3RTCA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nad and atp.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
489
structure length
489
Chain Sequence
b'MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 185
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtcA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtcA02
3K9EA 1UB0A 4K8CA 3RM5A 1L2LA 4EBUA 4O1GA 3RT7A 3BGKA 4K8TA 3HICA 4S1IA 5C40A 3RTAA 3NBWA 5BYCA 3W4SA 3RU3A 4GM6A 1YGJA 3UQDA 2AFBA 4KANA 3RREA 3K5WA 4K9CA 3I3YA 3UMOA 3NBVA 1V1AA 4K93A 3RO4A 3HPDA 5B6AA 4C5LA 2R3EA 3NCAA 1RFTA 1ESQA 4K8KA 3UQ9A 3MBJA 3RQXA 2JG5A 3KEUA 3NM1A 4LBXA 2C4EA 2AJPA 3RTGA 4YL5A 4C5JA 3D3KA 2O8NA 3Q92A 4JKSA 5C3YA 3RSGA 2HQQA 3RNOA 3RSQA 1JZTA 3RU2A 3PZSA 4S1MA 3JULA 3LKIA 2PKNA 4B8RA 2A9YA 5EYNA 4S1IB 2F02A 4S1HA 5BYEA 5BYDA 3RTEA 2ABQA 2DDMA 3ROXA 3KD6A 4K9IA 1LHPA 4U7XA 3NL5A 3VAQA 4E3AA 2R3BA 1EKQA 2AA0A 4UBEA 3RQ2A 3QA2A 2AJRA 2JG1A 2Q5RA 3CQDA 2F7KA 1TYYA 2NWHA 3N1CA 1WYEA 3DRWA 2DDWA 5C3ZA 5F11A 1LIKA 5BYFA 4JKUA 3MBHA 3RRFA 2XTBA 3RPHA 1C3QA 1U2XA 3UMPA 3VASA 2ABSA 1RKSA 1EKKA 2VARA 3IE7A 5CM5A 1RKAA 1RFUA 5COJA 4E69A 3NC2A 4C5MA 1RKDA 3UBOA 3RS9A 4C5KA 2C49A 3B1OA 1VM7A 4C5NA 3RSFA 3FHYA 3HYOA 5TRWA 3H49A 2DCNA 3FHXA 3B1PA 4XF6A 3B1NA 3IH0A 4XCKA 1JXHA 2I6AA 3IKHA 3RSSA 3LOOA 1RFVA 1TD2A 4N08A 3ROGA 4EUMA 2QHPA 3DZVA 3IQ0A 1YGKA 2PKFA 4E8WA 3NL3A 3BF5A 4LCAA 2AWDA 3RTBA 3RRBA 1TZ6A 2RBCA 4YWRA 1V1SA 3H74A 3GO7A 4DC3A 3NL2A 1KYHA 1LIOA 2I5BA 3PL2A 3B3LA 5C41A 4X8FA 4B8SA 4KAHA 4E8YA 3EWMA 2V78A 2PKKA 3RO7A 3GO6A 3B1QA 4KADA 4N09A 4XDAA 4DU5A 3KZHA 3RS8A 3RY7A 3LHXA 3NC9A 4XF7A 2DG2A 1UA4A 1YHJA 1LIJA 2AX3A 3ROEA 3RQ6A 5CGEA 4KALA 3IN1A 4JJPA 5CGAA 5F0ZA 3LJSA 3ZS7A 3OTXA 3NM3A 4LC4A 3RQ8A 1GQTA 3UQ6A 3Q1YA 2QCVA 4E84A 2HW1A 2JGVA 1LIIA 1TZ3A 1VK4A 4EN4A 1DGMA 1GC5A 4EOHA 2FV7A 3RPZA 2PKMA 3IBQA 2I6BA 4LBGA 3D3JA 3QAIA 5EY7A 3KTNA 3RQHA 2YXTA 2AB8A 1V1BA 2DDOA 2A9ZA 3RQ5A 4WJMA 3RQQA 4E8ZA 2YXUA 4KBEA 1VI9A 4O1LA 1RK2A 1V19A 1JXIA 3RT9A 3NL6A 3B1RA 1LHRA 1ESJA 4K8PA 3RRJA 3RTDA 3GBUA 5TQIA 1BX4A 2HLZA 3RTCA 3ROZA 3UQEA 4PVVA
chains in the Genus database with same CATH superfamily
2A78A 2FXVA 3RGGA 1UB0A 4OCZA 3ZS8A 3HCNA 1DOAA 2VF8A 4HFMA 4OP1A 2NG1A 4RLQA 4UNNA 4XQ0A 1RYEA 4N7BA 4R1MA 5AKZA 1KOJA 2CHFA 5EKTA 5LP6B 4JH0A 3LTNC 3HKCA 2ES4A 3I9JA 3WNQA 1VRWA 4C07A 2OBLA 3KV3O 2DUJA 4JDUA 3NBZC 4MGZR 4B71A 4KNVA 3HGMA 5KIAA 5IM4A 3QXJA 1V37A 5B3LA 1H2BA 3MIZA 1AQIA 1G7SA 3TYXA 3R0VA 1M66A 1T6XA 3DVRX 4IIEA 4GMDA 4ND8B 3IUPA 2Q4BA 4FBGA 4DE5A 1H9AA 3OCWA 1WMAA 5CP8A 2QMUA 2HMSA 1T4CB 1I1HA 1ZRMA 3O8QB 2OHXA 3DEFA 3GUUA 1UZUA 2C1XA 1XZQA 2PRJA 2ZUCA 3U0VA 2EW8A 1J8FA 3KEQA 3U3DA 3GRAA 1T29A 4AY4A 1YVPA 4C6TB 1PGPA 2CNBA 2IFTA 3K72B 2P9HA 3PIDA 4MWGA 3GJQA 5AJWA 1GEEA 2WJVA 4X1IA 4F5WA 3NL5A 5FLXA 1TQ8A 1A97A 4ZOCA 1CR1A 1J8VA 1HETA 5EPEA 3F96A 3B2EA 3I0ZA 2ZIGA 2DWOA 4Y2SA 4AD8A 4BWVA 3UAXA 1R0XA 1FLAA 1QAMA 4KPUA 1LQTA 2GOYA 2EFEB 4MNTA 3UV3A 4ZMSA 5KX5A 2I7XA 4CF6A 1E18A 4YECA 3NNSA 5CITA 3PUHA 4UATA 1OROA 5A03A 5GINE 3OQ1A 4HAIA 4Z86A 5DM60 1A95A 4KV9A 1MB3A 1O03A 1ZM7A 3NHFA 4G8JA 4DR6B 1CYDA 1U9JA 2FG7C 1V3VA 3KXPA 1TGVA 3MCZA 2FX5A 4HVTA 3WQHA 4GKJB 1E8CA 3UKDA 1XXLA 1P5HA 1VM7A 2IPNA 3IVXA 5A9SA 3BCUA 4ZDJA 1TXGA 3TBHA 2I6FA 1KDRA 1DIOB 3ABRB 3RSSA 1S1CA 2P3OA 3PI6A 1D0IA 4FIDA 4LZOA 3TWOA 1XF1A 5B6PA 3GPLA 4LYHA 4UMVA 4PGGA 5DBIA 5KWEA 1Z5GA 2POQX 2WD9A 4WOJA 4B6GA 4DM3A 4UOEA 1VDMA 1T34A 3EZ2A 1ZGAA 5HX7A 2Y1CA 4HLQB 3AY3A 1ZESA 3WAKA 2RGCA 2C2GA 3HLTA 1HT1E 3JV7A 4C4RA 2X6QA 2HX1A 1YR1A 2DQZA 2PX4A 3Q7SA 3LQ1A 4TXMA 3ZWYA 5LA6B 2EEPA 4R2MA 1UBTS 3LPAA 1M34A 3RANA 2IF2A 5EJAA 1E3WB 1Q2XA 3D3EA 3DZHA 4RX1A 1M0WA 1COWD 4EP1A 2RD2A 2GEBA 2RBGA 3SF8A 3VISA 1C14A 1QHSA 1U3UA 2BHRA 3DC2A 3NAGA 4WK6A 4X63A 3FRJA 3LX4A 4II2A 1O0CA 1K5GA 5CCDA 1UOPA 3UXHA 3U9SA 1RRFA 3UA4A 3A05A 1JEEA 1O95C 2Z56A 3CH4B 2IHBA 3TQHA 1I4TD 2ODPA 1EJBA 1QJCA 4X1KA 1CLEA 3Q5EA 2OAGA 4WXHA 1U99A 2A0UA 2ZE7A 1GZ6A 1ZXBA 4HLCA 3I6IA 2W6ID 4QFCA 5CT8A 3FLEA 5LQJA 4C03A 2Z4RA 2A30A 5EIOA 4WX2B 2BC9A 5CLGA 1U8XX 4Y6LA 2ZJ6A 1LI4A 1U3VA 2CC2A 2J6CA 4CDGA 5IRCD 4P2BA 4AG5A 5IU6A 4MHTA 5T5QA 2P6RA 4PR0A 4L5BA 4PBSA 1QZ3A 4JKIA 1FFSA 3T3NA 4WKBA 2D1FA 1GYPA 5ALVA 1QS0B 2XMSA 2P35A 3IUYA 4IDPA 3TR6A 1DMRA 4CGZA 1XEXA 4DNFA 4RFSB 1L8QA 4QELA 2DECA 2K5UA 3QJGA 5DASA 2QA5A 2CZGA 4WLUA 5I45A 3G0DA 4XM1A 1XMIA 4NU8X 3DYBA 3FJ1A 1MO3A 2C94A 3IURA 4TTVA 1U2GA 1LPNA 4NY1A 5E2AA 2BEJA 4JLNA 3P27A 3I01M 3WYEA 3GPIA 2H54A 3MAGA 1IJKA 2XADA 2OPBA 2JC3A 2X4DA 5AOBA 4AQ7A 3AJAA 4IDGA 5DP1A 5KOIA 3PQ5A 1YR7A 2RAVA 3QMWA 4CDRA 4DCVA 1WKCA 3EMBA 5FHQA 4R0NA 4RV5A 5KI6A 1RDFA 2WC1A 3GLVA 5GM2A 3ZD9A 3ZWCA 3MAJA 3FMVA 3LX5A 3SBOA 4TLBA 1QGYA 4P7GA 3RWOA 5DM70 2GETA 4NCXA 1MRZA 5J4LA 5LYJB 4C5BA 4KR7A 4NV1A 4QARA 1CU1A 2QWXA 4O33A 3RH0A 3KTAB 4CWAA 1XPUA 2FUEA 2V6JA 2BHLA 4K8OA 5AMXA 4UNSA 3CX4A 5TRWA 4CDNA 4Q9JA 1CP2A 4HPXB 1H9BA 1AUPA 5FLKA 4GE3A 2YZKA 2FHSA 4B87A 4WV3A 3ELWA 4D3YA 4GKAA 5JNSA 1RPZA 1QLJA 2XWPA 3BT7A 2AG1A 1H65A 1OGYA 1T5IA 3I30X 4RD0A 4YRKA 2C88A 1CUIA 2MINB 2EZUA 3B70A 1K2WA 2HJSA 1GA6A 4NEHB 2MR5A 4UEOA 3I8XA 4P4UA 4DM4A 4B3JA 3HACA 5FYDA 2V8BA 4PLZA 4UNPA 1A4UA 4OXIA 5F7XA 4YT4A 3T9AA 1P77A 2R1VA 4HHEA 4YP0A 3TJRA 2IHVA 1C3OA 2XA9A 3CNQS 3LKBA 3LYUA 1WDWB 2QTNA 3DSRA 1D04A 3KU1A 3U80A 2Y4NA 3EFOA 5G1NA 2ZQZA 4ENWA 2ROQA 3FBGA 2C03A 4OMDA 1PZXA 2CXSA 1QCDA 3EGOA 4C0LA 1MHTA 1JEQB 5AW3A 2PKYX 1D8AA 3H6HA 4Y6RA 1YRBA 3MOSA 4N7RA 5D5QA 5FUWA 3PQ2A 4YX9A 5C1OA 2RGXA 3HJTA 4O4IF 5JPCA 5KC8A 5BV2P 4L85A 3RM3A 4A73A 4IQ8A 3PUZA 1IPHA 3GFPA 3KPVA 2CF6A 1AU9A 2H2IA 2EFHB 4GI3A 4I1RA 1CR4A 2IYLD 1V47A 3W5BA 3QG1A 4LCEA 2HSJA 2J67A 3ROPA 3TEJA 4KX3A 1NT2A 2A8YA 2O0KA 3FAKA 2PAFA 3Q2IA 2ECFA 3BGWA 4WKGA 1F2UA 3KT0A 4HN4B 4NK4A 4LAFA 2GHQA 1CD5A 4KRGA 1KMIY 4RXMA 3DV0A 5AVQA 4G9BA 5T8KC 3GJ7A 3W8NA 4EB6B 5M04A 1J06A 3L6EA 1S9DA 3HICA 4IIXA 1P1HA 1KY3A 1Z2DA 3KXKA 3ED5A 1KP9A 2VOJA 4GM6A 5D6OA 3GJ4A 5GJCA 3GQBB 1R50A 1V4NA 3MWYW 1YDHA 4P4LA 3U3XA 1ZMTA 4G25A 3F6RA 1MRSA 1NOKA 3T3EA 4C5LA 1W4CA 1X7YB 4J0QA 3SS8A 3LZDA 4MB2A 3L77A 3O8NA 5DLDA 5KHLB 3COVA 3D43A 5H9WA 5HSGA 2QTTA 3JZDA 2EZTA 3KVYA 4JJ6A 1G5HA 5LDGA 5BWBA 1EIWA 5B3JC 1EP1B 3MM4A 1RI4A 1XLTA 3SVLA 2BELA 4OQEA 2B4YA 2JCSA 1YTLA 1Q15A 4QVGA 2IS2A 1VKZA 5EQDA 1FXWF 4QBKA 1FIUA 2H06A 4GXQA 2JH8A 2Z2ZA 4HO1X 4OYLA 2UV8A 1V7CA 2ZRBA 1SUDA 2CNWA 3CLRC 3JQ8A 1XJ0A 1BHSA 3JW8A 1IN6A 4X66B 2AS0A 1L8XA 3TLYA 3V8VA 3OCVA 4YRZA 4B3RB 1P6UA 3FNFA 1I32A 1T26A 3N1CA 3I72A 4ZHQB 1A96A 3L7JA 4OJQA 4FFVA 3WNBA 1TIKA 3RD5A 3CLHA 1XCMA 2HJWA 2TYSB 2NTJA 3ESBA 3N3BC 1JHRA 4NG5A 3DVAB 5BR1A 4C4XA 4I1PA 1LTQA 2RAPA 3G2OA 4MW1A 3I09A 3UNXA 1W5AA 3BD8A 2FP4B 4Y2PA 3DEAA 3LBHA 1VOTA 5FI0B 1WUJS 1X15A 1GDDA 4NOLA 1R8SA 2CNOA 5JCOC 2C49A 3I73A 4CM5A 1GP2A 4J0FA 4U7DA 1RSZA 1P9RA 4JUCA 1AC5A 4KSCA 5GV7A 1YDMA 1KDTA 2ZDQA 3IMKA 3VR2A 3QUTA 4DAEA 2R66A 4MB0A 1ECBA 2UYYA 1HPLA 3HNOA 3QFHA 4OXQA 4EFMA 3HK2A 3UHPA 3AHFA 3BFVA 1XJWA 1E59A 1JRLA 2GT1A 2QAGA 1BCSB 3OPYA 4H7DA 4R98A 5IHXA 5GJVC 3JWJA 5AKLA 1T2UA 4N49A 2OA0A 4F96A 4DC3A 3N58A 3GCGA 3P9RA 1XZEA 4ZD6A 5LQUA 1KRWA 1IHXA 1LPPA 2QLMA 1EZ1A 3H1GA 2TSYB 1CUXA 1NWHA 3C2QA 4BRWA 3E3NA 2V59A 4UC0A 1Z82A 4W5JA 2X6TA 1Z0ZA 1V1MB 3L01A 4LMRA 5FOSA 1OT5A 2JPDA 2YIDA 2F3SA 3VR0A 4KNYA 4U00A 4X93A 1RNLA 1AX9A 4FYPA 3C3BA 1KF0A 1L8LA 2AL7A 2CGEA 4KTTE 1W78A 2ZJBA 2Z5FA 3M8KA 3QNUA 4C7JA 2QCVA 3G68A 3AVWA 1ZAKA 3WK7A 3GROA 2I2DA 1MVNA 3MFYA 4AMVA 2ATXA 2QRZA 3PRYA 3N0TA 4M9RA 4O6VA 4Q9NA 1XMSA 1FFHA 1HEUA 4OF4A 5L3RA 2C2KA 1KRHA 2HA4A 1RQPA 1SUIA 2Z3WA 1QB8A 3B5IA 4OIMA 4AZ0B 2BDUA 3EWNA 4TTQA 3I5XA 3MYYA 2PE5A 3HI6A 5AXCA 4LWZA 4F4HA 1DAPA 1RM4A 3A1UA 2QN2A 3I45A 1UL1X 3OIVA 2CL7X 2R60A 1EXMA 3E9RA 2FW6A 4FR5A 5DXJA 3C8HA 3AR3A 2HOQA 1L1QA 3GB9A 4RE5A 1CZNA 4FDVA 1E2MA 3JQGA 4JCCA 4RQUA 4TQGA 3AI2A 2VHCA 3RYFB 2Q9BA 1DPGA 3NDRA 1PG2A 4ZOLA 2NXNA 1B14A 5L3SB 2YVQA 2GXAA 5KYXB 4NFSA 2PD3A 1ZQ9A 2WJHA 2HSZA 4GI5A 1B0UA 1BEEA 2GX6A 1MABA 3FUCA 3LDAA 4MRVA 3OTWA 5CNJA 2IDKA 1WMBA 4F93B 4ZKEA 1AZSC 1UJ2A 1XAIA 2JIQA 5AKGA 4YQEA 3R8CA 2Y0DA 4C01A 1AF7A 3R1IA 4Q9IA 3I23A 3SZ3A 3K4PA 4KQCA 2G88A 1ZN9A 2P9TA 4TV8F 3W2FA 4DMMA 3EVEA 2FZ4A 1Y0BA 3X1YA 3MINA 1EQAA 3N2YA 3VC2A 1VECA 4YRMA 3ZV5A 1EX7A 1A1VA 5D6NA 4H7HA 1U9YA 4A8JB 4WUTA 1J2YA 1A2BA 4PC7A 4ZV4A 1DKUA 1E0KA 1W5TA 4W4TA 1E7QA 3KP1A 1PN3A 2OFOA 1N4AA 3MUFA 3W04A 4D25A 3C8UA 4O1IA 3VR6A 2FPKA 1WXGA 2D7JA 4TVOA 5CBPA 1XRQA 2NO0A 1FXUA 4LJLA 4EFKA 2I2BA 2B8WA 3CR8A 1ZPDA 4KO2S 4NL4H 5MFZA 3ZVMA 1T25A 4F2PA 2NWQA 4NCAA 1MOSA 1M1YA 4LV8B 1HNNA 1L3CA 3BE6A 1QYXA 4QFBA 3KKLA 1G66A 4HTAA 2FMXA 2A88A 1Z62A 3EGDA 4OJYA 3QWFA 4L50A 4DBLC 1SXJC 1LEHA 5BNFA 4N54A 1FVXA 1NXPA 3PXBA 2OBMA 1AA6A 4RNDB 3FBWA 3AM1A 3AZQA 1MNQA 4TSFD 3WMEA 3BL6A 3QA9A 2FAXA 1C3LA 3C8ZA 3IP8A 3D0KA 1YL7A 4G0PA 4MPRA 3WGVA 5HWSA 1ZEJA 2KE5A 2I5PO 4L74A 4DLTA 4GR9A 3USZA 2WKQA 4JBGA 3IQ0A 3UCFA 5FTKA 3G1TA 3G9ZA 4YCCA 3A4VA 3PFKA 3AGPA 3TNFA 4O1HA 3UFBA 2UVDA 3K0CC 4UJ3A 1LIOA 1PSWA 4KEAA 1G2IA 1HDOA 1FRFS 2G63A 1YL6A 1TJPB 3RHSA 5AJTA 1PGJA 1G2OA 3K9GA 4K26A 1J9ZA 3X1MA 1F06A 3I04A 1MJFA 3R5SA 2I71A 4N5NA 5EWLA 4EMSA 3DZFA 3LXXA 2YFYA 3OIUA 2GA8A 2XECA 2E4VA 4KDRA 2EJUA 3K09C 2VHTA 4PYIA 4XVRA 1PL6A 4J9VA 1GFSA 4GXNA 3RFTA 3RSZA 1O6BA 3EZ9A 4M21A 1A7UA 1ODFA 3O3OB 4MVCA 4ODIA 2OV3A 4UE6A 4K81B 4WRRA 4I14A 4YGYA 1H05A 1AKUA 5G1PA 3ZQJA 1W6UA 1U3WA 1ZL0A 2YTZA 2WWFA 2NTEA 2QP4A 3KAQA 3NVAA 3OTIA 3PFIA 4D1YA 4TMWA 2WJ4A 1JEYA 5CB6A 3TLGA 4MVJP 3PD7A 1A8UA 3VDXA 5GY7A 2ERXA 2YFKA 3VSBA 4OHYA 4HVAA 3RQ5A 1KPIA 3ZZTA 3NH6A 2JHAA 2DSNA 4XE5A 3H9QA 3WNZA 1DUIA 1O7JA 2Y1WA 1GL7A 3NGMA 1DQSA 3GHHA 4F60A 3L8GA 1Y3AA 3CJRA 5FOQA 3ZIAA 3HJFA 2I4RA 3EG5A 4I0WB 1NG1A 4WBSA 3HMQA 1IQRA 4E32A 2JCGA 2YCLA 5LQNA 4KPEC 4QM7A 2VNAA 4EBUA 1Z6YA 1XKLA 2BI4A 3NBKA 1TA9A 4S1IA 1NWCA 2ZI7A 3CEMA 3S8MA 3CFYA 3GWGA 1MDFA 4GMHA 3G7UA 1EG2A 2GFIA 2Y1EA 4IDQA 4IS2A 4OMCA 3WNCA 3OLCX 4J4BA 3BMNA 3EXHC 1TKBA 4MGKR 4CODB 2VDRB 4D46A 5SYNA 4H1VA 2FYTA 3PC3A 3UXMA 4J0EA 4G5XA 3UENA 1LY1A 3HR4A 2ASVA 4D8VA 1VJ0A 2P4EA 2Z95A 4IV0A 5K8JB 5ABPA 3MTBA 2ZRLA 3U44B 1IHPA 3KHKA 2FJPA 4YP1A 1VRCA 5EOVA 4QDJA 3VJLA 1F4LA 3S28A 2W2TA 2UZ1A 3MB8A 2C57A 2FK7A 1G20A 2QSZA 3NTOA 4LTMA 3RF6A 1IBSA 1Z56C 1KMHA 1GL3A 2J9YB 3TQSA 3LCJA 1IQUA 3H3FA 2H2DA 3PC2A 1VCNA 2WSSD 3IXQA 2AA0A 2C5EA 4CI9A 2EBHX 3ILHA 5JFOA 3H2IA 4XWWA 4E4RA 5IK2D 1HR0B 3VGPA 3T12A 1WYEA 1EDOA 1NVVQ 1RZRA 4FKMA 1LBIA 2RCNA 5HF8A 2V7QD 3OC0A 2FZLA 4QE3A 4D99A 3ZDEA 2CYAA 2OOSA 3B6EA 3TBFA 3VASA 2QMZA 3E15A 4K46A 3JYQA 3B12A 1XQ1A 2WD8A 2Z2KA 1VIDA 4FILA 4I7EA 3BEDA 3DPUA 4G0OA 5ADWA 1GADO 4I5DA 2QX7A 4JBLA 1US8A 4IDBA 1M8PA 3BOSA 5IXSA 1DXOA 3HYOA 2XDQA 5B53A 2XDAA 1AV6A 1EB9A 3B1PA 4DSOA 3F7MA 2JLCA 4E30A 3FYUC 4D7AA 2VPXA 1GL9B 3W0LB 1BG6A 1TVKB 3AUYA 2QD2A 4F86A 3LZ6A 4MRAA 2VYCA 5GVSA 3SKVA 4PFQA 1KYXA 5H16A 1UIRA 1UDCA 3AVQA 2X40A 3M33A 1BEZA 1SA0A 2W6OA 3L7DA 4XEHA 2B82A 2WWGA 3X1KA 4F04A 1SUAA 3T9FA 4C7XA 4A9AA 2IYPA 3ERCA 2NNWB 2VDVE 3C4VA 3ZYZA 1KEEB 2IV3A 4NDZA 8LDHA 3HFGA 1I9CA 2G5CA 2C58A 1RKVA 1BD4A 3N75A 4C30A 1OKKA 1IN8A 3L84A 4X7BA 2QDKA 5FIUA 3ZCTA 3RC2A 2I3ZA 3WGQA 3DFKA 4ZO7A 4A91A 2COUA 3DL4A 3QOYA 2JKZA 1RTKA 4HKTA 4FMCB 2A9OA 1GQTA 2R87A 1UXKA 3STYA 5IUKC 2WVGA 4EYQA 3WLHA 1PGOA 4LMAA 4RD6A 1QFSA 4E84A 3GDWA 1TCUA 5D5PA 1AUVA 2OFXA 5C34B 3RCBA 1B00A 1L5MA 3BGIA 5CX1A 5FFFA 3PIIA 1BWQA 4YDHB 4B31A 4FFPA 1QM5A 4DVGA 4GOKA 4B6JA 3GUYA 4DQVA 5C7YA 4P92A 2XW6A 1S3FA 3F6BX 2QUBA 3ETGA 5BP7A 5F3WB 4QOGA 5LC1A 3RT9A 5FFNA 2PXHA 1ENZA 1EQ2A 3AEUA 2ZJYA 3FMGA 1S2OA 1WBBA 1NNLA 2FN9A 3LQRA 5LBIA 2GBPA 5T57A 1H1LA 5TPWB 3N7TA 3SMQA 4ZVKA 2ECQA 1FZTA 3KOOA 4ZCQA 2EZ9A 4Z2AA 2WFZA 2Z8YA 3P9QA 4AF6A 4F38A 5DLQC 3NT5A 3UJ8A 2SNIE 5TXGA 2I3GA 3KLOA 4DUPA 1OAOA 1VGRA 2CJPA 3JAWA 3BIWA 1XVTA 3WIEA 1MAUA 4NAUA 1NQOA 3I37X 4Q18A 2V0NA 2BD0A 1XZFA 1JSZA 2I4IA 2OM6A 1LV7A 1R74A 3B48A 3FDXA 3OT1B 3WYGA 4K0RA 4CM4A 3GRFA 4WLVA 3Q8LA 1SD5A 3FWYA 4FOSA 5LUBA 4CEIB 1XJQA 3FJYA 3WXMA 5ITSA 4N3AA 1QO7A 3IPLA 4GT1A 4XX1A 3ZGYA 1ZOOA 1CJTC 1Q1ZA 2XVAA 1E9BA 2NZXA 1UXIA 1Y7TA 4LYEA 3IHTA 4UUBA 2IVZA 4RADA 4CVMA 1RJWA 2G5PA 3ICOA 1IU9A 3FLMA 3M3HA 3B5JA 2CW5A 2OXTA 2A9YA 3OEWA 1ECPA 1Z28A 1TT5B 1Y6JA 1WLSA 4WBXC 1ISPA 3S8EA 3PA6A 5AVTA 1LRJA 4CIWA 1OLSB 4K9IA 1VMIA 5LCXA 3IS3A 4DSUA 2C5GA 3Q9SA 3PQDA 4NJEA 4LNHA 5A06A 3QXCA 4DG9A 2RGGA 2IHJA 2QTRA 2FWRA 2X5JO 3GH3A 2HIHA 3LF2A 4NJOA 4QDKA 3W6NA 3WGGA 3WADA 4K1XA 2OO5A 4OQZA 3BGDA 2DZDA 3PHLA 1H42A 1QCZA 4HNAB 4NP6A 2YVUA 1UPBA 5EIHA 1T5DX 4YBRA 4MTCA 5E7IA 4BEWA 4U8GA 4QM6A 1FS4A 2ZAIA 2YWFA 4IKEA 3QV2A 1RWBA 3I1JA 3UT5A 3CU5A 5JCZA 5ADVA 2L82A 5ILOA 4F97A 3U60B 4DFDA 2HRDA 2E55A 2X9GA 3F46A 4MOWA 2FN3A 5DJ5A 5E9JA 1ML3A 3WNDA 5HKKD 3UUFA 3CZPA 1R66A 5I9SA 1K1EA 1XMQB 4XF6A 4IOLA 1PEKE 2B6HA 1AXEA 3R5XA 5KMGA 4QBHA 1FZQA 1N6NA 3FUWA 1R0YA 1WKVA 2G0TA 5KOHA 2PJUA 4R1UA 4OKIA 2KSQA 3AILA 4BFUA 3VHQA 3FCXA 3UPUA 4J6FA 4L51A 1EBFA 1WPGA 1AZTA 2HZBA 2OHHA 4PCLA 2C54A 4JLSA 4R69A 1ZK1A 4QHSA 3VZPA 5HZHA 1CT9A 4FFBA 4RDCA 3B85A 4S1OA 3F5DA 5TB5A 3G85A 3WLMA 3IOEA 1N32B 4FE3A 2A5YB 3AY6A 4JI6B 4KHPB 2R62A 1RE1A 4KAXA 3ZK9A 3NC9A 2C7VA 2YYAA 5F2NA 1T8TA 1ZJWA 2MIIA 1XD9A 2EF0A 2IOHA 2WF5A 4FDAA 3PXEA 4MV7A 5JS7A 1TIBA 3W8FA 5H59A 2WJIA 2N75A 3KJGA 3MWDB 4DIOA 3OKPA 4A2WA 4URXR 1SUPA 2YV4A 3TIVA 3I5YA 1P9NA 1JPJA 1YZVA 3IJPA 2A35A 2C1EA 3M4YA 2IH2A 1DGMA 5COBA 4ZQBA 2I6BA 1ZCFA 3KAPA 2CLCX 4GW3A 3U3JA 3GRVA 3NBQA 4Q3DA 5K6AA 1YQXA 1SCIA 3DP7A 3DXYA 1HQCA 1CFJA 4P7JA 3EDYA 5L53A 4GOJA 2B37A 1GRVA 4EX7A 1U2DA 1ST3A 1E6EA 1BX4A 4N0PA 1FUUA 3EVTA 1GVNB 1AUXA 1P9LA 1QH1A 4ZA2A 3SJCA 1ISJA 2QUAA 2J3DA 2QLLA 4FOOA 4IDNA 5AK5A 4K8TA 1WO8A 1EGHA 2ZE6A 4YAFA 4IH9A 1SOWA 3L4KA 1OT3A 3E7XA 4V24A 1NIPA 2MYPA 1P7YA 1GPDG 3GLQA 4MEAA 4L02A 4DG5A 4ENUA 1S8AA 1EK2A 2IYSA 2NU9A 1W96A 4WDQA 1B3RA 3OCXA 4ES6A 1V9CA 2BY4A 3AJ8A 4J7XA 4X20B 2NTNA 3CRZA 3DNFA 2ZM6B 2G7MC 3VO8A 1L4MA 3PXXA 3E70C 1T9KA 4ITVA 2QRVA 1B23P 2ZRCA 4ZARA 4HNTA 1FTYA 3DMFA 1H8HD 1Z8HA 2AFHB 4AZSA 3N2NA 4JELA 2BE7A 2W00A 4LYYA 1EM8B 4C0XA 1ZGCA 2B99A 1P1RA 3HJNA 1NZFA 2CLFB 2BM9A 2DX7A 3ZY3A 1KVRA 2FPPB 1YB5A 4EB3A 3IAS6 3VAQA 3QZUA 1IOZA 3A3KA 2LD4A 5AVXA 1NW7A 5FUQA 2RC5A 5JAMA 4HT3B 3PSHA 3O83A 3TVDA 2HJRA 5ERGB 1XMJA 1P9WA 3GHYA 5JCOA 1WJGA 3AVYA 3FWHA 4X41A 4BV9A 4BKQA 1P72A 3LV8A 3V7WA 3S40A 1XZKA 3ZZUA 1U2XA 3HJRA 1VPEA 3DOEA 3WJ2A 2WF9A 1LU9A 2PS9A 3LM8A 5BSUA 1P1JA 4LWQA 5GGYA 5HHTA 4XIGS 1IDOA 2O5RA 2PEZA 3N0WA 4ZO9A 1F8FA 3KJNA 2XYQA 5CVVA 3PTAA 4HDOB 1IOVA 2QTLA 1LF5A 3QLTA 1N2IA 5BNWA 1Z29A 1WU8A 1U1FA 2X77A 2PGLA 3KAJA 4D8WA 4UQLA 2IHNA 5J3JA 4JZKA 4PAMA 1IY1A 1E3LA 1P9OA 4OYRA 1BE8A 2GAJA 2MU1A 3KOMA 4EOGA 4NCHA 5FADA 5JNUA 3AF2A 4KE6A 4IDEA 2PRYA 1KMQA 3OLZA 1L8OA 4OP3A 3T38A 3V4ZA 3ZE1B 2HSEA 5K0JA 4F8YA 2IS6A 2ACEA 3FE2A 3T5PA 3T35A 1P6QA 1FP4A 1H5NA 2FEOA 2EU8A 1BU5A 2Z4TA 3PCRB 4GOOD 4KL8S 1HE1C 2B2XA 2P0AA 4LZJA 4HDAA 3UIEA 4F85A 1NN1A 1YUBA 4J94A 4EPVA 4F4DA 4DV7B 3AQIA 2V96A 3N2IA 4QO7A 1O54A 3I2JA 5EYPB 1C30B 1NJ8A 2WU3A 2BMAA 3DB1A 3E5NA 3QUSA 2WF7A 4OA8A 4XQ9A 1K8XB 4YLGA 1BE0A 3R6TA 1A72A 3LUDA 3CO0S 1JKIA 2VO1A 4L5CA 1CQZA 1PCXA 3UG6A 5BMVB 1D0SA 2CLSA 5D3MA 1LIIA 2XRYA 1QPGA 2XF8A 3LVBA 4MDEA 2HWYA 1J0EA 4ND5A 3V2UA 3ZWQA 4YMGA 3QAIA 3EZ6A 4PLVA 3OE4A 4BMPB 1QC5B 2BTQB 3FPSA 1NTOA 4G24A 5CHEA 1XE3A 2CVPA 4Y9TA 2O8CB 4OQDA 1EUDB 5AW5A 1CY6A 4K86A 5D7NA 3TJMA 3RTDA 1AS0A 1SCBA 3MT9A 2G67A 3W4IA 1LK0A 5JY6A 1QBKC 2W6CX 2PX2A 5AHOA 4DLYA 1SZDA 2QXUA 3Q11A 1LX7A 3RT7A 5ERYA 4XDGA 2Z43A 4MS1A 2Q99A 1FP7A 3FA2A 2MOKA 5LQMA 4EABA 1ZMOA 1F0YA 1QDLB 2J9FA 4CR6A 3CZCA 4F3YA 2OVBA 2XGSA 2ZYSA 2MMGA 4QOSA 1F2TB 3AI7A 3JXEA 3K5IA 3OPXA 4WMLA 4Z6KA 2E1RA 3MTGA 1A9YA 2X7HA 3PT5A 4ZJYA 4UXIA 1KYWA 2FSSA 5EA2A 3FNIA 4IXWA 1RPAA 1YZQA 2DHRA 3JVEA 2F9FA 5DGTA 4RVDA 4UDNA 5KWSA 3GP3A 4PZPA 4JKSA 1YZLA 3NATA 4JYMA 3KFLA 2X7XA 1EKXA 4NOJA 2Q7DA 3RVKA 2E37A 1KY2A 4IKOA 1X92A 1CRWG 3WRYC 5I3ZA 1Y3DE 2IXFA 2DFLA 1KY5A 2VVTA 3IE2A 2JIDA 3CVJA 1TJYA 1UMKA 3GFRA 3LUAA 3TLMA 3WG9A 1DAKA 1QZTA 3M4XA 4N3NA 3OTQA 4FYVA 4I66A 2APJA 4W9NA 5SZIA 4BLUA 4DADA 1S5PA 5EHNA 5MFPA 3P8ZA 1R5OA 3NHRA 1OA1A 1QOQB 5LL6P 4QXRA 5K0CA 2X5KO 4D6XA 3DZ8A 3F3KA 3I9NA 3NNNA 1S4QA 1SBQA 1SC4A 1FYEA 2F3PA 2J0VA 2LDXA 4H3HB 1RXIA 3FYTA 4I3FA 4EB0A 2A9PA 5G4KA 3HXTA 3UGQA 2CNDA 4BP9A 4CI0B 2OC4A 2C20A 2Z2YA 4D80A 4NESA 4Y1EA 2WT4A 5BNZA 1Q0SA 1V3UA 2QJRA 4D82A 1L4UA 2CBGA 2VAPA 1UMDB 1FJXA 5JYEA 5A4FS 1H9CA 4WESA 4OI0A 3JQAA 1FQKA 3L6BA 3ZD7A 4AJKA 3EXEA 4NZZA 3B8HA 1MB4A 3RYIA 4Y1GA 5BMOA 4KRXA 2O2ZA 2PQMA 3WK8A 1TPZA 3LUJA 1PTJA 1ZJZA 3M83A 3A2KA 4FHFA 2EIXA 5LLSA 2PD6A 1UOQA 1B1CA 1IFXA 1K9SA 1VJTA 5HFAA 5I51A 5IYZA 2L18A 2OAP1 3NYWA 1U80A 1RCFA 2DFNA 2ZITA 2Q7XA 3C7CB 2DPYA 3KX2A 3SVZA 1VI2A 2GYYA 4R01A 3P2YA 1OLXA 2Y77A 1A7KA 5KYUA 4R8MA 3SR3A 3CZMA 4DU5A 1DKPA 1ZICA 1U8UA 3MGKA 4HFRA 1ISRA 2ZRHA 4CMEA 3VNBA 5DBFA 3UICA 2VDJA 4R2WA 1RMTA 2FDXA 4CKWA 1GTJ1 4O2AF 4I50B 3OP1A 1YBMA 2HWXA 2OFPA 1UOOA 4KMRA 5LWHA 2WYHA 1QZUA 4NABA 2V55B 2XUIA 1PP4A 4YR7A 5KPDA 4LC4A 3RQ8A 1VYVA 1PS8A 2EGGA 2VZEA 3TSOA 2G6TA 4I19A 5J43A 5FPTA 2WICA 1GPLA 2R00C 2N3ZA 2AN9A 2GTHA 3NYIA 2NUPB 1AKTA 4LC9A 1VKOA 3OZFA 1A71A 1Y48E 1OZAA 1UJCA 4JK3A 3A6FA 5K8TA 1XTTA 3ZY5A 1N3LA 1N25A 3PFNA 2W2OA 4RCYA 2H92A 3ENNA 1HLPA 4RETA 2GCPA 3BF8A 4BB5A 5H80A 1EE9A 16PKA 4MICA 5A0VA 4ONEA 5FUBA 3G8CA 3GJ5A 4M9CA 4L4YA 3JRNA 1OZ0A 4FX5A 1QHEA 4MUGA 3D8TA 3MS7A 5YASA 3GEMA 4PAGA 3R9KA 4KXXA 5CURA 1HA3A 5DGDA 5C4IA 3W4SA 2ZCVA 3G6WA 2WUEA 4LJKA 2J3EA 2YC4C 4B3HA 2BFCB 1PNRA 4FDMA 4QTZA 4R6WA 3ZLJA 4L9SA 2O3SA 4LHZA 1ND6A 1YVUA 3OQHA 4I4LA 5JAUA 5LXTF 1UWLA 4JB3A 2PUAA 2O8DA 1YAHA 1ECJA 4DR3B 4KMSA 2NLOA 1KBZA 2CXXA 2POCA 4HAUA 5CM2Z 3RSQA 4C2TA 2ZATA 3C4QA 2H4FA 1XNGA 3I61A 1PZNA 5EQJB 1GUZA 1X7XA 3K2IA 3UHJA 3UK1A 5FV7A 4YP5A 4A03A 2QTVB 3A1NA 1XYYA 3OJOA 5ENVA 2QVLA 4N76A 4XYGA 2VHXA 3PD0A 1X8JA 4PAWA 3RFVA 4CL8A 3UBTA 2R5FA 2ZB3A 3U19A 5LP1A 4X97A 3NM6B 2O7QA 2FB9A 2NXJA 2Z6VA 4LOKA 5AUNB 5A2QA 4UBEA 1XDGA 3NVMB 1OI4A 3AU8A 5J5AA 4CHGA 2FPRA 5CBKA 3WJAA 2ZR8A 5KNDA 4KFSA 5BOVA 1QIIA 2GEJA 1FF9A 1U9IA 3G5MA 3BQMB 4UCXA 1SCKA 3Q6MA 3RRFA 4BVFA 4LRXA 1UT5A 2OCYC 3GUZA 3I4CA 2OHVA 3KBBA 2LZ0A 1JAIA 3OQIB 1QU3A 2XI4A 4B6PA 4KLAA 2GSDA 1R8JA 5G41A 5HIJA 1TVMA 4QDIA 4OXYA 5H3CA 1EFVB 3DF7A 4OHFA 2JGMA 2PYZA 3R7LA 1FX0A 5AI4A 2XDWA 3IBFA 2CD7A 4DWOA 3U81A 1Q74A 3RNLA 1JXHA 5DWQA 1ZW1A 4FU0A 4QBGB 3A9VA 4XDYA 1Y5MA 3K32A 3ROGA 4QJBA 5EZQA 4C4OA 3EHEA 1QE5A 1GNRA 4RZ2A 3VX4A 3ICQB 2NUBA 3QUBA 1OBVA 3C3PA 3CNBA 4HEQA 3F47A 2Q3JA 4JYPA 1M5TA 2RGWA 2GDJA 4EMTA 3Q3JB 2CNWD 3O73A 4NYIR 2O20A 4TVBA 4WZ6A 5DHRA 1HTWA 4GG1A 1JMVA 2DFKB 3M5CA 1YRLA 2WWIA 3PNOA 4NNOA 1XEFA 3N8KA 1EX1A 1MJHA 4YRIA 1PR6A 3NNDA 3KOYA 2A9RA 5CH8A 1JIXA 1T9DA 4I5IA 4FMDF 3HM9A 4YJKA 4XDAA 3IP5A 4RKRA 5AVOA 2IVFA 2AVDA 3B8EA 2X8BA 1LS6A 1U2TA 1VB5A 3MWGA 4Y30A 4EQ6A 4EJ2A 5KNBA 1S3SA 2WWVD 4EVQA 1TTTA 1G0NA 3B2NA 3IOYA 3QU7A 1GPAA 3ROEA 3UMMA 4P6VF 4OD0A 1TUEA 1CRPA 2W2LA 5EXSA 4HADA 5EQTA 3WRVA 1W88A 4GFDA 2WJPA 1YOVA 5B7QA 1IY8A 4JXKA 1T3SA 4YR9A 1TZ3A 5EAIA 5LZ8A 3QLEA 1CUUA 2ZJ1A 5G1OA 1NONA 2AGVA 3SX2A 3RAGA 1DIHA 5IKOA 3VR2D 4OK6A 3KR0A 1SQGA 4BO9A 3T7TA 2QOEA 1U6KA 3O93A 3JALB 4QUJA 4B9EA 1E79A 2B92A 3ROFA 2KI5A 4ZTZB 1DOHA 2GHRA 1DKMA 3UUGA 2PZBA 5CG2A 2D2XA 3GW8A 1G41A 3KQWA 4U6SA 5KYYA 3KTFA 1QRSA 3SFVA 3KKZA 4P3KA 4RBNA 4ZDIA 5FT9A 2FQXA 3GUCA 2R5NA 4PZ9A 4WCDA 5F1KA 3EPPA 1AD2A 1PE0A 5CB8A 1N2JA 4JOQA 4RUKA 3ZW8A 2NADA 3FUXA 1PQPA 3QVVA 5G2OA 1N3IA 1F6BA 4FFLA 3FDFA 2YY6A 1AGPA 2R4TA 3UBMA 2QN8A 2DSTA 4US1R 1LC3A 2HL6A 4REQB 4Q37A 4AMUA 2DKNA 2DF8A 4LCJA 1A8HA 4WCFA 4QGAA 4YCLA 4HP8A 4H2DA 1NVMB 1EFCA 2JZNA 5E6SB 3UJNA 2FUG1 4DLVA 1L5VA 5KDDA 1M8JA 1CUCA 4RJKA 3BSFA 4RJIA 1K8ZB 1V39A 3PGVA 4KXQA 3FOBA 1VBKA 3V42A 4E2FA 2UAGA 3OVMA 1P4RA 4C4YA 2Y68A 5K5EA 1OREA 2VDMB 4DV6B 2JIBA 1WPQA 4MR9B 2NYVA 2IL1A 2OO3A 4YVFA 3RKSA 1D6SA 5F35A 4MV1A 4JOBA 1I3OA 2MSLA 2OGTA 3KWLA 4KE7A 1E32A 1HI9A 5JDCC 9MHTA 4ERNA 4AJ2A 3EX7C 2Q5RA 4HQNA 3C16C 2JGEA 4O0LA 2DR3A 1D2HA 3T3DA 1T2FA 3N76A 1WKBA 3T0GA 1U0LA 2JF0A 3EZGA 3ABIA 5HUQA 2ZSDA 2GR9A 4E4TA 1NBHA 1KJJA 6Q21A 1H93A 2ZR9A 1K68A 4YUVA 1N2BA 4IQGA 5KKAA 4HB2A 3VTAA 2A5DA 2PRKA 3GJ0A 3H3XA 4GVPA 2F1JA 5I3CA 3L92A 3ESDA 2OXIA 5CDSA 5KU7A 3CPJB 3JQDA 4HQ0A 4B4WA 2NVWA 1MRNA 2ZRIA 2XYPA 1N9KA 1ES9A 2G3YA 4CQLA 1U90A 2B69A 1N2OA 2I6AA 1TFRA 1SXJB 3WHKA 2D06A 1A98A 1ZISA 5AK3A 5JS2A 1GGEA 1XK7A 3KVRA 2WT8A 1UP6A 1JT2A 1UJ5A 3KL4A 1RWPA 4G5QA 3PYXA 3B13B 4PZ0A 4WA8A 5TMEA 2QN1A 1B76A 1G5IA 1QPBA 2XOXA 4MR8B 2OG2A 5DFAA 2GCOA 2L2QA 1A9TA 2AF3C 5K8CA 3Q8MA 2J4CA 1F4PA 3ZH2A 3FIJA 3LYHA 2REQB 4R3NA 3CPHA 3DVQX 3II6X 3MUOA 4D4IA 5C41A 5HZKA 4MJXA 5DB4A 4MYSA 3FCAA 5IAOA 4KR3A 1RHMA 4M38A 3VR6D 4DV4B 1WF3A 4C7OB 2IKSA 1KYQA 3KOZA 1X19A 2IZ0A 4GP6A 5AR1A 1R6TA 5HVNA 4IH1A 1LGYA 3WQQA 1SCUB 1RAAA 3B53X 4MYUA 3VZDA 4DLKA 2PJZA 5MGNA 1GDTA 4R05A 4WCVA 3AF3A 4L3OA 2H8GA 1PL0A 1RU3A 4TX1A 4Q21A 4GX1A 1RBYA 2VP5A 3ER9A 1PV4A 1ONNA 2VHUA 4RH3A 1RRKA 3IVMA 4R41A 1R6DA 1H22A 5KDLA 3TRHA 4NKRA 3EVCA 3D6AA 1WW8A 2P9ZA 3CEAA 5JAHA 4IYRA 2WNIA 1ENOA 5C8XA 3MOIA 1ADCA 1CQJA 4OFXA 5A3JA 4B83A 2H1OA 4AM8A 4A82A 4MDFA 3NOVA 2FWBA 3L1JA 4F46A 4UM8B 3RC7A 1GU7A 5JNWA 2GRJA 2ZEJA 5KCMA 4MKRA 3NOQA 3DQZA 3SXUA 1P19A 3A1SA 3AI3A 1YFZA 4RZSA 5E4FA 3CVYA 4TTIA 1UXHA 3TXAA 1AF4A 3A6HA 1J9GA 1V41E 3C5WP 3OCUA 5BWCA 5MF6A 5DI3B 1Z63A 4M22A 2TMGA 3EIEA 3FF1A 3OF3A 4N3BA 1WXFA 4P5DA 4I3HA 4DNXA 4UHDA 3CNLA 4D4KA 4C3OB 1I2AA 3WGNA 1I51A 3ISJA 1CUFA 3A4TA 4J16C 1EUCB 3R7WA 5KQLA 2JANA 1W36D 2VDWA 1U5BB 4U5QA 4GOXA 4FGLA 5EZYF 3EXHB 3OUTA 4I55F 3G0HA 1OFHA 1ADJA 2VK4A 3MZ0A 5FBLB 1V5FA 4ITUA 3ZIUA 1NMYA 2P7IA 2Q2VA 8ATCA 4PIMA 5M5BA 1KSHA 2RBEA 1FXSA 1KI1A 1OXXK 2QVBA 3E0XA 3TJZA 3J81k 2IYXA 2G9ZA 1Z0DA 3HA7A 3JULA 2X41A 2JFBA 2OO7A 3NHWA 2P79A 1VSTA 1G64A 3ER6A 3H83A 4RK4A 3GLFA 2AJ8A 4UUPA 2O50A 1TU3A 3KYIB 2GN4A 3GFBA 3MTIA 4FFOA 2ISSD 1AKEA 4YJFB 5CW1A 4YJ2A 1Q11A 3KUKA 4HWOA 1KWKA 2Z9DA 3BB4A 1W75A 3ZIAD 2UXDB 4FHCA 2FVYA 1P4SA 2HMAA 4HB4A 4BV2A 1M0EA 2BT4A 1EM6A 3CCBA 2ZBVA 4OHKA 4UJ5A 2EKPA 2EP7A 1FQOA 3QE2A 4Y98A 3WBBA 5C0OE 5PNTA 4E3ZA 4F1WA 5C1PA 5JXGA 5JALA 3O4FA 3GLHA 2VPQA 5EGNA 4FZJA 3S2ZA 2VARA 2DXIA 1UBJS 2YJ4A 4Y2GA 3ZDFA 5K2OA 3QF4A 4L4UA 2PH1A 3UBOA 2AWDA 1P0IA 2IZ6A 2CHUA 4G8BA 1Z17A 3IUNA 2XF2A 4Z51A 3OZEA 3FGOA 2WR8A 2Z8ZA 2WYIA 3OJ0A 1HKUA 1J00A 2IZ5A 3AHEA 4A23A 4C4AA 1X42A 2VT2A 4QASA 5JFTA 4FW8A 1BA2A 2IX9A 3FYUB 3JYLA 3GYGA 3A6GA 4PYRA 1YFJA 3QI7A 1PFUA 1S3IA 4ZU6X 2V7XA 2Z58A 4BQNA 3ABQB 1V7PC 2P5SA 4AY3A 3K70D 3OFJA 1QQ6A 3BTUA 2RHWA 1UFKA 2YNMD 4UBIA 3T1YB 2L42A 1LLQA 2WSIA 4QGSA 5F51A 1C4XA 4FFSA 1JLHA 1V25A 3SCZA 3GMSA 1F1JA 1Q17A 1SRRA 3OPYI 3T7JA 4YJDA 1RZRD 3HDTA 2BKVA 4IO0A 1RI3A 1YUMA 5LR6A 1ZH8A 2C97A 2CBZA 1VYUA 4RK1A 4QYIA 3R7FA 3DT9A 3QVWA 3ZS7A 3A06A 3TL6A 1KQOA 2CFOA 2O07A 1CEYA 4U02A 3N0VA 3RIHA 1A77A 1KIAA 1PR1A 5JIBA 2ENUA 4BUJA 3E9YA 1HWYA 2QM7A 4EY6A 3U5TA 3NO4A 5J2TB 4CLOA 1FNNA 3P9IA 1O8BA 2GCEA 2KJQA 1U8TA 2XWQA 4IPTA 4DMUB 1DAGA 4TXHA 2F1IA 3F5QA 3THOA 1OI7A 5K0TA 1MIOB 4LG1A 1V96A 3TPCA 5DYYA 3FMPB 3PNLA 3F8TA 3ZNOA 3SS7X 2WKSA 3CO5A 4X1OA 1FL9A 4JUFA 2OHJA 3TDNA 2HCRA 1YB7A 3ZDZB 2VP3A 3F9CA 5B58T 1NULA 1QHFA 5ICEA 4TXJA 1RBMA 2XXAA 1D2EA 1JSRA 1WW2A 4WBNA 2C2XA 4ZYUA 4M8KA 4CIDA 4V1CB 5T7BA 3E84A 1JLSA 3C8MA 3NBWA 1SQSA 3QX8A 1TK2A 4L08A 2VA8A 3ZBUA 1SXIA 1KJIA 1OKKD 4ZEWA 3KQYA 5KAPA 1E2HA 2H07A 1Y1RA 4QJ5A 3WLQA 1AQUA 5KS2A 1OX5A 4B3IA 1XKTA 3DMTA 1P4GA 3DM5A 3RK4A 1EIZA 2IYOA 3FUTA 1B41A 2X9QA 1SC9A 4IJKA 4YJGB 1JMYA 3V80A 3FDJA 4R9VA 4KIGA 3Q0IA 3RSGA 4A0SA 5A02A 1JP7A 1XQ9A 5JISA 5BY2A 1PVDA 3L04A 3PLNA 1ZJ6A 2WA1A 2Y9MB 1P45A 2QBYA 2QX6A 4GPIB 3S4YA 1B8PA 5ALNA 3A26A 2FW7A 3JQ9C 4G2TA 4YPFA 5I9IA 1L7AA 4F1KA 1KL7A 3S7ZA 5BYEA 4JR2A 1W2HA 3PRKE 4OQLA 1J8QA 4TOIA 1R6VA 2YJ6A 4GAEA 4B6FA 3I2HA 1UBRS 4K8RB 4RESA 4L28A 1TKRA 1EFAA 4C22A 3PWTA 3Q3CA 4GOND 3R8XA 3W7BA 3CUWA 5FDFA 2J09A 2XMDA 1KJNA 2PJRA 3U7RA 5IT5A 3QXHA 1YQEA 4IV8A 4N7MA 1ZBQA 2D2EA 4PAQA 2EFCB 3L49A 4JHLA 4KWEA 5K1ZA 4QG7A 2UVPB 1R5JA 4CEJB 2C5AA 2VAMA 2V6GA 2ZROA 3DHVA 1V7ZA 2OBBA 4KKXB 4R1QA 5FWDA 1RFUA 4RKEA 4AXBA 4IVRA 3GZNA 3H0CA 2BOVA 2HA0A 2Z3VA 4Z0PA 4AKEA 2OLJA 4JR1A 2AG5A 1VSUA 2QHXA 3CF0A 1R10A 2H7CA 4RF3A 4Y1FA 1RP1A 2Z2XA 3EE6A 4UUAA 1KZ7B 3LUPA 1UANA 1GCIA 5CYFA 1K5HA 1S2DA 1U8YA 3H65A 4YRPA 4GEGA 2FN4A 3NFRA 2FHPA 2G9UA 3MWEA 4G85A 3MQ2A 5BW8A 3U16A 3AUKA 3R7BA 5DF1A 2JW5A 1CW2B 3PQCA 2CN1A 5JSUA 1JQAA 2WZQA 3MJFA 4MI3A 4QULA 4BVBA 5I6DA 3PNYA 5DV9A 1KI4A 3DOIA 2VTDA 1KYHA 2H31A 1ZX1A 2X3FA 3L7LA 1UBUS 3U6BA 1NYTA 2IBTA 1IXRC 3AEQB 1OH6A 4IUDS 3NVKI 1POWA 5BN3B 4KGXA 4HZUB 3VZBA 4JLOA 4W5HA 5IF9A 2PLNA 4JLJA 1TQ2A 4AURA 4M83A 3BWCA 4W5WA 1GSAA 3UKOA 2JLVA 1NBEA 4O2BB 4G07A 3NKLA 2GD0A 3QELB 4KAAA 1DRWA 4N47A 4WNAA 1RRVA 4C0KA 4D5GA 5LOVB 1O5OA 4LOLA 2KB0A 5HDQA 5F0ZA 3IOCA 1JLKA 4MQ4A 4N6GA 2YYYA 5GAJA 4JI4B 5JXHA 1AGRA 4H18A 4Y1RB 1T9GS 1CX9B 2J5BA 1T3GA 3I9V1 1KEWA 1L6IA 3WWOA 2JIOA 2J08A 1FW8A 2Z4SA 4ZZ0A 3HU2A 3MBIA 4G9GA 4ZV7A 4PLGA 3BGOS 2QM3A 2I8LA 4I1VA 4AG6A 2AOUA 1VG0B 1OW3B 1YXMA 2R8RA 1DARA 3QIVA 4X0EA 2CXRA 5D3ZA 2XQIA 5DX1A 3WLLA 4GZLA 1ZCBA 4MEBA 3NX4A 5SZJA 3PGA1 2H4JA 1USUA 1X77A 1UK7A 1HUQA 3PNQA 4TV9A 3GNTA 2KQUA 4ZCMA 2GJ4A 2Q5HA 4NE9A 3EISA 4J75A 4OX9B 3DAOA 3WYAA 4KITB 3LQ2A 3UY4A 1Q3HA 3HRHA 4JL8A 3UZUA 4K9CA 1GHTA 5TEVA 1AXGA 5TVGA 5JNLA 2V3VA 3RBXA 1S0UA 1VPDA 2PFGA 3DTVA 4AN4A 5FO0A 2IS1A 3EVAA 4WACA 4XB1A 3H1FA 1CHDA 1CY8A 3OQJA 5G3YA 1HL3A 7REQA 1M5RA 4YL5A 5A4KA 1LSOA 5KX5F 2CHGA 2DC1A 3I1IA 4BNZA 3BTVA 1GSHA 2ZSFA 2BKEA 2PT5A 1E0SA 2WHQA 3T95A 2GEFA 4LJ9A 4MS1B 4C1NA 2P4SA 3EUWA 4PYJA 2YJ5A 2QRKA 5CT6A 3GEEA 4B7ZA 1B8UA 3LPCA 1T8PA 4LF6B 3DWIA 4MJLA 4XIYA 4R7TA 3AWIA 2QUIA 2KHZA 3NP9A 4HH1A 4PN7A 1F12A 3A1FA 3W5JA 3LDUA 4MYCA 4ZT2A 1YMVA 4O4HB 5HCUA 5FH9A 4YUWA 1R4MB 2VYVA 3ACCA 3QOFA 3RHZA 4WEQA 4MA5A 4WK2B 1GZUA 3A2MA 3GJRA 4MW9A 4LHVA 1PR4A 3G2PA 2EV9A 2O1WA 3IQZA 3LG2A 2QMOA 3IQGX 3FTCA 4JXJA 3DEZA 5BXYA 3FHCB 2YMPA 1HFWA 3ANLA 3GQVA 5KWVA 1W1WA 4QOHA 3WNVA 1WB4A 3RIGA 4KBFA 1JTEA 1HE3A 2QU7A 3GLTA 3NM5A 4EB8A 4PQFA 3ZGZA 4C0HA 2Y9PB 3ES9A 4MVWA 1G9SA 3PYZA 2WZCA 1N3BA 4MQBA 4F3NA 4IM7A 4HWRA 3MA0A 3U9LA 4RKYA 2AJBA 3MUEA 3VPGA 4MDYA 4GR4A 1VA5A 3REQA 3OIGA 1G59A 1KDOA 1UT6A 5KYKA 2PZEA 5DDIP 4S1PA 2IUFA 4UVEA 1GNPA 4BYGA 4RVUA 3AVOA 5DMXA 2DMRA 5BR4A 5EMKA 2C78A 1XCJA 5CM8B 2I66A 4G0NA 2H4YA 1I80A 1ZUNB 4PX2A 4MHOA 5FUXA 2XB4A 2CT8A 3UGKA 1J56A 4TZTA 1TMKA 4R84A 5J4YA 1B4DA 4IJMA 1O77A 1RADA 3TPFA 1R0RE 1UXGA 3ZOKA 2G72A 3G79A 3G2QA 1PT6A 4UAGA 1MF7A 2VDPB 4R8LA 4WLFA 5KSYA 3KWFA 2ZBDA 4Y2QA 3BHMA 3LY5A 4NYJR 3F2IA 5IH3A 1PJRA 3UG7A 5TSDA 3IAHA 2HFJA 3IUJA 2C2YA 3P19A 1IK6A 1Y63A 4NENB 1QG4A 2PGIA 3OT5A 3A37A 1XQ6A 2PTGA 3AB7A 1LK5A 1Z88A 1J7JA 3H04A 1P2FA 4UULA 2P62A 1JDTA 3RAEC 1CRZA 2Y66A 1EFPB 2JD2A 3K5HA 4GRIA 2YJ3A 5IEBA 1MT3A 3H9UA 3SBEA 2NUTA 5JI2E 2HTFA 2IYZA 4RKWA 5CK5A 3AKZA 1ECFA 4IIBA 2AYXA 2ZJOA 1JPNA 3GN2A 3HM2A 1KNXA 1M83A 4BXOA 2W5UA 3B9PA 3A3OA 4RDHA 5C35A 2HEGA 4LCBA 4UU0A 3TIIA 1PFVA 2C3MA 4HXYA 2IIQA 3GVXA 1W8IA 1RXWA 2WDPA 2X0NA 4QNMA 3S70A 5I4KA 1ZBDA 4EPTA 1T8RA 3HO1A 1M8GA 5KEIA 3AUFA 1GNQA 2BFEA 2GTIA 3SEZA 3LGXA 5GONF 4AUEA 5BUCA 2QTBA 3HYTA 1I2CA 2XD4A 3H84A 4XWAA 3KD2A 1U7PA 4B80A 2FW1A 4BNLA 2B1QA 4F6CA 3LKIA 2F00A 1XC7A 2GD2A 1ADYA 3QLUC 4LC1A 1ZCAA 2X9VA 3D7RA 2R7KA 4KUHA 3VYRB 3ZCXA 4FOLA 1EK5A 2V74B 2XEDA 3E1SA 3C14C 2R6GA 4INPA 3K8YA 1PT8A 3UWDA 1O0SA 3UGJA 3GLGA 3DMPA 3OO1A 4WJLA 4HQFA 5CYGA 1JVSA 2IXEA 1HTBA 4E15A 3WHIA 5LIRA 3PB3A 4KFTA 3RK0A 3AOEC 2C0PA 2QR2A 4NU0A 1WMSA 2W8BA 5DWVA 1ZD4A 1TGYA 1JIUA 3D6FA 3DPSA 4FD2A 4RK0A 1LS1A 5CT4A 1M2OA 2WYWA 5LB2A 4YRBA 4RTMA 4TWBA 1I10A 1ZMBA 4HLUC 2BKUA 5HGJA 2X86A 3IDFA 4G26A 5T41A 1WZCA 3SDZA 4GGPA 5CT5A 4R68A 5B3AA 2AG6A 3DL2A 1EZ4A 3KKMA 2WFMA 3NHUA 4LN1A 4B4UA 4BKRA 4XUEA 4XVCA 3FHXA 1ZNYA 3IEIA 2MJLA 3ZK8A 3E3AA 4PRYA 3TIXB 3OZCA 3B1NA 2GB4A 3UJHA 4UARA 4HRXA 3FCEA 5AW6A 4ER3A 4FFMA 3E1KA 4KDEA 3WHLA 1SKQA 1Y1KE 3WVNA 4A4DA 1U4NA 3DLBA 4HNRA 4ARZA 2EYUA 1O58A 1H8EA 2QD3A 4HPJB 3OZWA 2B25A 1LPSA 3M1YA 2QXTA 4LS3A 4W99A 5DCUA 1UM9B 2O2DA 2XCIA 2BP7B 4NAVA 5DTRA 3ZK7A 3GLIB 1M6VA 4B8SA 1ZD3A 4DW8A 5KVVA 4JI7B 3M6LA 2O5VA 3EEIA 3WS7A 4XB6B 1Z9BA 1ORIA 3O94A 4IF6A 2IXDA 6GPBA 1Q1NA 1CK4A 2I55A 1CIJA 3ABZA 3BN3A 2I3BA 2OZLA 3P2KA 4WFJA 1N4DA 1UDBA 2J4FA 1FRZA 4B2YA 2YUIA 5TQ2B 2F90A 2QEQA 4TRRA 1N2CA 2Q5QA 2Y93A 1M2NA 1KOFA 4UAUA 1SUSA 4BFVA 4MW7A 1V4VA 4UEQA 5DHFA 4C2BA 1CJBA 1WY5A 1AZLA 2R65A 3E81A 4WKNA 1XNQB 1M54A 4QDOA 3T4PA 2NO1A 3AFHA 4WN3A 2UU9B 1D03A 1RD4A 3Q87B 3HC7A 3D7MA 3KK0A 3W1WA 4DCUA 5BSVA 3JQAD 1ZGHA 1NBWB 1RZ3A 2X9LA 3KEFA 2E4ZA 4DPKA 2JFFA 3I0NA 3MNFA 4O3MA 4YALA 2GWHA 1X1DA 3KVVA 3ZJVA 2ZZMA 1V4BA 1XZBA 3ACBA 5JTTA 8AT1A 5C3UA 1DKRA 2CE2X 1OU4A 2QPOA 1WVIA 2JJ2A 2QJTA 4ETIA 2V97A 2YRFA 3ENZA 3PUKA 3PD1A 4KMMA 3I2YX 1IBCA 3ODPA 3OWHA 4MYDA 1OX4B 2HJHA 5JAOA 1I94B 1UPFA 1I3CA 2DH6A 1WHSA 2HXSA 3CG0A 2C61A 2CCJA 1J33A 1ZNXA 2VK2A 3G13A 3H4IA 1YE3A 4L0DA 1U28C 2UUCB 3JY6A 3R6LA 2QIOA 3RT1A 2F48A 3E8SA 1K0FA 3ESXA 4P53A 3DLHA 3KEUA 3EN0A 3OLXA 4DA8A 3VNAA 4OI4A 3V2IA 3H8SA 4BMYA 3L4JA 4JI3B 1ORRA 1GCAA 3JVVA 4QGBA 1SEVA 1JZTA 1VJRA 4XCVA 4OV6B 4ZEVA 4LXHA 1PEDA 3TKAA 2D2IA 1BIFA 1RWNA 4E22A 5EYNA 4BGVA 1QG2A 3C43A 1Z4QA 2HEIA 2IE0A 1P0CA 2GZ3A 5HJEA 1G18A 1NDUA 4HNQA 1LBTA 3X2SA 4ON9A 5AP9A 2WJJA 3SU8A 2CL6X 5B58C 3G8YA 3VPCA 4ZI3A 5BUQA 2NW6A 4G5SA 3QVGB 1ELOA 2HWWA 4TKLA 4D8YA 2GILA 5F11A 4R31A 2D1RA 1K88A 4GRDA 4CKEA 5LQKA 4J0IA 3B20A 4UBJA 1Z26A 2X2FA 3GAZA 1RKDA 5KSOA 4AVYA 4RZQA 2X22A 4YAUA 3BXGA 2ZQYA 1ZHHA 2JEZA 3BJRA 1RZVA 4URYR 4W8GA 4GKKB 1JQEA 1NPYA 1YD7A 4MQFB 2QJOA 3CB4A 3OZAA 4CLDA 1JXAA 4HGQA 4H77A 4B17A 4DCMA 4DCNA 1PS9A 3IUSA 2V8OA 2TRSB 4DMKA 3BXPA 3EOZA 3RIEA 4BIIA 1ICEA 5F5XA 1E2KA 4LYDA 3S55A 1QHHA 2PA0A 3EGIA 3HN7A 1AMNA 2JI4A 1MA0A 3GO7A 1C0LA 3V1YA 3NHYA 4IOJA 1ZWKA 4B0PA 1DDIA 1K98A 2VOSA 4G81A 3HB4X 1YI1A 1KZHA 2GZDA 3OEHA 3N8HA 3PT9A 5J5VA 1XAJA 5KNDD 3D7LA 4LZLA 2ID8A 3F90A 3TQTA 3P0JA 2O3JA 1W59A 2W6PA 3E8MA 3NAMA 3STHA 3O91A 3R3JA 2QPLA 4KU4A 4EUFA 5HTKA 2A9JA 3FTQA 2MT9A 3DDUA 4AC9A 4I3GA 5DO9A 1NN0A 3T3MB 1EGVB 1DBPA 2A58A 1X0VA 4MUFA 4N65A 5E0OA 3WYDA 2IYUA 3SHWA 3DWFA 2I6UA 4KQHA 421PA 4RPIA 4IGAA 4QPDA 3U0BA 2WE7A 3UAOA 5BN5A 1C3XA 1ISFA 3EWSA 4JQSA 5D1NA 5C2JB 3HWWA 2BM0A 4JP1A 4O1LA 3AERA 3U4MA 3HYNA 3B1RA 1HOXA 1KEPA 4PQEA 3B7GA 4X1YB 1PU2A 1W8DA 2P9BA 3GBUA 4TS1A 1YR9A 5CB4B 3ZV4A 4I4TA 1UXJA 3H5WA 1E6UA 1NQAO 4IJWA 5BSFA 1O1YA 2VJOA 3GGOA 1DV1A 4ZC1A 1XZNA 5CLJA 3T3HA 1TM3E 1YKSA 3DBVO 3IERA 1GPBA 5BQOA 4OPMA 1PSDA 1ZLYA 3LY9A 4MX8A 4OH1A 3SDSA 3U7JA 1UFRA 4QLBA 1GGHA 5KNBD 3BK7A 2XNHA 4EI2A 5IFLA 3PNKA 3PFBA 1T2VA 3K71B 1QZZA 4DLBA 1KEVA 1Q0TA 3H4VA 1FSPA 1MZPA 1V6SA 3TAXA 4Q4DA 2Y8EA 2W2LD 1E4YA 4AFNA 4J0CA 5DM0A 2PKQO 2BR3A 5ELXA 1H4QA 3N2AA 1JKJB 1B6SA 1U3GA 4R4JA 4Q4AB 4HDMA 1PT5A 1GXSB 3ZH9B 3IAM6 3KXDA 2PKNA 1RBZA 5AFSA 2ZANA 3DCNA 1XWIA 5JJ5A 3L1UA 2GPBA 4UMFA 3G5LA 1NBAA 2NV0A 2UXBB 1SIBE 2EL7A 1MH9A 1NN3A 2GI4A 2O2IA 2VJYA 5F2KA 1E79D 4Q4LA 2DDMA 4LHSA 2FPGB 3FCSB 1XGKA 2FV8A 4KZKA 2VYFA 5ENDA 4EGAA 5ARBA 4DJFC 3T3GA 2DAPA 3ZU2A 1V48A 1ZSVA 1HBJA 1QOPB 1UQRA 1ZUD1 2DBRA 1ZKDA 4ESVA 3FKSD 4W9MC 2BFBA 2ZTMA 2P2SA 2J3HA 3Q4GA 5E6RA 4C87A 4U7TB 4U6NA 2FPLA 3G0BA 4MJ7A 1V8BA 2GEVA 1LBSA 5BSTA 3TB6A 2PWPA 4QA9A 4HEA1 1J2JA 4M0PA 4KJZA 4HCJA 4HWPA 2FCRA 1EVJA 4RA9B 2OP0A 3HADA 4QBTA 3W9SA 3VU1A 3JCZA 2ZULA 3GEIA 4IICA 1U4OA 3K6RA 3TG8A 4N4AA 4K03A 5LUAA 3G9UA 2GZSA 3SVTA 4LF7B 2QRGA 4TN5A 2BGIA 1U2EA 1YIDA 1Q44A 2J6HA 2VIIA 4JFRA 3FYSA 3QFTA 3V1MA 2RK6A 3L7CA 3AFGA 4FK8A 1T2DA 3B9BA 3PNMA 5ALZA 2B4RO 4CLRA 3RTBA 3JAMA 1J5EB 1R0SA 2NXCA 4IVQA 4CF4A 4FR2A 2I5BA 1PD0A 2GJSA 1G3QA 3OQVA 4HH4A 1COZA 4A6XA 2JAOA 5KQSA 1II9A 1XI2A 3CM0A 2PIAA 3PFWO 3VJKA 1IEWA 1AO3A 1XZDA 2JL1A 5EJEA 5JC8A 4MV9A 5HKLA 4KDFA 5KTNA 3A2LA 2PSFA 4TWIA 1C5KA 4WN9B 3T9DA 4YP7A 4YHBA 3TOCA 1GTZA 3ILSA 4TQAA 4B47A 4BP3A 4E3WA 3ROQA 2XCTB 2YC2C 1CEQA 3CX6A 2W4QA 4GZ3A 1I36A 3DMHA 1BKDR 4Q3NA 2E5FA 3F3MA 2IEDA 4QJ4A 1N0VC 1XDDA 3K05A 4EGFA 3A1EA 3IEUA 2FNAA 2H4WA 4DR7B 3ZVKA 3KZNA 1R88A 1YBHA 2G1AA 3D59A 4CFSA 5A3SA 1SIUA 3DO5A 4O8CA 2DDOA 3FI9A 3I8OA 3ZU5A 2N0SA 4XD7A 3Q8XB 2OYRA 2Q5CA 3H75A 4M0FA 3VC7A 2OD7A 4ZI2A 4ZI7F 1UADA 1G3RA 3MCUA 1FE8A 2A2ZA 4ND3A 1P61B 2IUUA 2FFAA 3C3YA 1T4CA 1S8OA 2ORED 1S7CA 1NQXA 3D4NA 1TJ5A 3O8QA 2HV9A 4LW8A 3SOZA 1CVLA 3ZTWA 3BORA 5D87A 5FBZA 4KR6A 3GU3A 1WZ2A 3SYLA 2V3WA 4H4CA 4C6TA 1G0OA 2RFLA 4XJVA 5CVJA 4ZAXA 4KQEA 3RV4A 1Z4OA 2J0EA 1ILWA 1V6AA 2ZIXB 1YVEI 3LOQA 2WD7B 1NUPA 4RF2A 5BORA 2OLKA 3FBTA 1UP4A 3IVCA 3ONVA 1AQNA 3ORSA 2VTVA 3BH0A 3K6KA 4JITA 1BXGB 4M7OA 4NMMA 5FPKA 2GEUA 2P2NA 3KR2A 1WG8A 2PRIA 4YV7A 5JUWA 2Q1TA 5L6MB 1H2HA 3RTGA 1GZ5A 4WD3A 1UJMA 4POAA 4HX5A 2ZRJA 4PM4A 5HILA 4BE7B 2WJ3A 2IEIA 1VXOA 1J8YF 1IEVA 4RAQA 4XJTA 2P4HX 4A2PA 2R6CA 1Q5PA 2CL0X 4E5UA 1L5ZA 4UW9A 3O8RA 2H17A 4ZODA 5K3FB 1KBQA 1UPXA 2V03A 4LPSA 4B4KA 1GCUA 4L7VA 1Z25A 3REFA 3BK2A 3DOCA 1PL7A 3RG2A 3O92A 1NRXA 4ETMA 1DC3A 3C5EA 1NBIA 1SCJA 3GUVA 3DPIA 3DXZA 4KQKA 2FJ0A 1ZUWA 3R5KA 4KGDA 1HNWB 3WAJA 1YNOA 3AVXA 2OXFA 4LVUA 4XLTA 2CUZA 3LFTA 3WLSA 2WAXA 4EAQA 4DJJA 4ZHSA 5CCEA 1RXVA 3JATA 3JQBA 4DHWA 4R5MA 4YH1A 3UMPA 5KQGA 3TDMA 1HK7A 1X8LA 2ZLBA 3PEFA 4IR7A 1DJNA 1ZRNA 1JDSA 3QNWA 4HI0E 3SJAA 1FOEB 2FPMA 3NPMA 4KGVA 1JHQA 2CJXA 3RVLA 3RRMA 3TX2A 4ALMA 4URZR 1NNEA 2BBSA 1VGVA 2CB9A 2PKRA 1PJTA 3AW8A 1RYFA 5EXEA 1YJXA 4ZXPA 3ZX4A 4BLPA 4C88A 1E3WA 2HGSA 4F7WA 3H0KA 3IV6A 1A0OA 1R00A 3D3QA 2PX5A 4W6QA 4F2WA 4NXNB 2VZ8A 1ODTC 1Z83A 1CDDA 2E4YA 2IYEA 2VDKB 4FYJA 4LHXA 5LQCA 4YQYA 1P73A 4Q3OA 4Y6GB 5ALHA 4A1OA 1M75A 1U2GC 3LRPA 1E9AA 3B3LA 3GBSA 4B1FA 3HWRA 3OWXA 1GKLA 2R8PA 1GV1A 1PUJA 4NZYA 3GR6A 1CZKA 4NJMA 1SXHA 3SS9X 1XPRA 5CEJA 5EIXA 3GG2A 4AZ3B 1JE0A 3UATA 4RF5A 4N41A 4PYNA 2J0QA 1N5LA 2RG1A 4O4IA 4PZEA 4I5EA 1W1IA 2JAUA 3A04A 3ICWA 3P4YA 1MV8A 1PT7A 4QU9A 5F7OA 1QP7A 2RGRA 1H3EA 3MD0A 4RMJA 2FPIB 3EQ8A 4C5CA 1DDGA 3BXFA 2VJAA 3CZAA 2DT8A 3PUVA 1JQJC 2YDXA 2BFMA 3A1DA 4KQXA 3KUDA 3AM4A 3ROMA 2FV7A 1QS0A 1PV2A 2G82A 3ZV3A 5TQ0A 2M6KA 1NVEA 1TVEA 2GK6A 4OM7A 5AM2A 4NXMB 1IC6A 4L5JA 2PX3A 4RFSA 5HUJA 3L40A 3OZTA 4DT1B 3O31A 4E5SA 4MVJA 5GIOE 5CFZA 4JYZA 1V19A 3HFJA 2O8FB 1T8WA 2PZFA 3QE9Y 1ESJA 2AC7A 5IXJA 4XQCA 3PX7A 3MF4A 3BFJA 1RM0A 2WIFA 1YZKA 3A7DA 3O8BA 4FB5A 3G2JA 5JECA 2XE6A 1I4OA 5ALGA 4JX9A 4J0JA 1GUAA 1Z0AA 4KQJA 4RPKA 2ZZNA 4BDSA 4GNRA 5KCZA 3BRWA 4HUJA 1BHO1 5EP4A 4D98A 1VI6A 2JDIA 1F7VA 4U5XA 4TRNA 1OC4A 1PRYA 4LI0A 3IA7A 3LC1O 2R3EA 1XP5A 1SM4A 1C8BA 3PEEA 1VE1A 2OKCA 4RY8A 4PG5A 2A4MA 1G4HA 2D5AA 3K0BA 3TRKA 2GF9A 3F7TA 3FVWA 3FTPA 1TNDA 4EJ6A 1BYUA 3I3SR 3SEFA 2OAQ1 4ZP1A 1WSBA 4KP7A 4RFVA 4YRJA 2HT6A 5LYJA 1FSFA 2K4MA 1WEHA 2I6SA 3NTVA 5AW8A 4N48A 4CPDA 3AK4A 1XPJA 4A3SA 2VDLB 3COJA 2HT1A 4QBIA 5F12A 4RC9A 3FNHA 3L6CA 5DLPA 5CFPA 3UMFA 3SZLA 3ZCUA 2FMUA 3CRVA 4S24A 1E2BA 1XN1A 4HWKA 1HF3A 2L0XA 1LWNA 2GFQA 2P75A 5KSZA 3MRSA 1TOAA 4F06A 1IHDA 3X1WA 1IZZA 1AK9A 1A88A 1VSBA 2YH2A 5GOTA 2NN3C 1E2IA 4EFLA 3ZLTA 4HDKB 1C2YA 3LL7A 3M6MD 4H60A 4IH4A 4C29A 2ZIEA 4RZ3A 4WIAA 2OYCA 3S2EA 1ZOIA 2CFIA 7ADHA 3THRA 1FRNA 1KJ8A 5HF6A 1U65A 3HGQA 4U3JB 4FGUA 1LKZA 3B78A 3SF0A 4D5EA 3IPAA 1M8FA 4Q9AA 3DXXA 1XXHB 2G8NA 3T0FA 1U2PA 4S1TA 3O0DA 1X9IA 3CKMA 1GJRA 2PS0A 3DAHA 4V02A 2GJ8A 2Q5LA 4HAXA 3RC3A 1JI0A 4B7CA 3OEYA 1A2QA 4MR7A 2B3TA 3SICE 4FNGA 1XN4A 2FR1A 3OX1A 4HR7A 4IWYA 2XVMA 1M67A 3PHCA 2AH5A 3E7PA 3HXKA 4OJTA 3MJVA 1XTJA 3DS8A 4HEJA 1W30A 3QBDA 3TOXA 1KJQA 3G8BA 4UTOA 3U3KA 1CY1A 2CFSA 4URUR 2GO1A 1Y9JA 1XLTC 3CNNA 1V1SA 5JZVA 5KYGA 1X1TA 4FKBA 1N3YA 1YS6A 2AIRA 1P2DA 4RIEA 2WWXA 3ND7A 1DQYA 4HWTA 4HDQB 1DWPA 3TZ6A 4X8HA 1H0HA 3T9CA 1JMKC 1KHHA 2X42A 1F17A 3VOSA 1AH2A 4P5PA 2WIGA 2G25A 1YULA 3IJEB 2NNLD 4X6LA 4H4EA 4HX9A 1ZNQO 1YJ5A 2PNFA 1QPZA 4OLAA 1YE8A 4LI3X 4KALA 3HHPA 2WJZB 3SDBA 3EULA 3M6AA 4CDMA 3F74A 2VRBA 4YRCA 5TMBA 2V9PA 1BO6A 1SOUA 2RH8A 3GQBA 4HAVA 1HKHA 2W4IA 1R0ZA 2R4UA 4KQFA 4R3WA 4X9XA 4C5AA 4LBGA 3UTDA 1Y33E 1Y37A 3P5BA 1X7YA 2JEYA 3L9XA 4QTTB 1CFZA 4BFSA 4O4JF 4WZZA 4BLWA 4D4JA 3O74A 1NYRA 4KQIA 2J3QA 4LXYA 1LPMA 2REBA 1XP8A 2NSJA 5IKEA 4CM7A 5CLLA 1T6BY 2VHJA 2B8JA 4IW3B 4KBYA 1N8SA 2ZYWX 1RQNA 4RJJA 4XEUA 1YE5A 4ZT6A 1OXMA 1R3UA 5LKRA 2YFQA 2OWEA 1OIVA 3Q3GE 2GBGA 1ZC3A 4FGZA 5IJAA 5I7HA 2VF7A 2O8BB 2HKIA 3ZE9A 1JU4A 1QKKA 3ZW9A 3SLKA 1ZGGA 2JD0A 1RWWA 4PF1A 1KQ3A 3TTSA 3UV6A 4GUAA 1WDTA 3DDCA 1K7CA 1EEHA 1QHGA 2VJBA 3QVOA 4AQDA 3CLSC 5CTAA 3T5BA 4DPMA 1MQ8B 2XUZA 4B40A 4ALLA 5KYVA 4B6QA 2QTMA 2ZAYA 2HDWA 1E1MA 3C3EA 3PXDA 1OFUA 1YB4A 3CKYA 1ZJ4A 2ACKA 4FUQA 1ESNA 3MHTA 4EKIA 4KFCA 1XNJA 4C0BA 4TV8A 4KO8A 3HDVA 3OFKA 3EYWA 1U04A 4ID3A 4REOA 3OZGA 5H9VA 5AKXA 5AJUA 4NG4A 1D5WA 5H82A 1Q7BA 3RHTA 3VH2A 4P08A 3DVAA 3TNLA 1BXZA 3P1JA 1P4JA 1ZS9A 2VUHB 4Y9UA 3S6JA 3PX3A 3O2QB 3TW4A 2H1LA 2JAWA 4E6EA 4EA7A 3HLKA 1ZP6A 3FN4A 5CU7A 1K7FB 1QDUA 2O4CA 4R8RA 1QU2A 1GQOA 2L19A 5JQGB 4RTOA 5DCWA 3JD0A 4ZYVA 2RE8A 4CT4B 3AP2A 4DRXB 4HATA 5AKKA 5IZCA 4IHAA 4YT8A 4RVCA 4QRDA 2QDXA 3ZGVA 1F0NA 2UZ3A 1V43A 2JFWA 3MVEA 4LFAB 4G4SO 4D74A 5EWMA 2CK3A 2AVNA 3N5CA 1PK9A 4L2IB 3SM9A 4L57A 1NVVR 1U0EA 3T54A 3V34A 2IRWA 4JYBA 5TS2A 3G0IA 1C1XB 1U1CA 2PWAA 3R0XA 3OKCA 3P9KA 4F71A 5COJA 4HAZA 1QX4A 1KZ1A 3C6MA 3DTVD 5BSKA 2AG0A 1OFGA 3NS7A 2ZPUA 1U0TA 3HCAA 3P71T 2VJQA 3R3WA 4MP3A 1P7VA 5IVPA 2I2WA 4B5LA 2FVXA 5A5GA 4XCKA 2FMHA 4JAVC 3AG6A 3FVQA 4FQ8A 4N12A 4OXNA 4Y18A 1DX4A 4EKEA 3EVDA 2BKXA 5AOCA 1K7EB 1VM6A 3JYPA 2Y1FA 1F3LA 1W35A 4ENPA 2V5UA 3UCEA 1OLUB 4H7JA 4YLYA 2GDZA 3A4IA 1JQDA 4D4MA 4GLFA 3WLEA 2PWYA 4H3SA 1WB6A 2FF7A 4E11A 1MT0A 3OJWA 1Y6ZA 1IXKA 2A57A 3DH0A 3REOA 1T1SA 1UAGA 1NM5A 2EKDA 2GZHA 2VXYA 4GXRA 1TDJA 4YRLA 3C5CA 4N0DA 2HHCA 3N2KB 4JC4A 3NPAA 1TUGA 2VYVD 1U7TA 5D7BA 4UXHA 1PLKA 3V97A 621PA 5KOJA 3LC2O 1GN8A 2ZTLA 2ZIWB 4P98A 5TS3A 4YRTA 3FWZA 3OJXA 1JFRA 1NUTA 1U3FA 1VG1A 1B73A 4KYIB 4NV3A 3SX0A 3QTBA 3FGNA 2BEVB 1O5TA 3AF0A 3R5TA 2EBUA 3WGZA 1G5TA 2JATA 3DBHB 3MGBA 3SZMA 1N78A 3R0JA 1HYHA 3SQOA 1HEYA 5C31A 3CF4G 1DJOA 1KETA 2OE2A 3N0XA 1AHIA 3OD1A 4PPFA 3RVRA 3U1TA 2XAAA 3COYA 3VO1A 1LSJA 3VR5H 3WBJA 3CH7A 4S1WA 4Y2TA 3GCZA 1LPAB 1P7PA 2C7QA 2HXYA 5B37A 3IHKA 2VSOA 4Q4JB 5CJJA 5K8LA 4KOAA 1MH1A 3PV0A 2O54A 4RD3A 4MSUA 2C59A 5TLSA 1XYVA 2J33A 2PMFA 2ZVPX 2P9QA 1KI6B 2WWHA 3M0EA 3PVZA 4K9MA 4BUCA 2QGNA 3LT4A 4IXTA 1XAHA 4M76B 4TQUS 1QRUA 4WXEA 3LQYA 4QEZA 1SQFA 2A1IA 2EHJA 2JLBA 2FPWA 4BU1A 4BZQA 1V1AA 4C4ZA 2DWCA 3COWA 4UHCA 4D3FA 3AVPA 3JVDA 3NCTA 4NS1A 3SLRA 2BFDB 4A1FA 5LQRA 4MHSA 4KRFA 4IY1A 4BAGA 3QU2A 2EQ5A 4I2VA 4ZALA 3C4JA 1JSXA 5GIPE 3PQ6A 2HDNB 4TLAA 3PNBA 2CXNA 3ZUPA 5IFKA 2LXNA 1RWVA 1FQWA 3PNPA 3QJYA 4NBWA 3UO8B 1EGMB 1W36C 5K01A 1AN9A 1AKQA 1B3BA 1PWXA 1YU6A 2QM8A 4MCJA 4Q9KA 4RMNA 2VKTA 3K0AA 4DCOA 4LZNA 1K5PA 4G0VA 1JWBB 2XB9A 2YY7A 1XDBA 2XLBA 3BQ9A 3I01A 1BS2A 4X00A 5E2IA 5AM4A 3Q7IA 3VU9B 3RC8A 4ZCPA 2PQ2A 3O4GA 4ZT7A 1S7GA 2C4TA 4KQWA 5ADHA 4CBVA 3TUZC 4JL6A 1E1CB 1LJ8A 3WLOA 5KTSA 4BMNA 4OLBA 3UAVA 2GHIA 3H9JA 3RRZA 5K0ZA 1CDZA 2PJDA 1JWLA 5EJ7A 1SG6A 1RYNA 3V2GA 1MX3A 4CMCA 4HXEB 3RYTC 4Q3CA 4ZT4A 4BU0A 1X94A 3RPHA 4ZMRA 4K6FA 1UPTA 2BKLA 4CG1A 1KAOA 2QQFA 1XCBA 4IFEA 4BY9E 2FWIA 3Q12A 4LZZA 3V2HA 2NQ2C 2AMFA 3C98A 3RG8A 1TZKA 3NRCA 2ASEA 2VBFA 4NQRA 3OLYA 5JXWA 4INOA 2WPNA 4G8DA 3ZU3A 3HZHA 1GTRA 2A94A 3L8MA 3WYNA 9LDTA 2JGDA 3GJYA 3N3AC 3ZWKA 1CUDA 5C37A 3KPYA 4PHGA 2PUEA 3NKFA 4D79A 2DKFA 4FGJA 3SOPA 5CCXA 1Y3HA 3B1FA 4CEHB 1BRMA 3SQLA 3OA2A 4K88A 4TLDA 3LJKA 4DNOA 2VEDA 3BF5A 2IITA 3RPEA 4EW1A 1IRIA 1SHTX 1NP3A 2UZ0A 2Y27A 1KWGA 3OH8A 1QIFA 1E96A 1XWFA 4YY3B 3EG9B 1C7RA 1FQJA 1UPUA 1RCUA 2H7VA 2XQJA 2Y1XA 3CE6A 3LT2A 5E9AA 4D57A 3K70C 3O1LA 3D6TB 3I9LA 1KP3A 3GT4A 4LSZA 2GHTA 4M55A 4ZQIA 1LCIA 2XNKA 3WIBA 3TGPA 2WWYA 1LIJA 4URVR 3S81A 4LDZA 3R23A 3G7NA 4PXYA 5FKJA 1DG3A 4NBSA 4JEUA 4UUOA 5JSQA 2DCUA 3NB0A 2J5RA