3RTEA

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp and atp.
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 180
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rteA01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3rteA02
1VM7A 4KALA 3H49A 4K8TA 3RQ5A 4U7XA 4KANA 5C3ZA 4E8ZA 3QAIA 1JZTA 2VARA 2QHPA 2O8NA 3IH0A 3RPHA 1ESQA 1VI9A 2HLZA 4B8RA 3ROXA 3NL5A 4UBEA 3RM5A 3EWMA 2DG2A 3RPZA 3NL6A 2A9YA 4DU5A 3HPDA 4N08A 5CGEA 3K5WA 3RTDA 1VK4A 2PKMA 3RTGA 3N1CA 1V1BA 2YXUA 2JGVA 3CQDA 2ABQA 3ROEA 3H74A 3B3LA 4LBXA 3RTEA 4S1HA 5BYDA 4KBEA 1YHJA 4E69A 3FHXA 4E84A 4S1IB 1YGKA 2DDOA 3PZSA 3D3JA 2AWDA 3ROGA 3RRBA 1L2LA 4C5MA 1C3QA 5TRWA 5CGAA 3RS8A 2NWHA 4EOHA 2YXTA 3ZS7A 1UB0A 2AFBA 1WYEA 3LOOA 1UA4A 3OTXA 3RSSA 3GBUA 2XTBA 2V78A 3NL3A 2AB8A 2I6BA 3RQXA 3IBQA 3B1QA 1U2XA 1LIJA 3B1PA 3FHYA 3KD6A 1TZ6A 2DDWA 2Q5RA 4K93A 5COJA 3UQ9A 4B8SA 1LIKA 3RT9A 2C49A 2DDMA 1EKKA 2PKKA 2JG5A 4JKUA 4KADA 3W4SA 3RRJA 3NM3A 1RKDA 1V1SA 4DC3A 5F11A 2C4EA 3KEUA 1KYHA 3UQDA 1GC5A 1V19A 2AJRA 3LJSA 5BYEA 3RY7A 2QCVA 1GQTA 3UBOA 4LC4A 3HYOA 1V1AA 3IN1A 4K8PA 4S1IA 3VASA 1LHRA 3IE7A 3RU3A 2R3EA 1JXHA 3RQ8A 1RFVA 1EKQA 5EY7A 1TD2A 1LHPA 3BF5A 4O1LA 5BYFA 5C41A 2AX3A 4EBUA 1YGJA 3IKHA 3VAQA 3HICA 3RT7A 1RK2A 5B6AA 3KZHA 5C3YA 3PL2A 2HQQA 3RQHA 3RQ6A 3RQQA 2AJPA 5TQIA 2F7KA 3I3YA 3NBVA 4YL5A 4C5LA 4E3AA 4JKSA 4EN4A 5F0ZA 1RFTA 2PKFA 3UMOA 3DZVA 4K9CA 4PVVA 4XDAA 3KTNA 3LHXA 3Q92A 4S1MA 3B1OA 3IQ0A 3JULA 3LKIA 4K9IA 3RTAA 4N09A 4XF7A 5EYNA 4GM6A 3UQ6A 3RSGA 1LIOA 2FV7A 3DRWA 3GO7A 3B1RA 4C5JA 3GO6A 3RREA 3K9EA 1TYYA 3D3KA 5BYCA 4WJMA 5C40A 3RU2A 4K8CA 4KAHA 4O1GA 3NBWA 1RKSA 3RS9A 2RBCA 3B1NA 2JG1A 1BX4A 3RSQA 3RTCA 4E8WA 3NL2A 4XCKA 2PKNA 3NCAA 3RO7A 2A9ZA 1RFUA 2HW1A 4LCAA 2I5BA 4E8YA 4K8KA 3RSFA 5CM5A 1JXIA 2ABSA 1ESJA 4LBGA 3UQEA 4YWRA 3RQ2A 4C5KA 3MBHA 3QA2A 1TZ3A 3NC9A 3UMPA 4JJPA 3NC2A 4X8FA 3RRFA 3RO4A 3BGKA 2DCNA 4C5NA 4EUMA 2F02A 3MBJA 2I6AA 2AA0A 2R3BA 1LIIA 3RNOA 1RKAA 4XF6A 3ROZA 3NM1A 1DGMA 3RTBA 3Q1YA
chains in the Genus database with same CATH superfamily
3P2JA 5K4HA 4QUEA 4MGHA 5JLAA 1MJ5A 2FPMA 1X92A 2WNSA 3LLVA 1FNCA 1E63A 3SF8B 1OX5A 3BH0A 4P5PA 1TZCA 4BWYA 1VG8A 2AN1A 4OMUA 4RY8A 2CXUA 4LUCA 2G9NA 3ZN2A 2IP1A 3W8EA 4F9TA 2QRQA 4J0GA 5HCUA 2P9GA 1K8ZB 3A2KA 3SYRA 4R1LA 2EYQA 5F5XA 3MHTA 1T36A 1C1XA 2XQIA 2PGOA 1PFKA 2C96A 2W2VA 4YRPA 3GJ3A 4X44A 1EVLA 5KYWB 5LMUB 3C4JA 2ZM5A 1VL6A 2QM7A 5TQ0B 3X0DA 4PYJA 5LQMA 1LRLA 3OZ7A 4IKOA 3EBOA 2E1PA 3GRZA 3Q8WA 1JLMA 5D86A 3K15A 1YGKA 2I4OA 3C0KA 3PWSA 5HJ7A 1ZMRA 2V6JA 2O8BB 2IPLA 5AK3A 4EYQA 1ULBA 3FRJA 4WGFA 3FBTA 3TR5A 2YFHA 4YT8A 1YS2X 1OQAA 2VKQA 2R00A 3A7DA 3Q8XB 1LB1B 1MG5A 1YASA 2P78A 2Q4EA 3FLMA 1P1JA 4EA7A 1GUZA 1P0MA 1X9GA 4GH5A 3LBIA 4MMYB 1CJSA 4XCKA 1LVUA 1V96A 4F5ZA 1GWNA 4Q4AA 4BVHA 4QOFA 2XCQA 3TIVA 1QF6A 4OA8A 2PBRA 1KAEA 3DBVO 2UUBB 3INTA 1CR0A 2FJUA 2K6GA 5AI8A 2C92A 1XZKA 1Y1PA 4ND2A 1ZH6A 3V2IA 3G02A 6ABPA 121PA 3K1AB 5LB2A 3QJGA 4FFPA 4JBLA 3RSZA 4DC3A 4PC6A 3T1OA 1N2ZA 3B1WA 1Z0SA 5COQA 3SD7A 5L3QB 4ZOLB 2D5AA 2OLJA 4N39A 5DE3A 1GGMA 5DNCA 2RGAA 3OZTA 4TTIA 3WOVA 4R1TA 4R83A 1YUBA 1E5VA 4XB2A 1RQ7A 1ZM7A 4Y2UA 3IDAA 4P7FA 1XGKA 2HCJB 2A4KA 1E2JA 1Q0QA 2V5AA 2VJQA 3ETCA 3HP1A 2OHXA 3ILSA 1KMIY 1YI0A 1F2TB 1XOIA 1GQYA 4I36A 1DAOA 3V2GA 3NBAA 5AVXA 5JZ9A 3A0UA 3KIPA 1AF7A 1MT3A 1XLTC 2W71A 3O0TA 4JSYA 4PAMA 4UPEA 1LQUA 1G20A 3JALB 4YECA 3RK0A 5JI2E 2ZXEA 2FZ4A 4QNMA 3LT4A 5L3RA 1TU3A 4GKAA 1HURA 2HJSA 4MW5A 5CITA 2JASA 2G0TA 4PG6A 4QDZA 4BECA 4YPOA 3TVYA 1TF7A 1XSEA 3E4DA 4GX0A 3VR2A 4BO3A 1W7AA 2CDCA 1PZHA 2AR0A 3MUNA 2X6RA 1F6DA 4TTSA 4Y9RA 3P9ZA 4A23A 3D9QX 2R65A 3GJ8A 4XIJA 1H1LB 4YQZA 2WQZA 2H1IA 4JNCA 4F3TA 4OAQA 1IY0A 4WOJA 2R25B 2W8ZA 4PYQA 2JCXA 2ZG6A 4RM2A 4NK5A 1REQA 5EXXA 3U3KA 2FPLA 2YJ5A 2HW1A 3S28A 3T95A 5K3EA 1NT2A 4UBIA 1K6JA 1ZIXA 3WLHA 2XHEA 2XZPA 4URVR 1G8MA 4DMMA 1YZNA 1S3SA 3R9XA 3G0DA 4CMBA 3A2NA 2PKCA 3QVUA 4KL8S 4PYOA 1XT6A 3EASA 3UF0A 4B09A 2G7ZA 5F2NA 1RZRA 3AVXA 1MGPA 4KTVE 2QPAA 5JOQA 1RKBA 4AG3A 2ECQA 2GAIA 1PJ2A 3OP4A 3GRRA 4C3VA 2IEZA 4JY7A 3DGEC 3LVFO 2DSTA 1Y1QA 3ISTA 4IH4A 5C4IA 4C4SA 4YMVA 2XBUA 4ALKA 3NBQA 5A3SA 5ENDA 5FHRA 2MYPA 4D3SA 1EFVB 2FPXA 3G7NA 5SICE 4Q18A 2DG2A 5DXAA 3LZDA 5DU2A 3T41A 2XECA 5I6DA 1P72A 3MJSA 3TOZA 1MPTA 2JHAA 4D74A 4DEYA 2UYCA 1E2UA 2I4IA 1G64A 2X0NA 1HZZC 3COYA 4GYJA 4PSCA 4O59O 4U02A 5EYPA 3WIUA 4ZGGA 1V7QA 3S8YA 1XDGA 4FWTA 2QN2A 3ZD7A 4P8RA 1SCUB 2EF1A 2C8VA 1IAVA 2BT4A 3U17A 3D3JA 3NUQA 4C0XA 3L0CA 3A1TA 3GFOA 3QMVA 3RRBA 2ZZNA 1Q74A 1UKVY 4YRAA 4CTKA 3GQBA 2GZMA 1BCSB 1BE1A 1OIWA 2R8OA 3EODA 4K87A 4YCSA 1UDXA 1P1HA 3SHWA 3S1SA 2D3WA 3WADA 4G84A 4DAOA 2RC6A 2QYTA 5BT9A 3CVUA 2WZCA 2Y1KA 3OCJA 3LLSA 4D9EA 2RDMA 4LXHA 5A3VA 1V25A 3X1MA 1IBLB 1GNQA 2WWYA 4LKRA 2M32A 2VJCA 3LA8A 1IXKA 1L8QA 2H0AA 3BCUA 2ZYRA 2ABWA 4NHOA 4L28A 4OLFA 4BO6A 2XZDA 4AYXA 1CT9A 1ORRA 2HSWA 4V0SA 4WH0A 1Z15A 3RSLA 1PJTA 3HJFA 4EF6A 2PSFA 4TVSA 3BICA 4BLWA 4M7PA 1ZD9A 4BP9A 3TSZA 4HT3B 5K3FA 4N7BA 4B6EA 3A3PA 5C18A 3S3TA 4Q3OA 2NUPB 1J9ZA 1PSZA 1G38A 3L4JA 1YR3A 4O1IA 1BXGB 4H3VA 4RELA 3IEMA 4O2BA 1PSDA 3K8ZA 3IVRA 1JQBA 1GAEO 2D7CA 3C3KA 3PHCA 3KQPA 4W1RA 1QHIA 2QGNA 5AJTA 5E9AA 6LDHA 2VTBA 5FT9A 5HK8A 3M1YA 4YJ3A 3UUGA 2CWWA 4BIIA 3OJWA 3GHYA 3WQQA 4DDVA 1L5QA 1NN1A 3CUTA 2JGFA 4H08A 4WY8A 1MORA 1P2FA 3AHGA 3E61A 4YRDA 4IFEA 2QDKA 1D2NA 1FBTA 2PKWA 1Q0HA 1VZ3A 4K9IA 5DVZA 5EYNA 4RESA 4GM6A 1J0XO 2HHLA 3PGLA 3SSAA 3DTNA 2G70A 1JIVA 2D5IA 2V5VA 4AJEA 2OM2A 1CUXA 2QN1A 4IF6A 2BI4A 3EZ6A 4MARA 2G0NA 1SBTA 2JIDA 3L1KA 3HGQA 4M8SA 1L3CA 5LQUA 3BB4A 3RFVA 4Q03A 3KD3A 1Z4IA 5E6SB 1BWRA 1E3IA 4EY4A 4W5RA 2A35A 1Z4KA 1KQGA 3Q87B 1RDFA 3RSFA 1SUSA 1PEAA 4MEJA 2QVLA 3JQGA 4P7KA 4CM4A 4ED9A 4LNUB 5K6AA 1THZA 2ZSUA 4B9AA 2J59A 3OG9A 3W6PA 1GO2A 3GLHA 1ZP6A 3N2YA 1EDDA 1KO1A 3OUUA 1PV1A 3ZWWA 3UW1A 2JATA 4RMGA 1P0IA 4GICA 1Z9BA 4JBXA 2OMKA 3AHCA 4Y6SA 5GMOA 5GOTA 4AUNA 4F8JA 1KMCA 1S2DA 3TIXB 1XWWA 4DTIA 1GUFA 3EXG2 3JRNA 3BJZA 4ZYZA 4OF4A 3UFBA 5THQA 4FM9A 4L5AA 5AKHA 4BAZA 3CLTC 4IO1A 4C87A 3QLUA 4ERNA 2G80A 3CCBA 1PP4A 5A6SB 3WXMA 4BCBA 2CLSA 2UZAA 4RIFA 4RKFA 1DIRA 5JRDS 3L6UA 5B7NA 2DFNA 4ALJA 2DF8A 1P1IA 2OGUA 3HZRA 1UKAA 8GPBA 3TL3A 1KFEB 2B5VA 1MAHA 4UNQA 3RVOA 3ZM5A 2VG8A 4BMVA 4PX2A 4P53A 1X1BA 2DFTA 2BMAA 2EBUA 1SXJE 2HDWA 3WQHA 3WLSA 3DKIA 4BAUA 1FCJA 1RCFA 2UDPA 4HN2A 2P0AA 2FSIA 1EA7A 2X8LA 4ZVQA 1XA3A 4TS4A 3I62A 4P83A 2AGVA 3EEQA 3G2PA 1JIXA 1OBHA 1JMKC 2UVPB 5JCPA 3IAFA 4XJVA 1OGIA 2XTNA 3SVTA 2OXCA 4GKJB 2GPNA 4BTVA 5FUVA 2OQVA 2ZDQA 3UM9A 1M33A 2C8LA 2ZS9A 4GUAA 5ERGB 2XTBA 3EH2A 1XRQA 1Q1NA 3MJVA 1AE1A 4OXKA 3S1LA 4LCBA 4RKWA 5FFMA 3U9TA 3WGNA 4HVCA 1FA9A 2GERA 1D6JA 5I5EA 4FILA 5CK4A 4UBMA 2FZKA 1RLJA 3FNFA 2OOSA 1BW9A 1AHPA 3IVMA 2VTKA 3HXKA 5KJFA 1NY5A 3WSTA 3W4SA 1GDHA 2G7MC 4XCXA 4BLUA 1KAMA 2NP7A 3JU3A 3PCTA 4D8VA 3CUVA 4MRAA 4RZ2A 3W5JA 4WL0A 3GLFA 3DXZA 2E4AA 2FR0A 2VNSA 1F14A 3JWPA 4NTZA 4DA8A 5EY7A 1ZH0A 5I01A 1R5JA 1VLHA 2I62A 5DH9A 4WBNF 2C4EA 4QQFA 3FHJA 4YJHB 3CUKA 1GFSA 4LY6A 1USWA 1AXGA 2Q0QA 3U80A 5ICGA 4U7GA 2V6FA 4F2GA 3DCNA 1H8EA 2ID7A 2JGIA 4NCHA 4S3MA 2PMWB 3CU5A 3SEZA 2QMQA 4EH1A 5AVSA 2YV3A 1ESCA 4M9QA 1OPRA 4HRAA 3BSFA 3NX4A 4BCCA 3I5YA 1W5BA 4M22A 4F7WA 1BCRA 2EBFX 3H2SA 2J7PD 3JVVA 1YL5A 4V0ME 1OJ7A 3PWZA 3Q92A 1B6TA 1KK0A 2GZ2A 2X4GA 2ZBVA 3D02A 3NT5A 2CMKA 1ZVJA 4J0KA 4NOLA 1HFKA 4UJ5A 3NYQA 2IYSA 4L85A 3OM0A 3IUYA 4TYWA 1XK6A 3PQFA 4ADSG 1A4RA 1SCIA 3ZGYA 5A9SA 1RKSA 1FVOA 4KYIB 4YP0A 4YCMA 4TWZA 4US0R 5CIYA 4ZK6A 2PQ2A 3HLYA 2D2XA 3PIRA 4JEHA 3NHJA 3U1TA 1L1RA 1Y9ZA 1ZS9A 1SKAA 2YWRA 3V8PA 4B87A 4E8YA 1NRWA 1XTZA 5F9MA 4A5OA 2CV0A 3ASZA 3LUPA 4CIDA 4BQQA 1M8KA 2DP4E 3CX7A 3WGJA 1AJEA 2WUDA 3CO5A 3IUNA 3KL2A 4GZ6A 4DJ5X 4F0JA 5KYYB 3LCVB 2X58A 3AEZA 1Z6QA 3HJHA 4HWPA 4S1NA 5AOVA 3O90A 4GBMA 5BN4A 4AMVA 3DUFA 3ZWQA 4FOPA 1K75A 2WR8A 4EWLA 1LS1A 2R60A 4UTPA 1X77A 3IJPA 2C9BA 2NXJA 2RGNC 2G77B 4HDKA 2C5SA 1MB3A 2FRXA 2LXNA 3NYWA 3ZDQA 1MRZA 4QRIA 2BGKA 2B83A 2ZITA 4BBPA 4L50A 1CUDA 1LVGA 1KETA 1QHYA 3INRA 1L5OA 4JZKA 1RI2A 3RDPA 2AT1A 5IWAB 3L8ZA 2R84A 5KYYA 1U80A 3S2SA 4U2EA 1LQTA 4H7KA 2ZVJA 2ZIGA 4TTAA 2GPWA 2MR5A 2BZ0A 1TW2A 4GVXA 3KFLA 4FC6A 1ULUA 3ZW8A 3DE2X 4D1YA 4E12A 1KIAA 3CLSD 4MJ3A 3GA0A 4F6RB 1CRWG 4I9UA 1SQ0A 3AH8A 4BFWA 5LN1A 4ISCA 5C52B 1YE8A 2G63A 3LHKA 1JSXA 1JXOA 4GNRA 5SZKB 4R3UC 3AM4A 2B3TA 3L49A 2I3DA 4AO7A 3GIWA 1Q12A 2Z95A 4R8LA 2C2WA 3MYRA 4B76A 1IUOA 2B1RA 3ZIDA 1JG3A 1KY5A 3VV3A 3U7JA 4CIBA 1J7JA 1KGSA 4YRTA 4BKMA 1ST3A 3A36A 4YUAA 1DQYA 4L8GA 1MDBA 1M6NA 4FCTA 1EFKA 4YP6A 4E7PA 2II6A 3BIOA 2EJUA 3W5HA 1D7AA 1MH9A 2OBNA 2PKXA 4MIEA 5EN4A 1E7WA 4FEEA 4TPKA 5EINA 2YV2A 1N36B 2A0UA 2OBMA 3EZXA 3O26A 4WXEA 5HCNA 3WZMA 1IHOA 5EHXA 3R74A 4NCKA 5C1DA 3TMAA 4ZCPA 2EP7A 5LC1A 4WI1A 5F21A 2H00A 3PUJA 4FOSA 4C7OA 2PZGA 3IMGA 5JNTA 1LX6A 3AIOA 3RS3A 1PW7A 3MFQA 2R5FA 3CONA 4XFKA 1U65A 3STYA 3QWIA 5F1OA 3RLIA 4EMTA 5IF3A 3TTXA 1F12A 4BQFA 3OJXA 4R1MA 2DHEA 4WN9A 4F2WA 1K08A 1J8MF 3PNBA 1IRIA 1XD2A 2P2SA 1EWTA 1LHPA 1QGZA 4PNEA 2VWHA 3JVUA 3GJ5A 5B1YA 1THTA 2C88A 3SK0A 3KC2A 1AUVA 4JROA 3RYFB 4YEDA 2NYRA 5JY6A 1E3WB 1O5OA 5LB4A 5JS6A 3L6CA 4TZ0A 5EWMB 3M6MD 5KJCA 3BJEA 1QE0A 4BBZA 3I8SA 1YDHA 1YR2A 4M8IA 2DH6A 2WLSA 2ENUA 4JDPA 2MU1A 4NDNE 4C14A 4BP8A 1SU4A 4RGQA 4LQDA 3JQEA 1T2VA 4PZPA 4IDFA 3G0BA 4X20B 1NNEA 4BTLA 5TQVA 2LUOA 3GA5A 1CQZA 2E4YA 2WUVA 2X5NA 4GMKA 2JG1A 3OE1A 3WGQA 1XYYA 1F60A 1KAHA 4KVAA 4L76A 5EWJA 3V2UA 1Q0LA 2HI0A 2WIJA 4AF7A 2C7PA 4UBOA 2AFIE 1N1EA 4FCWA 3EX7C 5ICEA 4N8EA 2OCPA 4BFSA 1SB8A 3DAOA 2ZR8A 5IEBA 3HR7A 3LUDA 1LD3A 4N3CA 1GEGA 1E96A 3PD1A 5SZJA 3EFOA 2I3BA 4A4DA 4IIJA 5HUQA 2G36A 4OXQA 1H8HA 2D5LA 3KJZA 4C5NA 1LSJA 2YS7A 2F02A 1YA6A 1OV6A 4MV7A 1U9YA 1Z36A 2Q99A 1PT8A 4OCZA 3R3VA 4BVGA 1L5ZA 1OYWA 1YQEA 2QYHA 2PNFA 1QGUB 3PUVA 5CPBA 4E4TA 1ODSA 1UH5A 2R1VB 3BXGA 2JD1A 2QAGB 3RAPR 4B4UA 1IXSB 4YMLA 2PZLA 1IHUA 1E6WA 3HXOA 5ILQA 2CLIB 1XLVA 1USUA 3UMFA 4K03A 2BI8A 1W49A 1I4OA 2Q3CA 1MCZA 3H8WA 4HR7A 2EQBA 5BMVF 2C7BA 2JAXA 3BVPA 4AMZA 3A4IA 3EXFB 3IULA 3N9IA 1L5RA 4AF6A 1B2RA 1QE5A 1E3DA 1JKXA 1F8YA 4IDQA 4KBEA 4TYYA 3GVXA 3VYWA 3AETB 3RYHB 1AO0A 2BMFA 5LZ5A 2PJDA 1Q0SA 5DLQC 5C1OA 5JROA 4P4LA 2FWPA 3M2PA 1DJLA 2ISQA 3BWMA 3Q9LA 5BMVA 2XA2A 3ROGA 3FKSD 4INPA 1E5XA 1U28A 1DO8A 4EB0A 1K5HA 2QL5A 2VJAA 3FLEA 2HA2A 3EAQA 4LNHA 4MUIA 3A6EA 3Q98A 2Q3BA 1VJDA 4PNPA 3VC7A 1WD7A 4ZZ0A 5KDOA 3NGMA 3W9YA 4BNFA 4TMFA 1AQUA 3MS4A 4PHHA 1LTQA 5L3VA 1DU4A 3ZM6A 4I5EA 3SNHA 1XJWA 4F4IA 1PK9A 4GI3A 2P41A 4EGAA 2Y92A 4MMZB 3KDPA 4EG3A 3VOBA 1VE1A 3OETA 2GRUA 4EO4A 2VCEA 4WXYB 5LP1A 2GEJA 2HIMA 4HXYA 1A5TA 2XMZA 1D6NA 3OZUA 3LKZA 1XQXA 4HAUA 4CMGA 2JKVA 5T3YA 5AM3A 1RXWA 3C8MA 4G86A 1U8XX 3MWYW 1GPUA 2X4DA 4YRRA 3ZEIA 5IFLA 2OXTA 4JP8A 3T1HB 2FOXA 4LOIA 3UK0A 1MU0A 2NO7A 4WW0A 3ZHQA 1RM5A 2P3SA 3IL2A 3FKJA 1TC1A 1QIKA 1UKCA 3N2KB 1HM5A 3H6HA 4CMKA 4QOIA 2Z2IA 4YDSA 3NOQA 5C4MA 1B2LA 1I6KA 4FFLA 3TM4A 4MVJI 4B7CA 4B47A 3HDGA 3M3DA 3VGJA 4EN4A 1E4EB 2A9JA 2C9ZA 4YBZA 3LL4A 4DZTA 5DGDA 1BWPA 2XITA 3ZBUA 1M5UA 1YXMA 2XNDD 3CVWA 4L07A 1J90A 3QWBA 4DXDA 5J1SB 1G21A 3TTTA 3I01M 1FNDA 2EJTA 1ZM3A 1W8IA 4Z2YA 4OOEA 1W46A 3DR3A 2Q07A 3KEMA 5C40A 5EVJA 3O1IC 1MQAA 1C7EA 4JLKA 5DNAA 5BVHB 2BGRA 1DZ3A 1SBIA 2BDEA 4D4LA 4YCCA 5DNYB 2BISA 2ZKIA 4GWLA 5G0TA 4IUYA 1UPUA 3LY9A 3K9BA 3ZWBA 3IDZA 4QWWA 4L0CA 2HBQA 1LW6E 2QNIA 2RHOA 4X8OA 5ADUS 5AVYA 1HZZA 4DR1B 1C81A 3OCVA 4ZT3A 2C7OA 3SJ7A 3KLNA 3H7AA 4G9BA 5F76A 3K6SA 2HMAA 3VR4H 4TZ6A 2ABSA 5FX2A 4EFNA 4BV8A 1JIJA 4PZDA 5JMPA 4ZYWA 3OUTA 4IG4A 1OH6A 4WVFA 4LBVA 4OP2A 3RJ5A 1DVRA 4DSNA 2WTUA 4WFIA 4U7PB 2X42A 3I4LA 5JAOA 1DDGA 1X38A 3RF7A 1DUVG 3EIHA 1FDSA 2P27A 4CODB 5B3AA 3T5DA 1L7QA 2YHAA 2AUTA 4QNNA 2B82A 1NR1A 3G88A 3SCZA 3EGDA 2VN8A 1RPJA 2H17A 4UUPA 3HO8A 4LDZA 4B79A 1YS9A 2QVCA 3H5LA 3K35A 4WSOA 2OXRA 1E1QA 3GAZA 2P3OA 1XWFA 2WHYA 3D8SA 3EQZA 4CL8A 4L0MA 4ZIYA 4AXBA 5EWLA 3RM5A 2FPOA 4DJTA 2G5TA 3LUHA 2CXNA 2XX3A 1BX3A 1FK8A 1JEEA 3RRYA 2GVNA 1MB0A 1GU7A 1XCMA 1FDVA 2A30A 2X1VA 1KOFA 3C39A 2ZR9A 2H2DA 3HL0A 4I8XA 2Y2UA 4YT4A 2RHGB 2DOKA 1LPNA 3L05A 4IVNA 4L8WB 4M0KA 4ALIA 4LF9B 4M7OA 4NS1A 5GOZA 1LWOA 6Q21A 3FOZA 1W9MA 2REOA 2QD5A 3FB1A 4Y2TA 4ZEWA 4NYIR 4PIMA 4BMYA 3PYMA 3ZL8A 4HGNA 3LQ1A 3VPHA 3PX2A 4M1EA 2PZMA 4RK6A 2GRJA 3LKVA 2ONCA 3BSYA 3AYZB 4MUNA 1ODCA 2WE8A 1Z73A 1QGDA 3DE4X 1X7YA 1RRMA 3NKLA 4GMDA 4JLUA 4PC2A 2YZKA 4S1WA 1PFYA 1V37A 2ZAMA 3CIFA 5CEJA 5CEEA 2ILTA 4HVTA 2XQJA 1I8TA 3ZVMA 5IVPA 2ZIZA 5IAOA 2V78A 4H1HA 3EWAA 1S4MA 1DWOA 2EAUA 4HC4A 1RC1A 1IB6A 2J45A 2YHSA 3EIQA 5IJAA 2QT9A 2VWQA 3UTCA 1OBVA 1UZUA 2GN0A 3PUHA 3TBFA 2X5XA 2NOAA 4Q9JA 4CR7A 3K8OE 2PG3A 2HFJA 3UATA 4L1KA 2ZJ2A 4E5PA 2BYTA 5BW5A 2V7XA 2P3QA 4CJXA 5FTLA 5L4NA 3QNWA 3TZ6A 2OHHA 4RJTA 2BEUB 5JO9A 4HAWA 1LBIA 4C7XA 4AW9A 3VASA 1HNZB 1J8YF 1E1KA 1JR4A 2WLTA 1NJ8A 4DSZA 5FULA 2DLCX 1P77A 1CR6A 2OCIA 2DH5A 2B20A 3WL8A 4TKLA 3SS9X 2APJA 1XE3A 3K1AA 1COWA 1HLDA 1J1ZA 1GRCA 4LOAA 4MYSA 4FYWA 4DM7A 5K7SA 1NG9A 4HX5A 1YU6A 3W6NA 1CUIA 1MEEA 1RQPA 1AKMA 4HAOA 5AVKA 1Q0ZA 2WJ4A 4S1OA 1UPXA 3ET4A 2M6SA 3OJEA 3QELB 2F59A 5HQJA 1Q50A 1UMCB 2W6ZA 3IPLA 4LXYA 1TQ4A 4BU1A 5MN6A 3GRCA 2JCVA 3C6YA 4Y2PA 3FYHA 1ZN8A 5IX8A 1H94A 2F64A 2D0OB 2W4QA 1I5RA 2OXFA 3IT1A 4AJPA 3B1OA 4ZAGA 2DUWA 2Z3VA 2XSZA 2J87A 3QLUC 4JVMA 4M9RA 4QHYA 4FUQA 3E8XA 3LT2A 3ELBA 3IFSA 1RTKA 4EKEA 4EHBA 1ADFA 5D8DA 4OP3A 3E7PA 3GWZA 4JEUA 2I5PO 4D97A 1JG4A 1EX1A 4AI6A 1YB7A 1CJBA 2ACEA 4K6GA 4ZRNA 4ARCA 4V0OA 1L5HB 1ZISA 4O63O 4RVNA 4CEJA 2X6QA 3ZH2A 2B98A 2Q4OA 3GFGA 2KM1A 4UVDA 3QY9A 16PKA 4PE5B 5TF0A 2WPNA 3E15A 1HOXA 1O6CA 4DB2A 1GZHB 1XAJA 2OBYA 2PBLA 2XD4A 3L18A 4RZSA 4WXPA 4BV2A 3BDAA 3ADDA 1JJAA 4XRGA 3PFFA 2XB4A 2CB0A 2QT0A 4UC0A 2GO1A 1UFKA 2HCBA 2ODTX 2Q6LA 3E3NA 4G5XA 2XY4A 4J1QA 1AX9A 1DDOA 3IUEA 4I3GA 1PLKA 3IT0A 1UIRA 1DL5A 3OZGA 3PUWA 5E1BA 4YJ3F 1C5KA 3CM0A 1J25A 3AFIA 4P54A 3ANTA 2GD1O 3OFNA 4A8JA 1GVHA 3Q1YA 2VAPA 3GJXC 1GHTA 3CLSC 3KJGA 3P9IA 2IZ6A 3WMGA 3W2IA 3DPSA 2OO5A 4RH1A 2DECA 4E08A 4JQSA 1TEVA 1YVDA 3S2UA 3VDMA 1Z08A 3IVGA 5JC1A 4OUDB 4KQHA 1ZOIA 2YMQA 1JA9A 4I4TA 1Q16A 1GXSA 1SCBA 3GPDG 3RTDA 2VJYA 2JLZA 3DXXA 2VHVA 1PNTA 2PA3A 1N3IA 2L69A 3GY0A 4P6VF 5KPDA 2C4KA 3DV0A 2I2XB 2ZWIA 4PVCA 3ZPXA 2KLHA 5I7FA 2XIJA 1S2MA 3IAXA 4QARA 1XRSB 1EIZA 2O1XA 2X7HA 1YIOA 3EXG1 4QUHA 1EH5A 4H6VA 3X2SA 4DLZA 4P35A 2Z5FA 2QTHA 1DAPA 2Z1MA 1CIVA 2RD2A 1QRRA 5D5QA 1ZR2A 2CJWA 4DBLC 4C7VA 4C76A 1OTXA 2YXTA 1ZR4A 2CHEA 1YCGA 2F3RA 5DW3A 1I7LA 3ZE6A 2UZ1B 2R2GA 4DA4A 2O2GA 3UJ3X 1QVRA 1SHZA 1TM2A 2YMLA 1YKFA 4UUBA 1EHCA 4LRWA 5J3JA 1E2NA 1JZQA 5MGBA 3P2IA 5JO0A 1YFKA 4MDHA 5JBIA 3HO1A 2GCPA 4Q9KA 3OEHD 5AVJA 3F6YA 3RHTA 3CRQA 3DFFA 3VU9B 4BV3A 4C4TA 4F86A 2C49A 2QZZA 2PUBA 4D82A 5IAGA 1XUOA 3ORFA 4FGUA 4NV0A 1ZUHA 2WF5A 4E3AA 1XEFA 4H1VA 2JLBA 1FXWF 4ARUA 4I1SA 2Q2OA 2EYUA 5ALNA 5AUNB 4M9UA 3EK2A 5DNUA 3I92A 1I10A 5EQTA 1JR6A 3BF5A 1CS0B 4UHEA 3MTIA 4OD0A 5I7UA 3JPWA 3OTGA 2G9UA 1FSPA 2C9YA 5FUBA 4KGXA 5CXQA 2Q3HA 3AW8A 2RAPA 1O5TA 4FEGA 1U3CA 3RQ6A 4JUCA 1XRPA 5LZ4A 1AGYA 3M6XA 3BTSA 1TUBB 1F3OA 2NTJA 5SY6A 1ISPA 5A02A 5K6RA 3CX3A 3K0BA 1YTUA 4PVVA 2BSQA 3VHLB 1RBQA 1HFEL 2UVQA 4QQNA 4Y98A 3K30A 3ZKAA 3OWXA 4CTMA 3JULA 1MHPA 1I7DA 1N6HA 1EK6A 1QUFA 2ZJ1A 2ZBEA 3E23A 3EIOA 5AJHA 5F5LA 4E07A 1TM1E 4I3FA 2ZUSA 1WQ4A 1S89A 4BLSA 4JFRA 4C3ZA 1MAWA 4FOLA 1DKPA 3KWJA 2P62A 4KLRA 2RK6A 2ENWA 4DIDA 4GOXA 1TNDA 2JJ1A 1N2XA 2PH5A 2FZLA 5DHPA 1RXSA 2AC7A 1OAKA 2A59A 1GTJ1 1V8PA 4R0NA 4WQMA 4B5KA 4LCAA 3MWDA 5AVZA 1UP7A 2DPMA 3Q3CA 4YP1A 4K9NA 1MIOA 1QH8A 3D2AA 4PXAA 4ZTBA 1I3CA 2Y1FA 2O19A 2VCHA 4FW9A 4LJSA 3IP5A 4IY1A 4DABA 4UHDA 3NVMB 4DCVA 3VPCA 2ZBUA 3QF7A 3NS7A 4WXHA 5DN6D 2CXRA 2R8YA 4LJ7A 1GZ7A 1K6XA 5F9FA 5K1ZA 4D6XA 4PM4A 4QFCA 3LO5A 3I12A 3I05A 3KUKA 4CQLA 2MINA 3ZX5A 4U2DA 1PFUA 5B6PA 4ZT4A 2EWWA 2DULA 3MNFA 2OHJA 1QVZA 3JVIA 4DXHA 3WOHA 5HKKA 3TX6A 2IXDA 1UAGA 2UKDA 3UJHA 2Y1OA 1D1PA 3OU6A 3JATA 1F9EA 2Y2VA 3M4XA 4YRCA 2GEDA 3GRAA 4N9WA 4RX1A 1WSWA 5AT1A 1OILA 1KMMA 1Q1BA 4C6HA 4EW1A 3H5IA 3G1TA 1C8VB 2WSSD 3A6JA 3PUZA 5D1NA 5ELLA 3CT6A 3V46A 3DDHA 1BMDA 1KYYA 1QYCA 2XVXA 2FJ0A 1G4AE 1QYIA 1GZDA 5E4FA 1AHIA 2YXDA 5BXYA 4TM8A 3O3MB 2ZYTX 3M33A 4BO8A 1C29B 4RPGA 4Q7QA 1M2NA 1VXRA 1DRKA 1OVGA 2P79A 3UK7A 2QTMA 2VYQA 1NSTA 2NYAA 2ZRCA 3K70C 1B23P 1DTWB 1CIJA 2EZUA 4WEOA 4LVUA 1OWMA 3K9QO 5ALSA 4EEZA 4OLJA 5A4MS 1JLLB 1XA0A 1CR4A 4NMLA 4Z4HA 4MMXB 2WTBA 3GFTA 3IB6A 5CXSA 2X0DA 1S8AA 2QMEA 3I8OA 4Y1EA 3RD5A 3RS2A 3BRWA 5LPNA 2HDNB 2PKQO 3NR2A 4YJKA 1F2VA 4JB8A 4L5JA 4YJ3B 5AW4A 1WTAA 3AKZA 1Q5PA 3QVLA 3LBFA 1CUVA 4DCTA 3V3TA 2CYBA 1ISIA 4XR9A 3VC2A 1NBME 2R0QC 1J2JA 1E8MA 4L95C 4R8SA 4X8MA 1ZH2A 3D7KA 3FOCA 1XQVA 2VP6A 3MWEA 4QYIA 2JGAA 3R0IA 3W0LB 2P2CA 3IVCA 3IPYA 2KB0A 3GEMA 1Z8HA 1U3WA 3IKJA 3LK6A 2H3EA 4IWNA 4QDOA 2DUMA 4PR0A 4QSMA 1EGVB 4CCAA 3HYOA 3PDCA 1JG1A 4LC4A 4S1IA 1UMDA 2JRCA 3ZE0B 1IQ0A 4Y2QA 1W0CA 3HVJA 4PQGA 5HK9A 2W2KB 3LOUA 5UKDA 1XFDA 2Q3LA 3UKJA 3UT5B 2GLUA 1VBKA 1EFLA 2QP9X 3DH0A 4LZLA 2XTAA 4P4NA 1P8JA 3AT1A 1YZKA 1G2PA 2PXXA 1NI4A 2O2DA 5COBA 2OSBA 3E9MA 1NI5A 3L4BA 3OTIA 1IVSA 3X1XA 3HCBA 3Q9NA 3OFKA 1J5EB 2O7RA 2AZTA 3P2EA 2R8ZA 5FNZA 4QOEA 4M9CA 3DBLA 1HRDA 3M6LA 5TRTA 2YIMA 3V7UA 1MNQA 1UFVA 2BM1A 2Z2JA 4JB3A 4ML3A 1ZGHA 3ZGVA 3W79A 1TUIA 5K9ZA 4GM1A 4HZIA 1TKCA 4CDMA 2G72A 3PWKA 3QBJA 4KCGA 4EP1A 4YR7A 5FI1B 4XW2A 2AXNA 3CKLA 4HK4A 2J30A 3UOWA 3R4CA 3N2KA 3OIWA 1LSUA 3CA8A 2DBZA 3P9RA 4UULA 4W63A 4HUTA 1AOXA 1OX4B 1M6YA 4AZ3B 4JV5B 1I2MA 3K92A 4MYUA 3K1JA 4TL7A 4Y6LA 4XKJA 2VQDA 4A9AA 3CG4A 1GPMA 2QVGA 3ICPA 3KYCB 4FTWA 4TYMA 3HO6A 2AZ4A 3GLTA 4IJVA 2Y1GA 5IP5A 3WI7A 3PSAA 1BS9A 2XCOA 1G6Q1 1NZFA 3IGFA 4HXEB 4GBJA 3UWOA 2EHJA 4ZI2A 1JQDA 4JBYA 1MF7A 1ORHA 5AOCA 3JQ7B 3VGPA 3VOAA 1W36C 1EVKA 1OOEA 1WW2A 1FJHA 2J32A 2JFPA 2RAUA 2XWQA 3FI0A 1ICEA 4GOMD 2CJPA 1RWOA 5ALZA 4QFMA 1Z0JA 1A8QA 1J09A 1BU8A 2E4XA 2GRAA 2FGJA 2J1LA 3KJHA 4J91A 3V5NA 1L4EA 1QO7A 2V58A 1UMKA 4UEOA 4XGIA 3QITA 2WT9A 2WNHA 3GT4A 4FMCF 4GP6A 4UATA 4ZKDA 3INYA 2DERA 2FEAA 2PMFA 3QYAA 2ODPA 4DA0A 2GARA 2C3PA 3DQPA 4OG2A 1GNVA 2YW9A 1LPPA 4DANA 1TD9A 3ND9A 5CHYA 3E82A 1XCPA 4NULA 5T4EA 1GLNA 4P4UA 3TE7A 2IUFA 3DJYA 4U3JA 1P2UA 2CBGA 1X13A 3GEDA 3LC7O 3Q7PA 4XWAA 1RXIA 2OFPA 1JJVA 3HUFA 5C7YA 3TLKA 1H5NA 4EF4A 1BSVA 3KYJB 3AKYA 5HMMA 1A71A 1Q21A 2RJOA 1M1YA 2HF9A 3HXMA 2DPGA 3FYUA 4PRKA 2ZLBA 2H4WA 4BLRA 1UK7A 3QUCA 3C48A 4DV3B 1CUBA 4LF7B 4BEVA 2A6PA 2V6BA 3QVSA 1JHMA 3U13A 2PVPA 3S5UA 3F6RA 4QD3A 4E03A 1PX2A 1DRWA 4B40A 3VNBA 1Z4OA 2B0CA 2IGBA 1QCYA 1ZEJA 2WSYB 4BX9A 5CW2A 3HP7A 1IN8A 2YZNA 4AS3A 9GPBA 1RKDA 2FF7A 3QPDA 4FHDA 4E5UA 4I19A 1PDOA 1OC4A 1RLMA 4JJ4A 5A1JA 1X1SA 4YHBA 2VRNA 4AO6A 4D4IA 4IHJA 4NAVA 4DLBA 4FXPA 4G56A 1NBHA 1BTOA 2KHZA 3N2LA 4FINA 4GPAA 1EG2A 1PRYA 1TGVA 3KQVA 4L9RA 4WINA 3DVQX 5BSEA 1NYRA 3HL4A 2GDJA 2IE8A 1KK2A 4P81A 4KE7A 4Y2VA 1JN0A 1DAHA 2KPOA 1YTLA 4S2UA 1OKKA 2IHZA 3KZHA 3DE6X 3MF4A 3A3NA 4FJ2A 4ZV7A 1ENZA 3FMPB 3EW7A 3RQHA 4RD2A 5K6TA 3U0BA 5KTMA 2ZSKA 1Y48E 1Q22A 1ZLYA 4KN9S 4MKGA 1I2CA 1BYIA 4LF5B 1NKSA 3JZMA 4DBZA 3PT5A 1D03A 5FORA 4AWBA 2E48A 2VP2A 3DVLA 3L46A 1QRAA 1LW7A 2VEDA 3MEQA 5DDIP 3T12A 4F84A 1HE1C 2Y67A 1JSRA 5ITZA 1I51A 3ECCA 1OCEA 2GZ1A 2W2OA 2VDJA 3C5WP 1AKTA 2Z9CA 4HB2A 4TGLA 4DLSA 5D3MA 2JI8A 2XV1A 4LGVA 3PSHA 5A5DA 5CFNA 1NMQA 2Q6VA 5KUTA 4F56A 4ZZ2A 5TPWB 4F12A 2C2BA 4G0WA 3DGFC 4MEBA 4KITB 2FWJA 2C77A 4M1OA 1KEZA 1DJOA 1IBSA 5LZ9A 2XEDA 3GZTB 1U0SY 1XZAA 3PWTA 3FVRA 3NWPA 5BN3A 2BBSA 4WN9B 3DL7A 3IKTA 3E7XA 4KV7A 1SNYA 2ZRLA 5F3RA 1YQTA 1KVQA 4IYJA 1X70A 2QX7A 1RKVA 3B52X 1ZQ9A 2X5OA 3E6AA 4MPDA 4NE7A 3RU9A 4CMHA 4DMUB 1IMOA 2QMZA 3QU9A 4G8JA 4QQRA 2E4ZA 4DWWA 2RHMA 3ORSA 1V3TA 2FP4A 2WU0A 3PIIA 1H85A 2JVKA 4O8ZA 3T9EA 5JDCC 5J63A 1TKAA 4KXFB 5BW8A 3DYIA 2RHWA 4IGAA 1KJWA 2B5WA 4XD7D 3LC2O 2OQIA 4JJ8A 1B6GA 1SVIA 5EQDA 3AUJB 4MLCA 4QYWA 5DB4A 1JLKA 5AKYA 5KVAA 1GGFA 4EOGA 2JLQA 2F4VB 1HRKA 5G41A 1QK3A 4DVJA 1Z5WA 3WICA 4MR9B 5K99A 1W2WB 4BNGA 4RPHA 4ZKEA 3RWMB 1TIKA 2X13A 4J7UA 2NU6A 2O0JA 1L4YA 2H5IA 2YZMA 3B3GA 2X9LA 4EPWA 1VK4A 1CE8B 1UJBA 1E5TA 2VH2A 3NHBA 4EMBA 4OHUA 2PR2A 2QRMA 1QK5A 4L8YA 2QJOA 2D6FA 4QXRA 4QTXA 3UMGA 1F48A 3RC3A 1Q92A 4U2KA 2POQX 3G8BA 1GVNB 4J43A 3VU3A 4Q1CA 2DDOA 1WB4A 4MQEB 3NJ8A 3PUXA 4BIMA 1ZOLA 2QP3A 3JWEA 2NUBA 1I14A 4EHIA 1N0VC 3F0TA 3HKDA 4V24A 1QGAA 2ZIEA 4TL6A 3RIMA 3I09A 3H1BA 1R0YA 4WKNA 5DOVA 1JDSA 1FU4A 2OGWA 3FYSA 3TR6A 2EFHB 4XM2A 5ENVA 3U9SA 5IS2A 4E0BA 3P0FA 9ABPA 2X86A 2Z6AA 2HV9A 3SHTA 5B57C 1SC6A 3P4UA 2XE8A 3G0HA 4LPSA 3D5EA 4I7EA 3VPFA 1LLFA 1DMRA 3HBLA 3GQVA 3KLMX 3PFHA 3ZK7A 2XNDA 2W98A 1PR2A 1Z12A 3IJ5A 5K8JB 2YXBA 3HKEB 3G2MA 3L43A 3NOOA 3MTDA 3O3NB 2POCA 2HU7A 3B9QA 1D4OA 5BNZA 1VLQA 2GH1A 4R54A 2IBSA 3IE7A 2JFYA 4W1QA 3SHVA 3WNDA 2WWFA 3U9LA 4HLNA 3QHAA 3MWLA 4KQKA 4KLNA 1Z0AA 4WCDA 4Y0AA 3ZHXA 4M98A 2A5FA 3D6VA 4YP9A 2GXAA 5DYGA 1NUQA 3TTUA 2FFAA 4HF7A 1PT7A 1OR8A 3RWBA 2R66A 5FBRB 3WB9A 5D84A 1CULC 4BNMA 1UWCA 1GU1A 4NXNB 3A32A 1TC2A 4L73A 4CKCA 1N0IA 1Q0PA 2AG0A 2C3UA 2R8BA 1JAIA 3KM0A 3ONWA 1WDWB 2GF0A 1CW2B 4TQUS 3R7DA 4B33A 2ZE8A 3BRCA 4PFSA 2GXUA 3QF4A 3NH6A 1VRWA 4EG0A 4JJ7A 1U2RA 1P31A 2IZ7A 1PJ4A 2R6FA 2XZLA 4HFJA 5A4KA 2GASA 1HG0A 5DNDA 2C84A 5JVDB 3AC0A 3QELA 4CLEA 4FX2A 2IHVA 4IQ8A 1WU7A 3GVCA 2ZWAA 1CRQA 4NOJA 2EZ8A 3OJOA 3GHHA 1T0BA 4GX1A 1W94A 3EIUA 4ZU1X 1THGA 1U8UA 2BFBA 3AX6A 2RAVA 3CR8A 2WWTA 3L92A 4JODA 4KP7A 4KXMA 3AR9A 2KWIA 2V6MA 4D9FA 4RKYA 2REXB 3GIDA 5FUQA 2Z83A 2MMCA 5M7EA 3WQBA 3S55A 1WA5A 3EQ2A 3ZU3A 1MGOA 1BHO1 1NXXA 2WD8A 3BMXA 4RA9B 1SH7A 3FHTA 3LWNA 4QYXA 3LM8A 4G09A 3A6ZA 2HA6A 1Z75A 1NHGA 5ED0A 2JFBA 4HATA 3HRIA 2OWEA 4I2NA 4U5QA 3YASA 2AM1A 2W83A 1FU7A 3FNBA 3HJCA 3I2GA 3R6GA 4NARA 5AHXA 4BFCA 2WU1A 3RAFC 5SV2A 3KB1A 5DJ5A 1EP9A 2CJYA 2MSDB 1X8LA 1SO8A 3FTQA 1QGYA 1ADGA 1RAIA 2GUWA 3R4VA 4CG0A 4I6GA 3UGQA 4OK3A 3SXUB 4RWEA 3ETNA 4LSMA 3RFCA 4QPCA 1XI2A 5JT1A 3LW8A 2UVPA 1PAUA 3SQOA 3UHJA 4RTQA 1NFRA 221PA 2RI1A 3AGQA 1TCVA 3JQQA 3KWFA 4E2XA 5LM3A 5ILOA 3IQEA 3SXJA 3VAYA 5C51B 3MERA 4N12A 2I6UA 3C6KA 2QUHA 3EQ6A 5GGXA 3R5HA 5KQRA 1GNLA 4GWGA 1TM5E 1S3GA 3Q8MA 1LUAA 1KRWA 3GJRA 2PUDA 3PT9A 3ZZNA 2E87A 3DZFA 3VZBA 2O3SA 2YJNA 1JVNA 3GLRA 4GRAA 5KNDD 3PDIA 5BV1A 1J00A 3KJXA 4KNVA 3NB0A 3L6EA 1Q6ZA 4Y7DA 3AR7A 4X6XA 4LNAA 3RBAA 3PITA 2YZ7A 3UHFA 3NEJA 1U63A 1X9HA 1HV8A 1NG1A 4NBLA 2OUKA 1VJ0A 4ZCTA 1X14A 4CVNA 3HZZA 5CH8A 2FSFA 1PQWA 1JAXA 3EGDB 1E3TA 4MTCA 4YROA 5E6RB 1RFLA 2HB6A 4KPUA 4BKUA 2Y0EA 3WIDA 1JDVA 1NVAA 5KCZA 2X4IA 2Y1XA 1G20E 3KU1A 2P1ZA 3O0DA 1UOOA 1V2GA 3SX2A 3R3ZA 5GWXA 2VP9A 5F11A 4QO8A 1A69A 1GC5A 1AN0A 1UZMA 1RJ9B 3K70B 3KKEA 5HKLA 4FI3F 3TVDA 1JIKA 3KYCA 1N2EA 1JEJA 4R40A 4GZ5A 7ABPA 4UBNA 4ESHA 4OGFA 5DWQA 3ZWCA 5E38A 4XFJA 4ZICA 4MV4A 3H5RA 2YJ6A 1VIVA 1R9MA 4ER6A 4AL4A 1COWD 4ZGWA 2IX3A 4GLOA 621PA 4YY3B 8ABPA 3CSSA 4YMWA 4J6FA 3RT7A 1AMNA 1H42A 3I42A 3R7LA 1P0QA 4KXYA 3RQQA 5JSKA 3EZ9A 1OW3B 4QDJA 2QJRA 4UVGA 3F3SA 3QXHA 5ALQA 3T3IA 1KOLA 4EG5A 5KVCA 3VFDA 1V1MA 4HD8A 1VJ1A 3WK8A 5KHOC 1GSHA 3WK5A 3CXRA 2VPZA 2VT6A 2CDRA 1LBTA 5CYFA 5K8CA 2O7VA 3P9SA 4G5OA 5ADHA 2WFZA 2OGZA 1X7ZB 2R6AA 3C70A 1DIAA 1M8PA 3Q7TA 2WJAA 4MW6A 5AM4A 5EMMA 5GJCA 4EEXA 5HYVA 3K6JA 2EFDB 2Q8PA 3OMWA 4REMA 3U7QB 1O87A 2OB2A 3IKMB 4PIVA 4CKXA 2AD5A 3GLQA 5LWQA 1GFZA 1LBSA 1L4BA 1ECCA 3AI3A 3QXSA 2RG1A 3KCQA 3IR5A 3JQ6A 3MTAA 4UVHA 4FYMA 3SEQA 5BXQC 4Y9TA 1J5XA 5K0TA 2O8FA 1XIVA 2VZ9A 1P45A 3BS4A 4IR7A 3PCXA 1RRGA 3BB3A 4LI3X 4NG5A 2OZEA 3DC2A 4RXMA 3NDRA 3ZWPA 1KOGA 2BAGA 1YKGA 4E1VA 2N1BA 2W2NA 4IM7A 1KR2A 3W90A 2IEGA 1BHSA 2OYCA 3ZK8A 2OHIA 1YQQA 4B7XA 1H2ZA 4CM8A 4LYFA 3JTMA 1M2JA 4QREA 3PVCA 2AX4A 4LFBB 1JHRA 2VHXA 2J3DA 4WZAB 1WEKA 1XRRA 2C9DA 4J0JA 3HCWA 4ZP1A 1EK1A 1HDZA 3A9UA 4LYJA 4GM0A 3ROXA 3E3AA 1DBPA 2EU8A 4JL8A 1X7HA 1W581 2XUZA 2RGUA 4MICA 1CUWA 3CC8A 4RETA 3REQB 3A1VA 4ENVA 2ZUTA 3PXUA 2SBTA 4KH0A 3AETA 3RYHA 3ZVLA 4IIDA 5JZBA 2VQFB 4PZZA 5EYPB 3LVQE 2RBEA 2WHXA 4RVFA 3ROEA 3B3LA 2Z8ZA 2JZOA 2Z4TA 1UBGA 1OREA 4QKQA 2E21A 3B6KA 4RK0A 5FUMA 1N0WA 2I2AA 2EHDA 2R6DA 3DKPA 5K0BA 1PBNA 2ZJBA 4PGMA 1SIUA 5HR5A 3KDSE 4PSDA 3T1QA 1WPRA 2R2AA 1SXHA 5L8VA 1O89A 3LC1O 2ONYA 3OX4A 4YQFA 5GVRA 3M34A 4OI1A 1TPZA 3TWOA 3BAFA 3G6WA 1EGMB 1GL3A 4DFDA 3ABSB 2CNBA 3BGOS 3V42A 4BFLA 1XCJA 1CJUC 4ZO9A 3EIFA 3ESBA 4O02B 2IDKA 4J1SA 4EJ0A 3B6MA 1IBCA 2SNIE 1GPH1 4BFZA 1B41A 1MC5A 3UPDA 4GKVA 2WG2A 1TCBA 2WHRA 3FGNA 5DM1A 5EP2A 3T3DA 4MJLA 5C8ZA 1Q95A 3S7ZA 3AFGA 1KNQA 3FMIA 3A1DA 4KWIA 2XKAA 2WF6A 4DAEA 2IOFA 4KXLA 2QD4A 3HR4A 3OY2A 1DC8A 4RSGA 4NCBA 1IG0A 3MMNA 4F9FA 3DCIA 4P86A 4QPPA 4W1SA 2GBPA 2PCJA 4GR9A 5KSZA 3FNRA 3W8NA 4KDCA 3I9V6 1U7ZA 2HJWA 4L4ZA 1D3AA 1C7FA 3T99A 1EUQA 2NZXA 2AI3A 4OUKX 1VL0A 2P1RA 4YX9A 4GDFA 1B3RA 3QV1A 1XROA 3MJFA 5HNKA 2H1LA 4W6QA 2PBFA 2B4TO 4IKPA 4S1TA 3CRNA 4JIGA 3QFFA 4IIEA 4G63A 4QVGA 2OYRA 2PZ8A 3SM3A 2O8VA 4Y1RB 5FL7D 2H52A 1U5CA 3LC0A 2E5FA 3NUGA 2DQZA 2FUKA 1JG2A 1WQ3A 1QV6A 1R1DA 2JLCA 3HJTA 1IN4A 1O0CA 1HFJA 2WTNA 4TS9A 1B0UA 3RTAA 1GP2A 2DY0A 3G13A 4DMCA 1MQ9A 1B0ZA 3D4IA 3I3OA 4MQ4A 1WDKA 3OZBA 3OAAA 1EFPA 4B6GA 3I5UA 3W3AD 3VBCA 2FDCA 4EG8A 2QK4A 3W3AA 1N2JA 4V3BA 3SKVA 2IXBA 3VHXA 3VZPA 2GMWA 3UWDA 2WF8A 3MGCA 3NJRA 3ANXA 4FYJA 5DBIA 5JQGB 4I1PA 1GKYA 3LLMA 3BMQA 3C16C 3E9YA 5BO5A 3GDWA 5HEKA 2AZMA 3FZQA 2EIXA 3SZOA 2IYLD 3IAS6 2VRBA 2AFIB 3K32A 1GD1O 3R6WA 4BPRA 5FPQA 1MOZA 4UASA 3BJIC 3QK7A 1U3GA 2HK9A 3R8CA 2W93A 3H9CA 4MS1B 1DX4A 3BMOB 1C9EA 3C8ZA 4FFBB 4FFWA 4ND4A 3JQPA 2NU7A 3K9GA 3RTBA 2R3SA 3KZKA 3TMYA 4DLLA 1FYFA 3BPSA 4XWGA 1Q7CA 2Q46A 1ZHFA 1YR8A 3I2IA 3RVLA 2DQSA 4KRFA 5LR6A 1RZVA 5JPDA 4MVCA 4BMNA 3I9LA 5BUZA 2X0EA 2O5EA 2WIAA 4WOPA 4HUQA 1PVOA 4Y6GB 1NF9A 7REQB 2W6JA 1PGNA 1N2CB 3TCXB 3U31A 2W2MA 3S70A 1QP4A 1DXYA 3BWVA 4FJ0A 1SZDA 2GFIA 3RJMA 4JELA 1EQAA 3UCEA 4Q4CA 4I9FA 3G2NA 1CFJA 3O92A 5FPTA 3CEMA 2OLKA 4HRYA 3V1LA 1GNRA 1NF3A 2VXBA 2HLNA 3CNEA 2XWPA 3F4LA 4YRKA 3C1TA 1TQ6A 2RHBA 1LDYA 1A8HA 4NX2A 3K9WA 2C7QA 4BDTA 3H4IA 4C6TB 2HH9A 3PZSA 2H7VA 1EVJA 2J3JA 4YTEA 5FUYA 3GLFE 1E1QD 2YTZA 2WKSA 4R7TA 2CL5A 2ZCJA 3R8XA 3K5PA 1GA4A 3ROTA 4HB4A 3EPLA 5JIBA 3FKSA 5TMDA 1ECFA 5AKZA 1DTSA 1EA5A 1X1AA 4EY5A 4LXIA 4MRMB 2BI7A 3UQYS 2NIPA 1A3CA 3OPXA 3PNVA 1VM6A 1XMXA 2AEEA 3QX7A 3DM5A 1C2YA 3NRBA 5CVJA 3A4YA 2ZI3A 5HUJA 2W6CX 3ENWA 3DCJA 1TM7E 2QIPA 1XTSA 3RHFA 4ER3A 1BDBA 5LDHA 4N5HX 4G2TA 2QG9A 3OC6A 2PSEA 2PZFA 3NVDA 4Q02A 3NIDB 4YUZA 1C3QA 3IIJA 1LDNA 3SVZA 4N7MA 1P17A 1OXXK 1ZAKA 5AI4A 5FI3A 1H05A 1HLFA 3BZUA 4YQEA 3TZCA 3DQQA 3JYHA 4KQ9A 2OYSA 4UMFA 3DDOA 3V34A 2P6MA 3LGAA 1ECGA 2E55A 3EA4A 1ZW1A 4ZJPA 1ZJJA 4WNCA 1JNXX 3D2LA 1L1FA 3SQXA 3E0QA 2VDVE 2A57A 4K8RB 4NONA 3H5TA 3LVBA 5IVHA 4FHEA 3VH1A 1DP4A 1KP2A 1PR5A 1RWMA 1TQDA 3N6XA 2E2WA 2FTKE 2G8LA 3CUYA 3RVNA 3PI6A 3AESA 4NHEA 1IEVA 1T2UA 2IKSA 4A0RA 1WEHA 5EUCA 3TR0A 3BHNA 4J9VA 1KEUA 3ZDFA 2H59A 1B1AA 2OK8A 3AUFA 1B16A 4XF7A 4WBNB 1WE2A 1A8SA 2C7GA 5DHTA 1M34B 2NV6A 3UQ6A 4QXMA 2QL6A 3DO8A 4XYGA 4J1NA 4D8UA 1QPGA 3RADC 1SOWA 3CX8A 4FFMA 2J48A 5DGHA 3K9LA 2IY8A 3DZDA 4OSEA 3NKFA 4CWAA 2QX6A 4MS3A 3L93A 4JP3A 1E0AA 2QN8A 4LJ5A 5K0GA 2BRUC 2HAEA 1T3SA 3QTTA 2IFTA 4JVNA 4LVCA 1VLVA 1Z63A 4PZLA 2ZR7A 2X5KO 4XIIA 4B3FX 1R8XA 2SCUA 3OVMA 1KYTA 1QX3A 1T8TA 1WNTA 3AHFA 3LH5A 1WL8A 2I3GA 4PRYA 4Q24A 1DC7A 1I1NA 2OILA 3QLJA 3T94A 4WBNA 2C2HA 3FBGA 3L0YA 1T5IA 3UN1A 4U4AA 5C7OO 3BMNB 1EUYA 1BWQA 4Q7MB 5EIBD 1JIUA 2UVDA 3DMPA 4FU0A 4LV5B 3F6EX 3UO8B 8AT1A 2O3UA 5TLSA 1AUOA 1Q3KA 1W85B 1L6RA 1WMAA 3K8QA 4UJ3A 1ADYA 3T0GA 3OFVA 2B2CA 4FD2A 2F9LA 1ZINA 3OO0A 1M8JA 3DBRB 2PS9A 1WUIS 4N01A 1J0DA 4EW2A 1AMOA 3HN7A 2FWAA 4LX8A 4DMGA 3CKKA 5F33A 4D3FA 1LTHR 1KHHA 1V1JA 4J0FA 1GARA 3GEIA 1WAMA 3TLYA 4BE4A 1WXXA 2L19A 4YMGA 5K8UA 5K3OA 2N0SA 5FF9A 1LBHA 1A1VA 4B75A 2AUNA 3TRDA 3FZNA 1X42A 5JRJA 1YQ9A 3OKAA 1CLEA 1VMIA 4KI0A 1T0UA 2JKZA 4K6HA 2GJ8A 1KQOA 2DX7A 1XZGA 2R4TA 5EA2A 5TPZA 2AZDA 1SKYB 1NNLA 2Y4NA 3OM1A 4EZIA 1ISJA 1S2GA 4GR4A 1E61A 1KIFA 3ILVA 2D62A 4ZRMA 4XVUA 1MIHA 3QFSA 1MJFA 1PJQA 1TAQA 5BY2A 5DTQA 5BQXA 4W5HA 5TRWA 3ZCVA 3ZDCA 1JR3E 3B6ZA 1OWNA 2EWMA 2V6IA 3QTLA 4GMGA 3FSRA 3BE8A 5GY7A 1RP1A 1SVLA 5E4JA 3S44A 2IYEA 3GMDA 5T67A 2NZUG 2AMVA 1QKKA 1YDGA 2H54A 3H5VA 3MPOA 4JLOA 4DGSA 5B7GA 1HI9A 2X9QA 3AFOA 2BJWA 3P2YA 1ZNZA 2OZPA 4D8WA 1RJFA 4Z6KA 4TN5A 5LOVF 5K4AA 2ZZMA 1FBNA 1XVUA 2ID4A 2V8BA 9ATCA 2XYHA 3DF9A 4MGZR 4RDXA 1L8OA 4OBXA 1KP9A 4TT3A 4BDSA 2DFPA 2JJMA 1EBFA 4NYJR 1GKLA 5BSGA 3PPWA 3EZ2A 1O95D 4WLVA 3B48A 4UE2A 3WO0A 4FYPA 1YRLA 5KC8A 1IHPA 3GLUA 2EZ9A 3GYGA 3RQ8A 4B84A 1FP2A 2YN0A 1P5ZB 3K96A 1QVAA 2OCXA 3M5WA 3TH5A 1LX7A 2BCGY 2Z2YA 3DMHA 2CN1A 4TRMA 2BLLA 1LV8A 4YUXA 3JYNA 5TR9A 2REQA 1QE3A 4XQGA 5DLEA 3COSA 4QFBA 1OH8A 4F3NA 5BSFA 5JQWA 4KO1S 4KKXB 4LMPA 1BN7A 2WT4A 3IOCA 5C3MA 4L9WA 3FPJA 2CLHB 2IIBA 3VH2A 1N1MA 3KTAB 2ZATA 1FE8A 4QUDA 5KNDH 1B8VA 2I6QA 4V1CB 3P5SA 5K2MA 2D06A 1B8UA 2CNLA 3AJAA 4XASA 1F8XA 2NT4A 1J9GA 4A6PA 3QWAA 4D44A 5KTTA 5GM1A 3IE1A 4Y2GA 5DI3B 2AYXA 2BFDB 2FK8A 3RVMA 2HWWA 4BN5A 4F4DA 1PT9A 2DQ4A 3UFXB 3O8NA 2YJGA 1MC1A 3AYXB 3DWEX 1UODA 3GXOA 4UTRA 1RFUA 1WUYA 4AK9A 1GTSA 5G3ZA 5C5CA 1U02A 4MKRA 3GEPA 4U0JA 5DCYA 3C8UA 3F3MA 2ZVPX 2FRVA 5T8KA 5TQJA 3QIAA 4U2GA 3ZU6A 1IRXA 1E79A 1U3UA 1GNPA 2PUEA 1DKLA 3MT8A 4OM8A 3RVPA 1TK3A 5IZCC 4JI7B 3U7QA 2NAFA 5TPZD 4DCNA 5CURA 1VM7A 2O0MA 3W5SA 1VBNA 2LKDA 2QRJA 5JYEA 1Z39A 1KEVA 4PO1A 3OA2A 1OHHD 3SZLA 4B71A 1N2CE 3KB2A 1QGOA 4UKDA 2ZULA 4B32A 1AUPA 1QIJA 1K2VN 3Q11A 5ECGC 4YPVA 1EUCA 4MWGA 4YJGB 3TLGB 1P81A 4UQLA 4ZVLA 4MPPA 1Q3HA 2I34A 2A58A 3QFTA 1J2RA 3B20A 1H8HD 2ZQ5A 3JSAA 4JX9A 1V3UA 4JGGA 4C5AA 3OZCA 1FVXA 1EZ4A 4II3A 4V0RA 5AVWA 3HQ4O 4WA8A 1M66A 1X6VA 1BIFA 2RHHA 2ZJFA 4PR3A 5ELMA 4G1CA 4AY3A 4E2FA 1GPJA 1UEXC 1JEQB 2LTAA 5CNJA 2D1TA 2ZIXA 2PT9A 3WFIA 3OICA 1YCFA 2OE2A 4OJTA 1F51E 1OSNA 3BHMA 5FWNA 3ZJYA 2OZVA 4TLEA 4U9UA 1JHVA 4BL5A 4BQEA 3EQ8A 4TLAA 4ER5A 4R7ZA 3CRRA 3WDMA 1TGYA 2ZAGA 4XGQA 3UW3A 4BO4A 3CJRA 3W9UA 2Y0CA 3W2TA 1USKA 3ZE8A 1AY0A 2JFWA 3A9TA 1OVMA 1KSHA 3P97A 2W7TA 3TLAA 2E4VA 4RHTA 1TVEA 1I80A 3I5AA 4EB8A 1RJEA 2WI8A 3EN0A 4GX2A 5D5PA 4MQLA 5KNCA 1E1NA 3FBWA 4TS1A 1JPNA 3KAJA 5DHFA 3JZAA 1DCTA 2JIPA 1EHYA 1RC8A 2F2TA 4Y9SA 3SEFA 3VPXA 1B4DA 3FHCB 4U7JA 3AR4A 4Q1AA 1LH0A 1PHRA 5KVQA 3BXEA 1AS3A 1VL2A 1U7XA 4UMEA 4NV1A 5BV2P 5BYFA 5DMXA 1FMJA 1MOQA 3N7UA 1N6OA 2IXGA 3VJKA 3DOEA 4GAEA 2I33A 4N65A 3IQIX 3SC2A 2V8OA 4P3NA 1W88A 2L2QA 3AY6A 4R2JA 4KPGA 4HLUA 2J7PA 1WQ1R 4EBFA 3HMQA 5DF1A 3ZNOA 1UP4A 4KXXA 1O94A 4GBGA 3H42B 1JHAA 2CF6A 3EMVA 4RNDB 4J0CA 3COJA 4BNDB 1LPMA 2HUPA 3K53A 4DL9A 3L7KA 2PUHA 1DX6A 1R0SA 1QFZA 3QLVC 1MJGA 4HAIA 4JSTA 5ARBA 1P7YA 1WBDA 1YC5A 4RSRA 3RU2A 1UUFA 2IEYA 3FLAA 3GDGA 5KC9A 1LCIA 1UC8A 4G07A 1Z06A 2TMDA 3N3AC 5AK5A 3U60B 1EGHA 2QIOA 2VHJA 2PGDA 2PT6A 4B8YA 1EUDB 2J4DA 2NMVA 2HMUA 2ODEA 3O84A 3I61A 2Z4RA 3QH4A 3R7WA 3OTQA 3HYRA 2VH1A 4C5MA 5KTKA 1IUNA 1NVVQ 4ZU6X 3KXPA 5CJPA 1G5TA 1R9GA 1X7ZA 2O9JA 1JJIA 2X7XA 5FPPA 1EU1A 5MN4A 4ZD6A 3RVDA 4ZPXA 1GG2A 3H9BA 3O7MA 1HEUA 1PUIA 1XVIA 2BFBB 3G5LA 1NLUA 2QG6A 3ADKA 3MT0A 4ETMA 2UZ3A 4CG1A 3VSAA 2HZ7A 2BUBA 3LK7A 2Y1CA 1DS6A 5MF6A 4NBVA 3DL4A 4JOCA 5IM4A 3WLNA 1KP3A 2CY0A 3CUEF 3N8GA 4Q3EA 2QQEA 2VBFA 1M34A 1W2GA 1RWVA 2FWBA 2R1ZA 4HZUA 3GLIA 1SKQA 2XOKA 3QF4B 3V32A 2O3RA 5JSQA 1FJGB 4YALA 4PLYA 2WWVD 2BCEA 2HUNA 2IYUA 1ESZA 4LJ9A 2F1HA 4CKCB 1YS6A 1PK7A 1MW8X 2OFXA 3FYDA 4ZK2A 2WYOA 3DBHB 1ZJYA 2F8MA 3WYDA 1VCMA 3EGCA 5C8VA 2CSUA 4R16A 1KJ8A 1SU7A 2XI4A 3UK1A 3AM1A 3B60A 3ADCA 1JTVA 1N78A 3KHSA 4A0SA 1ZKDA 2X8WA 3U49A 5IU6A 3EDOA 4G0ZA 2CLKB 1T2FA 1U7TA 1G66A 2WJWA 3V4ZA 4B3IA 1NXQA 2J0VA 3FFXA 4FR0A 3LCMA 3N2AA 4FJ1A 3WJ7A 2DPHA 1LJLA 3SLKA 5H16A 1ILEA 3KZNA 4DARA 4IJMA 4W99A 4YACA 1NM5C 2IIQA 4DMHA 2EX4A 4H6WA 4UBLA 2XTZA 2DUUA 5CT9A 3V33A 3UUEA 4L3VA 1QIIA 2VRCA 4HDAA 3BDIA 3ND8A 1U2PA 4X5OA 1F0PA 1PU2A 3NTUA 3V2HA 1VPTA 4UM5A 1OMOA 4CF4A 1H8ED 3M6VA 1TZ6A 1GG9A 3FNGA 3URMA 2WQ6A 2JZCA 3DUFB 3ENQA 3P52A 4HEQA 2LRHA 3IQZA 5HG0A 3UOGA 3A4VA 4G01B 4LMAA 1XEWX 3CGWA 1K9SA 3TOCA 2QMUA 3O4JA 3PNMA 1XMQB 4HTFB 4B35A 4WLNA 4XM1A 5FUWA 2AN5A 3B1JA 3PYZA 1GQTA 1ECJA 3W1VA 1ZD1A 2H9AA 1N9ZA 2QJTA 2Z0MA 3NOXA 4OHVA 3AONB 1DQRA 2JJ2A 4UCFA 5HMLA 1R2QA 5CYOA 1K5GA 2UYOA 2GPJA 4ONEA 1UC5B 4OB6A 4XQ0A 2JIMA 4ID3A 3R9KA 2VHQA 3RC1A 2CL6X 3GH1A 4DQLA 1XZQA 4GMFA 1AK1A 4EY6A 4HH1A 3TAXA 1KMNA 3A9SA 4Q3AA 1KI6A 1LSSA 2C20A 5IJ9A 3BA1A 4MA5A 1FIUA 4LK2A 2GJAA 4NDZA 2WP8J 4EHHA 1I5EA 2MYTA 2W11A 4J76A 1QK4A 1ESEA 3CSDA 2D0PB 2Z09A 3RPEA 2WUWE 3LOPA 3NALA 3BCHA 1HG1A 2HW8A 2C4MA 4E6PA 2BGJA 5CRIA 2O52A 3EHEA 5LQKA 1PO7A 1TU0A 2BY4A 2FW7A 5AVQA 3UT0A 3CLHA 4RYDA 4YAWA 3TBKA 1JBWA 1G8AA 1IJBA 4N7JA 2IYNA 3TX2A 4F04A 1ORDA 1VYHA 2ZCVA 3F47A 3PPYA 1I0IA 1OLXA 5CLGA 5FLKA 1B0PA 3S2YA 3T4EA 5KB3A 5LDDC 4PV7A 4GU5A 4X20A 2BFMA 3E5RA 4CLRA 4A15A 3A70A 4I99A 4CM9D 4CF6A 1U1GA 3DLCA 5ALYA 3CNBA 1UEJA 5IN5A 4DBVO 3A27A 1H4QA 4UUQA 2WMDA 1HEYA 3IMKA 5ALXA 2R1TB 1UCFA 4YRMA 3WLPA 3U26A 1U1DA 1AGXA 2WTXA 3I2FA 2CF5A 1C7IA 1BMFA 1QONA 3DOJA 3PG5A 4LWPA 1ZVKA 3OTHA 4JWTA 5BNTA 4XF6A 1K97A 5D3MB 4UAJA 1YZTA 3AHEA 2JIQA 1ZU5A 4OFXA 1TZMA 2JGLA 2I2WA 3GFRA 1TJYA 2RGYA 4KRYA 3UJAA 1N6IA 1JZTA 1JZSA 1CEQA 3NNDA 3TTSA 4B74A 3BGSA 5BPFA 1SBNE 3TQFA 3FR8A 3QVOA 4QJBA 2VUIB 3U2QA 4KAJA 2BFFA 2R62A 2WYVA 4PAOA 3O8OB 1MENA 4LBWA 4L8LA 2PRKA 1FX0A 3HB9A 2HN9A 1S7GA 1BO6A 2YJ3A 4LV8B 4XJXA 3WSVA 4AJLA 1PQUA 1WHSB 3GH3A 1C3LA 1F9AA 4KQEA 3WMFA 4A2WA 5I4KA 1I33A 1ODJA 1QQ7A 1VKNA 2BMVA 2CNNA 2F4NA 1HXHA 2JFQA 1SEVA 5EJ2A 4LY0A 3B13B 3O7WA 4ZCIA 2C5AA 4UFOA 2IXTA 4F85A 3BWCA 1Z7YA 2CLDX 3RYCB 3JCZA 1B0AA 3QUSA 1U4SA 3MSXA 4Z9XA 1D6SA 4MOWA 4JJFA 3TNFA 4DQXA 5KJ1A 2OA0A 3NETA 4NZZA 3IHTA 4CCYB 3WK9A 4ZI5A 3LP5A 5GADl 2AW3A 2GD2A 3L04A 1Z26A 2H4YA 3ES9A 1JQ3A 3CNLA 4CL0A 1H66A 2ONJA 5IBCA 3RQXA 1U5AA 3ILHA 3LOOA 1M1ZA 1Z2OX 1LFAA 4K93A 1ND5A 1BWSA 4KQIA 3S40A 5KQMA 2NSYA 2H1OA 4DEVA 4WE3A 2OORC 2YWDA 5FYQA 4JI2B 5E9QA 3ELYA 1HDRA 4D9MA 3PKZA 1XDSA 3QLTA 3NATA 4PAGA 3JQCA 2IWRA 3QI7A 3H2HA 3OEWA 2VDOB 2JIRA 3Q3EA 4LNUA 1E1YA 1HNNA 2CCGA 4FVTA 4QUKA 3CS3A 3GXBA 4I4TB 4ER0A 3FDXA 5BQFA 2JG3A 3MW8A 2JCGA 4YASA 5D3ZA 2CW5A 3THXB 1OZGA 4BQPA 1JEQA 4Q1DA 1YR1A 4JT9A 5FV7A 1LDGA 2AMLA 1Z6XA 4Q9AA 4GOLD 3VSDA 2B9EA 2BP7B 1FSGA 3L1JA 1YS1X 1N9GA 3ZWDA 5C46F 1C3OB 4X60A 1NFFA 2I65A 3PL2A 1ML3A 3BFJA 2CK3D 4MWZA 2R7KA 1ST2A 4PCVA 1GUYA 1YZLA 1M0TA 3IS3A 3N74A 4K88A 3TLEA 2ZK7A 4EFMA 2AN4A 2MSCB 4CV2A 3QE3A 2GAAA 3MGGA 1H1DA 1M1XB 4L9SA 3DB2A 3ZV4A 2QL9A 1HGXA 2JFZA 5DN6A 3KZMA 1XCLA 3IV6A 3U7GA 3PNLA 1NZDA 2WWRA 3IXLA 5EP1A 2WB4A 1LIOA 1E1DA 5IJ0B 2Z6UA 5G4KB 4HGZA 1PKXA 1A72A 1NP6A 3WGIA 2RBKA 3T1TA 3GPBA 2WHPA 1R18A 5EIFA 4ZXPA 2NZ8A 1CF9A 2ORIA 2QRHA 4EHFA 1BXGA 3JYLA 1KE2A 2GA8A 4RADA 4DIFA 2FI1A 1NQUA 1P3DA 5KYXA 2IYOA 5CA1A 2GK7A 5IDQA 1R6AA 4AQ7A 3AEYA 4ZO6A 4GVPA 4N5LA 2ASEA 3TECE 3SBEA 4ZA2A 2ZPAA 2GM9A 1Q77A 3KPJA 4N6GA 5IYZF 4BOYA 2XKKA 2G76A 5E8JA 2O8EB 1PZXA 3GO4A 3AP3A 5DBGA 4DS3A 1N2HA 4JYZA 4DBLE 4RL6A 4KUGA 5LP6B 3JAWB 4QXPA 5L7TA 1E8DA 1E7YA 4DV6B 3LHDA 4E4RA 4UTXA 3KTFA 4H59A 4AKEA 4MJXA 2GTHA 1JHDA 2IL1A 1TQ8A 2C00A 2XDWA 3GLGA 3RBXA 4GLFA 5AQ1A 1X39A 1XZPA 3O2QB 2GJKA 5EQJB 1FYWA 2PYIA 3GEBA 4G1MB 4J0QA 3EXEB 3GDHA 3DDCA 2D7DA 4OX9Y 4ENPA 1U8TA 1MX9A 1YOVB 5GIPE 1G8FA 4YB8A 4LOHA 3MD0A 3LBYA 3AZQA 1SCUA 2V7EA 5BSRA 4G23A 2PKEA 1BXKA 2OC4A 4BNUA 3NRCA 1QFYA 4PS0A 2MOKA 4RCZA 4E5MA 1SXJA 4NNOA 3OOYA 4FI3C 4FKMA 2A1UA 5HRAA 4KEAA 4U0KA 3I8XA 3QXGA 2BFCA 3MCAA 3O1JC 5FWAA 5JPIA 1N8SA 1QWOA 3THXA 1SA0B 1X1QA 3SZ3A 4CKYA 2GWHA 1A4XA 1XZCA 4C4OA 3LUKA 4QGSA 4EDFA 5AI0A 3R2JA 1FRFS 1XC7A 1KMQA 1CY2A 2H06A 3R0JA 4FCVA 4JHXA 4P84A 4V0KA 3IEIA 1MP0A 4P0QB 5FOUA 3V1NA 4KBGA 2HHHB 1O96B 4C43A 2UAGA 4RHFA 5EPOA 5B2ZA 1CUZA 3RU7A 3VX4A 3UGJA 3KSMA 5AD1A 4H4CA 1AZSC 3H3XA 3PQ6A 1GUDA 1XTQA 1SOUA 4CU5A 4WXMA 3PA8A 2WAMA 1Z45A 1GEEA 4LC1A 1TF5A 1YDFA 3RUFA 3Q8LA 3RKSA 4RABA 3O8DA 2ZR0A 1O5IA 3DP7A 3TIFA 2J0UB 1XDZA 2V7GA 3CLUD 4OBBA 4GXQA 3F9CA 5KTNA 3C8HA 3QXJA 4Z7NB 4RV5A 3WGLA 1PX0A 4F1KA 4PFJA 1RBMA 1ZGJA 2QV7A 3G2LA 4G6ZA 3LX4A 1G291 1H22A 3X1KA 5E2IA 2BPOA 1N92A 1ONBA 2F43A 2HSJA 2OQ2A 5C81A 5JPCA 3OECA 1E1CB 5T8KC 3L8CA 1R9JA 4EG1A 4BX3A 4FGLA 1BD4A 4YL5A 4IVPA 2JARA 1T6NA 1D2CA 1ZCFA 5SZIA 1U4OA 4J8PA 3L7YA 3H9GA 5IKEA 1C4KA 2QQ5A 5C8YA 1R4ZA 2WJGA 1VMAA 2FE4A 4FMDF 1AGPA 3DR5A 1PFQA 5JMWA 4QHTA 2VSQA 3PR1A 1G3UA 2PQ0A 3TINA 1YZGA 1ZGGA 2NW6A 3TLBA 4ZOBA 3LTNC 3GO6A 1YNOA 1SRRA 2QTVB 3FPSA 4IHJF 4KFTA 3V80A 5JI3E 5FO1A 4G37A 1G59A 1EEXB 3G3EA 1YRQA 2FUG1 3G79A 3N2GA 4IJKA 4AZ3A 2AJLI 3PKIA 3ZNNA 3D4OA 3TQTA 3V9AA 3SX0A 1PS8A 3DULA 4L6IA 4HQKA 1PJAA 3TG8A 3VZRA 1FFEA 3BYZA 4TS3A 4DJJA 4GF5A 1T9HA 4GMXA 1NOKA 3HCCA 1NSFA 2XMBA 2FZCA 3G5TA 2Z2XA 4JT4A 2OG1A 2XKJE 3LL7A 2IY7A 4O3FA 5FPHA 2I8AA 3IUQA 1TO2E 4G5FA 4ZI7A 1FP4B 3CTMA 4BZWA 3IEPA 4IDDA 1N7JA 4QOGA 1DXOA 2GDZA 1K3UB 5J40A 1M74A 1NNUA 1FFDA 1QH0A 2BGTA 4KANA 1ICIA 5C3ZA 2G17A 3LT1A 1XPJA 2LD4A 3AFMA 1K4YA 4HNGA 4O2BB 4X7PA 3T38A 2CNWA 4ZEXA 3DMNA 3QVMA 4LJYA 4ZHQB 3R3XA 1BNCA 3H2BA 4DPKA 2GBFA 5DXFA 4BATA 1UOPA 3X1YA 4CM9A 3RPZA 4G0NA 4WJZA 1EJ2A 1UMDB 4ZEMA 2AG8A 2CLFB 5JCXA 1JFFB 5AW8A 5T4FA 3W3ZB 1DAFA 1UXGA 2ZT5A 1MO4A 3AR5A 3OM9A 4QL3A 3RRNA 1I13A 3CQDA 3JQ8A 1QAQA 1IH8A 2X8JB 3NHZA 1KO8A 2X1MA 4K2AA 2XB9A 3GVIA 4CBVA 3GJ6A 1J8FA 1LK7A 1B42A 1KOJA 1E9RA 2Q5EA 3AEUA 1NIPA 3BJMA 4G97A 4LAFA 4UREA 1DEHA 1ZUWA 2HMYB 3LXUX 3RQIA 1RHMA 1ADBA 2GWRA 3G2IA 3T5MA 4PN7A 2QN3A 4Q9NA 4HLUC 3MRSA 1K4MA 2LCFA 3KYDB 1MZPA 2XGJA 3SF8A 5K3CA 3EDRA 2JJQA 4WFQA 4FUTA 3RSSA 3BKXA 1G8KA 3CWCA 2V0CA 5CLIA 3NL3A 1P4JA 3IDSA 1DSSG 3NBMA 4JYCA 1DWPA 1E2PA 1IBRA 1OAOC 1TFRA 2G1UA 2YWGA 3CE9A 1EFUA 2WJHA 5ED4A 4FW8A 1AO3A 1PZMA 2DDMA 1EKKA 1SQ6A 3RRJA 2P9CA 2VTVA 1ZL2A 1HPLA 3F9RA 3JYQA 4N5IX 1I94B 3RT1A 3SR0A 3L0ZA 3AG6A 2OFFA 4QASA 4C6TA 3U4HA 3FX2A 4ZC8A 4F4JA 4Q21A 3X1WA 3WSWA 3VISA 5FA5A 3O5AA 3UENA 4D4GA 4AVYA 1E2DA 1M8GA 1YBVA 3E05A 4IDPA 2HMVA 2Q5FA 3JATB 2BSAA 1JQAA 1XF1A 1UKYA 4KXQA 4UFNA 5G0SA 1GXSB 1OXUA 3BTVA 3HXTA 1FYXA 3KFVA 1Z5VA 3V4SA 2J6CA 2P8JA 5ARDA 3IMCA 3KT8A 4AIIA 1P9RA 5J4HA 1E0DA 4RF4A 3WYCA 4F91B 4N0QA 3ZNQA 2VO1A 1MDFA 4WKCA 2C82A 4HNAB 3J81A 4Q3BA 1N1DA 4UAVA 3HKBA 1PG5A 1SHTX 4H4EA 2P6OA 1VOTA 4UMVA 2B2XA 4JYAB 5EZ5A 2HPVA 3OOJA 1WSDA 3TZHA 4BO5A 4MS4A 4CUKA 4I5GA 4D4MA 3EVEA 3AL2A 5CDYA 2FSUA 4ASUD 5J47A 2EGHA 3I1IA 2X0JA 2ZAYA 4YRLA 2V5UA 1FLAA 1O6GA 5KBYA 4M36A 2QU8A 1LXCA 4XUGB 4NFSA 2IODA 4TZTA 4RYLA 4X1YA 2AFIA 2C4WA 3TSYA 1Y1RA 3COVA 5J43A 3ZU2A 3LDAA 4DUZB 4Q00A 4XOIA 3O4HA 4BLOA 3M89A 3S2FA 2IELA 1DJPA 3PF9A 4NEHB 4ZIRA 1R0XA 1VFNA 4FNGA 4KPEC 2VDQB 4Y2SA 3BRQA 1JKMA 5G53C 1G3MA 3MBJA 1M72A 2DQKA 3FCAA 4BASA 1DQNA 3NNNA 5JAPA 1GKIA 2EP8A 4K7JA 4B3HA 3S6JA 2ORED 2CBXA 3F6BX 3THWA 1ZRHA 2C3YA 4XIFA 4Q05A 2DWOA 4YO7A 5D00A 1IK6A 2AYYA 3QHQA 3WL4A 3NMUF 2C8JA 3VI3B 3HY4A 3OX2A 1ABBA 2BKVA 3T5BA 2QZ9A 3E0XA 1F3LA 1XD2B 2EVWX 2QQGA 4W6ZA 1SG0A 2O1WA 2X3UA 4IVQA 1W88B 4CLRB 4K28A 4DDHA 4ZO8A 3SJUA 4BB5A 1U8AA 3P0RA 1KC1A 1VGVA 2ZRGA 1AK9A 4QM6A 4BQRA 2FPSA 2H9IA 2H11A 4ZEOA 1NW5A 2WKQA 2DTDA 3PL1A 4CKEB 3E84A 5CK5A 1LRKA 3C3YA 3BUSA 3FWKA 4E69A 4MS4B 5FKJA 4ENRA 4LS3A 1C80A 1K3TA 1KH3A 4J16A 1ZK1A 1V43A 3HVIA 2ECKA 5BV8A 1L5YA 4LHYA 5K3SA 1DQPA 3ZV5A 4KAXA 5TMPA 1WTCA 3WK6A 2CJWB 3CF6R 2LW7A 3I9FA 3CSUA 1I2BA 2EF0A 3E2IA 3BXZA 1CVIA 1VPEA 2XCLA 1C3XA 2GM3A 4BJ3A 4ZTUB 1V45E 1ZD3A 3LFUA 4MUKA 1ZVVA 4MO2A 3M8KA 3RS4A 5LMCA 4BNNA 1STOA 2VT3A 4ZOEA 1X3LA 1X7XB 4HLCA 3S2ZA 1OWOA 5IXJA 1RACA 2ZBGA 4EI8A 4E8ZA 5LA6A 2W48A 3ITDA 2WMOB 2AG6A 3DLPX 4LCJA 3RO4A 2IHNA 2HBRA 1H9AA 2TMGA 5A4IS 3IQXA 2VFAA 1ZK0A 1C0EA 2VJLA 2VSNA 2OGTA 5IZCA 3D6UA 5BSWA 3ZE2B 1EXVA 3LAWA 4H3HB 1VDZA 1L0BA 4FEYA 3TLMA 4ACBA 1CRPA 1Z0FA 1FDUA 4XYEA 3SQMA 5TF4A 1O08A 2CB9A 4G26A 1V7CA 1U0GA 2V9CA 1MVLA 4K46A 1F1JA 1QIFA 5KOHA 3VQTA 2ILVA 2OKGA 4H1TA 4Z0NA 1Z28A 4BJ6A 3EC7A 2ZW9A 3ZYZA 2Y9PB 1IUKA 3A4NA 4XGNA 4YMSA 4L3WA 1K7FB 2I66A 2AZXA 2ZRPA 3RUAA