3RTCA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nad and atp.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 185
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rtcA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rtcA02
1L2LA 2ABQA 3RT9A 2AX3A 3BF5A 4E3AA 2YXTA 4S1IA 3RQ5A 1LIJA 4C5KA 3GBUA 1RKDA 4EN4A 3UQDA 3LJSA 3RNOA 2YXUA 1YGJA 3RRBA 2DCNA 3B1OA 3NBVA 5BYFA 1V1AA 3KD6A 2HQQA 3IBQA 4XDAA 2PKFA 3DZVA 3RTGA 3RU2A 5COJA 2HLZA 4GM6A 3NL5A 3NM3A 5BYEA 3HYOA 2I6AA 1KYHA 3UQ9A 1JXHA 4LC4A 1TYYA 4C5LA 2I5BA 3B1PA 3RQ2A 3W4SA 2AJRA 2AFBA 3RTBA 3RTCA 1V1SA 3K5WA 2JG5A 5CM5A 3B1QA 4EUMA 1VM7A 4UBEA 3RPHA 2JGVA 3VASA 1C3QA 5CGAA 3NBWA 2V78A 3I3YA 4K8KA 4K9IA 1EKQA 2FV7A 3JULA 4N09A 4C5JA 3KTNA 4KALA 3RRFA 3KZHA 5EYNA 2AB8A 1EKKA 3KEUA 3ROXA 4K8CA 3GO7A 3RQHA 1TD2A 5F11A 4YWRA 1VK4A 4LBGA 3DRWA 5BYDA 1RKSA 5C41A 3D3KA 2Q5RA 3ROZA 2RBCA 4JKSA 3EWMA 3RO7A 4YL5A 5EY7A 3RPZA 3B3LA 4WJMA 5C40A 2AA0A 2C49A 1U2XA 1VI9A 3IH0A 4PVVA 2DDMA 3ZS7A 5B6AA 3Q1YA 3RM5A 5TQIA 4S1IB 1WYEA 4E84A 3BGKA 3UQEA 3UBOA 1UB0A 3RRJA 2VARA 3RS9A 3H74A 4JKUA 3H49A 4S1MA 4B8RA 3CQDA 1DGMA 3PL2A 3RSFA 1ESJA 1JZTA 3NL3A 1RKAA 1GC5A 2A9YA 3FHYA 4KBEA 3IN1A 3Q92A 3RSQA 2DG2A 3RTDA 2A9ZA 2AJPA 2JG1A 3K9EA 4KADA 3MBHA 4KANA 4O1LA 3ROGA 5BYCA 4K93A 5CGEA 3UQ6A 4X8FA 4XF6A 2AWDA 3RTAA 1RFTA 1TZ3A 4LCAA 4C5NA 4E8WA 2I6BA 4LBXA 4N08A 3IKHA 3RY7A 3PZSA 1V19A 1BX4A 3B1NA 3D3JA 2XTBA 3RQ8A 1V1BA 1YGKA 3HICA 4JJPA 4E8YA 3LKIA 3RTEA 3FHXA 3RU3A 1RFUA 3LOOA 1LHPA 3UMOA 4KAHA 2NWHA 4O1GA 2DDOA 2PKNA 3LHXA 3RSSA 1TZ6A 2C4EA 2F02A 3RO4A 3B1RA 5TRWA 4E69A 5C3ZA 3IQ0A 1JXIA 2QHPA 3QAIA 3VAQA 4DU5A 5C3YA 5F0ZA 2PKKA 3RSGA 1UA4A 2R3EA 3MBJA 2PKMA 3NL2A 2R3BA 3NM1A 3GO6A 2O8NA 3QA2A 4XCKA 4XF7A 2HW1A 4K9CA 3IE7A 4EBUA 1ESQA 4C5MA 4S1HA 3RS8A 1LIKA 2QCVA 3NCAA 3ROEA 4K8PA 4K8TA 4U7XA 3RT7A 4EOHA 2DDWA 2F7KA 1LIOA 3NC9A 1RFVA 3NC2A 3RQQA 1LHRA 1LIIA 1YHJA 3RQXA 3N1CA 3OTXA 1RK2A 3HPDA 4DC3A 2ABSA 3NL6A 4E8ZA 4B8SA 3RREA 3RQ6A 3UMPA 1GQTA
chains in the Genus database with same CATH superfamily
4GHWA 3FPAA 5T4BA 4WOKA 2MCFA 2EATA 2DFVA 1CNEA 3A4YA 2H1RA 1TAHA 2FUNB 4ZAFA 2UZ3A 4U8GA 3EZ2A 3EEBA 2VYND 2DPGA 3F6YA 3LUFA 3N6RA 4QVGA 4XLLA 3WWPA 1U3GA 2MR5A 2WHRA 1W2HA 1NBMD 3AR8A 5HBGA 3W78A 2ZUCA 3CVXA 4G0QA 3IIKA 1HFEL 2ZJYA 1XG5A 1XZJA 1EUCB 2JGIA 3KSZO 4QICA 1XMPA 2PNJA 5J43A 2GCOB 1FJ2A 4GOOD 4URUR 3LCVB 3OZCA 4P08A 4WMLA 3OAAD 4HS9A 4J0CA 4PFKA 2HXSA 3DD5A 3FMIA 3CW2A 3LFHA 1DB3A 3K2EA 4U4AA 4U7FA 4C4OA 5FTLA 4X1YB 5AVXA 1OROA 2O9JA 4I9UA 4DLZA 4DA0A 1EEHA 2CCGA 3I6QA 2WINI 3PC6A 2QUBA 3P9RA 4D6PA 4E11A 2AFBA 3FOBA 4KO4S 4IG9A 4W6QA 2HC9A 1VBMA 1TKAA 4RJLA 5FBLB 1KDVA 3T1YB 5FV4A 2OCGA 3OHMA 3N2GB 5DF1A 1D2MA 4GX2A 2PRSA 3ZKWA 1JHPA 3TMYA 1DCMA 1MN6A 3OKPA 3CTMA 1JKJA 5FWYA 3FD8A 3RYIB 1TQ2A 2WK1A 2JCVA 1JDBC 4IOMA 3IAM6 1PGQA 4TL9A 2FUG1 2O0LA 1QIHA 2JARA 4GBMA 1E99A 4N01A 4ZOLA 4JC5A 4CLEA 4QLBA 2PGOA 2W6IA 3CCCA 5EGSA 2QSYA 1F2TB 2EWVA 2IELA 2XB9A 1MV8A 1Z6AA 3NP7A 4JFRA 5FHRA 2GBLA 1JRLA 3UJNA 4EELA 5CCBA 2Z6QA 5HQ3B 2NO1A 1N8SA 1FFBA 2AUTA 2ZIUB 2WZQA 3H4IA 2H31A 2IY7A 5EHQA 4B46A 1UPUA 3FR8A 2ZSIA 4OFWA 3GDOA 4NICA 1FDTA 2YJ5A 2ERYA 5DM60 1JDUA 4OTZA 2OM2A 3FFAA 4G09A 3W7BA 2BLNA 2VJPA 2EKQA 4CV0A 4HNAB 1LQUA 5F7OA 1EIWA 1XTVA 2Y1DA 3K3PA 2J6BA 3O3CA 4ODIA 5EOVA 1D0VA 1EB8A 3DE4X 3C1AA 3EMVA 4UU1A 2A67A 3THRA 5FQOA 3F8WA 1POXA 2IU4A 2LWIA 2X0EA 4F5ZA 3U9SA 1YHNA 1CSEE 1RXVA 3ADPA 4O1HA 1RWPA 2HQBA 2WD7A 2BI8A 2QM8A 5HS6A 2BDUA 4MWZA 4QAJA 1H9BA 5DCUA 4OHOA 4F04A 3WGHA 3ANSA 3LP6A 3VKUA 4ER0A 2IZ5A 5KS2A 3CMCO 4LMAA 5B3JA 4HUTA 4TXNA 1J23A 2Q62A 3KELA 3MWGA 1OBCA 4DLPA 4YRGA 1E4VA 2BZ1A 3IAS1 3SXPA 4Z6KA 3PNQA 2GK7A 2QM7A 3IS3A 3R7LA 2HWUA 3PGKA 4G23A 1CUFA 1Y5IA 5HRAA 3THWA 3GO6A 3PENA 3FHCB 2H7YA 4XUEA 1BDJA 2I2XB 2IY9A 2W2OA 4C6SA 3NCAA 2ZI3A 3HN2A 3RHSA 1NFQA 1RQGA 3L7CA 3E4CA 1VL6A 1I7NA 4MWBA 2R8XA 4WOPA 4Q39A 1RACA 3HWSA 3CEMA 2VJQA 2VJCA 2BKUA 4OK6A 2ONJA 1PAUA 1E2FA 2W43A 3BREA 1S8OA 5CG1A 1HFWA 1VKHA 1K8XB 1YQQA 2F9FA 4OQDA 5JD5A 1L7BA 2XZOA 4GUAA 5DNEA 5FFFA 5A2GA 1TYAE 2Q29A 3SF8B 1TZ2A 1XDZA 3ENWA 1Q84A 2D5IA 3CW9A 3NLLA 4JVMA 5HIAA 3O21A 2ZUVA 1LW7A 1ZI6A 3DEZA 4DSOA 5B7PA 4MARA 1YGJA 2DUJA 2CNDA 2PX8A 3Q2KA 3CM0A 3GGOA 1U7TA 1TL7C 4IBOA 4M55A 4QJIA 2HWXA 5EIFA 4D3YA 5JNLA 3RU2A 3AKEA 5GOZA 4H1HA 1XPOA 4MR8B 1X6VA 5FXMA 3AF0A 2QK4A 2DUMA 2IQIA 2JANA 2YTZA 3CGGA 3QLEA 4HAZA 4WN3A 1GYQA 4CMJA 1L7NA 1GAXA 1OMOA 4FINA 4M98A 3JTEA 2YZ2A 3VVMA 4I50B 5AUNB 3IHKA 1T4CA 5EQJB 3ZWXA 3NATA 3GLSA 5AVYA 1KERA 1AVTA 2CE7A 2ZP1A 4P0QB 1TO2E 2I1VB 1NOKA 3NBWA 2HMUA 1XTZA 4RQUA 3L01A 4EHDA 1EKQA 1SVIA 1V4VA 2ATIA 1PHRA 1M74A 1HG1A 2P9BA 1N2EA 2RHWA 1P33A 1W1WA 3TTUA 3MUFA 4RH1A 3T3PB 3PX3A 3NKFA 2BV3A 3LUJA 3O93A 4MMXB 3VBEA 5KQSA 1QU2A 1XN4A 2AFHE 1UP4A 1PJ8A 1NNEA 2QZSA 3I6YA 3VMMA 3H2IA 3BDIA 3H9QA 3SDBA 3W2HA 4X91A 3WMGA 1EVQA 2Q0SA 4KPFC 1A7KA 2JAHA 4HLNA 1JALA 2HPVA 2IYOA 2QL9A 2YQZA 1PQWA 3K20A 5A71A 3ZDRA 4DM7A 1V5IA 1ECPA 4OXNA 1B3RA 1Z4PX 2HBZA 3I9V1 3MJSA 3R24A 1X7DA 2XWBF 4JUAA 4KK4A 3V1YA 4DIDA 2DZDA 3N8DA 5JROA 3HJAA 1LPOA 4MV6A 1N7HA 3TN7A 1KPHA 2XCLA 3RD5A 4RZIA 3RVOA 2P3SA 4HY3A 1XWFA 3M6UA 3HFGA 1P2FA 3IRUA 1NASA 3JAKA 4BLTA 3UK6A 1A9OA 5K8VA 1ESEA 1JXOA 4J16A 1JFSA 2H3HA 2UVPA 3PEWA 3NTRA 4QXRA 3HV0A 3T5TA 1EVYA 3I6BA 3QLUA 2F43B 4DEVA 1MAUA 2QP9X 5IC5A 3BJRA 3VR4D 1NUSA 4FFOA 4RVSA 3HICA 2VNSA 3OLZA 1EINA 1JF8A 5JO0A 1PBNA 2O5VA 3GLFA 2W00A 1T0BA 3QKSB 3OT5A 2FMKA 4RA6B 3UUGA 5HZKA 1VL5A 4NBRA 4EQ6A 2QHPA 1XZHA 4UCWA 1MKYA 1NBIA 1QVWA 4HLUA 3LZ6A 5BSEA 3JWJA 4NJMB 1CJVC 1S9HA 3DS8A 4DF3A 4TSFA 3JVDA 4EB6B 1CY1A 1O94C 5B7NA 2JEYA 5IN4A 2WIBA 3I2YX 4X3OA 4ND8A 3LQYA 1W2WB 4MH0R 1W25A 3VFDA 2Q5OA 5ERYA 2CY0A 4YJ2A 3DZ8A 2MMGA 1D7AA 3NTLA 4G5OA 2OFFA 1OFVA 2PWPA 1EFHA 5K0LA 2GYYA 3HU3A 3DBVO 3K9GA 2B3DA 3I5AA 5TGTA 1RK2A 2QVCA 4FI3F 2QOEA 3HBJA 1FPMA 3L5OA 3OO1A 3H8JA 3KLOA 1U7ZA 1IEWA 4HLCA 4X1OA 1YVPA 2LV8A 2XOEA 1N78A 3QVJA 4HG2A 1ZJ5A 3EUWA 4PPYA 3TBKA 1X3SA 4H7IA 4WBSA 1VIVA 2C5AA 3VM6A 1EFPB 1ULHA 2EFHB 4C4XA 3CLKA 4XFKA 5LQKA 4KN5A 4JLAA 5AVJA 1FMLA 3CIFA 3AI2A 2PQ6A 3M89A 3QTLA 4Y0VA 5K2OA 3KLPX 1K3FA 1U0NA 1XGKA 2RH8A 3B6KA 4QBGB 4JUCA 1PHPA 2JJ1A 1Q50A 2HYDA 3H5IA 2RHBA 5EWLB 4IEFB 1U7HA 3DKVA 4UHCA 5IJWA 3C3CA 3I39X 4QYSA 4Y6LA 4JBXA 2ZYTX 4KE8A 5L45A 3K6SA 4MW1A 2GD0A 3ME5A 2BFBA 5B64A 5T6BA 2YNMA 4WFQA 3D43A 4X90A 3L8GA 3TUZC 1CNMA 4UUMA 4C2UA 1C4WA 1F8YA 1SNYA 4ZVPA 3WDMA 3BFKA 2ZJ1A 2X3YA 1DS6A 2HCRA 5J2TF 5F52A 2Q1SA 2V7UA 3PFWO 4B2PA 2C98A 1K6MA 1K5GA 1L5HB 5G40A 5HILA 2GZMA 3RQHA 1KI6A 1GGKA 1P1HA 1KH3A 1PFWA 2KMLA 3I1FA 4N3BA 4QUBA 3Q6NA 1KJNA 2WUGA 3Q7RA 5CH5A 3EWMA 1US8B 4CUKA 3IKLA 1SXJD 1JFLA 4ESHA 3EY9A 1U9CA 3WIOA 2AA0A 1VG1A 1VI9A 2BEKA 4PG4A 3UWDA 4RYDA 1PZNA 5LA6B 2AOWA 4DE5A 1PZFA 2IXFA 1NN5A 3KHTA 2NMVA 2P5SA 5LL6P 1NI5A 1UAYA 3EFBA 1NMZA 4NJEA 1RJFA 2Q0QA 2D4HA 4AP5A 3ADDA 5SYMA 5JCXA 2P8JA 5BV0A 2BKLA 4NE7A 1A7AA 2OGZA 1YF3A 5K99A 2L69A 1U8XX 3FSEA 2WWXA 3TW4A 3RADC 5F51A 3WAJA 1A72A 1LSJA 4I66A 5L4SA 3L7LA 1KJIA 3FXAA 2B0JA 1DRUA 1JJVA 5H02A 5TRTA 1A5SB 4LOKA 4PGHA 5KNBH 1XAIA 2NO4A 1RQRA 1EXWA 2Q27A 2Q8NA 1NPDA 3FPFA 1NUUA 4IR7A 4O4LF 4ND2A 1IXZA 4TTRA 1RFUA 4FEEA 3RYHB 3I52A 5FB3A 3TOVA 5JV5A 4M8KA 3GH1A 3NYQA 2ATEA 4ACBA 1FX1A 4D1YA 4DABA 4TKVB 4ER7A 2R1VA 2JFYA 4LE0A 5CEEA 1JLHA 4L9AA 1XZLA 521PA 4IQ8A 2WKRA 1UDWA 5AM1A 3TM4A 4D81A 1YZUA 3HSKA 1KA9H 5L3SB 5CFMA 1SBHA 5J59A 3SXUB 4YPFA 1DOAA 1XVVA 4JCCA 4ZAVA 5IN5A 4RTPA 5CGZA 3ZU5A 2HNAA 4OHWA 4RJIA 4RAOA 3U7EB 5DGXA 4V1CA 3H8SA 1ULZA 4M6WA 4KE9A 2NTYC 5BXYA 2PX2A 5KC9A 4TTIA 2AG0A 2YOFA 3H5TA 5EJ4A 4KR0A 1BGWA 3TSCA 3EVBA 1IPFA 3EA5A 3HA5A 4L8GA 1O5IA 3NJ4A 4JP2A 2GOYA 1MQSA 4XSHA 4ZZ1A 5GJBA 2DY1A 4GZ3A 3JVIA 2YWBA 3DKRA 4PSUA 2VIIA 2QR2A 4XM1A 4C0KA 1T43A 1CY6A 2CFSA 5C8YF 2XLBA 4IH9A 5LB4A 4GX1A 1XXHB 2ZYRA 4J7AA 1KRWA 2OFPA 1A9SA 4R40A 4F3YA 4HX2A 5G53C 3QA2A 3AJDA 2C2WA 1F9EA 1U5CA 3GGSA 3KJIA 2HLDD 5DWVA 4EGQA 1SBYA 1PG0A 2O8DB 1SBTA 3F98A 2OZLB 1MOQA 5HIKA 1QTIA 5DHQA 1UBGA 5EZSA 1SBCA 4MMZB 4PM4A 3SKVA 3PEVA 4BWVA 4RV4A 4GM6A 3KVOA 2BEUA 1Z4QA 4I0WB 1CZKA 1QRRA 3K9LA 4CLOB 1PNOA 1UOOA 3O3OB 4MVJH 3MD0A 1ACMA 5D6NA 2QUJA 3E18A 4MGZR 1A69A 2X7HA 3SIPA 3VU0A 4DMMA 5B12A 3LYLA 5IH7A 1PT6A 1BU8A 1PTKA 2BE7A 4H1WA 1PEDA 2NQ8A 3AQIA 1Y8QB 4RFSB 3EB9A 5CLLA 2E4XA 3HGQA 3RJTA 2F4VB 2C5BA 6CHYA 1EK0A 1OLSB 5KKCA 1Z18A 1XZNA 4H7KA 1NRWA 3WNVA 1AIPA 1YR7A 4DZZA 1B41A 3MXOA 2ORIA 3P9XA 5GM2A 3M9LA 1K86A 2X5NA 3M9XA 4Z7QB 1U6KA 1NRIA 5ALSA 1RLTA 5CLGA 3O95A 4OYHA 3T5DA 1R15A 1NI3A 2CXNA 2ZBUA 3L07A 4RV5A 4BVLA 3LX8A 1J8FA 3L0BA 4DXDA 3SVLA 4TQUS 4J75A 3LNTA 1L4MA 3ZU4A 1NUHA 4OREX 3KJHA 2WJZB 4DV2B 4TKZA 3ORRA 5TQIA 4PNEA 1U99A 4LQLA 3P9PA 1KXZA 2DBRA 3IOBA 1TYEB 3DGEC 4D97A 1JBKA 5HK9A 5IAJA 2PX6A 2Q1XA 2FX3A 2ZVQX 1UL1X 1A2OA 4Q02A 2JGJA 3DEKA 5LFAA 4B33A 2F00A 2YYYA 4JCOA 2I54A 4YACA 2FMHA 4HVTA 4BV9A 5CAEA 1SXJE 3QW4B 2PH1A 3ADKA 5K8LA 2XZLA 2IYTA 1ORTA 4Z99A 3WFZA 1DKQA 4HNVA 3TSAA 3U7QB 3DEAA 1WEHA 3O75A 1TW3A 2FP3A 3ABQB 1J2RA 4MWTA 2H11A 4JJ6A 1BRMA 2C20A 4FUTA 4BTLA 1OKKA 4JSTA 4KXQA 1OTYA 4NCKA 3VRHA 1QP0A 2GJ4A 2X4LA 5SZIA 5JY1A 2IH5A 4BO9A 4K9NA 2PKNA 4LV8B 1E3QA 4M37A 2AQIA 1MT0A 2GD2A 1JKFA 4HDSA 4PC2A 4DADA 2IZ7A 5H81A 1SULA 2Y1EA 3GPCA 4UATA 3B9RA 3H2JA 1M67A 1GTMA 1CRWG 2NU6B 3OJEA 4JI4B 1IEQA 2AB0A 4L4RA 4D9IA 6ABPA 2G1PA 3KKKA 4UUPA 4X1IA 4ZIRB 4ES6A 3HVIA 3ZDBA 2QRHA 4KW7A 2VJBA 4ZDWA 4HQFA 4YJ2B 1U8EA 1P1JA 3BKXA 4W8GA 1N2GA 4NOJA 2X5OA 1JG6A 3JQPA 4G65A 3IT3A 1I1NA 1RIFA 3KR9A 4MYUA 3SQOA 1SU7A 4DG9A 3DVAB 2YUIA 5FWXA 3NL6A 5CH8A 4DQLA 3FETA 2PWBA 4FFMA 2Z8YM 2F3TA 1C8LA 3IH5A 1AN9A 4QNNA 1FYFA 1RCFA 4TVKA 3M8KA 4O4IF 3QE9Y 3EIOA 3A1FA 3KDSE 5AJHA 1AQNA 3DCNA 4RVGA 3ONWA 5LA6A 2FK7A 2H1SA 1ZK2A 1QKJA 1NDQA 3QA9A 4UMFA 1CE8B 3HDYA 3ELDA 4WXPA 1PL7A 5HBRA 4HB3A 4HVLA 1N4AA 1W0KA 1BH2A 2ZJBA 4KFUA 1LDYA 5K51A 3MRVA 1YVDA 2PR2A 4WZAA 1B42A 4RVCA 5JFTA 3VTAA 3V1TC 1YZQA 4Q3EA 2OAQ1 1QFMA 3PD1A 1DV2A 4C3ZA 4CM6A 3JRNA 3V8QA 3ZR4B 2QE6A 2C00A 2YVLA 3DDUA 3DLTA 4HMOA 1HMPA 4PLGA 1GA1A 4M8SA 2N3ZA 4OQNA 3FW1A 3NCTA 4URFA 4V2IA 5CM9C 4B84A 3ZWYA 4DMGA 4CG3A 2JAXA 2ZT7A 2PRYA 1ONSA 4X1YA 1O6FA 3OY2A 4RF3A 5CDTA 1VE7A 4LW8A 3BHIA 4Y2JA 2NPOA 4B8YA 4YAGA 2O2XA 1ITZA 3VJKA 3EY4A 4EO4A 4FR0A 4FVTA 3PFHA 2R1UA 4MVXA 4D0GA 4AXXA 3DB1A 4Q4AB 1LTKA 1H6BA 2Y6UA 1DZ3A 5H9VA 3ZE7A 4RSMA 3RSHA 4ZI7A 3E5NA 4B32A 5K0CA 1Z36A 3E9CA 3OIUA 3PC4A 4RGBA 4Z8YA 2CLSA 1MT3A 2DHDA 4TZ6A 1XNGA 3G0OA 1KY3A 2FPIB 2GARA 1GRVA 4HJRA 4QIHA 1GKKA 4CVLA 1KFJB 2I55A 3EZLA 4DSAA 4FHZA 4QOSA 1CUIA 2WG0A 2Z2XA 2C3OA 2X14A 3DFIA 4XUDA 4FLFA 2FCRA 5BSFA 1ENPA 1HYHA 3AWDA 1XHEA 4FJ0A 2XMDA 3DV0B 3EWNA 4GKBA 5DNDA 2GF0A 4PSVA 1L4NA 1BWSA 1IY1A 1Y1QA 5B6IA 2JFZA 1S01A 3GNTA 4O2RA 3ZV6A 3ROMA 4E7OA 2ZBEA 1Z6YA 4R2XA 1Y5NA 4OD0A 4Z3OA 3IULA 4KHPB 3TNDA 4K93A 1FTWA 4FHEA 4N76A 1QGAA 1Z29A 1YQ9A 4UVGA 3ZK9A 4FFBB 4N6GA 1A77A 1PVVA 4XYBA 4CCWA 3AFMA 1VJGA 4M9SA 5GJWC 4RVUA 3L6CA 5KTMA 1UPAA 1ZXXA 1XPUA 1GU7A 2ETXA 1J09A 2BM0A 2PZFA 3LHFA 3OZWA 4WOJA 2ZM5A 3LPMA 3W05A 4NIMA 2IIVA 3ZDXB 2BM1A 5LXTA 1NI4A 2CT8A 5LWHA 4GX0A 1VCOA 3T35A 3LOOA 1BCRA 5I7UA 4ZCRA 3W6ZA 3FAZA 2HHHB 3EGEA 3AGPA 1QZTA 1RZ3A 2XNKA 4I9HA 3TWOA 4DMFA 3K70D 2OLEA 1B76A 4KQGA 4R1MA 5DGDA 4E21A 1DAHA 2G08A 1G9SA 2RDMA 1L4KA 4N12A 2EZ9A 1EX7A 1OPRA 3IOYA 2BT4A 4NG5A 1IIBA 1NONA 1UJMA 4LDRA 3GWZA 3K09A 3DA8A 4P35A 3HBMA 2GJKA 5HCNA 4TUYF 2C0PA 4Q37A 5IPFA 4QELA 3I5UA 3D0QA 2GH1A 1IZZA 3O4JA 3GCZA 5LLSA 1NYTA 2A5JA 2LVBA 4ZOQI 5ABPA 4QTXA 2XCOA 4S1NA 5C2JB 1E1CA 2VT2A 4OKIA 2I2FA 3BRSA 4WNYA 2CVHA 4JI3B 3RUDA 1KDRA 5IAGA 3BE5A 1PL8A 4BP1A 3BXZA 3KHKA 2P6NA 1BOFA 3NIDB 1F0KA 1RI4A 2PS9A 3TSOA 3TIIA 3JV7A 4F9GA 2VAVA 3EA0A 1N1GA 1S8AA 2ZI6A 3GA7A 4D4KA 4GZ6A 4DIUA 5BUCA 2Z43A 1I1QB 5C8XA 3GLKA 1FDVA 2V65A 1XHLA 5KWJA 1CIPA 4J0IA 4JJIA 2AWOA 4L75A 4RH3A 4DPLA 4M4SA 2W4IA 2INGX 3BMNA 3S7ZA 2FJPA 2I3DA 5H7XA 4HEHA 1AA6A 1Z6GA 2C5FA 1NW6A 2D8AA 4ZCMA 4UUAA 5JJCA 4GQIA 4OFXA 4YUXA 2PZLA 3FB1A 5K3BA 2I1LA 4QJ4A 1CZRA 2FN3A 3GJ5A 1A8SA 1L6RA 2HA5A 4MS3B 4MSUA 1LPNA 5AK3A 3QEKA 1G8MA 4KMSA 3RRMA 2TS1A 3AUAA 3CBGA 4BX3A 5LQCA 3NUZA 1JQEA 1IJBA 4ZU1X 1FP4B 4OHYA 1PGPA 3IKVA 1UODA 3PHBE 1F7UA 4DILA 4TLAA 1I2MA 2IYLD 3LY8A 2J4CA 3KD2A 4O2AA 4YAFA 5DWDA 3CUWA 5EE1A 3VR4A 5A6SA 3M4NA 4YV0A 1IOVA 2PGDA 4LHWA 5J4YA 1ZAYA 4AZ3A 1OY1A 2JB9A 2BFOA 3X2EA 1GNRA 4G63A 1DFGA 2Q4TA 3C5WP 4RK7A 4K40A 4V1CI 1G64A 1E2BA 2XUOA 1YZGA 4DHWA 4FJ2A 1K68A 2IKQA 2XVAA 1ZD3A 2YWGA 1N9ZA 3G5MA 5EUMA 3F7NA 3ZPXA 3CLUD 3RYCB 2UUOA 5D7NA 2DC1A 3QFRA 1ZD1A 1OWLA 4IFTA 4RGQA 5DBEX 3TTWA 2GO1A 1DARA 1VGRA 4R1UA 1BWPA 1ADCA 3GRPA 5FBWB 3RF7A 3RUCA 5A5VA 4OHMA 2D0IA 2TMDA 3I2HA 1CR6A 5TT1A 1PQUA 1J0AA 3IEVA 4OAPA 4DG8A 3OX4A 2FJUA 4QUKA 1WSBA 2HI0A 5H3HA 1F0YA 3Q7PA 1QIJA 2YICA 2F3PA 1ACJA 2VSXA 4TWZA 1VDZA 3O8QB 4ZU6X 2JH3A 1RR6A 5HF8A 4HEA6 3OQBA 1HSOA 1TVKB 5BT8A 4GI1A 2PVCA 1G2IA 5B53A 3ZCVA 4F0JA 4QTYA 2DR3A 4IV0A 2IEIA 3TD2A 2XMGA 2ZWMA 1E5VA 4Q4JA 1EVZA 2PG3A 4G5XA 3E53A 4L0QA 1N7JA 4OXKA 4RZSA 3UIEA 2Y99A 3MB8A 3RSGA 3SQMA 4NBSA 4BEVA 2WHPB 4Q4CA 4XCKA 3KOXA 2HQRA 2XR1A 2ZATA 3GDHA 2D1QA 1NQTA 2VZ0A 4I7EA 4H0FA 1X1DA 3TD6A 3KKMA 2ISQA 4XRRA 2DDWA 4ZEMA 4NR0A 5LR6A 1SHTX 2WKQA 2O19A 1Y6QA 1YRHA 2EU8A 1X92A 2GK3A 3AR4A 5LZ2A 1V96A 1F1BA 2WNHA 4PGMA 1UFRA 4IZOA 1UT8A 2R8OA 2ABSA 1Z7YA 4BJ6A 1ZONA 2Z98A 1ZMRA 4B3FX 4YMSA 4RVHA 2QGZA 3AP1A 4O8ZA 4ZYLA 5FUMA 2NP6A 3IB3A 3KTDA 4K05A 5E2BA 3TIGA 4M0FA 3F73A 5CHYA 5BN4B 1V2GA 2X8AA 4KFCA 2IBSA 1WA5A 4K0KB 3T5MA 3ZQ4A 3UQDA 5DLDA 2QVYX 3L43A 2BAGA 3O73A 2H1VA 2RSLA 3DZIA 3FNRA 4LXTA 4O4JF 4PYQA 4TS1A 4MRMA 4XASA 1UBOS 3SHFA 3SJZA 1WUHS 4G5GA 1JG4A 1IEVA 2PZEA 2XDWA 3L6BA 4MVCA 1R4AA 1AA9A 1PR3A 2MOKA 1H2YA 1Z25A 3Q6MA 1VPTA 3ED1A 1UBNA 3JZDA 3JW8A 4MAMA 3V2IA 3WLMA 4GKJB 4I99A 5F1OA 1V1SA 5DULA 4XIGS 2QN9A 2V6MA 3A6FA 1OI2A 2NZVG 2WYIA 5DASA 3UV3A 2R00A 4C4TA 4A8JB 4WEOA 4EY6A 3ONFA 1VKNA 3KTNA 1WWKA 2HWYA 3QU7A 4B3BA 2GN0A 4EJMA 5HDBB 3KQSA 4R98A 3FWKA 3A9UA 1G8AA 2ZRJA 3FPSA 4NCXA 4OHFA 2JLYA 3GLHA 3K0CA 4WA7A 4QUGA 2QX9A 1PGOA 4Q01A 5ALPA 1SQ6A 3DZJA 2XWJI 2OY0A 4OHKA 2WAYA 4DLVA 1EVIA 1M2OB 1FYXA 1T34A 1XVTA 1ZVMA 3HN7A 2CXQA 4ZVLA 5IK2A 1E4YA 1SUFA 4K8RB 2YS7A 3GP8A 2HMVA 1OBFO 2E1RA 1KPGA 4BLOA 2XT6A 2JC3A 4BFSA 4R1PA 2I22A 3P9SA 4MEAA 8GPBA 5G2OA 2UAGA 2QAGC 3GDFA 1N6RA 4IV5A 4NL4H 1W88B 1SEPA 2QTVB 3TSYA 3UAOA 2JI7A 3NVKI 4YRPA 1PEAA 2FCAA 3O4RA 1WPXA 4QATA 2TMGA 1JNXX 4XKJA 5JSZB 5G0SA 4LTNA 3UATA 2A9ZA 1M1ZA 3LO8A 5B6JA 1LTHR 1O95C 1Y3FE 3CH5A 4Z8XA 1TQ4A 4F1KA 3PQ4A 2XYVA 1W2GA 3NAGA 5ILQA 3L9WA 1UKYA 1VE5A 4GXQA 4JA2A 4L8FA 2I3AA 2PKQP 3NG1A 4EVRA 4K03A 4NDZA 5KYWB 1NQWA 2O05A 1Z74A 2HLNA 4NU6A 4PZLA 4XOIA 4X7RA 3SWWA 5U4XA 4PY2A 1FU8A 4A82A 1HE5A 2NUPA 5NLLA 4C89A 2ZJ2A 3VSEA 3SAJA 2ZTLA 4TT3D 1SZCA 3ND9A 3F0TA 1I0ZA 5JH7F 2H5IA 2FSUA 2Z5VA 3K7EA 3IQ0A 3G9UA 5CCXA 3A2LA 1LVUA 3FNFA 1FLNA 2IPAB 2WJWA 3M33A 2P0EA 3R77A 2QJFA 4UHBA 2WE7A 1ZGGA 2DFKB 4RETA 4KZKA 3CUVA 3JZFA 4L8LA 4M54A 3RWOA 4YECA 4B4UA 1QYVA 2VOSA 1AK2A 3W04A 5FOTA 2Z09A 5ES3A 3NC2A 1STOA 2QJTA 2VHZA 4ZJYA 4B34A 2IVZA 2PA0A 2WHYA 4UMDA 4YGXB 1E9CA 4GM0A 3OTGA 2ZU0C 1A2KC 1OD6A 1QF9A 2HLDA 2E49A 4YAJA 3R3SA 2JBAB 4YHBA 4FHFA 3Q3GE 3MT7A 4P5EA 5BMVF 5GONF 1IN4A 1NC1A 3ZWMA 1RTTA 5IC6A 3IHLA 1THZA 4I55F 1NHGA 2HHLA 1F48A 2Y9MB 2C57A 5J5VA 3BRWA 3ADOA 2ZJOA 4LOHA 1XJWA 4X54A 2RJ3A 3AP3A 1SZJG 3FF1A 4TUYA 2HA3A 2X22A 1FNNA 1QH9A 5IEBA 2QW0X 5F77A 3ZE6A 4B73A 1LDEA 2P9FA 1EJBA 1KKLA 3GELA 2F3UA 4KPUA 4RTMA 5DHTA 5JZMA 1WDWB 1R10A 1FNSA 2F3SA 3MGBA 4OGLA 4WD3A 3TAHA 1HZZC 5JT1A 4FS8A 1GU0A 2IRWA 1HE2A 3A27A 3KQMA 4ON9A 5FNZA 2OHHA 3NQ41 1CS4C 2CD9A 4TRJA 2XF2A 1TYYA 3VC2A 3WGTA 2ASEA 3N2LA 3W9BA 2CJFA 2OYRA 2OBXA 4QHTA 1ZI9A 5D3ZA 4D4JA 3B1QA 2OHJA 1OQAA 4C7JA 1OC2A 1VM7A 4D99A 1FF9A 2GTHA 2G83A 4LSWA 4U2DA 1J9GA 1Z62A 3JARA 1Q20A 4C5JA 2Y1GA 3LNCA 5GJVC 2B4QA 2UV8A 4CNBA 3IHTA 1V11A 3HK2A 2NQTA 2R6ZA 2JRLA 4L9SA 1JLLB 3EA4A 3Q2OA 1AD2A 1RKXA 4PTZA 4PR0A 2NNLD 4YIKA 3L8ZA 5D87A 2CXXA 3C6ZA 4HPJB 4N7JA 3QK7A 5HE9A 2CL0X 3LX5A 4ZALA 4IDAA 5CXUA 5IABA 3Q9LA 1N9KA 3D3WA 2A0KA 3U9TA 4MB0A 1OWMA 2ET6A 1P5HA 5BR4A 1PZMA 2H65A 4NF2A 5AJXA 2FN9A 4EA7A 1T5DX 3LGAA 4JJ7A 2B36A 5KIAA 1G3RA 4C0BA 4WPGA 1YQWA 2GBPA 4WI1A 5KSWB 3N07A 5F23A 2J5QA 3SEFA 2GAOA 1NVFA 2D1SA 5A06A 2DFDA 1KJWA 5J4HA 4P2GA 4JKUA 4ROTA 3E9NA 2EIXA 3KJZA 4FFPA 3Q4GA 4RXTA 4AVYA 4HOYA 1E1YA 2G8NA 2WOOA 1RAAA 4JENA 5H83A 1BMDA 3RW9A 1BKYA 2ZUDA 2QV7A 4HTFA 1U5BA 1E5LA 1EBFA 4M89A 3TGWA 5FLEX 4C21A 3THYA 3RHZA 2ZI4A 1XQ9A 3SC2B 3UWMA 1JGTA 2NAFA 2HADA 1ML3A 3EIQA 3T5CA 2EKLA 1J21A 1IUPA 4EHHA 3L7DA 3BPSA 3RY7A 2V55B 4Z0PA 3FGZA 1XLTA 3L7NA 4OP2A 4MW7A 3HHEA 1UBHS 2RC6A 5ELLA 3TLGB 3NDJA 1X1TA 5AUQA 2ASVA 1B8UA 1QGUB 1RXYA 3FWHA 5LZ4A 3S8MA 4ZA2A 1IL0A 3ET4A 2P9TA 3HLYA 1GM5A 2HLHA 2YUTA 5GVSA 2P9HA 4UUQA 3HFRA 4IVPA 3VQTA 2RGAA 3PQ8A 4M99A 3UWOA 1RP7A 1JEYB 3CLRD 3LRTA 4D4HA 4L5JA 4PCLA 5F3RA 3OO0A 2BKAA 3N7UA 5IF3A 1MA0A 2VSOA 4YASA 2IDKA 3JAMA 1U3UA 3QVGB 2AM1A 2OFXA 1D2EA 5BRJA 3KG2A 1MX9A 1ZL2A 4NHOA 1BN6A 3PLRA 2ODNA 1AS0A 3SMVA 3RUFA 2AZXA 1YJXA 1QZZA 4QQ8A 3CCBA 3DBHB 4Q66C 1OVGA 3HABA 4CM1A 3JWIA 1HGXA 2XZTA 4YAOA 4PZZA 3UFXB 2AX3A 3ESRA 2J32A 5F4ZA 2YRFA 5JS7A 1Z8NA 2O3UA 1PT7A 3QVMA 2IXTA 1LUAA 4D5GA 3ZQUA 5K0ZA 3AINA 3GRVA 2WTNA 2HKIA 3WHIA 3PX2A 5FA8A 5BYFA 1G6HA 2XMRA 4H9GA 4HGQA 3B1WA 2WYHA 3N7AA 3FUXA 4BJ5A 4BP3A 3BB1A 2WFAA 1NQXA 4HYTA 1T3LA 3IUJA 1NTRA 4HNSA 4UTZA 1FUIA 1ZQ1A 2NLOA 2HO5A 3FLBA 1P80A 1T9GR 4XFJA 1BFDA 4IH4A 2OVFA 4IV8A 4UPEA 2V7GA 4IXTA 5ALOA 3NMUF 1CW2B 4V0QA 3TEMA 3MCAA 2QBYA 2JG5A 1U2EA 4WT7A 2WDZA 1KSFX 1Q91A 3OCJA 1RI2A 4WXMA 1OI7A 3W5SA 3AEKB 8ATCA 4UBIA 3H1GA 1NBWB 3AQ4A 1A7JA 1E9AA 1LU9A 2I8LA 3D6JA 3K53A 3PQCA 4FNAA 5F98A 3Q92A 3A0UA 1H65A 3SBDA 1YL5A 3ZVRA 2PFGA 2CE2X 3BA1A 3G8AA 1O58A 3IALA 3PDCA 4JITA 1H5NA 2VPTA 1BHO1 4NV3A 2NO6A 2IE0A 3FCYA 2Q0XA 2BFNA 4OGWA 5FNVA 2QTNA 2P40A 4CLRB 2IX3A 1ODFA 2YKGA 2GEUA 1GGVA 1MG0A 4ZYTA 2BHLA 3SC3A 3ZGNA 1SHJA 1U8UA 4LJ9A 5MGNA 3S2SA 3UMSA 3FOEC 1EWTA 4IP0A 1VE1A 3W6PA 1V1RB 2FEKA 3Q2IA 3E3MA 4R41A 4M0DA 3VISA 2AGVA 4Q3AA 2D2IA 2GHRA 4PG6A 1CU1A 4PRKA 3BWBA 4XARA 3ER9A 3IP7A 5CW1A 4U1RA 1UMBB 1PT8A 1E1DA 1FXWA 2XZPA 4LJRA 1ZYUA 4KMRA 2YXBA 5EYPB 2XE6A 3KKNA 1NXOA 3BZWA 3ZXIA 2AI3A 4MWOA 5CCDA 1GXSA 3PYMA 4OLAA 3VC7A 1ESDA 3ZHTA 3P19A 3OZSA 2CLDX 5FWNA 3A4VA 3BIWA 3K6RA 3OLVA 4F72A 5C46F 5A5DA 4PZ9A 3CXUA 3NUGA 4LJ5A 5KWIA 3I42A 1CRPA 1CUSA 3GCXA 4D0RA 3BTSA 3PP8A 4IUYA 5EE3A 3VX3A 2XLCA 3PUYA 3OQIA 1W46A 5HTOA 3QHQA 4JJPA 1W7KA 3ZWBA 1Q3HA 1TPYA 2PWZA 3D8HA 5IKXA 4UTVA 2DQYA 3TRJA 6GPBA 2CHFA 5KVVA 2XJ9A 5TGDA 4PAWA 3RYHA 4DKJA 1Y3AA 4BB0A 3WDLA 4PBSA 4N0DA 4UM9D 5BOSB 4XGQA 2C8JA 5HIIA 3H0EA 5IYZB 3C3EA 1X74A 1F8FA 3O74A 2HW1A 3HP1A 5T3UA 1KNXA 5C5CA 1KGSA 2MSWA 3C87A 4A0SA 4BE4A 4ZO7A 4EO7A 2OTCA 4E4YA 3L46A 4R81A 2JK0A 2WIGA 1K6IA 2F90A 2P4SA 2IOFA 3UQZA 4AY6A 5HF5A 1M2KA 5EY5B 1BVRA 1H4QA 3ISTA 2QQ5A 1OT5A 4RE6A 4F3RA 4ZICA 4M8IA 1AMNA 4RHEA 4LECA 1UK9A 1J33A 1T36A 2VDPB 3D2LA 3DBLB 4GYJA 1NVMB 4UXHA 3UK1A 4C87A 3V8EA 4DJJA 4LEIA 1N2CB 3LKBA 5E8RA 3BT7A 1N6HA 3K09C 1PFQA 1MC5A 1REQB 1S96A 1TQ6A 2QJRA 3RLIA 2H52A 4B6JA 2WIFA 1JN0A 2C94A 2E37A 3K8OE 1ZXBA 3JD3A 3QV2A 3V1NA 4KXFB 1FQJA 1Q7RA 1EFRD 3BERA 3CNBA 3MQ4A 5IVPA 3AG6A 3SZOA 2E85A 5EJFA 4K6HA 2FUCA 3V2HA 2GPNA 2Z8ZA 2V98A 1X7YA 5JJLA 4H7HA 4YH1A 1NVEA 2Q0HA 1KVRA 3AFGA 4H7JA 4YYEA 5I7EA 1NNSA 4EO9A 1YKSA 5CA0A 4QQFA 5HPYB 1RI5A 4OQPA 1G63A 2Z83A 3R7NA 3ILHA 1SKBA 2Q1TA 2AR9A 3W5DA 3BDVA 3L8YA 4MLDA 5JJIA 4O29A 2W0MA 5BXQC 4Q4HA 1V16A 2QVXX 1P1CA 2I7CA 5E4JA 4FB5A 2WQ6A 3UF0A 2FPWA 2D2VA 1GV0A 4MQFA 4YR9A 1BA3A 3WWZA 4ALNA 1JAZA 4AN4A 2XYRA 2HN9A 5K3CA 2C54A 3VSCA 3QXSA 2QTHA 4BEWA 4AF6A 2R1TB 5ICGA 3MSXA 4UVEA 2BFDB 4P9NA 4RABA 3JY6A 1M1UA 1CNFA 1VSBA 1SCBA 1MC4A 1WXXA 3GDWA 1T8YA 4IIYA 4Y6GB 3FOCA 1P0FA 5DK6A 1XLUA 3BXPA 1OBHA 1L8QA 3GVXA 1E5DA 2BEVB 1L7PA 3AERA 3NHZA 3E7PA 1DGMA 1ULSA 3N39C 1T15A 2PV0A 3QVGA 2ZZMA 3AY0A 3R7WB 3F4BA 1YA6A 1I01A 2O8BB 4B6RA 1M3SA 4FYPA 4DR7B 5NULA 3OT1B 3NOQA 5MHTA 2WJJA 4Y7CA 1H3EA 2EHJA 1HNZB 3QXJA 5DHSA 2LIPA 1M7GA 1NNI1 2PLFA 5FBZA 3C5HA 1FNDA 2JI9A 4G0XA 2YWFA 4MRSA 4BX2A 2QTBA 4UULA 1E2KA 1TVCA 3IMCA 4GMGA 1R0LA 1HEUA 1MJFA 2ZXUA 3WL5A 1RWWA 3G1TA 4ZAZA 4HH0A 4ZT5A 5TE9A 3RS7A 4QVKA 3F7TA 4LBZA 4BNYA 5BSWA 3C8HA 2X9QA 5EEGA 4A15A 4LF5B 1EQ2A 1Y5LA 2QRLA 1M6VB 2VDWA 2VHVA 4Z4HA 3T15A 2JAWA 4W5QA 4ZYVA 1DO2A 3LL7A 4D74A 1TJYA 4GR9A 2ZLBA 1VOTA 2EVWX 3HJ6A 4COOA 2ONYA 4IFIA 5TARA 2NU7B 2H1OA 4DC0A 4FWIB 5JZ9A 2XXAB 2HEIA 4EYKA 1JR4A 1N0IA 3SZUA 2H2AA 3FHTA 4EBUA 4I1OA 4UOQA 5GJCA 1SXJB 2YFYA 2VP6A 4I3FA 3O83A 4COKA 4EOHA 1XJ5A 1ULBA 4XEUA 4G4IA 4BNXA 4QUIA 2C9DA 3A1UA 4WH0A 5CDFE 3M6LA 3IBYA 5JD4A 5ALWA 2IWHA 3LFUA 1Y8CA 1ZITA 3RUEA 3RIEA 4BNZA 1SCQA 5IM4F 3KQYA 4Y9SA 2GUWA 2G63A 4LC1A 1Z5PA 4JJ4A 1RWMA 4DCOA 5A3VA 2EKPA 1PSZA 1W75A 1HDEA 3TVTA 1P1BA 1PD0A 1VLJA 5TJHA 1P81A 1N5JA 4NK5A 3VZSA 2CV2A 1R4NB 2IQ5A 3CPEA 2NW6A 5I9MA 4EN4A 4FE3A 3RNOA 2J3DA 3HCRA 3OLCX 3FPBA 6YASA 1SA0A 1CR0A 2NXNA 4Z9AA 3FPGA 3WMRA 3IVAA 2AFHB 4PLPA 4RTRA 1U2ZA 3NL5A 1UZNA 3KUKA 3NXKA 4JBNA 2CXSA 1L5SA 1KI8A 2O8VA 5JSHA 2ZJ4A 2CL6X 3WRYC 4JASB 4RVOA 1B0AA 4DS3A 2OO5A 3DOHA 2GBFA 2QX8A 1GO2A 3CLUC 4XR9A 3ZHSA 2Q9BA 3F67A 1T4DA 1XZFA 4KQCA 2IXAA 1T4CB 1ZZEA 2H0RA 2JCSA 2UVDA 1G2QA 2QN3A 4JVLA 2Q6KA 1Q1QA 1I13A 4DR4B 3I8SA 1KYTA 1DJOA 1XZIA 4J1SA 4K9IA 3AR7A 3HZRA 3DAYA 4R7TA 3H8WA 3PWZA 3D81A 4NENA 2PDAA 1U3FA 2V0CA 3ESQA 2PJDA 2QYHA 3LW7A 4PF1A 4CR6A 3TZQA 4M9ZA 5JPDA 2EGGA 1HDYA 1U8ZA 4FNGA 4LOIA 4LFAB 3CNLA 4Q9AA 1E18A 1ZVVA 3MA0A 2VJNA 4I19A 2CJWA 1XT6A 2M32A 2O1WA 3QE0A 4FGJA 4JB8A 4ZZ2A 2VKQA 2I4OA 3PUHA 1XNQB 4OUDB 3UKOA 2PKWA 3I2JA 1ACLA 5AHWA 3ZWQA 2VCEA 3WJ2A 3OMWA 4UVDA 4AG3A 5JARA 1UBCA 1GQQA 2ODBA 2ZS8A 3UXEA 4CCSA 5IBQA 1YUNA 4IRMA 4RFVA 1VYUA 1Z83A 1YOBA 2VS1A 5DHUA 4GSLA 2RD2A 3IIMA 4O63O 3PT9A 3GO4A 2B9EA 4KAAA 4UNPA 1YHYA 2RK4A 1QAQA 4Y2SA 5TC4A 2PGNA 4C0AC 2H2GA 5CFLA 1ISSA 4P22A 3HCNA 3INNA 1Q19A 4OG2A 5KYXB 1T8PA 1BEZA 2FVYA 3KPWA 3N9IA 3PTLA 2Z5FA 3NHUA 5ARDA 5ALGA 5I45A 2R6HA 3EG9B 2NPFA 3T4XA 4DV7B 3KJNA 5LKRA 1GTVA 4JJKA 3GRUA 1G5QA 1KVTA 1Q7TA 1QRDA 1BQ4A 2D2EA 2HY7A 2QUKA 1XZMA 1EHIA 1YVEI 3H4TA 3IUPA 3NHWA 2I3GA 2M2IA 3JZAA 2HV8A 5D84A 4YRRA 2FRVA 1EM8A 1YCHA 4XWOA 3HMQA 1Z45A 1DXOA 5EERA 5AUPB 3E81A 5FUBA 3GLFB 5BV8A 5KZMB 4O4IA 3HXOA 3HYRA 4BFWA 2ZTHA 3AONB 3TLYA 1CKEA 2WT9A 2ZBFA 4K1LA 1HT1E 5FH9A 5IUNC 5KVQA 2ZIXA 4L0CA 1S1MA 3EDRA 4EGJA 4XF7A 1GEEA 4S3MA 5JS1A 4KBGA 2HJVA 2FFRA 5DTRA 1YO6A 4BVFA 2XMCA 4EHNA 3KR1A 3UGKA 1GFWA 1SHKA 1X9HA 1R0ZA 1F4LA 2C84A 3PDJA 3QBVA 5JE8A 1WY7A 1U65A 1V35A 1XALA 1F4PA 3ZZ0A 4CEIB 4D8UA 2DLNA 2WKPA 4MGHA 2WUVA 5C52B 5FTKA 1E89A 4IX1A 3M3PA 3B70A 3VKWA 1CUCA 4IMIB 2PGAA 4JLMA 4QAQA 3KJEA 4UBKA 3T3GA 3MWJA 3I37X 4RPIA 4YRLA 4IILA 4DG5A 1LWOA 3NFYA 1F2TA 1QQBA 2VPZA 3IUSA 4N0PA 4NVRA 3QFSA 1VLZA 4LSZA 3G0DA 3NKLA 1L0BA 1N57A 1OTXA 4BKPA 1RKDA 2O5RA 2I76A 4M1KA 3B8EA 3OIFA 1TVKA 2A1UA 3IVXA 3KTAB 3A2NA 2VSFA 2R6R1 2W6JA 4NNJA 4RA9B 3SSAA 3IAAA 1PWHA 2CUTA 3H1PA 5CT4A 3AC0A 4LJ6A 4AMBA 2JCBA 3LV8A 2DT8A 2K2QB 1CLEA 4PQFA 3HKCB 1PS0A 5EZ5A 1Z63A 5KSZA 4AM8A 1BWRA 4IHJF 1Q7CA 4KUHA 5JC1A 3BAFA 5I7RA 4P6VF 3D4IA 3L7BA 1SKMA 2E6UX 3QX7A 3UENA 4ZVUA 1I1HA 3KEQA 2VI5A 2VUIB 2VDMB 4BU1A 2P1DA 2YN4A 3BTOA 1VHTA 4I8XA 3S1AB 1SXPA 5KYVA 5KYUA 4DPKA 1RHJA 2EW2A 3D8NA 5CVTA 5DXJA 3TSZA 3W8RA 1ZN9A 2W90A 3NBAA 1TJPB 4P4TA 2IV3A 4UZSA 4M7RA 1RE1A 2A9FA 1RKSA 1XEXA 1A4RA 4BU0A 4K86A 1T3GA 2Q5JA 3S8YA 4R51A 1JHMA 3ETLA 4EY8A 1Y5MA 2BN4A 1Z2PX 1GPWB 4YRIA 1NL3A 4BNMA 4Q48A 1Y4AE 1KI3A 1TX4B 2QVGA 3AB7A 4LKOA 4BNKA 1XDSA 1IB6A 5AD1A 5AVZA 2O8BA 2G1JA 5JATA 3T7AA 4RHXA 1RYEA 2W58A 3QXXA 5EJEA 3KUUA 1DO8A 1MEJA 4JHXA 3Q8MA 4ZT4A 4P32A 4F85A 4RELA 3BJIC 2ZBQA 3QOWA 4YCJA 3WWDA 4Y3UA 2B1IA 4Y1RB 4S1MA 1ZK4A 1J20A 4PANA 1SG6A 1E3IA 4YA6A 1IFXA 5IP5A 4AJLA 4WKNA 1NIPA 1QKIA 2C7BA 4TV8B 4YRKA 2VTBB 1UDBA 5GPBA 1YS6A 2GN2A 1A8IA 4O1LA 1SOUA 3MBHA 3I05A 5ALVA 1GTRA 3ES9A 3OX2A 3MIIA 1BS2A 1SKUA 3PEUA 5JFGA 5EJ2A 2W2VA 3CJTA 1VPVA 3AETB 5M04A 1XIVA 1SCNE 1X7XB 3K0BA 3U1TA 2CXPA 5KTSA 2C5HA 1R16A 2H1LA 3ANLA 3WGJA 4FDLA 4RIFA 4F6LA 2SICE 3BTUA 4FCVA 2FRXA 2ZEJA 2WFLB 3E7WA 3Q3EA 3WGMA 3VDXA 3Q88A 4IVQA 5YASA 2H9YA 1VZ3A 1FFCA 4M46A 3AF3A 4CDGA 1AJEA 4NX2A 1WOYA 2Z6VA 1XDUA 3BHNA 1PCXA 2R11A 3O90A 3OKFA 4Y98A 2NZXA 3M5DA 3W5VA 3OBIA 4PLFA 4O4JB 3VR6H 4Y1FA 1D1SA 2OGUA 4PXYA 3HU5A 1C0EA 2KLBA 1SCUA 3PNLA 5IMBA 5HSGA 3NM1A 3GUVA 5TPZA 2PUDA 1JE0A 3GLFE 2QY6A 2C2BA 4K9OA 3QX9A 4NNOA 1JVBA 3U37A 4B7XA 4ZKDA 5AI6A 3CEJA 1Q74A 3MAJA 3HXPA 3PGVA 4LCEA 2B20A 5SICE 4TWBA 2O7RA 3RVPA 1I3KA 1LBHA 1ZICA 2XKAA 4S0XA 4BX0A 5BR7A 1ZUD1 5FKJA 3HSSA 3K8ZA 3SOPA 1N2XA 3NHPA 1UBFA 1SVNA 1HDRA 1Q0SA 3IC5A 2IEDA 2C31A 1Z6ZA 2VRCD 1PR6A 1ICEA 1NRJB 2XUKA 4GC9A 4AZSA 2H1HA 2H9IA 2I6SA 2QXUA 1AKTA 1K7XB 2QLLA 1ESNA 1TUBB 1W35A 1QG0A 2WUWE 3EARA 3MMNA 4DC9A 2JLWA 3B3FA 4EF6A 1AV6A 1AHNA 3DV9A 5IJ0B 1XJQA 3G8DA 4R4JA 3CJQA 3DYVA 4Y6OA 3WE7A 3WK6A 1QAMA 1VG8A 3WR5A 3ZS8A 3B1OA 3MJTA 3OD1A 4YP9A 5EIAA 5TQ2B 2CSXA 1EWQA 3E9YA 4NEQA 4A6EA 3RU9A 5JXJA 3RASA 4LZZA 3S2EA 1GN8A 3K9NA 5AOAA 4GKAA 4UUBA 5A0FA 2BCEA 2R8EA 3W8FA 1ECLA 3PRKE 1C41A 4G0NA 1BXRA 1RSZA 1U1GA 2DQZA 1XK7A 2VK8A 2ZIXB 1DAIA 1IJFA 1DUVG 1H3NA 1K8QA 3VAZA 3VHRA 3OT4A 4HFMA 3E48A 4X92A 2UXCB 2GVDC 2YV5A 5AVWA 4G41A 3PXDA 2RHLA 3BXGA 3CEPB 3IIIA 4LBVA 1PNTA 1G5FA 3PITA 1SU4A 3I9NA 4HPWA 1AM4D 3E3AA 4P3PA 1DL5A 1XPJA 3B3QA 3SHOA 3KXLA 3R3YA 3CRQA 3G2KA 4IGKA 5JEDA 2JBAA 3JQCA 4J4TA 3KUDA 8MHTA 1PJSA 3L6OO 2B5VA 3DLPX 3P9CA 3R0QA 4Q12A 3ZXUB 4EW1A 2ZIZA 5DN9A 2QE7D 1RKVA 2D0DA 1ND5A 3QPBA 3FJOA 1GNQA 2BP7B 5FPYA 4MUMA 5C51B 2ZJ3A 1EBBA 4NWIA 2M6LA 3WX0A 4C14A 3PFBA 2HF7A 1T1JA 3OCYA 2A1UB 1X1EA 1WW2A 2HCFA 1FS5A 2IVFA 1PJCA 3RRJA 1OI4A 3UW3A 2ZIEA 5ER6A 3K4PA 1GSIA 2LGJA 4I1VA 1L5FA 4JC4A 1MO2A 2ZSBA 4JYPA 5A62A 1OV6A 4WXRA 3GT4A 1CXZA 3JALB 2JEOA 3HBAA 5JCZA 1TB4A 3K9CA 3RJ5A 1G3MA 2PRIA 1I7DA 4Q21A 2QUZA 2WVJA 4HXFB 3LX6A 5DM1A 1PD1A 5KDOA 2AKEA 4JSYA 4QPDA 1X2BA 1ZJYA 4YCAA 3MTEA 2J87A 4NZMA 3A6JA 1BX4A 3BE6A 1W1UA 1NI4B 2CUZA 1I2DA 1LD3A 5K05A 4R8LA 3MTJA 3ZNOA 4BMVA 1W4ZA 3R5SA 3VVLA 2QD5A 1DG3A 4IMJB 3DR3A 2BRUA 5IAOA 1YZTA 5IZ4A 4RWZA 2P9CA 1J8QA 1XF1A 3LQQA 5EJIA 4NABA 2B1GA 1N5KA 2PIAA 3P27A 3G0BA 3UT5B 3VYWA 4CM7A 1P4RA 3KX2A 2XRMA 4G84A 4N0EA 4FN4A 3ETJA 4KIUA 1UIRA 4N49A 2AOXA 4Q1BA 4TVBA 1H8HD 2C82A 3MBOA 4QJ3A 3LQFA 5F12A 3AF5A 3UK2A 4YC7A 3NOVA 1DAEA 3M6XA 1Z6PA 4PN7A 1QZXA 2NQ2C 1JSZA 1T5HX 2JCYA 2P78A 2ZPUA 3OPYB 4XRGA 1D1QA 4EL0A 4U02A 2CWDA 2IIPA 4PIMA 5AVTA 5IJZA 1CJSA 1OAOA 3CRW1 1JTVA 3RQXA 1SGWA 2W0SA 3OOHA 2R1TA 1GDHA 1LSOA 3DT6A 4MO9A 1Q0ZA 3NBFA 4Y18A 5DIZA 2DKFA 2FK8A 1FTQA 2P79A 3H6KA 1QFSA 2MHCA 2NSYA 1ANKA 2GDZA 4YMIA 2J7KA 4LRWA 2Q1UA 2AC2A 5A03A 2QT1A 2XNJA 2J3EA 3DFFA 3AJ9A 4E3AA 1KDPA 3VR3D 4UQLA 4C12A 3OOWA 5IJ9B 1LPPA 5FOWA 4CVMA 3S55A 1XKQA 2YV1A 3RUAA 3RS2A 3NC1C 1ZM7A 4FOSA 1Y4SA 4C5KA 2CMFA 3JWEA 3GOHA 2GCPA 4OXYA 5JPIA 1M8FA 4C0WA 5ALKA 4CGZA 3VPSA 4GOXA 1RYZA 1PX2A 2YVAA 3VR5A 4LNAA 3VHXA 4B3CA 5BV2P 5K6AC 5EPUA 5CNMA 3MBKA 1GL7A 2JGFA 5CR9A 4EMSA 5K1ZA 4ZYUA 5MN6A 1VJDA 2COUA 4C4AA 5AVRA 3DWGA 2EG5A 4B75A 4LF6B 3KB1A 1VA5A 2A1TR 5CEFA 3SQLA 2IH2A 2D7DA 4E22A 5GV8A 2XXJA 3U4DA 3EXFB 3E35A 3I9JA 3JYQA 4U39A 2HUPA 5FCDA 1KMIY 4OMCA 1MNAA 1O0SA 2FAXA 5JYEA 2FV7A 4MS4B 1ISRA 4BAGA 3PHGA 3HZOA 1ADYA 3DAOA 1ZWKA 3UA4A 4UBNA 1RWNA 2GLUA 3WYAA 5B4UA 4PGGA 1W47A 1YVUA 4AZ3B 2FZLA 3HBFA 1JT2A 4CU5A 2BFDA 3FOFC 4RMIA 1NP7A 1TDJA 2QQ0A 1YIAA 3ZTTA 2PGIA 4M1WA 4YWHA 1M6HA 5B3KA 5LQDA 2AYXA 4JJFA 3FKQA 3DG9A 1MQ8B 3RKRA 1NE7A 1G18A 1TYZA 3D6TB 5CIQA 2BH2A 2H5LA 1N2BA 4M7WA 3WYNA 3PUVA 1E94E 2F62A 3VTZA 3WXBA 2HJWA 3C43A 2YV3A 3FKSD 2VDQB 2ZJ7A 4TZKA 5GGYA 3T7IA 4EUKA 5BUSA 5AW6A 3PHLA 5AHXA 1MX3A 2XUAA 4IIBA 1UB0A 4HATA 1U9IC 5CK4A 2Y6VA 2I8AA 3EDMA 5BQPA 1LIOA 2R9VA 2BTQA 3GY0A 1FVOA 1DOZA 2XADA 4YGYA 5JTTA 1BHJA 1EUDB 1DC3A 4W1PA 3OIWA 1V5FA 2I9KA 1RBQA 4AS2A 1YR2A 2GM5A 4MVWA 3EG9A 2EWMA 1K7EB 2ZQ5A 2CYCA 3QUAA 1QAOA 3IKHA 4HLQB 4PFSA 3W4IA 1U0LA 4IDPA 4O5OA 3WK7A 4AB1A 3GCGA 3THOA 1NYLA 3QVXA 3G2PA 5LLTA 2O8DA 2RKWA 4YONB 4EY5A 1VLVA 2B8NA 3IILA 2GEFA 2JFQA 3MS4A 1P1RA 3ZLUA 1I14A 1OA1A 1QCDA 2FSPA 4MGKR 5FOQA 1BS1A 3SEAA 3PE4A 3SIWA 3TTSA 4KLRA 2ZQZA 1ES9A 3Q85A 4GP7A 2ZE6A 3OZEA 4O4JA 4AKSA 2BC9A 2REXB 1V41E 3Q3HA 1U0RA 1EP3B 2QX7A 3EQ7A 2G1UA 2FWRA 1NQAO 2CHVA 3ANNA 2VPIA 5GOTA 3FOZA 2O4UX 5DLPA 5CB0A 1YOVA 1C7IA 2IFTA 2O2HA 3M83A 2HIMA 3RVBA 3TKLA 1YZHA 4LQCA 1OXVA 3DMDA 1EX1A 2GDJA 1C3OB 1LY1A 5B1DA 5EINA 2PTGA 1GPMA 1LRLA 1HH4A 2C3UA 1XVIA 2JDID 4HDOB 4PLZA 721PA 4XAQA 1F6WA 2VYCA 1MA3A 1KJJA 3NWJA 4YDHB 2VOJA 4ZV7A 4CCAA 4GL2A 2AX4A 3VDRA 4EYOA 2ZRGA 3VUEA 4J49A 4F97A 3CYFA 4TLLB 2Q5FA 1NY6A 4A91A 2XUGA 4C01A 1SD1A 2IC5A 4MUIA 1JDJA 3NBVA 1QTRA 2FDXA 2YL2A 1XTIA 2ZYSA 4JROA 1ZFNA 2BMAA 4MVJA 3U9LA 1E3SA 1GUZA 3HA2A 4C29A 2HREA 5CG2A 4KNYA 4X8MA 2JJQA 5ALTA 3GPLA 3IKMB 1E6KA 3LBFA 1L5ZA 5CTAA 1VHDA 3LECA 3NHYA 3Q8LA 3HKCA 4LMPA 3TQCA 1SR8A 3BRCA 1B7GO 3HB4X 2W8BA 3L8CA 5ALMA 1SPXA 1LKZA 2IGTA 2WZBA 3NO4A 4Q47A 1UKVY 2HXYA 2PUTA 3GIDA 2CDRA 3OM9A 4LZJA 1A0OA 3C2QA 5DBIA 1CP3A 1KL7A 3O8LA 1M34A 4CM3A 2JLCA 1D2AA 5DLEA 4L5CA 2G0NA 2CUNA 4HGYA 3RC7A 1YZFA 5JMTA 4TYPA 5INTA 5J9FA 1Z4KA 4DIOA 3FZEA 1FSZA 4RKYA 1OIWA 3B9QA 5DLQC 1CD5A 4G9GA 4BRWA 1NSFA 4JJZA 2WLTA 9LDBA 1BROA 4Q18A 1E61A 3KP1A 1G5IA 1YI1A 4HLDA 1YXMA 3WRYA 4CQMB 1P18A 2GEJA 3PYZA 2BUCA 3RBVA 2GBCA 1NLYA 3GVCA 4U7JA 4Y6RA 2IXDA 4QDJA 1YB7A 4PYRA 3QGMA 1U0FA 1J9EA 3EN0A 4PLYA 4V0OA 1GFZA 4DXAA 1U2XA 1F17A 1WSDA 1G20A 1WZIA 2L18A 2BHRA 3QVLA 4LXQA 4U0JA 4W1SA 5EMJA 2A0UA 1FDIA 1GZ7A 2OBYA 4N6NA 2X0DA 4A0GA 3KDPA 4X62B 4A2WA 2GHTA 2Q5QA 1VB5A 4XQ0A 5AXAA 2ZJFA 2O50A 3NVAA 4B3HA 3K9QO 2Y0EA 1JLMA 1HUQA 2PKXA 1A4XA 4U7TB 4KQ6A 1LBTA 4GI2A 4JVSB 1T3HA 1A9TA 4DSUA 1MIOB 1U0SY 1WHSA 2AXNA 2DWPA 2M98A 3FKJA 3HCFA 5HFAA 3GB9A 4R0MA 3QKTA 1IPHA 2EBFX 3UMRA 3J7AC 3V8PA 1PJRA 2VDUE 1P19A 3HKBB 4BN0A 2YFQA 5EWLA 3WB2A 4E33A 2CJPA 3ESAA 2FRDC 5ENDA 4Z9XA 2RGUA 4G3XA 1XI2A 5KX5A 4KB5A 5AXCA 2YHIB 2RKOA 2JI6A 3BWEA 4R68A 3NT4A 3MLEA 4OU5A 1X3LA 5IHXA 1KY2A 1NNLA 3B3GA 4MPTA 4MICA 3DNPA 1RS0A 2PT6A 3F3SA 2ZETA 3IQZA 4R54A 1VSQA 4FYYA 4UJ3A 1JKMA 2UZ0A 1CB0A 1ULTA 2G0TA 2VRCA 3BE8A 5TMBA 3ZWWA 1QU3A 3UQ6A 1ZAKA 2EG9A 3ICPA 4LTDA 1WP9A 4TQGA 3WB1A 3AEUA 4JOQA 5C5EA 1V8OA 3QUBA 2IUUA 1ZGJA 1NBMA 3F7MA 4NS1A 3ZGLA 1G21B 2Q5HA 4FJ1A 5K0GA 4MS1A 4B6OA 3DM5A 3G1UA 3WGGA 3R3HA 3IBTA 3U0VA 3HUEA 3TS1A 4E3WA 5LP6A 3O8OA 3TLMA 4ARZB 1EA5A 3A4MA 4HGPA 4KKXB 1KWKA 4NFHA 4IKPA 2GXUA 5FI3A 3K31A 4DVGA 2IHJA 4BBAA 1NURA 3INGA 3MTGA 5EP2A 5C8YA 1UUFA 5BURA 1UJ5A 1MIOA 3IVRA 5K3FB 1QNFA 1FRNA 2WFZA 4FP9A 4P3NA 4MUAA 5AICA 1M2JA 3TQTA 5IM5A 3H16A 1EM6A 3OPNA 1XU7A 2PSEA 1EFVB 2FPSA 4CLXA 2C0QA 3QEBZ 1N8KA 4MUKA 5AKEA 1O95D 4DY6A 2PAAA 2X4IA 1I7QB 2GJSA 5LJIA 4QO7A 2TMYA 4GLJA 1ZGCA 4RW0A 4Q03A 1FFXA 1I3OA 1JQDA 5FEMA 2DFNA 4YMTA 1J2TA 1ID1A 2WU4A 3RTBA 4BAUA 1WXHA 1OFUX 2Y1LA 2GN6A 3A9CA 2X2PA 1MXFA 1X80A 3NM5A 1I2BA 1DMRA 2J08A 4HB4A 5EJAA 3NHLA 1WCIA 3S2IA 2ODQA 4LPSA 1C29B 4N5MA 3UAYA 3KZHA 1RADA 4L27A 2ZOSA 1XAGA 4CVKA 1G2OA 2R8YA 3N8IA 1E79A 3QXHA 4A4DA 4QDIA 1OPXA 3PPXA 2XYGA 3IDAA 3QXCA 4NPCA 1M8GA 3JTMA 4HH3C 2G9UA 2J6IA 4PAOA 1GA6A 2FDRA 4U2CA 4KZPA 2G36A 4ZOLB 5E9JA 3W3AA 5I3CA 1J0EA 3AG5A 4KGVA 3OHPA 3NBKA 5AW1A 4TXJA 1H23A 2HQ1A 4X61A 2CN1A 4NE9A 3G1WA 4HTFB 3T9CA 1KK3A 1BX1A 1UP7A 2NPIA 4K3UA 2FI1A 4MKZA 2WD9A 2G88A 3NS7A 3QKWA 2SKCA 4JFAA 2GX6A 4EF5A 1KJYA 3F74A 1S4MA 3R3UA 2GXAA 2ZCUA 4RD2A 1RWVA 2AXQA 5EKDA 3R9KA 2XYQA 4DDMA 2PS3A 3AEYA 3ZY3A 2Y1CA 5EIWA 1UKCA 2CV0A 2VJLA 3O26A 1HOXA 4ISBA 3LC0A 3D54D 4MV0A 1EK1A 1II9A 1KZ4A 4C0SA 3WP0A 5F3DA 5F76A 1P4SA 1AKWA 3OI7A 4BWFB 4BYMA 3HU1A 3A2KA 3O1IC 3QVSA 4H7EA 4TMVA 4EA9A 5HS4A 4OO3A 1Y80A 4QTZA 3T7TA 2QA5A 1YCDA 1CUWA 2I5BA 5SYNA 4UMVA 2LDBA 4FB4A 1Z88A 2EJBA 3JQ9C 3MZ0A 2CHGA 4NEGA 3TLJA 3AK4A 4FU0A 2Q3JA 1QHHA 4F11A 4LMRA 2RARA 1JI3A 2O3JA 2QDXA 4CEJB 4WEQA 4MQLA 4CR8A 4MIYA 1W9MA 1JR2A 1NQ5A 4Q1VA 4F71A 3KOMA 1AKQA 4DA8A 4YHHB 1ENZA 1OVMA 4GWGA 3K0AB 3JQBC 3OOJA 5F2NA 4J3NA 2R8ZA 3DONA 1I4TD 4GS5A 2MSEB 3E9RA 3QF4A 5KUTA 1KWGA 1L6IA 1OOEA 3TD9A 1JAIA 3QAIA 4IIXA 4YBRA 4WLNA 4B7CA 2JFGA 2ZSEA 4NYJQ 1JQ3A 1SBQA 1JIIA 1UMDB 1YZ3A 1HQKA 1GRCA 1EJ0A 1QF7A 2ORWA 5AKLA 3CNEA 3T7KA 1P60A 3BG5A 1NVBA 4O02B 2IYVA 4UBLA 2QNRA 3B7PA 3ZNNA 4GX5A 3C7DB 2F7KA 3AJ8A 1GYPA 1E1QD 1KGDA 2GZ3A 4JLUA 3LHKA 3I0NA 3NIGB 3ER8A 4QEKA 1XKXA 5F9MA 1NVKA 4R71A 1RC0A 4Y2HA 1UKEA 1ABEA 1W48A 4HVAA 1EQUA 1WXIA 1AMOA 4K9QA 1CQIB 1YDEA 1NJSA 3F78A 4JOCA 2Y77A 3PFCA 3NBMA 2H85A 4DCTA 2L17A 3FFXA 1BXGA 4MUHA 1P9RA 4JJGA 3ZWOA 3ND5A 1A04A 5DMXA 1HYBA 1W5TA 2AMVA 1OYVA 2VUHB 5FPTA 3CZ9A 5KNBA 4RTNA 2RIPA 3FNGA 2FQQA 3D6UA 4UEWA 3MGKA 2D59A 4HXYA 5LYYA 1RRFA 4AJJA 4M3NA 4FFRA 3QTBA 1TFRA 1KZ9A 3SDZA 2RHHA 3KL2A 5KPJA 3U7QA 2YWDA 1C9JA 2FJ0A 3HP4A 3JVEA 4L15A 3LL4A 3UT6A 2HQOA 3OKCA 1E92A 3VKFA 3LT1A 3HM9A 2B8JA 3KXPA 3BMOA 1YKFA 2AFRA 2XDQB 5IBPA 4AX8A 5C1BA 4N48A 2PIDA 3TMKA 2JJ2A 1D6NA 1GZHB 1II8A 1UJBA 1Z39A 2WE8A 4UEKA 5ESDA 2AZMA 4PZUA 4PQGA 4QT0A 1NW5A 4CM8B 3IKTA 2MT9A 5AMXA 5E6RA 2EFYA 3CO0S 1JAYA 3KC2A 4F60A 5JRJA 1IBLB 1HI9A 4HN4B 5ALDA 4YY3B 4A5OA 4M1MA 2O2GA 4HAVA 3BZUA 5DTJA 3WLRA 3COVA 3CN9A 8AT1A 1YVRA 4PLWA 2UZAA 1F2UA 1PWZA 2JHAA 3V4PB 1XE3A 3QH4A 3GUHA 2BIFA 2O54A 3A2MA 3ZN2A 2IU3A 2KJQA 1DTEA 4BEJA 4BLRA 1BEUB 3QE2A 3UBTA 2OBMA 3L7YA 4Z2AA 1L5YA 5CDHA 3PXGA 3RM5A 2C83A 3LHIA 4ENUA 2G72A 4BMPB 3LLCA 4CKEB 4PLHA 4ZQGA 2A8YA 5KTKA 2V96A 1EFVA 1TE2A 1G7RA 2HH9A 4P4GA 5I4BA 5LYJB 4DV1B 2JLVA 1YGPA 1Y8ZA 2FY8A 2IXBA 5ALIA 3G5LA 3TNFA 3OTWA 4IOLA 5A05A 1OB5A 3I8XA 4UE2A 3SDSA 3C39A 1Y8RB 3CURA 3CLHA 1XTUA 5LP6B 2L42A 1GD1O 1NF9A 5ESWA 3LJKA 1IM2A 2AM2A 4I1YA 1PK9A 2VYVD 3V8BA 5ALHA 1Z0SA 3JQDA 2I1QA 4ZYWA 3NIBA 1MO5A 1VYTA 3NV9A 2A94A 2Q5LA 2V4UA 5DX0A 1GVHA 3ZTWA 4AFNA 4LBXA 3OLXA 1QMGA 1B8NA 5LSAA 2BJWA 3BSYA 3LKIA 4LJAA 1XU4A 3A36A 4M76B 4OHXA 4N8SA 5BPHA 5IXJA 4KPEC 4PQEA 3ZQJA 2M9MA 2AXEA 1QORA 3SIXA 4P4UA 2OB2A 2BWJA 4BQEA 5JAPA 3DHEA 3ZWDA 2OD9A 3AHIA 1WCV1 3DL2A 4JBWA 1AQLA 1QUEA 4A0FA 4MRRA 3MRSA 5JRZA 3JWPA 4LBYA 3U13A 4S04A 2D00A 2APJA 5COBA 4ACAA 2NUAA 1SUWA 1CETA 4JYZA 1SCDA 4DRXB 1OFUA 4X1IB 4Y0AA 3RS8A 4S1HA 3EVNA 4MVJE 4Q4AA 4ZI5A 2NG1A 3DE6X 4CF4A 1KEEB 1AMUA 2XAAA 2UZIR 2G77B 2WM9B 1LRKA 1WU8A 1YI0A 1OZAA 2YIJA 3UT5A 4DV5B 4XVCA 3W7AA 4HWKA 4P3KA 3V3KA 2VP2A 3ETHA 5C31A 1KJZA 2WT8A 1O4VA 2XHEA 1Q57A 4KODA 5J2TB 1AG9A 4Q9HA 2YXTA 4AI6A 3RFFA 1ONOA 5IZCA 2OESA 2QUHA 4MR9A 1Z13A 1H9AA 1HQDA 4MB6A 5U4QA 1P4JA 3SJ7A 4QF5A 2G6TA 4XH9B 2AC7A 2DWQA 1OAOC 2XYHA 2AK3A 2PSJA 1NXTA 1L4BA 3VR6D 4DJTA 1WXGA 4MO2A 5CLHA 3W9UA 5A4MS 3W8DA 5K45A 1T8UA 1BDHA 1EWYA 1KEKA 2JA1A 2WU0A 5DFAA 3SCZA 3EUEA 2X0KA 3K6SB 3R9XA 5DM4A 4AWAA 1VSTA 4GL4A 3CU5A 3E8SA 3KZMA 5GZ6A 3BVPA 3K1ZA 3BAZA 4IJVA 3VPCA 3MPUA 4F96A 2ZRBA 2IZZA 3LCCA 4Q05A 2P1RA 5KQPA 5C18A 3A9TA 1BKDR 1OA0A 3EZXA 4E09A 1IJEA 4E5KA 3VBCA 1YQGA 2Z1DA 5BSHA 3U5ZB 4BCBA 1KVUA 1G3UA 1LZLA 4KRXA 3TOXA 2OLJA 4OSOA 2O2YA 1WS6A 1T0IA 3BL8A 2NU8B 2ZREA 1Q0RA 5LIPA 1S6YA 4K3VA 5HA5A 4GIBA 1W78A 4NLLA 4UNNA 5CYFA 1XZCA 5TDHA 3WHKA 3AY7A 3DLCA 1JE1A 4YL5A 1NP3A 3WKDA 3CE9A 2O23A 4E30A 4WBNF 1KP3A 2C9YA 3I58A 1X7WB 1UBJS 2IYAA 4D9NA 2A9VA 1LBSA 3T4PA 2COEA 4ZARA 1OILA 2OBNA 4PHTA 2HW8A 1Z4NA 3EXIA 4EG0A 3SFZA 1ZMOA 2OV3A 3RAEC 10MHA 2PQMA 4O4IB 4X71A 2GEKA 3CX3A 1SUAA 3R0VA 3UK0A 3HPDA 4LYGA 1GC5A 1MJNA 3FHYA 4OJTA 1E7MA 4HQOA 1FS6A 3V3TA 2JZOA 3DVSX 4PPQA 3LTNC 2CHQA 3T94A 1N5DA 1R00A 2PXXA 4BQNA 3PFFA 4Y2PA 2QT9A 4D9KA 1UWKA 3PUWA 3NTXA 3GCWA 2OYCA 3VC3A 3PUXA 3LP8A 1OCEA 2RMKA 3NRJA 3ZGVA 2JD2A 4BPRA 4S0ZA 1T2VA 3F6EX 5CFOA 4UQOA 2NWHA 1TYDE 5ALUA 3U7FB 5THQA 2VZ9A 1KMNA 4P92A 1ZJWA 4MW6A 1S3GA 1ZJ6A 1ZM9A 1K3UB 4V0LA 2EW8A 2E4YA 5GGXA 3TLBA 3UG6A 4CT4B 3A1NA 4REQB 5B58T 1KK1A 1N5OX 3QOFA 3NYIA 1JJFA 1TNDA 4IFEA 4JNKA 4YUYA 5M2QA 3NL2A 5ITZA 1JU4A 2WAXA 3KT8A 1IHOA 2WTMA 4ZAXA 2IYFA 2QX6A 3RAPR 4BO8A 4ZVRA 1U2GA 1YFZA 2FPXA 4NH0A 1TM7E 4QX6A 3OJCA 4WCDA 3GV0A 1ADGA 2PSSA 4G81A 1TEHA 3OURA 3VPBA 2JNWA 4BP8A 1CQIA 3C5EA 4JLVA 5K6TA 1FY2A 4M0CA 1BX3A 1L7VC 3PIDA 2FLVA 4MVYA 1F9AA 4KSCA 4E5NA 4Z4CA 2GPBA 2D2XA 2QL7A 1H4VB 4OPMA 5HF6A 5JC8A 2JFBA 3U44A 3P32A 4UHEA 1CT9A 5FTWA 5HJ7A 3DE1X 3KVVA 4X6YA 4D3ZA 3L4JA 2EFGA 1C1YA 3F9CA 4KVGA 2O7NA 4TS4A 3ISVA 5C3MA 1ETHA 1NVUQ 2P9JA 1FP7A 3AHFA 5IAEA 4YP1A 2BEUB 1EXNA 5ESRA 3H9UA 3M6AA 4IHQA 2ODAA 3MCZA 3V8NA 4AUKA 4Y1RA 2IYYA 3OCZA 3MCVA 4OLFA 3RUPA 1QLWA 3WZ2A 3H86A 5JNVA 1NSYA 3OCXA 3F96A 4NENB 3ICQB 3FHJA 1IATA 4O4LB 4Z2YA 5IU6A 3BSSA 2X4DA 1TF2A 5KVAA 3NWPA 3GN2A 3ZJTA 4C7OA 1ESCA 2JLBA 3FVQA 4FE7A 5IKPA 3FKSA 3MM4A 4YFYA 1C4OA 1OE0A 2VTVA 3B2NA 4JS0A 3CLTD 1W9HA 3PPIA 3L6RA 4BO7A 1E3JA 1DWPA 3H11A 1ZWLA 2PLAA 2G7MC 3EOBI 1EE1A 1BW9B 1L3BA 5EQFA 3CF2A 3TLCA 5J3JA 4R8MA 2WUDA 3OZGA 1X19A 5DO9A 3PQEA 3UKJA 1SM4A 4XPIA 3B3LA 3EXHA 1RJEA 4TZ0A 4LGCA 3HLKA 3FMOB 3VR2A 4C5AA 4RTJA 4AZTA 1UOQA 3RFCA 3EGIA 1ZH8A 4XWYA 2AR7A 3NC0C 4LJKA 3SN6A 4F8EA 4BGUA 3PGJA 1UINA 4MJLA 1LBQA 3W2GA 1LX7A 3DXXA 1FNCA 5T6MA 2ZYUX 1ODLA 1Q0LA 2UUPA 1I7PA 4CMIA 1JFVA 3B38A 1IVNA 2G9NA 1TZBA 5BVHB 4M9RA 3PIRA 2DB3A 2OV4A 3MIZA 3L8MA 4JLWA 2OZLA 2G4LA 3PU6A 3QMPA 5KHAA 3F3MA 4ITVA 3UFBA 2ZUEA 1CEEA 2O1SA 1TU0A 3NORA 4X3CA 4XM2A 5C1IA 4EHFA 2MSNA 3BB4A 4UEQA 4GPAA 3ZHYA 1BNCA 1CUAA 4P5PA 1XQ6A 4DFDA 3DZFA 1A95A 1AUOA 2BGWA 2WR8A 1RBMA 1T35A 2AG6A 4K46A 2PO7A 1NM5C 4J16C 3C3BA 5BSUA 2XIQA 3IQIX 3HXKA 4Q7JB 5JNUA 5KYYB 2V7WA 2JG3A 4KLNA 1BKSB 3D2CA 3DZKA 5F2OA 3ZKAA 1M5RA 3P45A 1HFJA 3N76A 4GLFA 4BC0A 4F38A 1JQLB 1WMEA 2YFHA 4DR3B 1DTSA 1DP4A 2HK6A 4NFYA 5DYTA 3R74A 3LU1A 2YVUA 1JX6A 1M0SA 1VBKA 1YC5A 3H5OA 2XUFA 2B5OA 3LLSA 4RS4A 4ZAWA 3PCXA 1MUUA 1VG0B 1ZHHA 1HBJA 3JWHA 4FDUA 2PZGA 3I34X 4NYIQ 4OIFA 4B2YA 4EUNA 4OFBA 3E61A 2PFSA 2WSMA 4BB5A 2ICAA 3H3JA 4EQZA 3ZDDA 1TM4E 3ITEA 3QNMA 5D51S 5JTUA 1VPDA 1K8ZB 3TRIA 4DIKA 4FS3A 3H99A 3SSMA 2Y3IA 4DQXA 1YHJA 3AGQA 3OU7A 1V6CA 4DV3B 2ZDHA 1ZN7A 1BVUA 3HJGA 3LZCA 4Q16A 3CRRA 1MV5A 3VPGA 5L3SA 4IL5A 4OIMA 3Q1KA 3FZYA 1W4CA 1GPDG 1XEWX 5EHNA 1AC5A 4IDBA 2WQZA 5HG0A 2ORVA 1BJTA 1FFHA 3AOEC 3BL6A 4L8YA 1D4ZA 1FNBA 1OSNA 4BMSA 2YHSA 2HO4A 3F90A 1T5OA 1BH6A 2IWRA 5E7QA 1DINA 1SCIA 3L1JA 4K88A 4F2WA 3O8CA 1QCCA 4OXRA 1EZ1A 1YE3A 1RKAA 1U2RA 4B9EA 1RMYA 4MW9A 1U2SA 5BMVB 5COAA 1VIDA 1A88A 4P3OA 5TY0A 3EISA 4UNIA 3UJAA 4AMUA 1EDEA 1GPNA 3GJRA 3FWNA 2AOUB 2C7VA 4LJYA 2CLMB 3QV1A 4BXOB 3BXHA 2RGCA 4LCBA 4BIMA 3OZDA 5TEVA 2OO3A 3OF2A 4WFIA 3S28A 5JY6A 3GL9A 1VL0A 4PX2A 4W63A 5KI6A 4ARVA 1TI7A 4OL9A 3HCBA 3J81A 3O4VA 4UBEA 4HDSB 2M6SA 3OZXA 3K0EA 1TFUA 2IW1A 2BMJA 5ARBA 4TLMB 4RU1A 1PWYE 3CKYA 3TW6A 1SVUA 2D0OB 1PYDA 3DAHA 4IF4A 4X94A 2QRQA 5IT4A 3N8GA 2OXEA 3KKQA 3VOSA 2WJIA 2ISCA 3OCUA 3AKDA 2O5CA 1Y1SA 1UH5A 2R6CA 1UIMA 4JBYA 1GFSA 1N9GA 2PZ8A 1G98A 4EW2A 3IAUA 2D54A 2ZB7A 3INYA 2HR1A 3AM1A 3DPSA 1KOJA 1NBEA 1W96A 2NO7A 2PU7A 4DM4A 1F14A 1ZRSA 2R48A 2X77A 1KOLA 1KAQA 2O0JA 1J8MF 1NLZA 2G40A 4OF4A 5L9AA 1QGDA 1X1BA 1BDMA 3E7DA 4CKXA 4TXMA 5FTNA 4U7DA 4Q9IA 2R84A 2ZB8A 2GCAA 2JG1A 4TTAA 1L9XA 2A59A 3MEQA 4OB6A 2CYBA 3HEAA 1HDIA 1CFJA 2WUEA 3GA5A 1T3SA 3F6BX 2JFNA 1C3EA 4X1KA 1B43A 3A31A 1L3CA 1RJGA 1SCUB 4HZUA 4IXMA 2ZULA 3UJBA 3VR5H 4KREA 3FHXA 2W2KB 5FUQA 3CZ4A 3VR0A 1H4TA 2OUIA 3EJWA 3FTNA 4HUJA 4N82A 5B1EA 3U7GA 2R7AA 3C16C 1PDWA 5AK5A 2ALJA 3ZHVA 3EG5A 4QGBA 1MO3A 4CKWA 1UJCA 3GFVA 2P0YA 5J1SB 3G2NA 3AM4A 3UXYA 4KC0A 3BMQB 1TQ8A 2NU7A 1Z16A 3QYFA 4HPXB 2CVOA 2G82A 4JJ8A 1ZOPA 2Z8XA 3IERA 1ZX1A 2ID7A 4ND8B 4B43A 4CTJA 2WIAA 4XGRA 3DTVB 3KOZA 3RBXA 2CKDA 3NXSA 1F6DA 3O03A 3VR2D 5BR1A 5FR1A 4EPTA 1VI2A 3JVVA 2IZ1A 5ELMA 1AUVA 2AOTB 4CTOA 3FPJA 3E5MA 3UJHA 3PL1A 3SKXA 2NO0A 4DW8A 4G25A 2VXBA 1GGEA 1GQYA 1PNRA 2YN2A 1JH8A 1VLHA 2VXCA