1WU7A 1N9GB 2BFEA 4C4XA 3KO8A 4RSMA 5LQNA 1VZ2A 1Q50A 4CIXA 5JECA 5ALUA 3X1YA 1LDGA 3MOGA 1TYCA 3KUKA 4E4YA 2JKYA 4NWIA 1YKGA 4U9HS 2VWPA 2XXAB 2XZLA 1LBTA 3OT5A 4ABYA 3TTVA 4BJ5A 4IUDS 4EAAA 4OX9Y 4JWKA 4YDSA 2PFGA 2DWQA 2WJGA 2IHJA 1BEEA 4RH1A 1Z17A 3WV4A 2RHTA 5TS3A 4QKQA 1LFDB 3HM2A 3O2NA 2ZI4A 3EGIA 4F2WA 1QTQA 1ZN9A 4DDUA 3D6HA 3ZYCA 3E9YA 1U2ZA 3FMVA 3TPCA 1F12A 2E55A 1Q44A 3DOHA 3V8NA 1M0WA 1RXSA 4FEYA 5LZ5A 1MENA 1QFXA 5C5IA 4RV9A 1KSGA 3K8ZA 4KIGA 2DG2A 1ISFA 4C4OA 1HNWB 2IK8A 5F5NA 5DNDA 2XYQA 4G9GA 4LA4A 3SJUA 3OQVA 2PKYX 2C5AA 1FW6A 2H31A 4P3YA 4BKPA 5ESRA 3ROFA 1O57A 1ZH8A 1J2RA 4X8HA 3TK1A 3ZJTA 2F55A 3U31A 3A25A 3Q92A 1RXYA 4YCJA 3T99A 1RLUA 1M2WA 5BR7A 5AKEA 3CJRA 1NFRA 4MLPA 2W6JA 2GFHA 2K6GA 2J3LA 4QPPA 5H5JA 3Q6MA 3A9WA 1A76A 3C1TA 4UAGA 5G1NA 4GPAA 2ODPA 5JSFA 3F8SA 4DV2B 1A88A 3UB3A 3DZGA 5KWIA 1XZHA 2ZU0C 3GFQA 4CIAA 3ROEA 3ADDA 3UO8B 2FQXA 3B1VA 2O0KA 1NVUQ 1LF0A 2OMEA 3O3OB 2EHDA 2P75A 4G24A 4QU5A 2J3MA 3K5PA 3IX7A 2GYWA 1BS2A 3WLSA 4URHA 2VJMB 3ZD6A 2C2OA 4Q34A 2JCBA 1X1TA 4UCFA 3B1YA 1ULTA 5FL7D 2MYPA 5AJUA 2CBZA 4HX2A 1T2CA 4RF3A 2M6RA 5JDIC 1L5SA 1MJHA 1L4YA 4ZC1A 3NHKA 3II6X 4NQZA 2JI9A 5E2BA 4N41A 2Y0EA 4QVGA 2JLBA 4MV4A 2AL7A 4AIIA 4EFNA 4EYKA 4D9KA 1YFLA 1QQAA 1EXDA 2XJ4A 2Z0MA 3W5DA 3CEHA 3CKMA 3U7HB 2YZNA 3H8WA 3TX2A 3WLFA 3DAOA 4LQLA 3BFKA 4PYNA 3B7WA 4C4AA 4EFMA 1M7GA 3QP9A 2E4YA 2NO9A 3QVXA 4CCSA 5IDQA 5KQGA 1FMTA 3I32A 3U61B 3GZTB 2IQIA 1NOKA 4L15A 3WVNA 4S1IB 3JX9A 5KJ1A 4WEQA 1RABA 1LD3A 1J25A 2G1KA 3TQRA 4CKEB 3QE3A 4ZN6A 1ZJ5A 4IM7A 2DY1A 1ZNZA 1Q7TA 2CXPA 1I3LA 2JD2A 2Q5FA 3IQGX 5DP1A 5IDXA 2QL6A 1ZNYA 3KOUA 3IBYA 2QW0X 1G2OA 1ORTA 1YRWA 5L95A 4P0PB 2BV3A 1RKSA 1QCDA 2Y1EA 1U9IC 3NHFA 1U3UA 3NTLA 2HMUA 4FMBB 5CFLA 2QRHA 2O9JA 1FEZA 2GEVA 5JQGF 3NJ8A 3EXIA 4JLPA 4CKBB 5EHZA 2EFJA 2ZIXA 1GTSA 3N07A 1RE1A 3NRCA 4ZREA 1SKQA 1USVA 2XNSA 5IVHA 2FNAA 2HLDA 5BMVA 3RRMA 3SC3A 1N5OX 1QV7A 4AP9A 1NVVQ 2IYZA 1WB5A 4DBZA 4D9CA 3QWIA 1L8LA 1M6NA 5AKGA 4NX2A 3DDSA 4JBXA 3WLQA 2XYHA 1BE6A 3AXTA 3IDZA 1Z3IX 1S8FA 2HLDD 2YW2A 2AZMA 1VI5A 3CX6A 4LGVA 1Z12A 2XKBA 4MLZA 4WJZA 4NARA 5IWCA 3C1AA 3GO4A 3OZDA 3QX8A 1HF3A 1SUDA 3QPCA 4G1MB 2KHZA 4RMHA 3TRJA 1Z06A 4CHTA 1TRKA 3HACA 4XCQA 5ALWA 4ACAA 1NW8A 2PTHA 3SZMA 1WOMA 3QW4B 3R40A 3PLNA 4HWSA 1UK7A 5CJJA 3GG9A 5HK8A 1JWLA 1R1DA 4G5SA 5ILGA 3HP1A 2YYSA 4JEMA 5JPCA 1TU4A 5KTTA 5FWAA 1RC8A 1T2AA 1LIIA 1NA5A 4ANFA 1W96A 2JANA 2JFFA 1IRIA 3E7FA 1OAKA 3FFTA 2P8SA 3N2ZB 4ZFNA 2RC5A 1ZD4A 1H5UA 1BRTA 3DDHA 2ZJYA 5K0FA 1H1LB 2GN9A 3G9XA 3ZBUA 1KTIA 1C4XA 2CDAA 4YJKA 3UFBA 1FTQA 4UUNA 4NNPA 5IT4A 1DS6A 2YV1A 1V16B 3NHPA 4XW2A 1BQ3A 4LNUA 4ZGWA 4O4LB 1GNTA 1GARA 4JEHA 5TX7A 4AZVA 3CB2A 5LZ4A 1TO1E 1I4TD 4I50B 1JVSA 1E9BA 2AA3A 4J4TA 3R9XA 1JIKA 2HZ7A 3Q6IA 4HXYA 2ZXEA 3HP7A 4CKWA 2J07A 1B8PA 3CO0S 5AM4A 3OFND 4KXFB 1P2VA 5HUQA 3G6WA 4Q01A 3ZI4A 4DA0A 5FBLB 5C0OE 1UBGA 3E9ZA 2ZB7A 2ZRFA 3PYMA 1GHTA 2DPMA 2DFNA 3T1NA 4LBXA 4EPYA 2DT8A 4Q1VA 1H94A 1I3OA 5AFSA 1PBTA 5FWYA 1A98A 5DM60 1IZ7A 1EAMA 3SGLA 2JLVA 2XTNA 2HSWA 4MVWA 2PZ8A 3C0KA 1USKA 2ONCA 4Y1GA 3ZCQA 4CKCA 1UZUA 4JUIA 1POWA 2Z2JA 1QAOA 1N2EA 5CUQA 2JA2A 1XLTA 5LMZA 2XIQA 2P9BA 3LL7A 2XCTB 2WWGA 3M5DA 2W37A 4B46A 2A9FA 2O8BB 2H7XA 4DWOA 1U4OA 2FZWA 4XDGA 2Y6UA 4W1PA 2V55B 2K4MA 1IM5A 2IW3A 4H3SA 2I2DA 4DREA 1E1QD 5KO2A 4DQUA 3W9UA 3I05A 1QCCA 3P0JA 4RZSA 1OIVA 4KNWA 1YBFA 4M2LA 1PL7A 3DP7A 3IHTA 4LN1A 3UTDA 3I62A 3KWFA 1GL3A 4G41A 4YO7A 2J0UA 4X62B 3PGLA 3C6YA 1GQ2A 3DPUA 2X1HA 4R0VA 4ENUA 3RC7A 4QOGA 2Q46A 1EGVB 3JD1A 3G6KA 4HGZA 5CYGA 5JASA 3EGDB 1V2GA 3IEMA 3G2KA 4N6GA 3GBVA 3LCMA 4AYTA 1X1QA 1L5LA 5IDYA 4TLEA 3FPAA 3CPHA 4QDTA 3U4HA 1NLUA 4UBOA 4JI8B 1T25A 1Z36A 1UPFA 4JI0B 5PNTA 3F9RA 2WKRA 2FH5B 2J48A 1ANKA 4RAOA 2G1PA 1HDYA 1N2HA 2W2OA 3U62A 1IQRA 5KYXB 1NMYA 1YOBA 3QH4A 3AINA 4TS4A 1Z8FA 1XNGA 3UUGA 4YUYA 4FGKA 5B3KA 3NEJA 4HEJA 4IDBA 2AQ8A 1OUMA 1FYDA 3HVKA 4LXUA 4Q93A 4MVJF 4U2EA 1PV2A 3IVCA 1CTQA 1SKBA 3JZAA 5A4MS 3V2HA 3ZE8A 3L4BC 1YS9A 4OV6B 1LNZA 3HBAA 4IDFA 3AP2A 1UQUA 3UMVA 1D9ZA 1O94C 2I7DA 1A7JA 3H5NA 3A6ZA 3KZ1E 2W4MA 2LZ0A 1C8BA 1IZYA 4I1OA 4JJAA 4HT3B 3THWA 2B69A 5DIZA 1SC4A 2WB4A 1J09A 4JVLA 1T36A 2YC2C 1QVRA 5EKXA 4EH1A 4GMGA 1CF9A 3LO8A 2FEWB 1P6XA 2QUBA 5ERXA 4N3CA 4K6CA 2G25A 1I7QB 4KWIA 1XA4A 2QE7D 3GMDA 4WTOA 4D9IA 5EJ4A 2Q50A 1VPWA 4R1MA 3ROXA 1CLEA 2DR0A 5EKTA 1H93A 1HE5A 3OESA 4N18A 4WSOA 2P6OA 1FTWA 2FZKA 2JAUA 3RYIA 2J5KA 3CO5A 3D4OA 4F04A 3SDBA 4HATA 3THOA 1MIOB 5CXUA 5DGIA 3ECAA 3O4IA 4Q0MA 1C2TA 1TQ4A 3HDVA 4IILA 2WQZA 5T8KA 1FYEA 1K68A 4Z51A 3BWXA 2AJCA 4MLCA 2J3EA 3MINB 5CFRA 1MX5A 1SVSA 1UEXC 4YT2A 1HK7A 5CA0B 3NIBA 1WD7A 1HE3A 2VL7A 1ELOA 4QODA 2J3KA 1L5HB 2R97A 3BEOA 4FN4A 4QYTA 2AN4A 1GV0A 1GZ7A 2Z5LA 4AX8A 4DQXA 1I6KA 2XMDA 1E99A 4C7JA 1MGOA 4DLKA 2O2GA 5KOHB 1UDXA 1X1CA 2I7XA 4UCXA 3I2KA 3EGWA 1K63A 2WZDA 3DOEA 3OJXA 1V5WA 2HSJA 4MV5A 3SI7A 3T35A 1B0PA 1FXUA 3TFQA 4Q4AB 5F3WB 4OUDA 3EAGA 3ITNA 1UFOA 2Z3ZA 3L3BA 4URUR 2QP3A 1KQOA 3U39A 3VJKA 2HI0A 2IT1A 4MGZR 5BSUA 1LTQA 1PKXA 4DSTA 3BWYA 3FHJA 4QJ5A 5DTQA 1IZ8A 4MV9A 2GAJA 3IOMA 4Y2JA 1UZNA 3P52A 3I6YA 5JZBA 1S4MA 1HMYA 3AONB 3R4VA 1GXSB 2CFTA 2VIIA 3JQRA 4NG5A 4PC3A 3ZV7A 4FGSA 5ALHA 5KYTA 5AWFC 4LC9A 3T5PA 1S9HA 1R6UA 3VOTA 3CUTA 4PIVA 2CFOA 1EH5A 4ZO8A 4EW2A 2I7TA 4EEKA 3IT1A 1EGAA 4XTCS 2HBZA 3B53X 2F3PA 3PQ6A 4BNWA 2ZUDA 1XGKA 2P6PA 1EUDA 3GFPA 3EIEA 4PSKA 1BX1A 2OCDA 3JD2A 1YVRA 1UEJA 5CHEA 3ZDXB 1E6UA 3VSEA 5BOSA 1OXUA 3NGMA 2QENA 5TPZA 1QG4A 3D3KA 4UAVA 4XDYA 3IULA 3SJ7A 4A6PA 2F43A 2O6LA 4UUPA 1KOGA 1HTWA 3GROA 4B6EA 3ZJYA 3L02A 4NOKA 4R1LA 2IEBA 4PZUA 1GCIA 4PZEA 2D1SA 4CGZA 1T9ZA 4FGWA 4R1UA 1V9SA 3DZBA 1DDIA 1DJOA 3D02A 4U2BA 5TPZD 2HIAA 5EJAA 1XA0A 4R9UC 1ENZA 1QRAA 5AIBA 3ULKA 4FSDA 3F67A 3MSXA 3B5IA 3BWEA 4YAUA 4A6XA 2PL5A 4IXMA 1D04A 2DQZA 2VF5X 3EAQA 4IJWA 4LY0A 3U9LA 1ZGCA 2EGUA 2O7NA 3M6FA 3IPRA 4KH0A 5J59A 3OTIA 3OZUA 2KSQA 2X42A 3OX3A 3HXMA 4KLZA 2EC5A 4ZZ2A 5KCMA 4IIGA 2POCA 1H6CA 5J2TA 2I9KA 2FCAA 2OB1A 3JU3A 3CM0A 3KCNA 1JW9B 1UBKS 2ZJ4A 1YDFA 4FKZA 4WZAA 3WL5A 4B32A 3PD7A 3W8FA 3HYCA 5C4GB 4ZTUB 1X80B 4JGGA 3EW9A 1IN7A 4P7KA 3U48A 3ZGNA 4A8JB 3VAQA 3ZDCA 3R5SA 3FVQA 2ZBQA 4ZVKA 1NVTA 1KOLA 3KTNA 1DAKA 5GPBA 5JWOA 3LQYA 3RJMA 4CM4A 4DQKA 2DT5A 4CFZA 2XA9A 3EQ9A 4PYJA 4X90A 4Y0NA 4CG3A 4D4GA 4PM4A 2CXOA 1PSZA 4EHLA 4YMTA 1C9DB 2I76A 2HL6A 4HQ6A 4RJKA 4WOBA 1N75A 4EA8A 4IIYA 4MVJG 3FMIA 5JXWA 5DXFA 4C4YA 2GZ2A 2GCGA 1XL0A 3RS7A 1WUYA 1YCDA 3PLRA 4JLOA 2OCBA 4Z2YA 3D7KA 3MBIA 4L5IA 4AFNA 4B09A 4ZVUA 1WXDA 4CI0B 4FXOA 5C8ZA 3BTOA 3ORHA 3O7MA 3GVXA 1AQYA 1BX4A 3U4QA 3L8DA 1BXGB 1F2TA 2C84A 3PNYA 3W1VA 2QXTA 2PYIA 1RWMA 3PC4A 3R3WA 4JUDX 1UQRA 4KYVA 3HK2A 1JXIA 2YICA 4B4DA 1BNCA 3OHPA 3ZHBA 2X8WA 3K16A 2I33A 1G8AA 2XYPA 4LYGA 1L1FA 2IYWA 3LBIA 4Z5XA 3DLBA 1XMXA 4UBKA 3N74A 3ZU2A 4PICA 1JEQB 1OX4A 1N1EA 2C3YA 4NJEB 1FRQA 2R2GA 4NYJR 2MIIA 2NACA 4ZGGA 4I4TB 1P9RA 1Q57A 4YAEA 4A0FA 1M83A 2OXRA 3R7WA 3IJEB 3RSSA 3A31A 1JB9A 3CX8A 2VJOA 3KJHA 4PY2A 4QHSA 4Y2RA 1T91A 1ISSA 3LFUA 4GX5A 4ZOEA 4HGQA 2FWPA 3A1EA 3FF4A 5K01A 4DLVA 1Y3BE 1Z4IA 5BMVF 1WZUA 1JA0A 4EKIA 2ZE8A 2ZJ7A 4CT0A 2FWAA 4IYRA 1YVPA 2P69A 3GRFA 3N8IA 4OB6A 1WYEA 1NOJA 3UV3A 1Q1GA 1JF8A 1FK8A 3K0HA 3L43A 2VDRB 3BBPA 2ZT8A 3T7AA 2XMPA 3ND7A 4C43A 5ALOA 2IYLD 1KMCA 1N1MA 4R1OA 3K32A 3T9FA 4GW3A 1K1EA 2BEJA 3N5KA 5GM2A 4H9GA 2PH3A 4C29A 1S01A 4TV9B 3F6EX 4KZPA 1ZK4A 4P36A 5IZCC 5B58C 5LP6B 3L7NA 1HZZA 1Q16A 2YJ6A 1QSGA 4QREA 3D2LA 1FX0A 2F64A 2FPOA 2PT6A 3E2IA 2GZRA 1GLNA 3K9WA 2P6UA 3KKEA 3LC0A 4KIUA 3PWSA 2ATEA 5D3ZA 3OCCA 2B8TA 2CKMA 2RK4A 4Z1MA 5THQA 4ZIRA 4FT2A 4PPFA 1OKKA 1QOQB 5CAEB 1BVHA 4PWZA 2M6KA 1JU4A 4CMBA 4OI1A 3BICA 1EPUA 1NI3A 4LHXA 1JU9A 2AKEA 2WHRA 3TMAA 4FB4A 2VZ8A 4TMXA 4N3NA 4B40A 3GRVA 1T13A 3QFSA 2NWHA 5EFOA 3R74A 1C50A 1YV9A 5EP3A 3PBKA 1OKKD 3DVAA 3P9PA 4TLBA 1Q19A 2WTBA 2XW6A 2ALJA 3A2NA 3G79A 3BF8A 1SUPA 4BFYA 2RGCA 2XXBA 3DYIA 3BGVA 1IEVA 1WXQA 2BBOA 3G5TA 4ZT2A 5IASA 4R68A 2RSLA 2WDZA 2G1AA 2FPIA 4X8LA 2W11A 4F21A 3ORSA 1S2MA 4MGIR 3Q0IA 1T8TA 4MCJA 3SIWA 3VZCA 1F8XA 3ZHTA 3PSAA 3P9RA 5CFPA 5J2UF 3QU4A 2ZM5A 5DYGA 3TLBA 2W6QA 3UXEA 3AWDA 4M9QA 1T9CA 1U2GC 1QP7A 3ICEA 2Q5RA 4YCAA 1YK1A 4JJ4A 1EWVA 1XZJA 3IEUA 1O2DA 4L4YA 3SG0A 2WHQA 3BGSA 3CKKA 4AUNA 4B31A 1IVYA 3EVAA 5ED4A 3WL8A 1QGED 4UNRA 1S1CA 4OB7A 2A94A 1JAXA 5JATA 1L5FA 2C31A 1YR3A 3AF4A 4V02A 5E9JA 4ILKA 2QLTA 4GI2A 5J1TB 5IJ9B 1OREA 3IRUA 4J90A 2Z5GA 3EW7A 2HA5A 3LLUA 1I2BA 2OVFA 5JXIA 1XA3A 4ER7A 1Q0PA 3OE1A 4GXQA 4QTXA 3QKUA 4QQRA 1KO7A 2EW8A 2XI4A 2Z8XA 3FPFA 4N0PA 2OOKA 2P2NA 5E2IA 4AF6A 4WY8A 2HHHB 4PYKA 3EQ7A 3QEOA 5IDWA 1IVNA 5HE9A 5BXQC 4TL7A 1HR0B 2R1VB 3F3SA 4EL0A 5CYFA 2GPNA 1GM5A 4HV4A 1R5NA 1UOPA 4JL5A 4DXDA 4HP8A 3AEKB 4ZAWA 3ONDA 1NWCA 2IXBA 4MZXA 1OJ7A 2QKYA 2WMOB 4IQ4A 2QI9F 1BFKA 4DWJA 3L9XA 4K3VA 4Q4CA 4GM0A 3T5AA 2VH1A 1P2FA 4X44A 5F4ZA 2ZROA 1EKKA 4ZI3A 4KQWA 3Q98A 2A5JA 2JC3A 3U7IA 3ZKAA 3GLGA 1KOFA 1AA9A 3IE2A 1NASA 2E4AA 2NZUG 3KTAB 4BLVA 4IHKA 4OCZA 2WTMA 3C6MA 3JYQA 4N8DA 4NVRA 4CLDA 1H3NA 1Z0IA 1ADJA 1PI3A 3T1TA 3VPHA 2WWHA 1V1MA 1HZJA 5CPBA 5DWVA 4C3ZA 4JD5A 3GX1A 2DB3A 2HWKA 4FOPA 1E0AA 1W9HA 3L49A 2WB2A 1NJSA 1FP6A 1YR6A 5AI9A 4ZKDA 1LIJA 5ITWA 2DUJA 5TXGA 2A5DA 4JJEA 3DA8A 1AMOA 4KBYA 5DXAA 3CF4A 3SC2B 2F90A 3SVLA 3TSCA 2YZKA 3DZKA 2GHTA 1GCGA 1W49A 4UE3S 1VG9B 4XIIA 3EZXA 3SAJA 2XADA 4ZOLA 3PFFA 3T4EA 2XYGA 1RMQA 3O94A 4GP9A 2Q4TA 1JFLA 3C6BA 2PJUA 4HXFB 5AXAA 1J70A 3L1HA 2B7BA 2G5PA 2EKBA 1IG3A 4MEBA 1VFNA 3G0DA 2JF0A 2P2SA 1YB6A 1XRQA 1XB2A 3KYCA 4B7CA 1KPHA 3VH1A 4GOJA 3RPEA 1GFIA 3SQNA 1P5HA 2WYUA 4ZU3A 4G3XA 4LBVA 1OA1A 3D0KA 4TVBA 3QKRB 1AG9A 1E8NA 1RBMA 3PKIA 4I5GA 1DVRA 1PGNA 2FP4B 2G1JA 3ECSA 4NDAA 2XF2A 4F6CA 5KTYA 4CEJB 3FOFC 2CBGA 2G9RA 1JX6A 1Y4SA 2C78A 1TAQA 2YQ5A 3C7TA 3HDTA 4CV3A 2WIKA 3IP5A 1LS6A 1A9PA 4YRDA 1D8AA 2FHPA 4URYR 2GD1O 1JDZA 2P2DA 5IKOA 1KZHA 2AW3A 1RAAA 3HKEB 1PDOA 3LSYA 4NSNA 4R9NA 4S1WA 1HC7A 3SZUA 2G7ZA 4WGFA 2VKQA 2O23A 4JK3A 1F2UB 5ALGA 1FFGA 1U2QA 3M4XA 1L1QA 2P6RA 4GI3A 5BQ3A 1QO0D 1L9XA 5EYPB 1KMNA 1YB1A 1O9BA 2ZYVX 3HKBA 2I99A 3FNEA 1KWKA 1M5RA 3BGDA 1N2ZA 4NV1A 5EI5A 4J29A 1X39A 2PA3A 4X7PA 1F9EA 1L5YA 2YC4C 2JGJA 2JLZA 1XCOA 2WOOA 4DUZB 2GPYA 3L1VA 4EHIA 1IHPA 2Y1GA 1J5XA 1NUPA 3PUKA 3AYXB 3FNIA 3SS9X 3J81k 3JQGA 1KL7A 1M1YE 3ZQ6A 4RZXA 4DIBA 3DDNA 1D1TA 5BN1A 9GPBA 1MOPA 2A14A 3BD7A 1OWPA 4GYYA 2AMLA 3ADOA 3QKTA 1RM3A 4BVKA 4EI2A 4BECA 2IYRA 4B87A 3E4DA 2FYTA 2EF0A 4R6XA 4J7AA 1E9AA 1X8LA 2Q7XA 1S2GA 4RDCA 5D1HA 4AURA 2GBPA 4DIKA 2PN1A 4KLRA 4Q16A 3NRBA 1MX1A 3GY0A 2KBFA 3M1LA 5BRJA 1E62A 2VATA 3VOSA 1QJCA 3EPJA 4PAQA 1OLOA 1U63A 2OCKA 2PO5A 1JHAA 1EE1A 3QXXA 5IVIA 4R2KA 3NTRA 4IGEA 3L84A 2BONA 3QPVA 4QYIA 3TQTA 2V6GA 1CQJB 1P62B 2QVCA 1A2OA 3WHIA 2UZAA 5KU1A 4EB8A 2PYDA 4HNTA 1RAEA 4O1MA 2PLRA 5BUSA 4OYRA 4TZTA 2L69A 1D1PA 1N3IA 2ZUSA 5J5CA 4K1XA 3TN7A 3UJ6A 1TYDE 4DCSA 2R4UA 2A3RA 2E5FA 5T4BA 4QEDA 2EGGA 2AE2A 4L7QA 1F06A 1GU7A 2VDKB 1YRLA 5FA8A 4PFJA 4YP7A 3V7FA 4EY7A 4RA6B 3T61A 1IXRC 2VNIA 3WTBA 1QDLB 3WWDA 2CVPA 4P5DA 1SUSA 2XQKA 3NWEA 2BI7A 1YCHA 4KI0A 1KH2A 2D0OB 2J3IA 1CE8B 2FW7A 4FYJA 2R6ZA 2P77A 3G5UA 3D0OA 3F4LA 1FY2A 3EZ2A 3M3PA 4K6HA 2P7HA 3V8PA 2AM1A 2ZR9A 4GXRA 3UMOA 4HX9A 2BSAA 2WTXA 5EGNA 3R23A 2B9EA 4L8YA 2O0LA 1KU6A 4MAFA 3UK7A 3GD7A 3ZHRA 1XNQB 1YL7A 2IOHA 4HDQB 5BV0A 1MLDA 4NPAA 4XX0A 1MUUA 2R62A 1B8VA 2EDAA 3HWSA 3H7IA 2IGBA 1ZH4A 1PJTA 1HX7A 1DC8A 2AGVA 2PAFA 4J2TA 1O96B 4M0CA 1W93A 1S0UA 1Y33E 1NYRA 2QE6A 2FG6C 4PG4A 2VH5R 2SCUB 3DBRB 4PX3A 3G2JA 5IAJA 4PHGA 3FTFA 3HP4A 4EG4A 2NXEA 5F2NA 4KR6A 2BN4A 3X2FA 5JFTA 3I6BA 2VP4A 3ENZA 2M1ZA 4I1IA 4Y7DA 4G0WA 3ZTWA 4XYGA 5EY7A 1NUAA 2JD1A 4OFBA 1MX3A 2A1UA 5HF8A 4MQEB 3X1MA 4QEZA 1GDHA 2W4IA 1P0IA 2JJ8A 3N8NA 5AQEA 3K4HA 5B4TA 3EDQA 4FBGA 4IJQA 4LDNA 4OY3A 3LKDA 2CNLA 4TMWA 5AK5A 5H70A 4B3DA 4BVAA 3UPTA 3QMMA 3BSYA 1SCUA 1R0RE 1J21A 1SHTX 2FGJA 3DMRA 4O0MA 1TVCA 3ODPA 4BFVA 2IEDA 4GZ5A 4OQLA 4IRMA 2CJYA 5BN3A 3RSOA 1N0IA 3F2VA 4H18A 2ENWA 3LO5A 3PD1A 1MDFA 5LQAA 4C3OB 2XRYA 5BN4B 1LWOA 3NPMA 4CMEC 3MJ4A 2W71A 1GAXA 3FSGA 3CEMA 1XL1A 2YHIA 3WG9A 4V1CB 1DE0A 3WGIA 4V2UA 2FX3A 3DHWC 4NCIA 3LBNA 4E1VA 2L0XA 2YWFA 5HF5A 2AXQA 1C2YA 5EKSA 3TLXA 4ZOAA 5CH5A 1ECFA 4WCFC 2EBUA 3L5KA 4EZEA 3JTEA 3VR6D 3FPHA 3I8OA 4ZOCA 3FSGD 1BCRA 4D5EA 3ABZA 3IALA 4C03A 5JEEA 1VGVA 3HEBA 4L16A 4G1FA 4MPDA 1GA6A 5EPOA 3ZVNA 1PX0A 3STUA 3KEGA 2CE2X 4EELA 1MXFA 1CUVA 3KVRA 1QUFA 2J09A 1GL7A 1YHZA 3PNMA 2YXUA 1NYLA 3LUGA 3TR0A 5DGCA 1TIBA 1EVEA 4HTFB 3E7WA 3L7AA 3ETDA 2XRMA 3IOCA 1RWQA 3CEJA 1XAIA 3S3TA 2YVUA 4EHNA 5L4LA 4M0UA 3Q8KA 3UFXA 1GPLA 1R4NA 4JJGA 4W63A 4DBLC 1LPSA 3PDWA 4H7DA 5L6MB 4JI5B 3LKBA 3GLGE 1ZSNA 5BVGA 3HDQA 2X5NA 1GZ6A 2NSJA 3N2GA 3DFZA 3FR8A 3IVGA 4DJDC 5F2EA 3WWPA 2V58A 2PANA 2FVXA 2FPPB 4DMCA 4X71A 5IN5A 3N2YA 4EAQA 1GNQA 2VRCD 4Q3DA 1H9BA 2I80A 3NDRA 4TSFA 4UOZA 5J4HA 3NVKI 5KMGA 2FRDC 4A6DA 4CVKA 2ZBGA 1Q3HA 1HLDA 1SPXA 4DN6A 2IKSA 5AW4A 5BV2P 4LRTB 5IH7A 3EXFA 4FR2A 3D2CA 5T4EA 4BWVA 2CE7A 4QJBA 4BV3A 1DAPA 2NIPA 2PSHA 4NRDA 1YUMA 5CNJA 1QGUA 1DJMA 1XLUA 5LBTA 2J5XA 4I6EA 4WESB 3UN1A 1HTBA 1VHWA 4RHEA 4P98A 3BULA 4MJXA 2L18A 2Z08A 4XGRA 4ENRA 3CC8A 4HGPA 4MYTA 4XQ9A 4MX8A 1Q0QA 4KRYA 4QXMA 2PKEA 3H9QA 1D2NA 2XECA 4YJ3B 4BLOA 1W44A 2ZOSA 1GA4A 2RGGA 3HLKA 4OXIA 5I6DA 1I6MA 1HNZB 4ZVQA 4HG2A 2CNWA 3O4GA 4BXOA 5CIYA 3GWZA 1YF3A 3AI7A 3EUAA 3JVIA 1T3HA 4R2XA 3ZS7A 3WL6A 1SHJA 1AGRA 1G19A 1LTKA 4P7JA 4OP1A 1RJFA 1DWPA 2Y77A 3CNEA 2H16A 4KUGA 1W85A 4RW0A 2PV0A 1R0SA 2CNWD 3V8EA 5DTMA 3ZVRA 2GK6A 4ZVSA 4LKOA 5CCEA 4FC7A 3GP8A 1YDHA 2COKA 4GNKA 4OHBA 5HZHA 1V1AA 1Z22A 1NDHA 2X9GA 3P1JA 3ANTA 4WECA 2DPXA 3KQLA 1TIPA 3WDMA 1PYGA 2C2WA 2J59A 2GYUA 4MO9A 3R7SA 1SB9A 2C77A 2HJGA 1VKRA 1PNTA 4DLSA 2B4TO 5BY2A 2WWYA 1UDCA 5HEKA 1G17A 3A0RB 4IHJB 3P26A 1P2TA 2C4KA 4GKVA 4PRYA 1KAQA 1KEZA 3UVEA 4Y6GB 5EIHA 1R8QA 2MJLA 2ARKA 2ZEJA 3MD9A 2W58A 1WF6A 2OLEA 3GFBA 2GLUA 5CITA 3BSSA 3VR2A 5EXXA 1ISRA 3IUBA 2AJTA 3RLFA 4IJUA 4LX0A 1JV2B 3K96A 1ORWA 2QRVA 3ZLVA 1XJCA 4C6SA 3WP0A 2O5CA 4HXGA 3THRA 4CM7A 1FVFA 2Z4RA 2HN9A 5K6AC 2BTEA 4MIKA 2VUHB 3VR2D 4J7UA 1ORVA 1F3LA 2A35A 1HLPA 4ERXA 2J6HA 3MLBA 4J16C 1MEJA 4G0YA 4E2ZA 1I7SB 1QRDA 1TT7A 4ASUA 4GC5A 3QBJA 4B2YA 1F0YA 4MITA 4GO1A 1PV1A 2GJ4A 1AK2A 1I5OA 2BFFB 4TZ0A 3EIFA 4DANA 1W1WA 1ZEJA 4Z4IA 1HMPA 3V8MA 5JVDB 5ILQA 1XDWA 4XJSA 5KDLA 3R7AA 1GQRA 4WXHA 3QAIA 2Q4BA 3ROZA 3SBEA 3L7KA 4Y0VA 2N0SA 1N5IA 2WU8A 2ZR0A 2R1TB 1F3OA 3INTA 3R0VA 4QNNA 5FYDA 4ASUD 5I5EA 1L7VC 2M98A 2Q3MA 4JLDA 4RADA 4BASA 3RT9A 3BDAA 3CZMA 3RYFA 4Z3OA 4BVEA 2YUTA 3UAXA 4DGSA 2OAP1 3ZWCA 5DHFA 5JZVA 1RACA 2V7TA 3HA5A 4N7RA 4WVFA 3LDFA 4ZOLF 3ZBTA 5M5BA 2FOIA 4HPWA 1PZEA 3QBEA 1KS9A 4KJXA 4XTRA 1DLIA 4QUDA 3LI2A 2OBNA 2ZSUA 3AKYA 3ZIDA 1A0OA 1YOVB 3RQQA 4ARVA 3IAEA 1TADA 3SYMA 3D8BA 4KE6A 1ZM4A 3ILXA 3IYLW 3MJTA 4US2R 4RHTA 1BGWA 2ZIZA 3C3YA 3CURA 1FP4A 5AW3A 5JU6A 5JY1A 4DA9A 2DSTA 2H54A 1HLFA 4C3UA 1E77A 3M6MD 4K9PA 1OFHA 3W0LB 4NFYA 3W5JA 1VC2A 1K5DA 1Z83A 3E7DA 2NUTB 2WSSA 4X64B 3FY4A 4HAYA 4BFTA 5IUKC 1HURA 1CC1S 4EUFA 2P4QA 3ZW7A 4EA6A 5EIEA 2B92A 2W2QA 5F0ZA 3V33A 4O4JA 1O6FA 1NVBA 2ZJBA 3TL6A 1SEPA 3B60A 3NCAA 2DOKA 2FPGA 3S27A 5CA1A 3ZD9A 2WSSD 3MTEA 4TQGA 4XIFA 3VTZA 4PZLA 1FDUA 1CJKC 2JHFA 3N8HA 2NADA 4G1BA 2P2CA 3SHOA 5B36A 1SMKA 4D9EA 1WMBA 1XQYA 4ND5A 1WVIA 3I34X 1GVNB 3VDMA 2D5BA 1APBA 4EJSC 4ZYVA 4RVSA 4K86A 2O8FA 3NEYA 5HFNA 1P1RA 4FMCF 2PT9A 4CIVA 5A04A 1XRMA 1EFPB 1F0KA 3Q7EA 5DE3A 1WLYA 3I1JA 4MGKR 2F7KA 2EZUA 2IUFA 3R3YA 1S2NA 4AJ1A 2DPYA 2CDRA 5D7BA 4OD0A 4EHFA 3ZWMA 2EEZA 1P2GA 5EPEA 3DBLB 1UC5B 2V0CA 2QTWB 1KGDA 1I9CA 3RBAA 3V34A 1FTYA 4GMXA 3MGKA 2ZYAA 3AVVA 4LC1A 3SE0A 1II8A 2O14A 2Q9BA 2R87A 1CCWA 2AOTA 2GSDA 5EP2A 1QDUA 5FOQA 3RIGA 1SU8A 4C6TB 4RPLA 3SX2A 3RO4A 2ZCVA 2N47A 3KJXA 2XUGA 1AQNA 1H1TA 1V6CA 4TT8A 1AMNA 4E2FA 4Y1RB 1X6VA 3KFVA 2YZGA 1WSDA 4H17A 4OBBA 1E1KA 3PXDA 3S7ZA 1OLSB 1HFJA 4YMVA 1U5BB 4NU0A 3HI4A 4F3YA 5A5DA 1WX1A 3E4CA 5IJXA 2H1WA 2O4UX 2VDQB 3W2TA 4BFSA 1R4AA 2DHEA 3RUAA 3L40A 1DBRA 4LE0A 3TUIC 5HZKA 1NT2A 4TMYA 4ODIA 5GOTA 1Z0SA 5KAMA 1VFPA 2YN2A 1UM9A 1EE9A 3V8RA 3PWTA 2DFKB 3CNQS 3CSDA 3ORYA 4MRMA 5CVDA 4JI6B 1WHSB 3TLGB 4CM8B 3OG9A 4H0FA 4IQFA 3TTTA 2Z57A 2V5AA 3ZU5A 3ZCTA 3Q3GE 3JR7A 4RJ2A 4AL4A 2J0SA 4AMZA 1EZ4A 1T3GA 3GZJA 1T9GS 1HSZA 1QV6A 5EMKA 4JROA 5SV2A 4ALMA 4UZEA 1XK7A 1TF2A 4FWBA 3C3PA 1CEEA 1BU5A 1D2CA 1OFGA 1JHXA 2I6UA 4G01B 2RHBA 2A7XA 3CKYA 3KZCA 3LHKA 3BMCB 3RHTA 3ZDZB 1VJRA 1EM8A 3JQ7A 2WHPB 4G9EA 4NENA 5KYUB 3C43A 2NG1A 2XDAA 5AKXA 4C30A 4CXMA 4NMXB 1EYZA 1HDOA 3BSFA 5BSGA 1QX3A 1XNJA 1Y3AA 2AC7A 2H4WA 3QV1A 2R8EA 4YJGA 2VZEA 3QENA 3KQTA 3RKRA 3V4SA 4EG3A 1Z45A 4U02A 2VP6A 2HV8A 4KN5A 2X5OA 3LOUA 3QZUA 4H6XA 2YV4A 3PC6A 1HEIA 4ZAFA 1RSZA 2EFCB 2FSGA 3UMYA 1T1SA 5AXCA 5K3FB 2IDMA 1U04A 4HYEA 1E4EB 5K7SA 3BMNB 3WWCA 4ESOA 4ERNA 3IV7A 4EBUA 1W8IA 2W2TA 3ZVKA 5F1PA 1X77A 1UJ4A 3JAWA 3PDIB 1CUYA 1QKIA 1UF9A 2AWOA 2Q9UA 5SZIA 5LKAA 4ER0A 2ZRKA 3TM5A 2IA5A 3FKSA 1QPBA 1ZD5A 1LRLA 3LQ1A 4FEGA 3FDXA 3IIKA 3MA0A 1H6BA 4IWXA 4LZJA 4BEWA 5BNTA 1F5SA 4P2GA 3X43A 1A9RA 1QO7A 2ZJFA 3OIDA 2ISQA 1WZCA 3NOQA 2GAAA 5DI3A 1F4VA 2OBXA 1P9NA 1R8SA 4EM6A 4CM6A 4Z54A 1QVWA 3HGTA 3HJFA 5CDSA 3FKSD 3PGVA 4H7KA 2JGKA 3ROGA 4Q3AA 3QLVA 1UXIA 2GD0A 2C4HA 1OROA 4JJ8A 5EJFA 4C87A 1B4DA 1NUTA 1MPTA 2QMOA 1KDZA 2XVMA 1FP2A 3M0EA 2EBWA 4AP5A 3CGWA 2CT8A 3ZCSA 4RC9A 4DRXB 3IQZA 4HLUC 2V78A 1QAQA 4MB0A 5K3CA 5EXEA 4DT1A 3NTVA 1DPFA 4LBGA 1KP9A 3BG5A 4D2IA 5H3LA 4Y7CA 3FYSA 4BRUA 2ACKA 3VV2A 4Z7JA 2BFMA 5AHWA 3W3ZB 3LOQA 3H9JA 3TZHA 4BO0A 3CRRA 5NULA 3ILSA 4MKGA 3OZRA 4QU8A 3VISA 3B1FA 2ZGVA 4O4IB 5M3BA 2Y4NA 3IP7A 1KC3A 1NUUA 1YRYE 3OJOA 4N5IX 1GPBA 3QBDA 4OOFA 3PC3A 4MP3A 1Q14A 1U28C 3ZUPA 4UUMA 2IDJA 4NMLA 3MMPA 2V59A 1VYVA 3NM6B 3BKWA 5DN6A 5F7OA 2FB9A 3VO9A 3NDJA 2F8MA 2R6FA 4QGBA 1TLFA 2IYXA 2WZBA 3T7RA 1C9EA 4GOXA 3DE1X 1WEKA 5F51A 2Q07A 2REQA 5BNWA 1AK9A 2QX4A 1J2EA 1SPBS 1T15A 2EARA 5DN6D 1UBTS 4RAQA 4BMCA 3KYDA 4JJZA 2QD3A 1TXGA 3CVOA 1M0SA 4D8YA 4DCJA 3AR7A 1A9XA 4Z3DA 3LHFA 1MOSA 1VB5A 4V1CI 1ZUIA 3LMKA 5E9AA 2JFYA 4OTZA 2NX2A 3FYUC 5JXGA 1SIBE 1XEWX 1PJSA 1VKHA 2YXTA 3HO8A 5SYMA 4IQ0A 4TQAA 4X1IB 2IDZA 3DTVA 4JKYA 4LGMA 1QU2A 3LLCA 4NCAA 2OB2A 3SZLA 3D8SA 2O7RA 3AH8A 3PA8A 4MGHA 5LU8A 1IY8A 1BX3A 3BIJA 4HDKB 2Y3IA 4E88A 5LUBA 1P6QA 3PX2A 4J7CA 4O63O 3MN1A 5A0TA 4BGVA 1NVKA 1ULSA 1GR0A 3DTVD 4S2EA 3WYEA 4TMTA 4BJ6A 2QRUA 4F3RA 1ODCA 3PQ7A 4OFXA 3JWPA 1V47A 3HCEA 3HHEA 2G4VA 4TWBA 5JH7A 3GO7A 2IYNA 2WHYA 3WWZA 4TTIA 3OEHA 4HDMB 3MILA 3R6DA 4KQMA 5MN5A 3QF4A 1GKLA 1C8VB 2CHVA 3RODA 4KI7A 1EDEA 3V48A 4B4VA 4D3ZA 5AVTA 5GINE 1T5BA 2JDIA 4HYQA 4BVJA 2QDKA 4P3OA 1J1IA 2CXUA 5JYBA 2C4VA 4JODA 3S28A 4BQFA 3OEHD 3DHNA 1SU6A 1M2JA 4HWKA 1L1RA 3DMNA 3Q5EA 3FPKA 1VG1A 3OIGA 3T5MA 3ZY4A 7YASA 3PCXA 1OAOA 4YMUA 1P1CA 2JDID 2PUCA 3KQWA 5FQOA 1AS2A 5SZHB 2V1UA 1T3SA 3PGXA 1L4UA 1Z4MA 4LHSA 1HUQA 4GLBA 1UOEA 3PR1A 1HDGO 2I6GA 3RD5A 3BE6A 1NTOA 3NIDB 1TCUA 2FOXA 3VSCA 4BB5A 3TG8A 4PSVA 5A4AA 4BLQA 3L1JA 1K7FB 2J87A 3K15A 4IMJB 3TLZA 2O5VA 1CYEA 3DZCA 1JG1A 2XT9A 3H05A 3LVRE 4X1YA 5A2QA 4C3VA 3L8GA 4Y2UA 4EKDA 3ZDBA 3F5FA 4F4IA 1L2TA 2H92A 2MU1A 2XMCA 3OOHA 2PX5A 4GPTA 1Z0AA 3KHSA 1EFLA 5LLTA 4B73A 1XVIA 5JS6A 4QSHA 1DWUA 4MQBA 1Y7HA 1GCOA 4HDNB 3D4BA 1NDQA 4D8UA 3BBLA 3NVDA 5AJTA 1CG6A 1DBIA 1UMBA 3B5EA 4FR5A 4YMIA 2LWIA 3FI0A 2PSDA 1BYUA 3M9LA 1RBQA 4HOYA 2DYKA 3FLEA 1TTPB 5BPFA 4B48A 2C95A 2FE4A 4X92A 5AW9A 1E5QA 2QYHA 4D8XA 2JLQA 2V5VA 2VPWA 4EBFA 2EZ9A 5BUCA 2OGSA 4AM8A 4X7BA 4EK9A 1ESCA 4PXAA 2PWAA 1JLKA 1MG5A 1DINA 1ULUA 5LYJA 5LJLA 4S1TA 2WQ6A 3ESAA 3ZV6A 3BAZA 3S81A 1G38A 2ODAA 4L6CA 2DUWA 5KSWB 5ITSA 3P2KA 2EIXA 3I37X 4HN2A 4H35A 1PWYE 1RHMA 2ACEA 2D7DA 5HM8A 2X58A 1IJFA 2WABA 4B35A 3FTNA 1GCUA 4I7EA 5ICCA 2BIFA 3VPGA 4QICA 3H3FA 3I1IA 3KWMA 2NVUA 3LWBA 4V0ME 3Q11A 4IL5A 3EMDA 4O4JF 4RKYA 4W9RA 1UBRS 2IUYA 2Z1DA 5LPNA 3UAWA 2NLOA 1U3CA 1H6AA 1DCKA 1PJRA 4ZMRA 3G0IA 4ZD6A 1KH1A 1FU8A 3VA7A 1YL5A 4INZA 1XELA 4CM3A 2IU0A 2M2IA 3CH6A 2YVKA 3I30X 5JDIA 4Q82A 3UC5A 4RANA 1QIIA 3JD0A 3N9IA 4KXYA 1EK2A 1RC0A 1Y9JA 3N5CA 4L72A 2GCEA 1QE3A 1R2QA 2A5FA 4FD3A 2F3SA 1XKXA 1DRJA 3OI7A 4BO2A 3OCYA 2C00A 3LDGA 4G4SP 3EGCA 1AB5A 2R11A 2F1KA 3VAZA 4GUAA 3W8RA 1D03A 3KOZA 4G97A 4XJTA 1ATZA 2Z8YA 1TD9A 3V7UA 1M2OB 3EF1A 1G5FA 5BORA 3DRWA 2C98A 4K6KA 2O2HA 5AM3A 5LIRA 3JQCA 2X7HA 3OKPA 4FXPA 3RIMA 4EJ0A 4JJIA 5A71A 3OT1A 2VHEA 1UIRA 1VRCA 5EE3A 1WXWA 1L7QA 1F4PA 1YR7A 2YHAA 4KWEA 5K5EA 1XP5A 4W7HA 5ADUS 1T5SA 2AT1A 1W1IA 2WIFA 3KSBC 3LFHA 1U9IA 1LA2A 3RE1A 3LCUA 4EX6A 5E6SB 3V4VB 1A9SA 2MSCB 2NP6A 2QHPA 3ZXUB 2A92A 3EFOA 3R6WA 1UJBA 2HNKA 3CLKA 3OPVA 2AFIB 4R2JA 1RKVA 5JPIA 5JUWA 4J7XA 4IV8A 2B82A 1AMUA 1R6DA 2F4VB 4Q1FA 1E79A 1SIOA 3CZ4A 3F5QA 3TZLA 1ZEMA 1M1NA 5E3IA 4C5BA 1AOXA 2YRXA 2VPZA 3TW4A 1C14A 4AO7A 5I7EA 1TUGA 4QDKA 1U7UA 5JW6A 4KPUB 4ZWNA 1U0HC 1QIJA 2R9VA 3U3XA 1QFSA 5LMUB 3CLHA 4WOJA 2XMSA 4Q7QA 3V1TC 1XOIA 3D4LA 4ZVLA 1XXHA 1OXSC 1VKJA 1CZNA 2V7QA 3DE3X 3EIUA 1E79D 4LDAA 1YDEA 3DGFC 3QYPA 3KQMA 1G5IA 2GPSA 5I51A 1YUNA 1EUCA 3IRVA 2CMGA 4B79A 5ALTA 1KQPA 3WKDA 5KNBA 4LBZA 2CXSA 2OO5C 2YJZA 3KEUA 3L4JA 2F3TA 3F0TA 5ITZA 3L2OB 3DOCA 2IV3A 2ENUA 3EWNA 2R7KA 4XGQA 2IH4A 2V7QD 2NM0A 4BP8A 4ENPA 4YUXA 1RI2A 3KSZO 3LM8A 2J6BA 2WF5A 2VYCA 1OU4A 3B3JA 2O19A 2NPOA 4MWTA 1NQWA 3D0RA 2VJNA 4M53A 1RWXA 3HL0A 3BAFA 3QBTA 1U5CA 3VR1A 4E4RA 3A26A 3ED5A 5KNBD 1YZNA 4X45A 1CJSA 3A9TA 3SDSA 1NXXA 4GL2A 4AXXA 3TB6A 2DH5A 3QEBZ 5TPWA 4B3RB 2CBXA 2OHHA 2HADA 1LI7A 3NKFA 4MYDA 1USUA 1MA0A 4CRWB 1UM8A 3D3QA 3MIZA 3MS4A 3IE0A 3PPVA 3PQ8A 4QRHA 5FNVB 4J9VA 4F12A 4J0DA 3K1JA 1R0WA 4GM4A 5C1OA 3ZBPA 5CFNA 1TM1E 5LZ8A 2WKSA 4PGAA 1RAIA 2ZRJA 5LB4A 5FL3A 1MFZA 1OGJA 2IYSA 3E9EA 4PC2A 2B8EA 3ONEA 4Y6LA 2IP1A 4A91A 4E7PA 2GA9A 4WKCA 5EN4A 5I3ZA 4BLUA 1L8XA 1Z39A 4ADSG 4UDYX 1JFSA 4TVOA 4JLBA 1JBWA 2JAOA 2FOLA 3W5AA 3CZQA 3U7QB 3OZAA 1WDMA 3CBQA 2FA9A 3MCAA 3L77A 2JZOA 1BVYF 5TF0A 1X3LA 4WLEA 2Y92A 3MBHA 3WRYA 1W94A 3BMQA 5AM1A 5IG2A 4MQLA 2NSYA 2BGWA 4EZIA 4WKNA 1QH1B 5EAIA 4HAZA 5CVCA 3KQYA 2UUAB 1NUQA 3B38A 4ZP1A 4OIFA 4UAUA 1GPAA 1FVXA 2WAAA 1D0VA 1EJ2A 2XEDA 1T0PA 2ZRIA 3H4MA 3MRXA 1YZGA 2KLHA 4W8HA 3SBXA 1R9MA 2Y0BA 4CDGA 1K27A 5I5GA 3ONNA 3UOGA 4HY3A 1H65A 4OU5A 1V7CA 4UNIA 3HZZA 4EGCB 4G5OA 3TRFA 5KQLA 3A70A 4UTPA 3R9WA 4UU0A 1OBOA 2X6RA 4ZCMA 5TB5A 2HAEA 5DIFA 3RIYA 1O9HA 3WGNA 1EGQA 2F7SA 3SEQA 4QJ3A 4XIGS 3NBVA 4IKEA 1WXHA 3RFUA 2J9FA 3CT6A 3LL4A 5J23A 5LFAA 1YGJA 4BO4A 1RRKA 5A0FA 1M0EA 4NBNA 3FJ1A 3IILA 3I3OA 2HIMA 3CWCA 3I76A 2I65A 5BWNA 3EVFA 5JNTA 1SRQA 3E8SA 2IXDA 2XE4A 4JR0A 2DUUA 3AB8A 5JYDA 1RLOA 1ZW6A 5FPTA 2DXIA 1CWUA 2RBEA 4WXRA 5C3YA 3H1BA 1NATA 3CUYA 2WWWA 3GFFA 3FPSA 3CF6R 4FLFA 1YQEA 1DTWB 1J9ZA 4AMGA 2JLUA 1A2BA 5LA6A 1JEOA 3IPAA 3NAGA 3MTBA 3LWZA 3Q3HA 3VC1A 1IRXA 5BW5A 3RV4A 4URXR 4HH0A 2BDUA 4QOHA 4XR4A 3C97A 4RH0A 4YFYA 3UA4A 5GZ3A 1PDWA 3GCXA 3LU1A 3NC4A 1DOHA 4EPTA 1LW6E 3BZWA 1L2LA 4FFRA 3PHCA 4BMVA 2WNHA 1KJJA 1KMQA 1P5RA 2ZUFA 2VJYA 5LWQA 3PFKA 4OREX 4BLTA 4EVQA 1JEYB 1L5OA 3L4BA 3QSYA 3SZRA 1IPEA 4MI3A 1NVXQ 4BNMA 3ND9A 4PLFA 3SYRA 1Q0TA 1JKMA 2IUEA 3FMPB 4ZRMA 3LUKA 3BILA 3FCSB 1NW7A 5GIOE 3RS4A 1EVZA 3R7LA 1P9LA 4FYVA 5TGDA 4OGGA 3ABQB 3K70B 2HSGA 1P0QA 1SWWA 1SXJE 4QATA 4R1QA 3SD7A 4UHBA 2OHFA 3IAM1 4TQ9A 3I9OA 2I34A 1VCIA 3N75A 3GO6A 2R48A 3FNFA 2CJPA 2JFUA 1PS9A 2EV9A 2XVXA 2H1VA 4YIHA 2Q6IA 3WS7A 2FLWA 3I5UA 1LVHA 1JHPA 3I2FA 1GSAA 3OPYB 4FI3F 4HUQA 4UTOA 5CR9A 4AD8A 5JH7F 2C5LA 1UWVA 5E4JA 3UICA 3NCHA 2V98A 2OBLA 4IIUA 1BVRA 1EFTA 2EEPA 3H1GA 5JC8A 2JFVA 2QVYX 1HDCA 4MYUA 5DXJA 2JAPA 5T5QA 5JBQA 2AW5A 6CHYA 3G1UA 4NNOA 2AM2A 4FYMA 2KPOA 4WI1A 2H07A 4OXYA 1XD2A 4N6NA 4U2CA 2HFJA 5KOJB 1MNQA 1QF9A 4UEJA 4F45A 2KJQA 3A6JA 4PLVA 4PXYA 2VJLA 4M0EA 1Z4QA 1A2KC 1JA1A 3C3XA 4HPXB 2QL7A 4PV7A 3N59A 3WV5A 2Q29A 2Q1YA 4WLNA 5JE8A 3PXGA 2BZ0A 2BFBB 4J0CA 5E0OA 3GLIE 4JR1A 2XCSB 3LUFA 2C7OA 4PYQA 4HO1X 1EXWA 1JTEA 1L5WA 3W6PA 4D3FA 4OJKA 2DWPA 2JI4A 4PAOA 4BJHB 2BI4A 3H8JA 2OAEA 3RSLA 3SR0A 4I55F 2BP7B 3AR6A 4WNIA 2IYYA 5AM5A 3T95A 3RUHA 1DC5A 3LQKA 2V45A 1FYVA 4Q05A 1XMPA 1TPZA 1IHDA 3HM9A 2HXGA 3QA2A 4AS2A 4BKMA 2QZ9A 4HKTA 5REQA 4E8YA 2I8AA 1G3QA 1SQGA 3KOOA 3TLAA 1SQSA 4KGVA 4CMIA 1YZUA 4GE0A 1VECA 5K3DA 4KITB 4BUZA 1SUCA 5FH9A 3FHTA 4YRRA 3RSQA 4MW6A 2ZLBA 2D6FA 2VBGA 3EIWA 5EFZA 4UM9B 3QWFA 2RGRA 3Q85A 1Y1PA 5CB4F 1TNDA 3PNKA 1MC4A 1KEKA 4F11A 2JEYA 5JQGB 4B0OA 3CFYA 2C4UA 3Q6NA 1A5TA 4X6UA 1GTZA 1NSYA 2FR0A 5LQJA 5BVHA 1TAUA 2RKWA 4J0KA 1ECBA 4MRAA 5DW3A 1FMCA 2E2WA 1F0PA 4ZAYA 3DD1A 1NNUA 2IS1A 3ZHYA 2QR5A 4YCMA 3SOZA 3BPSA 4ZJZA 2V5UA 3ME5A 5JTUA 5F76A 2BMJA 5KX5F 2NW6A 1TZ3A 1N5LA 1QZTA 1XN4A 2JJYA 2VBIA 4NI5A 3H5OA 3JPWA 3KX2A 4Y9DA 1JWBB 4IOKA 1NJ5A 1E3SA 1VE3A 4MWGA 1BGXT 4FVTA 3I04A 2Z43A 1QX4A 3NYIA 3BN3A 3W9BA 3NH6A 5F64A 4EB3A 2HU2A 1P73A 3GGPA 1NVAA 1SXHA 2O8DB 2CFSA 4MR7B 5H4GA 3HRHA 3U81A 3NETA 4H7EA 3C3AA 3K9EA 1LUAA 4WNYA 4DGQA 1GQSA 4QXPA 3MYRA 3ZOZA 1TTTA 3D1VA 3UW1A 1SKYE 4B6PA 4B6OA 5FRDA 3ZLJA 1DX4A 3GXOA 2QS9A 1L7BA 3LXRA 1MZVA 2J6IA 2WFMA 3DE2X 3IUSA 4TLMB 4C7OA 2H5JA 1TF7A 1RRMA 1WCXA 3IH5A 1IOVA 5JAMA 2JJ1A 3L8FA 4CR6A 2I54A 3GT4A 3NH9A 1RFTA 4QHTA 3S1AB 1I8TA 5K03A 1V8BA 3L8ZA 4OG2A 3MFYA 2MSKA 2RGUA 3OKCA 4QSMA 1T26A 4EPWA 2Q3EA 2BSQA 5DGDA 4YJ2A 2DPHA 2JASA 2BKLA 2DR3A 2PG3A 3D5QA 3NORA 4G5YA 4RIGA 3T3EA 4ME6A 3CZ9A 1E9VA 4EG7A 5FBQB 5T3YA 4BNXA 7MDHA 4BQOA 3IB6A 4FZRA 4P82A 3SYLA 4GOOD 4BX2A 2FJUA 2DDOA 2HWWA 2J33A 3GJ4A 5EMMA 3Q7PA 1U2XA 3N0XA 5U4XA 1YC2A 5KSPA 1F6DA 1KP3A 4MW5A 3BF5A 4R01A 3OCVA 4BZZA 1ZJ6A 2LKDA 3DMDA 2E18A 2EQ5A 1YRBA 1XZMA 2GD6A 2O0MA 1Y9ZA 4O1HA 4OH7A 5I9SA 3TFOA 1EBUA 4ZCTA 1XEAA 2EZ8A 4UUAA 3V6MA 1G8KA 3RTAA 1Y5NA 4XPIB 3MPOA 2E9SA 2QEQA 3NNDA 3T94A 4PLCA 3F6BX 3AR9