3RTCA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nad and atp.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 185
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtcA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtcA02
5EYNA 3RTEA 3RS9A 4XF6A 2HLZA 4C5JA 3LOOA 1LIOA 4K93A 2AFBA 3B1PA 4WJMA 3ROZA 3RU3A 1EKKA 3IQ0A 3RQ5A 3B1QA 1ESQA 2ABQA 4KADA 3VASA 3UQDA 3RTDA 5C3YA 3PL2A 2HQQA 4JJPA 4S1IA 4B8RA 3IE7A 2C4EA 3UBOA 3IBQA 3W4SA 5TRWA 2C49A 3RTGA 2XTBA 2PKNA 4E8WA 3GO6A 5C3ZA 2YXTA 1TD2A 3NL2A 2PKMA 4LC4A 4X8FA 3HPDA 4GM6A 3GO7A 2AA0A 3QAIA 3RSFA 2QHPA 4XDAA 3UQEA 4EUMA 3UMPA 2F7KA 3RO4A 3BGKA 2DG2A 3N1CA 3H49A 1V1SA 4JKUA 3RTCA 4S1HA 3FHXA 1LHPA 1EKQA 1YGKA 3NL5A 3BF5A 2DDOA 5C40A 3B1NA 2AX3A 1GC5A 3NBWA 4O1LA 2DDWA 3RT7A 1KYHA 2ABSA 4B8SA 2PKFA 4C5MA 3DZVA 3K9EA 1VK4A 4K8PA 4YL5A 4K9IA 4C5LA 4E69A 2A9YA 5CGAA 3EWMA 1JXIA 1UA4A 3GBUA 3ROXA 3RO7A 2I5BA 2AJPA 3K5WA 2F02A 1TZ6A 3KTNA 4E3AA 4EBUA 1VI9A 5BYDA 1BX4A 1V1BA 1LIIA 4EN4A 5BYFA 1TZ3A 3PZSA 1ESJA 3NM1A 3NCAA 1UB0A 3CQDA 4E84A 3Q92A 2JG5A 1JZTA 2RBCA 1LIJA 4XF7A 3OTXA 3NL6A 5F0ZA 3HYOA 2VARA 3RRBA 2JGVA 3UQ9A 4DC3A 1RKSA 3RT9A 2JG1A 3B1RA 3RTAA 1LHRA 5B6AA 4U7XA 2PKKA 3B1OA 5EY7A 4K8CA 3Q1YA 5CGEA 2R3EA 4O1GA 3UQ6A 3NC2A 1WYEA 3DRWA 3RQ8A 3LKIA 1RFTA 4E8YA 3NBVA 3RM5A 5BYCA 1C3QA 2AWDA 1RFUA 3RRJA 2I6AA 4XCKA 2R3BA 4YWRA 1RK2A 3MBHA 3RQQA 3RQ6A 4UBEA 1DGMA 3LJSA 3D3JA 1GQTA 4E8ZA 4EOHA 3HICA 4LBGA 2FV7A 3IH0A 4N08A 5C41A 3QA2A 3MBJA 3ROEA 1RKAA 2NWHA 3RQ2A 2O8NA 5TQIA 2DCNA 3KEUA 2AB8A 3NC9A 4KALA 3I3YA 3IKHA 4KBEA 3VAQA 2HW1A 5BYEA 4LCAA 3IN1A 2QCVA 4S1MA 3RNOA 3RREA 3KZHA 4LBXA 3RPZA 4C5KA 3RSGA 3RPHA 4KAHA 3RRFA 1LIKA 5CM5A 4KANA 3D3KA 1YGJA 1U2XA 2DDMA 3RSSA 1RFVA 2Q5RA 4S1IB 4N09A 2YXUA 1V19A 3JULA 1VM7A 1TYYA 3NL3A 3ROGA 2V78A 3RY7A 4K8TA 3UMOA 3B3LA 3KD6A 1JXHA 3RU2A 3RTBA 2A9ZA 3RQHA 3FHYA 2AJRA 3RSQA 1L2LA 3H74A 1V1AA 5COJA 5F11A 4K9CA 1RKDA 3RS8A 4DU5A 3LHXA 1YHJA 3RQXA 4K8KA 4JKSA 2I6BA 4C5NA 3NM3A 3ZS7A 4PVVA
chains in the Genus database with same CATH superfamily
1YB6A 2WAMA 1I2BA 1E7RA 1ZMBA 3N2EA 3H9UA 4L75A 3HVRA 4K46A 3GJ7A 3GRZA 1XCOA 2EX0A 1KWKA 1XDSA 2JEZA 4G4JA 2GN9A 2P78A 5KAPA 4BFZA 2ZZNA 2GZAA 4QWWA 3HY4A 2EYQA 4UVHA 1E58A 1QLWA 2B9EA 3UWDA 3KSDO 4R1SA 2CXOA 2AQ8A 2VZ9A 3QF7A 1P2UA 4JHXA 3UK6A 1SXIA 4E03A 4AU1A 2WJWA 1SU4A 5EMLA 3HY6A 3PFFA 4Q19A 2BP7A 1S3SA 3ABSB 4U63A 1LSJA 1V16A 1IY9A 3CH7A 3RJTA 3EXIA 2FSFA 4KACA 5FNVF 1QVZA 4FDUA 5TNXA 1OIWA 10MHA 4R1LA 1SC4A 1E2BA 4J0FA 1ZIPA 4Y2PA 2X15A 3LOPA 5CDSA 5ALDA 4C0BA 1SVUA 1KQFA 1M8FA 3O90A 3SG0A 1VMDA 5GZ3A 1C7EA 1NY5A 1CZRA 4YJFB 5E9WA 2AX4A 4K9IA 1T5LA 2R7AA 2O2SA 3VO9A 2ZW9A 1DAKA 2C8LA 4AXBA 5A6VA 1HLFA 1CUIA 5ILQA 1YI8A 4RMHA 4P7KA 4YJKA 1V1BA 4D82A 1XD2A 2ODEA 3DBRB 3HKBB 3WNZA 5BSHA 2W90A 2P4EA 2FW0A 5BPFA 3GLIA 5TMBA 3D9QX 1C0EA 2AMJA 3F7OA 4OI0A 3OZ7A 4H7HA 4LUCA 3H8JA 5CA1A 4HB3A 4LZLA 2AUTA 5BMVB 4MGIR 4QBTA 1O57A 1LLDA 4JJGA 3GGCA 4HYQA 4IJQA 1POWA 2B4KA 5EJAA 3SKYA 3ZXXA 4IFBA 4GBGA 4L3VA 3U1TA 2H48A 3EZGA 1H3EA 4OFXA 1QYVA 4JJIA 5COAA 2Q7OE 3RSOA 4DVGA 1Z2EA 5K09A 1DJMA 1VI5A 4EG4A 4ZHQB 5I6DA 3ZWMA 1PT9A 3BD6A 5KX5B 2ZOSA 4B4OA 4JB3A 2AS0A 2OP1A 4OLBA 4E13A 3ZIDA 2X8WA 3QEAZ 1IG3A 3CLTC 3KQWA 3FI9A 1N6HA 2FOLA 5CCXA 4IIFA 5FQNA 2Z4TA 5CGQB 4EB0A 5BSGA 3DP9A 3LYLA 3QA2A 4NNPA 3E7XA 3JWGA 3R3HA 1P2SA 2PY6A 1PSDA 3D6FA 3EBLA 4L5JA 5ALNA 2W6CX 1B15A 3VR0A 4OX9B 4OGWA 3CNEA 4F2HA 2WJ3A 1IOLA 2POQX 2QTNA 3DGFC 4JLJA 3PI6A 3RRFA 4O5OA 4I4CA 5FJJA 4HGZA 4NK4A 2Z2XA 3RVDA 3ZC3A 2CJWB 4EVSA 2JCXA 2PGJA 4YMTA 3CXRA 1U2XA 1M6HA 4Q00A 3E48A 5JSZB 3ADBA 3NL3A 2P8SA 3R41A 3I2HA 1JFTA 1TE2A 1W19A 1TMOA 1UKVY 2PS9A 4OLHA 2YNMA 3IAEA 3Q7PA 3RHTA 4RZUA 4GVLA 2Y71A 4MAMA 1BN6A 3R5TA 1Y8CA 3FBTA 2IV7A 1MA3A 4Q24A 2BYTA 5TY0A 2ZSDA 5H3HA 5BV8A 2V1UA 4ZVUA 5B1IA 3PFGA 1OPXA 4MIOA 1B43A 4HFMA 3LWZA 4MW9A 4E5KA 2CFCA 2DX7A 3I0MA 4X6XA 1VPTA 3TOVA 3QE4A 1VXRA 4DLXA 5KUTA 2CVHA 3I2YX 3KCQA 1H6BA 1ZD1A 1CUXA 3MJHA 5JJBA 4RABA 4RPGA 4QKQA 1RXVA 4BAZA 1LF0A 1Z16A 1Q7TA 3IB3A 3MYYA 1GZ4A 3IAUA 4B8ZA 2F43B 5JH7A 4U0JA 3BQNB 1V6AA 1OXUA 2GARA 2JA2A 2QUIA 1XZCA 4FLFA 1OWLA 4GP6A 1TQ2A 2BVNA 1ZRNA 3TCXB 4WZAA 1R8YA 3NL2A 4XIGS 5AKKA 5CCBA 4H27A 4EZEA 3DHEA 2O6LA 4L4RA 5AKYA 2F43A 1XHLA 4ETNA 3NFYA 5JI2E 1A9QA 1JBQA 2WKQA 3FJYA 3OZDA 5J63A 4GU5A 4N0MA 4PNHA 2IU3A 5DNEA 3RC3A 1BFDA 1GPNA 1CQIA 5AI8A 2PRJA 3OZWA 3LCCA 4EHAA 5GTDA 3QU7A 3RT7A 1OFUX 1E69A 1AXEA 3I2JA 4OJNA 3LY9A 3OTIA 3LT0A 2HSJA 4QIHA 2XYRA 4HT3B 2I9KA 1HX7A 1QBKC 4A8JC 4FGLA 2D5IA 1NGSA 4G5XA 2AUNA 2Y1WA 4FN4A 4LECA 5K3EA 2VN8A 5IH3A 5IYZF 3QZUA 3AL2A 3PXGA 2RGAA 2QD1A 3ZCUA 5DYNA 3DDOA 3TW8A 4DV3B 2WYIA 2B5WA 3FRHA 4EG7A 4RQAA 3ZEIA 5C53B 1EWTA 2WUWE 4FEEA 3M4YA 5T7BA 4C5BA 4MKFA 1LV8A 1LIJA 1T0PA 5DDIP 2B34A 2H16A 2R6AA 4GQBA 4OF4A 2VC2B 3UZUA 1ABEA 5IEJA 3I37X 5IBQA 4BNWA 4D0NA 3IL2A 3L5OA 1KR2A 4FNAA 1ZITA 3JALB 1FNNA 4JGGA 4ZI7A 3JQ9A 2ARKA 2IXEA 5DRYA 3CT4A 2V3CC 1M6VB 1ULSA 3ADPA 4XUCA 5EJ2A 1O0SA 4AC9A 4PG5A 4H7FA 3MWLA 3AW8A 2D0OB 2DGDA 2Q6IA 2RBGA 2VJDA 2VT7A 3DCYA 3DEYX 1UBNA 2M32A 4R8MA 1JR3D 1NBWB 1YJ8A 3PEUA 3MT0A 4MGKR 1QBGA 2GHTA 1NJ8A 4XD2A 3USES 5LMZA 3H75A 3VPFA 4QJIA 1T26A 3GDGA 2H18A 2HWUA 1W5TA 3Q4GA 1N9GB 4H6XA 4I1RA 1E3WB 2X3FA 4IAOA 4DM4A 5KHOC 1IG0A 3BXZA 4OHVA 2N46A 4RY9A 3V7UA 3RC8A 4DIUA 3ASZA 3CVWA 1KAGA 2BKEA 4X1IA 5AOAA 3VDMA 2X42A 3PC3A 3SLKA 4QICA 1ECFA 4DSNA 1O6CA 4EPXA 3RUEA 1OGYA 1GTMA 2JLAA 2WVHA 4OHBA 1V26A 3EF3A 2EW2A 1T9GS 3OQOA 4G37A 4WD3A 2IY7A 3A9SA 3AUSA 3OX2A 5CD9A 2GCIA 2XKBA 2JBAB 4NWIA 4JQZA 2EAUA 4ZRMA 3ZEAA 5JNUA 1EZ1A 4OHCA 1PJZA 2GNAA 2O52A 1GAWA 1MABA 2JZCA 3RTBA 4F91B 3DDNA 1SQ6A 3N70A 3NBYC 3T1TA 5LD2C 3W8NA 4ZT6A 3SYRA 2DHDA 4LF6B 1R18A 1EFKA 5FOVA 5DU2A 1PJTA 3T8YA 3UJ7A 5I5GA 1D4FA 2XA2A 2W2LA 4LY0A 1S01A 2PZKA 2R8EA 3BWEA 3BULA 4BEJA 2OHJA 3DOFA 3Q7RA 4V02A 2DBVO 3I5UA 5AH0A 1QVAA 4L27A 3R8FA 1XALA 2Q2QA 121PA 4B3DA 4F1JA 2AIRA 3IAS6 1FU8A 3C6QA 3K0KA 5CFPA 2IPXA 4CI0B 1XI2A 1ORTA 3PD0A 1CUDA 3B3GA 3ZGOA 1JBEA 4Q7MB 3B9QA 2HMYB 4HNAB 3RV3A 1M6WA 2J3KA 3QKTA 4C7BA 3GRFA 4ZVRA 3M6WA 3BJMA 1XRLA 2G70A 1H5UA 2HRCA 2OD2A 4ZAFA 2HMVA 2R7KA 1W5FA 2CLSA 4JS0A 1W0JA 3OTOB 3EIXA 3SK0A 2WWWA 3QX3A 2VI5A 1R3UA 4MV6A 1V1SA 4RVFA 1Y6JA 3FPSA 5IYZA 2RI6A 1G4HA 3ON5A 1GQOA 1UEJA 5DWQA 1QF9A 1R66A 1VIYA 4ZC1A 3TXYA 2QRVA 3DTVB 3RYFA 2JBWA 3WLJA 5K8UA 5FA8A 3R7BA 1KYHA 2O0MA 2CHQA 4GVPA 2PKFA 1MXHA 1AS2A 1XU7A 1O96A 2VJPA 2HK9A 3FUTA 3PCTA 4PQYA 4KSYA 3EXHC 4ENVA 4ER5A 3OHPA 2QRPA 3JQAD 3NG1A 4JQSA 2WV7A 1QE5A 2PR7A 4JKYA 2X9NA 4I4NA 4PX3A 3JATB 3I5YA 2R1VB 4J0HA 4O0LA 1NKVA 4A2QA 4EG0A 3PGVA 1L1FA 2Z8ZA 2G77B 4J03A 1QNLA 2WAXA 4D25A 2IU4A 2RGDA 4DR7B 3MWJA 1CUJA 3VTFA 4DDMA 1THMA 5DSZA 3HG7A 4D4IA 4JVLA 5AM1A 4UZFA 4H1TA 3WDLA 3PFWO 1OF1A 2GJ4A 2CUNA 3IXMA 5JJKA 1G2QA 3NHJA 5LMUB 5LYJB 3LBHA 2PUHA 1HMYA 4OJYA 1PR0A 5JCJA 4KGZA 2FZ5A 2OFPA 3B3QA 3V4OA 4Z4HA 4FHZA 4YCBA 4K8RB 4FM9A 2FDXA 4LJ4A 3B6ZA 3SE7A 1YA4A 3NC0C 4RADA 2PGDA 2EARA 3V55A 1YMVA 1SVWA 2UZ0A 1UZMA 4R2KA 2UUOA 1S2OA 2VUSA 3HRIA 1FUYB 1BHQ1 3U4IA 4JCOA 1M76A 2R6GA 3LMKA 3ONVA 2V58A 1YOVB 3M6UA 5F1YA 1ZVMA 5CTJA 5AJWA 3K9GA 4FFDA 1VXOA 4FYKA 2AW3A 3AEUA 1KQNA 3B6MA 4KR2A 1L7VC 5AKIA 1XUOA 3NGXA 1LTQA 1DQNA 1DP4A 2JIZD 3HJNA 3JQBA 4J07A 1J49A 4OP1A 3TJRA 4RV5A 2JEOA 3DKKA 5HK8A 3WHPA 4JU8A 1Y7PA 3CG4A 4QARA 2O3QA 3HWWA 5A03A 1DC4A 2XMPA 3EGXA 3ROGA 2A78A 3T4UA 1WEKA 5KYUA 3EY9A 4Y2QA 5HZMA 2ILTA 1Z7YA 1SQ5A 5B3JA 2ONKA 1NG9A 3B3LA 1MT3A 2BKLA 4MEBA 2J85A 1Z82A 3JQQA 4PIVA 1MPTA 2C4WA 4KLZA 5JNSA 3F5QA 3F90A 3SGLA 1M1UA 3LRPA 4OP3A 1BCRB 4W9NC 1J0DA 1K6JA 5ECDA 5AW2A 1FFGA 2BBSA 5E6UA 4QFBA 2VXBA 4RXUA 5IVPA 3SEFA 1W1IA 3H9GA 3LECA 3ZD8A 3KT3A 5KYXA 2H63A 1AH2A 1MJGA 2YL2A 1SHZA 3F97A 4TLAA 1Z5WA 3TPCA 1LU9A 4FE3A 3ZWKA 2XVAA 2XSZD 2JI6A 3HCEA 3P2EA 4GXQA 2XE7A 4HDSA 1FLVA 3GNLA 4H6VA 3ZXIA 4NBLA 2CXRA 2GSWA 4S1NA 3LQ4A 5FHRA 3SZGA 2LBPA 1E2QA 4WBNF 3GEEA 1ONOA 5A5FA 3T0FA 2JJYA 3BWMA 4L74A 1CZOA 1ZH8A 4EL0A 4EKGA 3O8NA 1O5OA 1OLXA 3IQIX 2JH3A 3IIJA 3K0CA 3LUDA 3U7RA 3PQ2A 3FVTA 1SVNA 2DTDA 1MCZA 1JSXA 3SF8B 4F4HA 2O20A 4DPKA 1K89A 1KRWA 3FM9A 1GUZA 1Q1NA 3H49A 2H1SA 1RAHA 3KSRA 4IIHA 4QYSA 1WNFA 3R9KA 3IT2A 1LFDB 3LXUX 5AT1A 3ZOKA 3QTTA 3BF5A 4YP6A 2Q5OA 3Q3IA 1VHJA 2UVDA 4IF6A 4B2PA 4JBGA 4K2HA 5BVHB 1SXJA 3I23A 3T4EA 4L4SA 1IIRA 4Q3NA 3D8BA 3TSWA 4M60A 2C2BA 1JAYA 2P4HX 5B2EA 2Z57A 3FNQA 4H0FA 2ZUFA 3B3FA 4NFLA 2C61A 3ZIAD 1T5SA 2VZEA 2AYZA 1T2CA 1Z29A 1U9IC 1IOVA 4RY8A 3HVHA 5F2EA 2AM1A 5BURA 1S2NA 3TL6A 2WTEA 3KDAA 1SXJB 4HEQA 5BW5A 1G17A 1VIVA 2IHJA 3A7DA 2O50A 3F5FA 1QFMA 3DYBA 2NU9A 4IWXA 1JL3A 3G9XA 3G17A 2ES4A 3LVFO 2B9VA 4HH1A 3R8XA 4NESA 4EYQA 3HO6A 1IVYA 1KK2A 1QGZA 4J0CA 3KRTA 1XNQB 3SR3A 4D80A 3QYJA 3DUWA 4CYMA 2F3PA 2IEGA 2PBFA 1WZIA 3JYNA 1SQGA 2R84A 1V11B 4LK2A 2AKEA 3MCUA 1LVUA 1LX6A 3OQVA 4HAVA 4YXWA 3DLPX 3IIEA 3MWYW 3V8NA 2X1VA 4AM8A 2V0GA 4EY5A 3N0VA 3NHKA 3OWHA 3W1WA 1YB2A 3KBOA 1H1LB 4BOYA 4E22A 4EW3A 5IWAB 4P0QB 1MFZA 2C9MA 4BBPA 1M1XB 1MB9A 2BFOA 1TXGA 3FVWA 4LTDA 3BTOA 5T4BA 3TTSA 2QNBA 5JSHA 3T3MB 1ZYUA 2IWRA 3SIRA 1GLVA 2I1VB 2IUSA 3H8WA 5DCYA 1SUPA 1J9GA 1GKKA 2YVUA 3W5SA 1CHDA 3MM4A 1N2OA 1ESZA 1CRWG 2J7PA 1MVLA 5IKXA 4TM8A 4A1FA 1K7XB 1RC1A 1LB1B 1SC3A 4GLBA 1FQOA 2JVKA 2QW0X 3DULA 1KPGA 5IM4F 1DAIA 1DBQA 2YXPX 5J47A 4L4ZA 4NV3A 3IP8A 2I8CA 3H4VA 3V7YA 1U2PA 4DMKA 2O05A 1U0HC 2PG3A 3JVVA 2IA5A 5JSUA 3LFUA 5U4XA 3M1YA 3RWBA 2KBFA 2QM7A 4PFJA 3WGZA 4JBHA 4LV6A 5IFLA 4RIIA 2WICA 1IM5A 5FD8A 5KNBD 1KS9A 3TMKA 1YV9A 1UWKA 2CKMA 2OXEA 2QG9A 3ZKWB 4NQRA 4HB0A 5JHGB 1OY1A 2ZAIA 3S0JA 3OPYI 4YIHA 3Q3JB 3V6MA 4D5GA 3DLBA 1TTHA 4JLBA 2I7VA 1PUIA 4NEGA 1ID1A 1ORRA 4JVNA 1URPA 1K86A 3TAUA 1HE8B 3UAGA 1OH7A 2HLZA 4BQRA 1C4XA 1DMRA 1SCUA 1T29A 2G07A 1Y7HA 3A3YA 2OWDA 3L40A 4PTLA 4NENB 3TZQA 2VYFA 2Q5LA 3AFMA 3F96A 4CG2A 3JWHA 5A02A 3EIQA 3PC2A 4XIYA 4S1IA 3LPLA 5BWBA 1ZUIA 4PQGA 4P0PB 2CYBA 2VRCD 1O0BA 5BYBA 3I76A 3HBMA 1NZDA 1FPMA 2WZDA 3AY7A 4MMYB 4JT8A 5LQJA 3CVXA 2XTBA 5CLFA 2R4UA 4IH4A 3F47A 1SBZA 1Z4IA 3H3XA 4RZIA 4CTMA 2A0WA 3K31A 5A71A 4I4IA 2Q3DA 4R1TA 3CLSD 4XVUA 2IHNA 3O4IA 1F2UB 3A1DA 4GO1A 4RJJA 3R5FA 3MW8A 1W2HA 2AM2A 2DDOA 3BJIC 3U4HA 4QUBA 1LSUA 2Z30A 3MTBA 3MJTA 4DKXA 3NTLA 1CNFA 2XD4A 1BCRA 3HSKA 3O9VA 5FH9A 3TG2A 2PBLA 1N2ZA 1XTQA 2R1ZA 2GN1A 4Q1EA 4ZZ0A 1E5TA 4G5SA 4YRNA 3H04A 5BSEA 4PYRA 3FGNA 1EBUA 3N58A 2A0UA 4ZFNA 1KNXA 4BLPA 1F7VA 1T3HA 4JC8A 3BDIA 4HNVA 3F7MA 2ZM5A 1R5NA 2PSFA 5CFMA 5J43A 1GPUA 2Q9UA 1THGA 3REOA 4MS4A 4WKGA 2VCYA 1PWZA 2CDAA 3M2PA 3ODGA 2CLMB 4WESA 4EW6A 4IXDA 3D8SA 1J2JA 2CD9A 2PPLA 2WD7A 2XT6A 3T7IA 4WDRA 4EATA 1NV8A 1ISFA 3U4MA 4JUAA 4TKVB 1RZRA 5IULC 2WSIA 4NZ9A 3TB6A 4HC4A 4M89A 2IPOA 4AFNA 3M6VA 1BIFA 3G6KA 1K5DA 5E4YA 5E8JA 4CPDA 5I01A 3BEDA 3WYGA 4Z3OA 3KR2A 1DTWA 2WJZB 3TD2A 4EUHA 3N7AA 2H52A 3T54A 3VZCA 1QUFA 1QIEA 1CQJA 3H9BA 3HICA 4FBLA 2Q3EA 2GAJA 2NW6A 5KYKA 3K9BA 1TJPB 3I61A 4RFVA 3WWZA 2ZJYA 2ZI9A 3GLUA 2X5XA 2BMJA 4DLTA 3ORYA 5ADUS 5L7TA 4LVOA 1O97D 1JPNA 3TB4A 3QTBA 4LBXA 1JHZA 1Q2UA 1MRZA 2JFQA 4RO0A 1T43A 4B31A 4ND8B 2P0YA 1HXHA 5AW8A 2AH5A 4XM0A 1DEOA 2R5FA 3KVVA 1MD9A 1INLA 2GYWA 1T1RA 4EJSB 1PEAA 3KLBA 4F7DA 1OLOA 3KD6A 3CX3A 3ME5A 4Q15A 3WJ2A 5K3OA 2GXAA 1JPUA 1RBQA 3SJCA 1DAEA 1AKYA 1JLMA 4PZPA 2OFWA 1TTTA 3C6MA 5FWNA 3E8XA 2CNBA 3SMQA 4RSGA 3LBYA 1EK0A 3UT6A 4DUZB 4GZMA 1QHNA 1SZCA 2HCTA 4V3CA 1F38A 3EAQA 4D98A 3OOHA 5M5BA 1Y1TA 1QCZA 1VA5A 3BILA 3HJGA 4DCGA 1Q21A 3BERA 4RM3A 4PYJA 3R76A 4P4NA 1RKDA 1LUAA 1EWRA 1JEDA 2YMMA 4PAMA 2BDUA 1UJBA 3L7OA 5CT6A 3ZZ1A 2FMIA 4DNFA 2BI7A 5C3YA 3VAYA 3NBUA 4LEIA 4EECA 2BEKA 4ZT5A 5T4EA 2OCXA 1YMQA 3G8DA 1Q0TA 3E61A 4URZR 4FTWA 4YMHA 2Z2KA 4UNIA 3ET5A 2I1QA 1W4CA 1T4CB 1L5OA 2QM0A 1KTIA 1XEXB 3X0DA 4DCSA 3DHYA 3D6HA 1PLJA 2I1LA 4YIKA 4M1ZA 4HJRA 4BP9A 2C04A 3C24A 3A11A 1LS1A 4OMUA 3LNTA 3VPHA 4BNZA 3ML1A 3GRKA 4EHLA 4FC7A 1XZAA 3CS3A 5TVGA 2PU5A 3GZNB 1TQHA 1SOVA 1XGKA 3T9DA 4N8SA 3LAWA 4Q93A 3CKMA 5EZQA 4K28A 2JAOA 4PLVA 1C3EA 2DH5A 3RS3A 3DNFA 2O2IA 4F3CA 1EE1A 2C8VA 4IV0A 3UKOA 2B0CA 1G9TA 2BSAA 1GXSA 1XVAA 2B2XA 2PKCA 3HN7A 4QL3A 5KYVA 1WW3A 4L0MA 3QP9A 1M5UA 4G9EA 4N03A 4ZREA 2X7JA 4NG5A 4QFMA 3T12A 4K05A 1W96A 4BNLA 3ZM6A 4JI2B 1VL5A 5EJ7A 1E96A 1Z56C 3E1KA 3AERA 3WV5A 3WJAA 5BQPA 1D6JA 3F4LA 3I32A 4G36A 2BFBA 3Q2KA 4X6LA 2XCTB 4HLNA 2CV1A 2HDOA 4GZLA 1UOPA 3B89A 1ZI6A 4KSCA 4ZGBA 1JIXA 4GR4A 2HLDD 3PWZA 1Y1QA 5FQOA 3K9HA 2E89A 4AULA 4DSOA 3EJ6A 4COOA 2G08A 5SZKB 3UQZA 1Y6QA 5EPOA 4GYWA 4AJOA 3KV3O 1ZMTA 1C80A 3MJEA 4FYVA 1J7JA 2OAQ1 5EKDA 2OY0A 2FJUA 4IOMA 3ZGNA 1R4MA 1IU9A 1GPLA 5JARA 1ORIA 3EWIA 4LQDA 3F3KA 3UWPA 4CIYA 3IEVA 3E1GA 5FTKA 2Z4SA 4ILEA 4CMEA 1E0JA 4FWTA 5J2TF 1CE8B 2Q6KA 2XNKA 1E5DA 4HB4A 5JRZA 1UDCA 3V32A 2YN0A 2KPOA 2NN3C 3HCWA 5G4KA 4D6PA 1WOYA 3E58A 3F8SA 4PCLA 2FH5B 4YFVA 2ASVA 3SSOA 1DINA 1S7GA 2AD1A 2GM3A 3GFPA 3INYA 3S7TA 1QU2A 3RWMB 4ITVA 4QYIB 4KXUA 1U0RA 4JKOA 1PWYE 3O93A 2B3DA 4XPIB 3KEGA 1B41A 1R3DA 3P2JA 2X77A 2QTVA 4I0WB 4KMSA 5TQ0B 1L7BA 2R8ZA 4IVNA 2PL3A 2IDZA 2WWRA 1NUSA 2P69A 4N54A 1IHPA 2P6UA 3PD1A 4BV3A 1KZ6A 2FB9A 1H0RA 1JBVA 3K5HA 1GCOA 4JAVC 1HWYA 4XQ0A 4YCDA 4LI0A 4TGLA 1NPYA 3TDNA 2ZSJA 3LO5A 1KTVA 4ZI3A 4ZV4A 2Q8QA 3E0XA 4MWBA 4QBHA 3EXG1 3ROZA 2OA0A 2NZJA 4J3NA 1VKOA 3A9VA 3RVMA 4XVCA 5A5VA 3PJFA 3SS7X 3WGGA 1NLZA 4DLLA 3WFIA 3GGPA 2GN2A 4H7KA 3MAGA 4EPYA 1SHTX 1UC8A 1ZVJA 1Z22A 3K9CA 2WQZA 2YRWA 3KHTA 3T3IA 1EGHA 5LUBA 3Q3GE 2Q6LA 2OORC 3MRSA 4I4LA 3HN6A 2FRDC 2JHPA 1G64A 1Z8HA 3BMNB 4UCXA 3RSHA 3ZHRA 3FDIA 4IYRA 4B46A 1R9NA 4MVJA 4YJ2F 5FRDA 5JFGA 3PEWA 2P40A 4RETA 1DQYA 3BL8A 3PI7A 4R1PA 2IHUA 4EY3A 4QTYA 4IQ4A 3PNLA 4WT7A 1ESMA 5C40A 1UKAA 2FE1A 4QX6A 1C81A 3A4TA 1VHLA 3L8YA 5EHZA 4PCAA 4JI8B 3O3CA 5YASA 2GRAA 3QKUA 5CW2A 3QIVA 2NYRA 1E89A 3WGOA 4BMSA 3FTQA 2JLYA 1VK4A 3DDWA 1SVKA 3SQNA 1W36D 2W6ZA 4R8KA 1M83A 3DDCA 2J3DA 4P7FA 4HH4A 2R66A 2RFLA 3LY5A 4FXOA 4QXQA 5L53A 4M9ZA 1VLVA 2R11A 3L6CA 2M6KA 4EBUA 1V7PC 4Q7JB 3L8ZA 4TKZA 4W8OA 1KI4A 3HA3A 3AWDA 3A4YA 1WW8A 2A9FA 3K1JA 2DMRA 2XKAA 1QYIA 3PWTA 4DLZA 4HLDA 3UCEA 4D9BA 4HNSA 5CJ2A 2W0MA 2IEIA 4OQLA 4YUZA 2JLSA 5IJXA 3GPLA 3IDFA 1CJBA 1NUAA 1WSBA 4MQFA 1V16B 3UMSA 4DS3A 3ZUGA 2OBNA 4G0OA 1I1HA 5FFMA 1X39A 1AHNA 4PIPA 5FIUA 2R3EA 1TAQA 1VGQA 2CE7A 4HEJA 4LMRA 1Z5GA 5HRAA 2FPLA 3JS5A 4XFJA 1BXZA 3BHIA 3MJVA 5EIWA 4E5UA 5B1YA 2ZRPA 4BB9A 5FBVB 3GLSA 3RFVA 3R3WA 3MEQA 3QV2A 3U7QA 3MBHA 1V4VA 2ZIAA 4RPJA 3AVUA 1TF5A 2GEVA 1V41E 1GQYA 1QH1B 3JX9A 4ARCA 4REOA 4JU9A 4N08A 1FLDA 1M0SA 4KLRA 2XQIA 2O3SA 5IDVA 4OHFA 3OZRA 3DAGA 1L5RA 3EIEA 4G09A 5EERA 1QORA 3GA7A 4EMSA 3F5DA 1OBVA 1PTKA 1R5JA 1U3CA 4K6OA 1P9WA 4S1MA 2H00A 1MRSA 3PDHA 5E7IA 4HAXA 3DAHA 4P22A 3FPFA 1ARZA 1FS5A 5FBWB 3DE1X 1MNQA 4NOKA 3W7VA 1K6XA 4CG3A 4JDPA 1PUJA 2RK4A 3FLBA 4ZT3A 1J39A 4PYOA 4NYJQ 2NAFA 4TT3D 1M7HA 4UC0A 1MO2A 3ER6A 5E7JA 4WZZA 1P4JA 2IEDA 4LE0A 3U37A 1OI4A 1RAFA 4G5YA 5HCUA 1HT1E 4P54A 3U7EB 3DFZA 1F8YA 2JI7A 5FAXA 4AD8A 4BS9A 3OJFA 3L41A 3BCRA 4K6MA 2J5BA 4Z53A 1FF9A 2E4ZA 1EP1B 3IRVA 4ZQCB 1R6VA 2FLWA 1GFSA 1KORA 1TO6A 4KFUA 4EGQA 4UOEA 1QHFA 3T5DA 4HMOA 1TQ4A 3SF0A 1P9LA 5BWCA 4PVVA 2WSYB 1CJMA 4GFDA 1TAUA 2H9AA 2XLCA 1P1JA 4L02A 3ZTTA 3P9ZA 2CT8A 3Q15C 1CU1A 4YFYA 1FTSA 4EG3A 3MGGA 3OC6A 3DEAA 3L8DA 1XPOA 1TYZA 4QUHA 4WPGA 3NVDA 4XJSA 1IHDA 3HB9A 2O4CA 1YJBA 4BFLA 1KBOA 3TTWA 2M1ZA 1GPWB 3AJ9A 4I7EA 3BRSA 4NI5A 2OM6A 3EVGA 1YS4A 2GAAA 3MVEA 2IIVA 4IXNA 1LF5A 1JKIA 1HYEA 3O84A 3HRKA 1UK8A 3S2IA 3PXUA 5IJ0A 4YRRA 5HUQA 3NTUA 3BSWA 1Q95A 4DIOA 2OCPA 1L5SA 4GMGA 3JQCA 4B34A 1B00A 2RONA 2IYLD 2A9KA 1A5SB 5JMWA 4PC3A 4LK3A 4EY8A 3EASA 4E7PA 3UJ3X 1S9HA 3DWGA 1VSQA 2VAVA 1Q1EA 2XY4A 3CF6R 4FR0A 2KX7A 4R8SA 5LZ2A 3LUHA 4DWJA 2WUDA 2OMEA 3W3AD 3NHSA 3K96A 4YTEA 1RC0A 3MWEA 4WK0B 3D6MA 4H3KB 1KI2A 2H9YA 3ZV3A 3TLXA 1II8A 2GBCA 4JJZA 4X20B 2P2GA 3ZW9A 1E1NA 4LHWA 3A1TA 4WGGA 4EBBA 2PZGA 1PJ3A 1AIPA 4PLHA 1E0AA 4Q4JA 4TVBA 5KNCA 1TZ3A 1C29B 1Y8AA 4V24A 3VU1A 2VUHB 2WJ4A 2EATA 2J0QA 2OBFA 3RUHA 1T4MA 1TKAA 5B55A 1FTWA 5JAOA 1E6LA 1ZHHA 2H07A 3C3BA 3NWJA 4P6VF 2PUCA 4QJ3A 4DT1B 1J7KA 4JLKA 1J9EA 4Q0MA 3ZJYA 3JRXA 4MI1A 1VRVA 4TSKA 3SHQA 3B1XA 3C1UA 3I9V1 5F12A 5JZVA 1JLHA 3FWYA 3PB3A 1O3YA 2V0CA 3CINA 1CY2A 3GVPA 3A4LA 2FFQA 3L7JA 4NNOA 3GLRA 2FPUA 4CL2A 1B1AA 2OCKA 3MSCA 2XWQA 4W8GA 4H1WA 3G89A 1ZONA 4OHWA 4Q1CA 1DCKA 2FKAA 2ERCA 2R4QA 3TWOA 3A9UA 5JALA 3ANXA 5G1PA 4P3KA 2C9CA 3FF4A 3MZ0A 5CLQA 1E18A 2NV2B 4Y98A 5IVIA 3ZH2A 4E6PA 2J07A 1QP7A 3A10A 2DQ4A 1H0KA 3C8UA 4M3NA 4PZEA 4RA6A 4IKOA 2JAHA 2ZE6A 4B3MB 1PI3A 3EXFB 1QK5A 2WT9A 2J3EA 2BGUA 4NH0A 4UAVA 1E2KA 1W76A 2H06A 1KY5A 2XZDA 4MAAA 4RCVA 1KOLA 5HJ7A 2H6EA 1NMYA 1X19A 2VTVA 2EGHA 2EJVA 3NKFA 1KI6A 4NVRA 1E0SA 2R25B 3QV1A 3HXMA 2YXUA 1R15A 2EP7A 4I9HA 3Q9UA 4UXIA 3DH0A 3NV9A 2WUFA 3ZWQA 3NTQA 4FIDA 4P3NA 4OY3A 3SAJA 4C14A 4W5JA 3D54D 3LBFA 4PLWA 4YRFA 4DCTA 4NBRA 3RY7A 1QV7A 1UMCA 4JR1A 4N5NA 1TJYA 3PC8A 3P0HA 3EZXA 3UN1A 3HCAA 4ZANA 3ZU4A 3V8RA 1EVQA 3WGQA 4AK9A 2XEXA 4EJ0A 1JJIA 3F6EX 3P2KA 5AM5A 1YRYE 2VJMA 1W4LA 2ZIGA 3DO6A 3ZHXA 3NBFA 4ZU6X 5CB6A 3V1UA 2NXJA 1BEUB 2PUDA 1CUAA 4WDQA 3L4EA 1N34B 2WBLC 2YOFA 5FCDA 3FUXA 2IZ1A 5JC8A 2FSGA 1UMKA 1OFIA 1WM1A 1ZM2A 2JKVA 1DEAA 2XXAA 1M1NB 3BA6A 2CNLA 4TTTS 3IMEA 2XD9A 1RJ9A 4XKJA 3ROPA 4E4YA 1A2KC 3SBEA 5ED0A 1AKWA 1XSEA 1JTVA 2XX3A 2NSHA 1FFHA 2ZYUX 4UHCA 4DTCA 3WWOA 2IXFA 1JHMA 2FU5C 3A6KA 3H18A 2V8BA 1AQUA 1IXKA 3SZMA 3QEJA 1M2KA 3R5XA 4LYDA 3IUQA 2C5GA 5ALXA 4AUNA 3H1BA 2FPKA 1UXHA 1NATA 3OJCA 4WXEA 1RR6A 3H05A 3MERA 3PUZA 3PCRB 2BFFA 1BRTA 1DIGA 3ASYA 2OKCA 4H15A 2QZ9A 2X9QA 3HDYA 3KEQA 3RGGA 4YRDA 4GX2A 1VMIA 1S8FA 1EI9A 1I36A 5BUCA 1ZHOA 5DM0A 1QQBA 3EZ2A 2ABWA 4B8SA 4MCHA 1KZHA 4LF7B 4PSDA 3LT4A 4K8PA 2P27A 1MZPA 3H1PA 3LWDA 3SJAA 3TNYA 1AGXA 4R54A 3BE6A 4R3WA 3WLQA 3CB2A 1H2RS 2I65A 3KJQA 4PHGA 2OV2A 4Z9XA 5EWMB 3E1SA 3QI7A 3GD5A 1TM2A 3KL2A 1XKLA 5JH7F 3HB7A 3NUZA 1EP3B 3U3OA 5FADA 5E9QA 2CBZA 1AGRA 2BEUA 1J99A 2ID8A 1TKCA 1XL1A 1HETA 3FDFA 2QJWA 1SD5A 3G8BA 2H31A 2BD0A 3EDCA 3I9LA 1DE0A 3BIFA 3EULA 3B7WA 4JLOA 4KVAA 4MV0A 5CVDA 1EE9A 2RK3A 1F14A 2UVQA 3ZW8A 4ETWA 4TTQA 5ALIA 4W99A 2JFFA 3A1FA 3VOAA 4QUGA 4A2WA 1C3VA 2Z9DA 2QP3A 1Y4SA 2EZ4A 1WYEA 3PZRA 4LDRA 3ZR4B 1EFRA 3MRTA 3TOCA 4JOCA 2BN4A 2OBLA 3L3BA 1WXGA 4TKUB 4GKKB 1YR3A 1WY5A 3BJRA 4UARA 1Q1ZA 1HQYE 2FPOA 3DPIA 2GVNA 2H1HA 3GLVA 4LISA 3OAAA 4PRLA 4WN9A 3V42A 3AY3A 4UKDA 3A31A 3OA0A 2PWBA 3P1JA 2QQ0A 4FDLA 4MZDA 3LWNA 2V03A 4ZVPA 3VYSB 1ZIOA 3X1YA 1E2NA 3RQ2A 3KD3A 1I4EB 4LDJA 4AG6A 5IU6A 2IPNA 3BQ9A 4F11A 1J0CA 1OJLA 3H6KA 5AHWA 2EX4A 3LFHA 4WOKA 4GZ5A 1P6UA 3RPHA 2I62A 4JGIA 4B48A 2PJUA 2D00A 4BO0A 2FSHA 3V8EA 1IWBB 3V80A 3R3ZA 4QPDA 2QLTA 2QVCA 1JFLA 2TS1A 1SCUB 3B53X 3QJGA 4XQCA 4IY1A 5IK2A 4QGSA 2RC5A 3AR8A 5AKJA 3TVDA 2EZTA 1RRKA 1IHXA 3B1JA 3EZNA 1BKYA 2HXGA 2JIPA 1OFTA 4L0QA 4OUKX 3H5RA 3NJRA 4GOLD 3T52A 5DHRA 3O1JC 4D46A 4H6WA 4V2IA 3EQ2A 2VZLA 5FO0A 1N78A 4YY3B 4BMDA 2FZEA 2ZPTX 3RSLA 1A8SA 2DY0A 1IZZA 1KIAA 3HFSA 3A6EA 5TXGA 3COSA 3U40A 1CF9A 3COVA 1ODJA 4KQCA 4AYWA 1LS6A 3EEBA 5JS6A 4B75A 2IH2A 1E1MA 2DU8A 2GAFA 2DHQA 4C12A 1KI9A 5LJIA 2WSBA 5AW4A 5DO9A 4LQLA 2C9ZA 5CLIA 3KZXA 3D3NA 2A9PA 4ZOBA 4POAA 2ZPAA 3UT0A 4E4TA 5EIBD 3T3OA 1CF4A 1WXHA 3FNHA 4Z54A 2PEYA 1KYZA 2OESA 4R0VA 2P9YA 3KQSA 4NYIR 1RACA 1U6JA 1YC5A 2VPIA 1V8FA 4DCUA 3G0HA 1QYXA 1CUZA 1JEOA 1GNQA 2GZ2A 2I78A 3BL6A 2Q3MA 4CG1A 1ZGAA 4JX9A 5HG0A 1G8KA 4AZ3B 1D2GA 5ECGC 1XHFA 2I29A 5AXBA 3U3ZA 3CFYA 3DLAA 2OAGA 1BG6A 5A62A 4RVSA 1XJ0A 2II6A 3OTGA 4HZIA 2FN8A 3C6YA 5HGJA 1K8ZB 2IZ5A 1XXHB 1SUIA 3FB4A 4ZZ2A 4CF3A 3FN4A 3ITKA 3I58A 2X0RA 5EJ9A 4K40A 4D9IA 3WQRA 3NIBA 2EBFX 2D7CA 3OX4A 1IUPA 1GU1A 4W82A 3JRNA 2ENUA 3DDSA 4EPVA 5B64A 2R00A 2XW6A 4RNDB 1ZEMA 1DWUA 2FOXA 4WK6A 4AUEA 4ETIA 1NQVA 2PLWA 4E69A 1A2BA 4LI3X 2BGNA 2F3QA 4RYDA 3G2NA 1ZXXA 5IDYA 4F86A 4ZHSA 3PHHA 4H2DA 5CJPA 3CEAA 4PE5B 3RSCA 2DXIA 3ANSA 4ERNA 4JQOA 1JIQA 1GGJA 2L82A 3HL0A 5C5CA 2AFIA 2J09A 4KNWA 1ONBA 3UTDA 1KJWA 4OHYA 4PRZA 3WLAA 2R2AA 3O92A 5JLJA 3NVMB 2KI5A 1EFPA 3E22A 1NW3A 3I9MA 3UWMA 2NYVA 3WQQA 1B16A 2CWDA 2OAP1 5D01A 1SIBE 3O8BA 4JCCA 1GNPA 4XQGA 3QPAA 4MI3A 5DTIA 4EL5A 4DN6A 1EEHA 1VTKA 1N2XA 2UKDA 3O2JA 5JNWA 3OU7A 3T3GA 2C54A 2A9OA 5SY4A 5C1BA 5LZ4A 2RB4A 3A36A 3TQSA 2MYPA 3KWLA 4LRUA 3A04A 3TUJC 1PUXA 5JZ9A 3KT0A 3UJCA 5LWHA 3SXUA 3JY6A 1EVLA 3ISTA 2RHLA 1E1YA 3FD8A 5TLSA 1LPOA 1TYCA 3Q7SA 5IHPA 3IH5A 1G20E 4M0LA 4U7FA 5MGNA 2RG7A 3OMWA 2CNOA 3BF7A 4MAFA 3ZE9A 3GEDA 3OHSX 1P9NA 4P3XA 1I10A 3IC5A 3Q9LA 2IODA 4HQNA 1DBSA 4Y2XA 1P72A 1R16A 4RM2A 1G7CA 1G6KA 5DFAA 5FUMA 4O4IF 1KO7A 5DBFA 4RK4A 3PNPA 1G9XA 1XOIA 3UO8B 1HDOA 4AJ2A 1M1YE 4GBJA 1ISJA 3GIWA 4RWEA 2JZNA 4Q3EA 3TRIA 2QQFA 4M9CA 4BN5A 1UFQA 2ZUBA 1Q14A 1Q91A 3AFOA 3TFWA 4LNUB 3V8MA 1XMVA 3M6XA 4W6QA 2J5XA 2VF5X 2C4VA 3DC2A 1GL9B 4LYYA 1REQA 3TW0A 1E9RA 2PVPA 4LYGA 3H2YA 3PNOA 3FCUB 1NVFA 3RSQA 4L8WB 3VC7A 4TROA 3TECE 1ZRMA 1DXQA 1D1SA 2IP1A 4KN6A 3PEYA 2QLJA 4NZOA 4WKBA 3X1KA 4EW1A 3WLMA 3VTAA 2EV9A 3ZS7A 4B3IA 3CNNA 2PM8A 2PFSA 4DNPA 1ECJA 3CEHA 5JCOC 2MCFA 2J0UA 5A1TA 2FQYA 4K9RA 3RHZA 3RRZA 4K93A 4RACA 4JV5B 2XMGA 4XM2A 4P93A 3RU3A 4R4JA 2FPSA 3WSWA 3ZCPA 3Q11A 1OA1A 4W5WA 4QXRA 3GHHA 2ZR0A 4ESEA 1A9XB 1Z5UA 4D4LA 1JTEA 5F76A 4KFCA 3R8CA 2O1WA 3U2QA 1V1MB 1CEEA 4XB1A 2ZDHA 1NJ2A 4KFSA 5L7WA 1FFXA 4JT2A 2HUPA 3C7TA 2G9NA 2AN3A 1K4MA 2Q4DA 1YB1A 2ZK7A 3ZDZB 1Y5RA 2GNPA 1UP4A 2OXFA 3DEKA 4R9VA 2EU8A 3GUVA 2AQHA 4M4SA 1T13A 5CB4F 5CDYA 5GP1A 3MCWA 1B14A 1J70A 2Y66A 2VAXA 3NT5A 4IZIA 5KTPA 1CY7A 4E4RA 1XMXA 1QKKA 1TO1E 2QD3A 3L9WA 1YAHA 3ZLJA 3LL7A 2QR2A 4JXJA 3YASA 2CVOA 1QDUA 3BS4A 4CCYA 4XDGA 2I2XB 4BCCA 5DKFA 2CMKA 2R6FA 4FLMA 1UPCA 1RWQA 1TJ4A 1PN3A 2EBHX 2GPTA 3I2IA 1TIBA 1NXPA 2LXNA 1RCFA 3LY8A 3NCTA 4OQXA 2QDKA 4ME6A 4QEKA 4OXRA 4RK7A 5JPDA 2Z43A 3CG0A 4KQKA 1NASA 2FEMA 2FA9A 3HI6A 4UFOA 2ZWOA 5CCDA 4IOKA 4JT4A 3D8UA 4KR9A 4F3RA 1YIOA 2PAFA 4Y9RA 2A1UA 1KI8A 3B6KA 3R9IA 1UMDA 3IFSA 1LK7A 2HHCA 3DKVA 4OLJA 4UUBA 3F7TA 1W88A 4YASA 4NDZA 3SX4A 1L4BA 4J4HA 1L5LA 1YBFA 1QVWA 3VPSA 1B8OA 4DLVA 5B58T 3VH2A 1CRLA 4L50A 4IEFB 3UMFA 4B3XA 2HIMA 3AUUA 1C3OA 3UJ9A 4F38A 2VEOA 3F1LA 1FDRA 1TCBA 4MWGA 2KLBA 3W2HA 4XB6B 5L3ZA 3TKAA 1AZSC 2A3NA 3HK2A 1K5HA 1JIJA 1G3IA 4B2YA 4ISBA 4NAUA 4CIXA 1SH7A 3IE0A 5I9BA 4JA2A 1R0ZA 2GCAA 2JI9A 1WKCA 3PNYA 1WDWB 1J0EA 2J0VA 2CHFA 5FEUA 5KBYA 4EZIA 3AHHA 3IP3A 1H65A 2XB6A 1TA9A 3OP4A 3CBGA 1ADCA 1O08A 1JG4A 3HYTA 3QVMA 1EFLA 3KPUA 4RJKA 2ZRJA 4BFXA 3PVSA 4GPZA 3ACCA 4KJXA 1KMMA 3M6LA 4WKOA 3U17A 3UQYS 4I08A 3RIHA 4B0PA 3VR3D 4JLPA 2QU8A 4OJQA 3JYPA 4GQAA 2P30A 4QBIA 4D0GA 3GN1A 4EI8A 3WBKA 1KJJA 3NOOA 4G63A 1E4OA 1HEYA 3DOJA 5H59A 2JAXA 2IYAA 4N0DA 4K6FA 4MKZA 5AW0A 2H8GA 2Q6VA 4OIFA 2NIPA 3PGJA 3ZZTA 3SWWA 1U9JA 4P83A 4BXOA 2R6ZA 2VPZA 3CUEF 3VHXB 3JWEA 1K2WA 3DS8A 2ZUCA 2QW1A 4Y2UA 2F3UA 2F1OA 2X5OA 2XGMA 5LQRA 2RGRA 2LCFA 2XA1A 4YRCA 4AZ0A 1FYEA 2Y05A 2H1CA 3C45A 1FMTA 1CW2B 4KXFB 3TR6A 3VZRA 5IZCA 1SHKA 4CM8A 1MPXA 3IVCA 4WE3A 1E7SA 2ZBDA 3E70C 5B7NA 1MW9X 1A9PA 4G9GA 5EMKA 4YP7A 1AMUA 1DIAA 1E62A 1PV1A 3CZAA 4L0DA 5FTLA 1R9MA 1JNYA 4XD7A 5J23A 4YHBA 3VH4A 2OZPA 1BE1A 2BZSA 3JQ6A 4L6IA 5I9LA 1ULBA 3A1UA 5CDTA 3N2YA 1IBMB 2MSEB 2G1AA 2ZJ3A 2F1RA 1GTJ1 3AH8A 1F0KA 3DW3X 4U7HA 3TQFA 3DVRX 1EFAA 1PL6A 1P1BA 1MMFB 1V5EA 2PN1A 5ICGA 2X76A 1UEXC 2YC2C 2BFCA 2J6HA 1TAHA 1DV2A 2QY6A 1QWSA 2QHXA 3OPYA 3RTGA 2AN1A 2ODAA 2LDXA 2OXRA 1QVVA 3ZWBA 4Y6QA 1NMEA 3RG2A 1OLSB 2ACWA 2ZTLA 4YS6A 4P32A 1U5BB 2J9FB 1LSOA 1S2LA 3AHFA 1Z06A 1HDIA 5EXDA 2A86A 3EE6A 1RM0A 5CIWA 2BGWA 2BAGA 4GEGA 1EKQA 5KQRA 1AKEA 4TTPA 1AZLA 3W79A 2VP2A 1YIAA 5ICSA 1W5EA 2OB1A 4NEHB 1V2HE 1VLLA 2FZGA 4XJXA 5JPIA 3RARA 3S40A 4M83A 5G02A 3UHPA 2QUZA 1Q7CA 2OGTA 3ZE6A 2XNDA 3C85A 1L5GB 3OLWA 3GRRA 2HPZA 4C0LA 3D4IA 1RWOA 3P2OA 2G3YA 4BX2A 4BMNA 5FTWA 1E7YA 4BTVA 1DKPA 3GRYA 1OA0A 1I2CA 2UZ4A 1YXMA 1A9SA 2WLSA 1K5GA 5F0ZA 4FSXA 4MZXA 5IXJA 4UVGA 4BBJA 2IS1A 3CZPA 5JMPA 3ZV7A 1X2EA 3A05A 3KOXA 4CETA 2R5WA 2QLMA 2BELA 3KB1A 4O1GA 3U7IA 5I8WA 3O5AA 1DAOA 1NR5A 2VYNA 2W48A 2B1QA 4JYZA 1W35A 2VYCA 4AXXA 3U4CA 4I14A 1OTXA 2OV3A 1BVYF 1MIOB 3K7EA 4S1PA 2O0KA 2ZZKA 1ZS9A 3EIFA 4HTFA 5EUQB 1IBLB 2OD7A 4X85A 4C0HA 5F23A 3KSAC 1X70A 3GEGA 1VBNA 4XGIA 1AV7A 2X41A 1E6KA 2DWCA 3THRA 4OKNA 3HY3A 3ZE0B 2G0TA 2G04A 3H2BA 1ESEA 3BZUA 4Q34A 5DX0A 4QDTA 1G1MA 2XADA 2F3TA 1AX9A 3BWCA 1VFNA 5KPJA 4DTIA 2B6HA 1GNTA 2CLKB 5K51A 2MYUA 2XOKD 1I32A 4AQDA 4AYTA 1Y7TA 3WGVA 4K6KA 1I3MA 4H3SA 5EWJB 1SKAA 1V1MA 3A06A 3JYOA 3V1KA 3IXQA 2BDEA 3NP9A 2HBYA 3EGCA 4EUFA 1PZFA 4MS1A 4KL8S 4AZ3A 4BU1A 1S5PA 4PRKA 1F8UA 1R88A 2B8TA 3JSAA 2ASEA 3KZ1E 2GBLA 1QB8A 3D0RA 4FXPA 4L5CA 521PA 3OSUA 5LZ9A 4LZJA 3V8BA 1TEHA 2F1JA 3M9WA 4PLZA 1O95D 1QCYA 1A4UA 1D2CA 3CE6A 1DUSA 3M4ZA 3UM9A 4R0MA 4I4TF 2HEIA 2ZJOA 1NIJA 1PO7A 1XZGA 2HHLA 3CW9A 2NT3A 2PX4A 3HA5A 3K9LA 5AKGA 1QC5B 4IJWA 3ZPXA 1RE1A 1G6OA 1I80A 2IS2A 2R6HA 2WHRA 1M8PA 1YS6A 2FEXA 1UZNA 2FZLA 3SLRA 1ZOPA 3BDVA 4C5JA 3AVOA 2H59A 4JUBA 5KYTA 2GWHA 1LPBB 2RIPA 1LPSA 1T9HA 2CJWA 2CNWA 2DUNA 2PVCA 2TMKA 3FMOB 4RZXA 2YZNA 2QF7A 4UVIA 3TI9A 2A1UB 3X1XA 4A10A 1QDLB 4OK6A 1U5CA 1VOTA 4HN4B 3BHMA 2RCNA 3IYLW 4X45A 3NJ4A 3W5CA 2PSHA 1QWOA 3KG2A 4R05A 4NU8X 1JFVA 1N9KA 3F67A 1G8FA 2CFRA 4UM8B 5ALGA 1SVMA 3OEWA 4Q3BA 3ER9A 2DKOA 5DK4A 1X8JA 4R71A 1C4OA 2ST1A 4H77A 1V5WA 5JE8A 2AC2A 2X9LA 2GN0A 3P20A 4D4JA 3TJZA 3VPDA 1N2CE 3W6PA 3WK6A 5A3JA 3K8ZA 4E33A 4UM9D 2IU6A 4LBYA 1ZJJA 4MQ5A 5LDDC 1PSZA 4WXPA 4U7DA 4XCVA 4G9BA 2DE0X 3DDHA 4NZMA 5FBQB 1IUNA 2JF0A 4KXWA 1PR9A 3HB4X 3L92A 3IA7A 3R4VA 1CUHA 5GZ6A 4O1MA 3AFGA 5TPWA 3ED1A 2A9QA 3Q9SA 4LHVA 3I28A 3AOEC 4CT4B 3HN2A 2ZYTX 1ORVA 3E15A 5HF8A 1DT3A 2LUOA 1B1CA 2GXUA 1ZO8A 2ZUSA 2M6SA 1RJGA 1MG5A 3K2BA 3W1VA 1PLKA 5K1ZA 1DS6A 2GPAA 5DM60 4LNAA 1J8DA 1ZCBA 4L85A 4BO7A 4PSAA 3OCXA 3UTCA 1MX1A 2G7ZA 2AI3A 1FUKA 2IIQA 2W4MA 4CN9A 2YFQA 5HKBA 3PKIA 4YJGA 1SPBS 2VJCA 4EA6A 5HGXA 1PT8A 3GLGE 5D6OA 1M2GA 2I7CA 2FFAA 4OHZA 1RYFA 2V65A 3IBYA 1E2FA 5TX7A 3FYTA 2AVDA 2I2DA 4H4CA 3TLMA 4EYKA 1B8UA 4OI2A 3ND8A 5KHAA 2B8WA 3L06A 3TLGA 3M6IA 3EWNA 4TWZA 1X7YA 2CHGA 3QUTA 3VC1A 5KYYA 1VJGA 4LSWA 4EHBA 2O8BA 3CO0S 4CVMA 4C3OB 3PHGA 5IF3A 2ZQZA 3IUPA 4R9UC 4UZSA 1V7QA 1U8CB 4G6ZA 1KY4A 2IIPA 3DFMA 3A1NA 2QN9A 2GQ0A 3HDHA 1F17A 4PGGA 1JA1A 4QGFA 2A94A 4Q48A 3RDPA 4DIFA 5FUQA 1EM8A 1L7QA 3SYNA 3FTFA 4E5PA 1JIUA 3W8FA 5JYEA 1QH0A 2RH8A 1SZDA 1GCAA 1RWMA 2NO0A 3LXRA 3MQ4A 3JAMA 5GJCA 1V9SA 2E82A 3Q6IA 2QD2A 1UP7A 4NC9A 5ARDA 1V7ZA 2HGSA 2P8JA 4IWYA 4B7UA 3SF8A 5BPHA 1Y6GA 3AR7A 2RHBA 3IVMA 3CX8A 4EGSA 4DMFA 4UTZA 3ZJVA 3DFFA 1OCEA 3N8KA 4N7MA 5CT4A 2W6JA 5LOVF 3GLFA 5IVKA 1JIIA 3L07A 4IJVA 3HB0A 2ZCUA 2CDCA 4F0JA 4DU5A 1SEVA 1V1RB 1Y3DE 4C2UA 1AZTA 3PLRA 3AEQA 3BMOB 1JHAA 2C0QA 1IWOA 3N05A 2J9RA 1E0DA 2BGRA 1FXSA 2MOKA 4PBRA 4ECAA 2OVFA 4BATA 1OZGA 5KQLA 2FR8A 3TSYA 3H5LA 4RDHA 5BRAA 5G0SA 3QKSA 1QZXA 3GRCA 1DDIA 1MGPA 3IQEA 2XJAA 4JJPA 1HTTA 5EWMA 4UHKA 5JO9A 3NHPA 4KDFA 2CLCX 5HR5A 3HMKA 1ND6A 1QAQA 5DYIA 3LVQE 4I1OA 3PNBA 4HL6A 3SQMA 3ZZUA 4LC4A 1RRGA 4B6OA 5BYKA 4BNDB 3GJZA 1L5MA 1N5KA 5BQFA 3O94A 3TR5A 4MS4B 2GM9A 4R16A 1EWQA 5D1NA 2ZRNA 1D2RA 2CXUA 3VSEA 3W3AH 2WFZA 3DMDA 4DUYB 3QKSB 5KNDA 2ODTX 5AI4A 5JSKA 1K3TA 1IC6A 3ROMA 2GJAA 2X3YA 1QQTA 1TLFA 3HYLA 5IXSA 1OYWA 2P90A 1V6SA 1RYNA 2O1SA 1LBEA 5T4HA 3HYSA 2HN9A 5K4HA 5JSFA 4YJGB 4IOLA 2DUWA 3V2UA 4DC1A 4XR9A 1QKIA 2OGWA 1SXGA 5G0UA 3K5WA 1V1JA 4PCUA 3DJFA 5BWMA 1FTNA 4QASA 5KNDH 4MYDA 3NUQA 2GZ3A 4V0RA 5BYJA 3W5VA 2JLWA 1KVTA 4LX8A 3SC2A 5BUSA 3AR9A 1VBKA 3ND6A 4K0RA 4PZ9A 5JQGB 3QKRB 4AQYB 1H8HA 3HVUA 3QOFA 2YS6A 4LZWA 1BXGB 4WV3A 3KTDA 2NVOA 1MB3A 1P9OA 2AFHA 3PNSA 4FHFA 5EI5A 4HWKA 1SBTA 3CMCO 4DEXA 5KI6A 8LDHA 1JXMA 2VSFA 4EHFA 1G6Q1 2A1IA 3L4SO 2R47A 1EM8B 5A7HA 1N33B 3RUPA 1JHVA 2GILA 2HMUA 1UDXA 1JT2A 2LD4A 3OQPA 3FCEA 3MMSA 1DBRA 4JLDA 4E08A 3F71A 1ZVVA 3BTSA 4QU0A 4CF6A 1L1QA 4BQPA 5M7EA 4CEIA 3KLNA 5EINA 5JXWA 3BX1A 2HCJB 3QRWA 1UINA 3LU1A 3EXEB 4QHTA 4EFLA 3DBHB 1D6NA 1PJAA 3LVBA 3NT2A 2B4RO 4O2AF 1N3YA 4BHTA 2GZDA 3KPWA 4MHSA 4KR3A 3G2KA 3HA7A 2QE7A 2PD6A 2ZB7A 2LP4Y 3KZHA 3OJEA 4N6OA 2QT0A 3KYDA 3MD9A 5FWXA 3KE9A 2ECFA 3OFKA 5DNVA 5JZOA 2QMOA 4WVFA 1MIHA 5M2QA 1XTUA 4CKWB 3EY4A 3R6DA 1Z6GA 2Q5RA 2JLZA 4QU5A 4XDHA 1C1DA 3UJBA 1XEAA 3A1EA 2LWIA 5IK2D 3N3AC 3GQVA 1JFSA 2IK8A 1LPMA 1SURA 4V38A 4M8LA 1AKMA 1CJSA 1DKRA 1PF7E 4ZXPA 1K66A 5ERYA 5CAEA 3UV7A 4JYCA 3RBAA 1KHTA 1GYQA 2ID7A 4X8HA 4ENPA 3D31A 4H4EA 1I5OA 2C00A 2WT4A 2CJYA 4DYDA 4J29A 2V55B 2ZB4A 2OBXA 5E95A 1DGQA 5HKAA 5DM4A 1TKBA 1N1GA 3NIWA 1Z74A 3C48A 4FFMA 1OHHD 4M0UA 2NUTB 4ZU3A 5C51B 3WZ2A 1XBTA 1DPFA 1XROA 1N8SA 3UICA 3OZIA 4EF6A 2GFIA 5KSWB 2VWQA 3E5HA 3FF1A 3ZCXA 1DL5A 4BNVA 1SKMA 1R5BA 5REQB 3BCUA 4UVDA 2YY5A 4HQKA 1VKNA 2B25A 4CZ2A 5BSFA 1HNWB 4QVGA 3VO2A 2HK7A 5FUXA 3QE9Y 2A92A 1E6WA 1CY1A 2R2GA 3L1VA 4MCJA 1Y1KE 1QQAA 2BGLA 4CM8B 3WK7A 2WF5A 1CKEA 1O96B 2ZVJA 4JZYA 4J91A 2CDBA 3WKAA 4PC7A 4JROA 1A88A 2VDJA 2VJYA 1U3GA 4C2BA 5UKDA 2J5KA 3A3KA 2GK3A 2NUPB 4X0EA 4RVOA 3FMGA 3OLZA 3PZBA 5HFJA 5D3MA 3IQWA 3QE2A 1UKZA 3T7KA 2Y0PA 3K70D 4YH1A 3GXBA 2VO1A 4C5LA 4GE0A 1F0NA 4FONA 5KYYB 5HE9A 1WHTA 5MF6A 3AONB 2VUIB 2R97A 5HZGA 4DFDA 2JK0A 3B1VA 3DMFA 2VNSA 3DWFA 4NKRA 1X7XA 3W7BA 1XNRB 1EIWA 1KYTA 1W30A 1G8SA 3COYA 1Y42X 3I52A 1GUFA 2PRYA 4J75A 4QBFA 3WIOA 1YMUA 1I1OA 3DUFA 4O4IA 3LHXA 4GPAA 1QIIA 2PE5A 2ID9A 3W4KA 3L7BA 4D99A 4ZPXA 4IJKA 1NM5C 4YV2A 5JISA 5CM8B 1H8ED 4PC1A 2QX9A 1TFRA 4O2AA 1FC0A 4RGBA 3IP7A 1RFTA 1JYFA 2HQOA 3VUFA 2Z2JA 2XDWA 4WWHA 3T3PB 1RCUA 1UMBB 1DWPA 1Z4MA 3X2EA 3M34A 2CUZA 3MA0A 4BE7B 1YB5A 1E3DA 1FVXA 2OE2A 4HHEA 1G8MA 3GVHA 2OQVA 1ACLA 3G13A 2MINB 4ROTA 1WTAA 3JWIA 2BFMA 1RZVA 3CW8X 3CO5A 4MVJM 4CRWB 1VGVA 4EMTA 5JU6A 3AV0B 3DMNA 3U6KA 1KP3A 4KALA 4LV8B 5CIQA 5EWLA 1M6EX 1CFZA 4RJIA 5D8DA 4ZDJA 4A0QA 2DZDA 2FG5A 2QTCA 2V8OA 3L0PA 1LBIA 1UBSB 1YBMA 4S2UA 4TL9A 1L6IA 2YWJA 2YASA 3AI7A 4MPTA 4OAQA 5I9SA 1AUOA 1Z83A 2MU1A 1UR5A 5JCPA 1Y3CE 3EC7A 4Q9AA 4LCEA 3UWOA 1D8AA 2BFWA 4YXWD 3SJUA 1ZD3A 4W5NA 3L0SA 3P2YA 2HHAA 1XD8A 2RHHA 1KXZA 4DOMA 4EKNB 3RQHA 1U63A 2D6FA 2PX3A 1O03A 1OX4A 1Z5VA 1K68A 3O2NA 3JAWA 4GI2A 1FZQA 4FU0A 2W2XA 1SUEA 3OO1A 1D1PA 2JFNA 4QYMA 4CV0A 1ZDMA 2B2CA 2H2IA 2WIJA 4IIDA 4QE3A 4AURA 2JLUA 4GL4A 3K53A 4JX8A 4DCJA 5IYZB 3KQHA 2HRDA 2QSYA 3U7FB 4OXIA 5BNWA 1EJ2A 4JLWA 1O5ZA 5KCMA 2GLUA 3BH6A 2YN4A 1KQOA 3V3TA 4JEHA 4MS1B 3VYRB 3V8VA 2PXCA 1WD7A 1B3BA 2EGUA 3D6VA 3HO8A 4HTAA 1OFVA 1ORHA 1WU7A 5ALPA 4B3FX 3OE1A 5BN4A 1NXTA 5LP6A 1J2EA 3LQKA 2GFQA 1ECLA 2WVJA 4NULA 2GBLC 4M1KA 4S35A 5EIBC 3UUGA 2PJZA 3OT1B 4YCSA 1A9YA 1LFAA 3K1TA 1IATA 1OMOA 1E5LA 1SC1A 1VPLA 3EQZA 3LKZA 3S68A 4DDHA 5HIKA 2WE8A 4FDMA 5IDXA 4CMGA 4RGQA 1C9NA 3TM4A 1S8AA 2F3SA 1QGAA 4GM1A 1JKXA 3L0IB 2DB3A 4HI0E 3ES9A 1U6IA 2Q1WA 3F73A 4H1UA 4R8LA 4F04A 2JBAA 2JRCA 3UBTA 4B85A 4BE4A 3JAKB 4K81B 4UBMA 2DQZA 3UHJA 3SFTA 1USVA 1HZJA 1V0JA 4YVFA 3EPKA 4P7GA 5LQCA 2IZ0A 4LF4B 1JA9A 1E3LA 3R24A 3RM3A 1TD1A 3EHEA 4ZCLA 5JFTA 1ZD5A 4U2DA 4G4SO 5EJMA 4MJXA 3QENA 4DZZA 2C0PA 2VOJA 1Q1GA 3KXKA 1M75A 1PSWA 4GYKA 2F02A 4OXKA 1ULAA 2V6IA 4RHXA 2JD2A 5ENVA 1WBBA 2BMDA 1N9GA 4FSHA 4UEKA 5AK4A 3VR6A 3X2FA 3EPPA 4JVSB 4CF5A 1B8VA 5E6SA 3FPJA 4JEUA 1L4KA 1I3KA 3H65A 4E1AA 2QMEA 2WJAA 2BTQB 3D3QA 2HA2A 2X13A 3KUDA 2PSSA 3VXKA 2B30A 1KS2A 2O2JA 1R0BA 4RVNA 3MLAA 1WV0A 3V4PB 1IOZA 1OXMA 2E5WA 2GR9A 3CRZA 3EFEA 2YFYA 2PKEA 2VTKA 4KBGA 4TZTA 4PAQA 1FJXA 1UBMS 2OYRA 3QYAA 2JEYA 3CUVA 1AO3A 2CVQA 1XT6A 3I0NA 1NLFA 3JQBC 2XZLA 3PF8A 5C9ZA 4BXOB 3O8CA 3L1JA 3IEUA 2AHRA 1FVOA 3PVCA 1VM6A 2WD9A 3HB1A 4ND4A 4D44A 4US2R 1D2MA 5KQPA 1SO8A 3AG6A 1RFLA 3GHYA 2HB6A 1VLMA 3G3EA 4GOKA 5ALQA 2O8CB 3C7AA 4GUAA 1ZM7A 4I50A 1JTFA 2XLBA 1WE2A 4LNHA 4MARA 3N53A 3QJYA 2JLBA 3IT3A 3V97A 3VISA 1M67A 3IBFA 2PZLA 1WCXA 1ID8A 3DZ8A 1TIKA 1UBKS 3SIPA 1TK3A 4FK8A 5IM5A 4F9GA 2C98A 2YRXA 1YRQA 3G0CA 1DMSA 1WWKA 2VT6A 4EVQA 2WG0A 6PFKA 3W06A 1JEYA 3JD3A 1JR2A 3EXG2 4L3OA 1OKKA 3OE4A 3H16A 2P3SA 3DD1A 3HXLA 2VDUE 3U3MA 5LKRA 5M29A 2W42A 1Q7GA 3E5RA 4IDHA 5J5VA 3QSYA 3DTTA 2OXIA 4OG2A 3T5CA 4R2WA 1FUUA 1T1JA 4M1TA 2O5RA 1QH8B 2W2MA 4OMCA 1SXHA 3RC9A 3WC4A 2CJFA 1U3WA 1E2DA 1UJNA 3S28A 1KFJB 1KJZA 4ESVA 1A97A 5COJA 2ZIEA 4DSTA 4EA8A 3A4IA 4CM9A 5DBOA 1KMHA 2FGJA 4EHKA 4DZTA 1Y4AE 3CTMA 3FMFA 3E9NA 1L5WA 2RH5A 1C3XA 4NE9A 3NVKI 3EC1A 4PYNA 2ZJZA 4ND8A 3OF3A 3W2TA 1PBNA 1WUIS 5KKNB 1SQ0A 1DOAA 1U8UA 4W5HA 3WLIA 3EZ7A 3R3YA 1QIGA 2W4IA 1KK0A 2QLLA 3F6BX 1J2UA 1Z4QA 3JALA 1V35A 4JASB 3GO6A 3K2IA 1VMAA 2AOXA 2FWMX 3T1QA 4DANA 1S2GA 5AIBA 2I7TA 2R6JA 4ZMBA 3WMWA 1K75A 3LUBA 3PFBA 3K70B 3BGKA 1J21A 4I5IA 2QG6A 3KT6A 2IZOA 2ODWA 1EVKA 2FSSA 4GRDA 4P3YA 4L9RA 3P9YA 2BMEA 2PWPA 2WUGA 4YPVA 3Q8LA 1DO0A 5ESRA 4Q7KA 2J0UB 4D4KA 1NFFA 3WRXA 4GNRA 2PMFA 4UNQA 5HXAA 5IXYA 4F2WA 1C7FA 3QBVA 5AK3A 3VZPA 4PZCA 1I9CA 2HLDA 3ILVA 4DM3A 5HKLA 3OF2A 1Q3HA 3MIIA 1P5HA 4N01A 3KR0A 4ZAWA 3VNQA 4EI2A 5CK4A 1SU8A 4RL4A 1A9XA 5H70A 4AMZA 4M36A 2CUKA 2IFTA 3A0UA 4M98A 5D3KA 2Q3BA 5FYDA 4Q39A 7REQA 3LNCA 3AVXA 2FMTA 4CBVA 1I3OA 3ZCTA 4UHHA 1BHO1 1O87A 3CF4A 1NU6A 2XGOA 2WTNA 5FI5A 3CLRC 3TZKA 2GO1A 4CCAA 4ZOQI 2XNHA 1UPAA 2LR0A 3BD8A 1SKBA 2I67A 2QMYA 4RFLA 1NBAA 1OFUA 2JCYA 2JI8A 4NJMA 3GCZA 4MVJI 4NYIQ 1JQ5A 5F4ZA 5K8JB 1KO5A 4CGYA 1D2EA 1HBJA 3RVRA 2IYOA 1DLJA 1QHGA 3HGTA 3P9PA 1DKQA 2Z1DA 5C1DA 1KYVA 3N6RA 1N0IA 4CCYB 4E14A 5ES3A 4Z2AA 3GMIA 5HF5A 5BMVA 1BMTA 1L4GA 2DVMA 3HDVA 3JD1A 3IKHA 1IZ8A 4A0RA 3LP5A 5BVGA 1DTEA 3EMKA 1GXSB 2PUWA 4MKIA 5GOTA 1YDWA 1WPQA 4Y18A 2Y0BA 2YTZA 4D9KA 4JR2A 4GOXA 1ZN8A 5FLEX 2O2HA 1E1RD 1ZGGA 1RRFA 1L1EA 3SX0A 4DYVA 4CNBA 3X44A 1I3CA 1FOEB 4QT4A 2JFPA 2IYXA 4RD1A 4RF4A 2ACKA 4KAHA 3BBLA 4MV1A 2OK8A 3G5MA 1XTIA 2EFYA 2V7EA 2D0DA 4D9EA 4CM1A 3FMVA 5E1BA 3UK1A 4RIHA 4HXFB 2QXUA 4E21A 2BTQA 1X7GA 4UD6A 2CV0A 5B53A 1PD0A 2W93A 2ZITA 4MVJF 1E9FA 4RMGA 3ZWVA 1KDYA 5CBPB 3I1JA 1GLNA 4KPYA 1EM6A 4BB0A 1FRVA 5AVJA 3EJWA 3KT8A 3SBXA 3RQIA 3EPRA 3VDXA 6ABPA 1VJRA 3DFKA 4H17A 3TJMA 1AURA 2C3UA 4ZI5A 2RI0A 3CEPB 4UMDA 4NCJA 1YS2X 1U1IA 2BHTA 3TEMA 2VSXA 2AV6A 2SNIE 3EODA 2VUTA 3IAHA 3LUGA 5CPFA 2PMEA 4EI7A 1XIVA 1V9LA 4ACAA 5EIXA 1T1IA 4M2LA 1T4CA 1BWRA 3HM9A 4M9XA 4R2JA 2WFMA 3VAAA 3ZLBA 1SBCA 1ODLA 3I05A 3SHVA 4AY5A 3C5CA 1C7RA 1W75A 3FG9A 3DVLA 4J3FA 4OD0A 3WGKA 2WIAA 3BICA 4FT2A 2I2WA 1XB2A 2QN2A 4KN9S 3W4IA 4FNOA 3TCNA 4XIFA 3AQIA 4G0VA 1Y33E 1EIZA 1D5CA 3EGDA 4OLAA 2OPBA 4TMTA 5FWYB 1SIOA 2NGRA 2RBKA 3MUEA 3VDRA 2PKMA 4PAGA 4X1YA 3TN7A 2OV1A 2QHPA 2Y2UA 3VR2D 4PSCA 2I3GA 4EDFA 3BK2A 2BR4A 4ZTZB 2C7PA 2CYAA 2P35A 1JG1A 3LBNA 2JFVA 1ONPA 2CNKA 5ENZA 3CXUA 3GROA 1K97A 2HA4A 2WP8J 4GLLA 2PH7A 4HAIA 3KQLA 7MHTA 4MA4A 5F2OA 2W6NA 4CKBB 1LLFA 2VOEA 4F4JA 2IX9A 4YRTA 3F5SA 3W2IA 2V4UA 4BMZA 1KZYC 3MBOA 3D2CA 1R7RA 1X7DA 1PEKE 2JLCA 4QBKA 3FFTA 4B79A 2GZRA 3K0AA 3QLVC 4CWAA 4BFWA 2MSCB 3C3WA 2J9GA 1CIJA 2AYXA 3AZOA 3IHWA 3D8TA 3DF7A 3NS7A 5BN4B 3KTNA 2PX2A 3AEXA 3HA2A 2QS9A 1ISSA 1DDOA 2GUWA 4BVGA 4K26A 3IMFA 3IA2A 4QOGA 4AJLA 3I8OA 4G0YA 2O3TA 4JVMA 4A92A 4S2EA 4P1ZA 4A91A 3CJRA 2IZZA 1Q0LA 3L0DA 3SQXA 5LXTA 5NULA 2VQSA 4TWAA 2D0PB 3G7NA 5LQKA 3DRWA 3DEHA 1VYUA 2PX6A 2X9GA 3PPXA 5GM1A 3WL4A 1QZZA 1MB4A 3EZYA 4GMDA 1UXGA 1UBLS 2IJGX 2VBIA 4M99A 1BJRE 3L6OO 2NM0A 5EOVA 3L8HA 1C9EA 4KQJA 4CM7A 3GD7A 3KE8A 3OTQA 4N40A 1QQ5A 1WVIA 2Q2VA 2XVMA 3IVGA 4C3UA 3BGDA 2OBYA 5FNVB 1RFGE 4BVHA 1WTCA 1YE8A 2DQSA 2N1MA 1N7GA 3QMWA 5B3LA 5IASA 5BUZA 2AOUA 2ZR7A 2P1ZA 3QVKA 5DK6A 3TIGA 3U49A 4HZUB 3ZX5A 2Z83A 5F77A 3L6EA 2C7QA 2X0FA 5BSTA 2EC5A 3DQPA 1VRCA 4BWYA 4DJJA 3ZQJA 1HLDA 1W6UA 1Y1RA 4F93B 3ESAA 2HYDA 1ZIYA 3GUYA 1SZPA 4RTOA 3ZVMA 2YJTD 3QNWA 3SZRA 5B12A 3EFBA 5FI3A 2XXJA 1GV0A 1LBHA 3BWYA 1NDUA 4AIRA 4HUJA 4E46A 2LKDA 3U0BA 2I99A 1LVGA 3WQBA 5B1EA 3SFZA 2H92A 3HQ4O 1R5OA 1FA9A 3K5IA 3OEEA 4FYHA 3VA7A 4ZAYA 4AX8A 1KRHA 1NYLA 3A4VA 2COEA 2HF7A 3CX4A 3PXDA 2G9ZA 3PT5A 4KNVA 4PO3X 4W4TA 5BSWA 1I01A 4P80A 1M2OA 2G9VA 4N6NA 1E99A 4D7AA 2YHAA 2NZYA 3QG5A 1ADBA 4OH1A 2EFHB 4PU0A 3WHKA 1K4YA 5EGSA 4MINA 3JQAA 3NM3A 3I5MA 1JSZA 2PWYA 4I9GA 2Q07A 2PQ2A 4KIGA 2C3YA 2OXCA 1OBOA 1IL0A 1EGQA 1RI2A 1I0LA 1VKRA 2WFAA 1CLEA 2CHEA 2IYFA 4OXXA 3HFRA 5BSMA 1KU6A 1X42A 1BMFA 3FYHA 3VU9A 1Q7BA 2A57A 2HNBA 3OJ0A 1VCIA 4J0IA 4UNRA 3CT6A 1FX0B 3PFIA 1OWPA 3KKKA 4E2ZA 2ZUEA 1YS7A 2O0HA 2Z8XA 1ZOIA 1XRMA 3ED5A 5B4TA 3BM5A 3EZFA 2J41A 2Y67A 4B40A 2PZFA 1XJ5A 4PAOA 2NZ8A 1L9KA 3OIFA 1J6UA 3H5AA 1YQGA 2YZ7A 2XUIA 3NBXX 3KZNA 5ALKA 1DX9A 2UDPA 3KK0A 4ZYTA 1BX4A 3NTRA 3HJTA 1A72A 4UMEA 1NE7A 1UPUA 2OHXA 3D7SA 4BQOA 1QHEA 3VKGA 1HKHA 3NV7A 3NASA 2I0FA 3LIPA 4I5DA 2ZUTA 1IVSA 4LOKA 4H6PA 4NZNA 3BGWA 3L0ZA 3U9SA 1RQ2A 3A6JA 3N75A 2C0CA 1W52X 1ZN7A 1CRPA 2O1XA 2Y1XA 1E6EA 3IEKA 4KI0A 3C74A 4KX3A 5AVZA 4DR3B 2AJPA 3H9QA 3ZGXA 3PIIA 1NW4A 3DZIA 1GGHA 1PFQA 3NT4A 3GBSA 4II2A 1NX9A 1WB9A 2QX6A 5C4GB 2CYCA 2D1FA 4Z8YA 5LVAA 4FS3A 3B2NA 4RKEA 2AUMA 2Q6TA 4YACA 4LDZA 4QEDA 3PQ7A 5BQXA 5JAUA 3FTDA 5A5DA 4ZU1X 5CCEA 1SBYA 2I4RA 1I3LA 1NVBA 1OXBB 3EH1A 2P2DA 1FTGA 3JATA 3LH5A 3B7PA 4G89A 3I64A 4O3MA 4CKWA 1A76A 3GRAA 8AT1A 1G42A 4TZ6A 2EQAA 2FCRA 3TBFA 4P53A 2FPIA 1GKIA 2HMAA 3TKYA 5C35A 1VCHA 1OX6A 1QJ4A 1LEHA 4HH0A 1EK2A 1CUWA 3VC2A 2JJQA 1Z73A 3TOSA 4A0GA 2OCIA 1M34A 3HLKA 3L93A 5FI0B 2DFPA 2IYWA 3IDZA 5EP4A 1U80A 4YR7A 4R1UA 2FV7A 4BWFB 1JQJC 2X86A 4Q4LA 2PJDA 4LGVA 2E9SA 4GMXA 4LHEA 4TL7A 5ULLA 4B5LA 4CCSA 1RPZA 4CL3A 2Q4BA 3Q12A 2BFAA 3KKQA 4TX1A 3BAFA 1IY1A 3OC0A 3OFNA 1S8OA 3OQHA 2GPWA 1RTKA 1J56A 2JC3A 2JHAA 2W8ZA 3MGBA 4HVTA 1P5ZB 1ZK0A 4MV8A 4Q7QA 5L3RA 3PRJA 1J20A 1U2GC 3B70A 4YAUA 1P7ZA 1N0HA 4Q3LA 5B7GA 3EN0A 3N0RA 1YVEI 2V6FA 2GJKA 3MG9A 1TX4B 1T0UA 1TZBA 2FWBA 3DE3X 3CRNA 3FZEA 3L7KA 4MQ4A 5K3CA 4FUTA 1I94B 2A0FA 1ZSVA 4NEQA 2BEVA 2EKDA 2OHOA 3P0JA 4HNAA 4Y2JA 4MDYA 3UKJA 1OAOC 4YMUA 2YIVX 4FDAA 3TH5A 4ASUA 1RI5A 4PQRA 3JVEA 4B0OA 1YHJA 3LX4A 2I33A 2BHLA 2ERYA 4C5NA 1L1RA 4NAHA 4CMBA 1NURA 2OTCA 2V7QD 1X74A 2ZKIA 4MW6A 3AF5A 4QDJA 5CTAA 5T64A 4RU1A 1EWVA 2QMUA 3D6NB 3SICE 4EO7A 2HD4A 4B6RA 3P32A 4MKRA 3LQFA 2V9CA 2UYOA 3PDUA 3S99A 2FX3A 4UTRA 3A25A 5AXAA 3RTDA 3FXAA 2PMDA 2Z08A 4XWKA 3GA0A 2WJJA 3GJ0A 1ZIXA 1FDTA 3CH4B 3A26A 2O3JA 3KJEA 4GOJA 4I66A 4OCZA 3ZBUA 3EXHA 3SOPA 5E1DA 3AILA 3D2AA 1ORWA 3OCCA 1JEQB 4R3NA 4HVCA 1GTSA 4QHSA 4NCAA 3VNVA 5AM4A 2DFLA 1AU9A 3I92A 3PC4A 3ESCA 2WA1A 1K98A 2R7MA 4L6CA 5ER6A 3WLPA 5BNFA 4MHTA 2L0XA 5TQ2B 4A27A 5J2TB 1RXEA 1CP2A 1MGOA 5DVZA 5ERXA 2HOQA 1LK0A 2XNSA 3FHOA 3Q85A 3QVLA 4HGRA 4XPIA 1K5PA 2GRUA 1E2LA 3ZWCA 4ZJPA 2WINI 4KMMA 2GTHA 2HPHA 2JAUA 3HBFA 4WNIA 2E4VA 5D1HA 3K6SA 4M46A 5T57A 1Q57A 4L6AA 2FSPA 3BGOS 3GWGA 3VHQA 1FFDA 4LVNA 5E2BA 1W9MA 1JNXX 4FHEA 5IABA 4XWYA 1VGRA 2F7SA 3PS9A 1QK3A 3PNQA 3KSBC 2PAAA 2PFGA 3E9YA 5KEIA 5BVHA 2GH1A 3A6HA 2YV3A 4HRVA 4F6RA 2AYYA 1GSIA 3GBPA 3WRYA 2JFWA 2DR2A 1YBAA 2VG8A 3HXTA 5AVWA 4X7BA 1E8DA 1HM5A 3NTOA 3TLAA 2A58A 2P2CA 5EZYA 4DXDA 5EUCA 3UMCA 4FN5A 3VSBA 4JSTA 4EFNA 1KEVA 2Q1YA 1IJEA 3ZDXB 2IOFK 1VHQA 2AF4C 3ROQA 1O97C 2P2NA 4FQ7A 4US1R 3SJ7A 1ZG3A 4P7BA 2AQKA 1KC1A 3REFA 1VHTA 1AS0A 3IODA 5EVCA 1MOQA 4E8YA 1BJTA 1Q1QA 3IAFA 2F1KA 5JG7A 3LTNC 2A9RA 2EEZA 3FA2A 1SOUA 2XJ9A 2CL0X 1CNMA 2ZJ5A 4HNUA 2PA3A 3BXFA 4CI9A 3D1LA 2PV7A 1D0SA 2NU9B 1HQKA 1XJWA 3B9RA 3HYRA 3STHA 1Y8ZA 1JYSA 2FW8A 3O9MA 1X1BA 5HWSA 4Q9IA 4K88A 4BV9A 3MJDA 1DKMA 3B9BA 4J0GA 3WGJA 3X2SA 5KOJA 2G4VA 2CY0A 4A0SA 2FMHA 2V7GA 2BMVA 2WHPA 3CNHA 1R6XA 1A3CA 3MMPA 3RANA 3TLKA 3ENKA 1HQDA 1JR3A 3E7DA 4NFHA 2V74B 2XPCA 3H6HA 2GETA 2O7SA 3BFPA 3B5JA 3BYZA 4IQ8A 1PR4A 5ITSA 4QPZA 1DZIA 1ES9A 1G66A 1R0YA 4FMPA 1Z0FA 2ZJFA 4GM0A 4PPQA 1E3JA 1EX1A 5KMGB 1ISPA 2QPAA 1IHYA 1VJCA 2VWHA 1KDVA 3GFRA 4DSZA 3T5MA 2VNAA 5KNDD 4REQA 3L7DA 4JH0A 4MGZR 1OQAA 3GEHA 4EP1A 1ZH0A 1CVIA 1RVV1 2O5VA 1USWA 4RV4A 1U5BA 1ZD8A 4ZQHA 3FLMA 1F6DA 1H69A 3PD7A 3WJ1A 1YRWA 3PL5A 4CM5A 2KBEA 4FYYA 4ZIRB 5HQ3A 5LYJF 1V3VA 3EGIA 4O6VA 4X00A 3NZEA 2I6QA 1JQ3A 2R5NA 3T1VA 5BXYA 3QVWA 4UEJA 2ZXEA 2QN3A 4EMBA 2GT1A 3PK0A 4IF4A 4YN3A 5DMHA 3RAGA 3ZK7A 4DG8A 4G41A